4RBOA

Crystal structure of a nanog homeobox (nanog) from homo sapiens at 3.30 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
55
structure length
55
Chain Sequence
b'TVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative homeobox protein NANOGP8
publication title Structure-based discovery of NANOG variant with enhanced properties to promote self-renewal and reprogramming of pluripotent stem cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein, transcription/dna
total genus 21
structure length 55
sequence length 55
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4rboA00
4CYCB 5IP9J 5IYDJ 1JKRC 1U9OA 3HGGA 1B8IA 3Q0WA 3HKZN 3TW7A 3JRAA 1JUSA 1ZR2A 3LSPA 1U78A 2LP0A 3UKGA 3Q0UA 3HOVJ 3IH4A 4AYBN 3BR3A 2LKXA 2H8RA 3JRGA 2LLKA 4M3DA 2Y2ZA 2VKEA 3Q0VA 3HM5A 3H0GJ 1D5YA 4BY7J 3GTLJ 5FKNA 3OSGA 1JTXA 3BR1A 3CMYA 2L0KA 1HDDC 2XPUA 1GDTA 2ELKA 3I4MJ 2ME0A 4GFBA 4B3AA 2X6OA 5GP9A 4A3MJ 1YRNA 2L7ZA 3G1LA 3HBLA 5E3MA 1ETVA 4XRMA 1P7IA 2XPVA 5E3OA 3WHCA 3BTCA 1XC5A 4FE7A 3GTGJ 4FTHA 4D7MA 3G1OA 1BW6A 3BQYA 3S1MJ 4UUSA 1GVDA 3B6CA 3CQZJ 5EG0B 3LNQA 3BG9A 4XK4A 4C3HJ 3HOZJ 2R93J 5C44J 3BR5A 5FKLA 2DA1A 4M3EA 5IP7J 2NVQJ 1OCTC 2VPRA 3HOUJ 2DA3A 5EF6A 2CQXA 1SFOJ 3D1NI 5FKOA 3WHBA 2PMZN 2MG4A 1K61A 4A3IJ 2OF7A 1BW5A 3GTMJ 5EEAA 1ETKA 1MBJA 1ETYA 1XG1A 3F0CA 5EGOA 2K9NA 2JA5J 2XSDC 2CRGA 2N8GA 2GM4A 3CCYA 2DA4A 1LFBA 2VI6A 2R5ZA 3OOUA 2LVSA 2X9DA 2M0CA 1HF0A 1WH7A 2ME6A 1LE8B 2MSYA 4I6ZA 4M6VA 4A3BJ 5F0FA 4MO7A 5J1UA 2EZHA 1MBEA 2K40A 1AKHA 2JA6J 2K9QA 2Y31A 5M5YJ 1G2HA 2KDZA 2XRLA 3L1PA 3S1QJ 4X6AJ 3BTLA 4A3JJ 4EEFG 3A01A 5DS9A 3ZQCA 5F27A 4FE4A 1IC8A 1IV6A 1WCMJ 2DN0A 2YS9A 3RZDJ 4IHWA 1ZR4A 1HOMA 2W48A 1QVUA 4XRSG 4BKXA 5FKMA 1IJWC 1WPKA 4XRSA 2HXIA 2O7OA 1HLVA 1ORKA 1P7JA 3FK7A 2DMUA 1UHSA 3JR9A 4DZPA 2M8GX 1R9TJ 3CDLA 2L9RA 1T33A 2D5VA 2NVTJ 3SJMA 2ID6A 2VUMJ 4V2GA 3JREA 5M3FJ 3TP0A 2GBYA 4NDLA 1SANA 2HDDA 2CJJA 2KT0A 4MIMA 1B72A 1JTYA 1U9NA 2HOAA 3TW6A 3K2AA 1JJ8C 3S16J 1MH4A 2NS8A 5EZGA 2HI3A 2Y30A 1FIPA 1FIAA 4G12A 4IEJA 5M5XJ 1JUPA 1RKTA 2DA5A 2WAQN 2HXOA 3B6AA 4DZJA 1ETOA 3VPRA 3K7AJ 4D5CA 4C3IJ 9ANTA 3GTKJ 1DU6A 3JRIA 5K7FA 1T56A 4D5FA 3S17J 4JP0A 3BT9A 3MVPA 2CUEA 1H88C 3BR2A 5C4JJ 2M34A 1E3OC 1MBHA 2CQQA 2EBIA 3IH2A 4QTRA 2HOTA 1ETWA 3BTJA 3ZQFA 1FTZA 4JX4A 1MNMC 3O8GA 5JLWA 2M2EA 3HGYA 1JKOC 2JA8J 5F1JA 3A01B 2XGEA 1DU0A 3JRCA 3HOWJ 4FCYA 2LY9A 3FKIJ 1LFUP 4V2FA 3PO2J 4ABZA 1RETA 1ITYA 1I50J 1PUFB 2XPWA 4XIDA 3S15J 3NARA 3DEWA 3A02A 1MSEC 3C2BA 5IYBJ 1W0UA 1OFCX 2P81A 4DW6A 4LOCA 4RBOA 3LSJA 4DYCA 1W0TA 1RESA 3M3YJ 4CYCA 4QSHA 2ECBA 3PM1A 2R5YA 5C4XJ 1ETQA 3BR0A 1B8IB 2JWTA 4RDUA 4L5EA 1F43A 5IYCJ 2EZKA 3H3VK 4A3CJ 1ZK8A 1JKQC 5C3EJ 1H89C 1I3QJ 3M4OJ 1Y1WJ 3JRDA 3G1MA 2E1OA 3ZQHA 2E2HJ 3S2HJ 2YUSA 1MBFA 1ZKGA 2COBA 2Y9ZA 2QCOA 2JJ7A 2DMTA 1VI0A 5J1RA 4IHXA 3DCFA 1IUFA 1TWCJ 3MN2A 2RAEA 5GPCA 5FLMJ 3BTIA 3IV5A 1JJ6C 3NAUA 1TWFJ 2LR8A 5EZHA 2E2IJ 1YRNB 3S2DJ 3HOXJ 2L7FP 4BY1J 2M9HA 1OJLA 3LSGA 3S14J 4UUTA 2XGCA 4FISA 3BG3A 3Q3SA 2IBDA 5F0HA 4QIWN 4W1UA 2AO9A 4A3LJ 1AU7A 4UUSB 2DA7A 1O4XA 1X2NA 1BA5A 3RKQA 1RKWA 4MFEA 5EYRA 3FISA 1BL0A 5EG0A 3GBGA 2B63J 1ZGWA 1IG7A 5FKKA 1FTTA 2DJNA 1JT6A 3S1RJ 3QPLA 1UG2A 1A5JA 5J3LA 3ZQLA 1APLC 1Q1VA 3JRBA 4BBRJ 2HOSA 4C3JJ 4Y52J 1TWAJ 4M3GA 2LD5A 2R92J 2NVYJ 1EF4A 2AHQA 5F04A 3FK6A 2HYJA 3A03A 2Y0SN 1HCRA 1I6HJ 2K9SA 1NTCA 1CQTA 3I4NJ 2R7ZJ 4M3FA 1JUMA 2XB0X 4DYRA 2DMQA 5M3MJ 4IHVA 1TWHJ 2X48A 5EGOB 2DA2A 1MSFC 3QPSA 4A3DJ 2DMNA 1TC3C 2R5YB 1BJZA 5IOYA 2WB1N 2VKVA 3W6VA 5IOZA 5F0CA 2GLOA 2DTZA 4IHYA 3RQIA 2R5ZB 2E2JJ 1GT0C 2HQ5A 1IDYA 4I76A 2DA6A 2FX0A 1XS9A 5JLXA 1LE8A 2WV1A 1ETXA 5E3LA 2O9LA 1AKHB 5EDNA 3JRFA 2I10A 5FJ8J 1RR7A 3E7LA 3HDDA 1A6IA 1K83J 1IGNA 2LTPA 2EQRA 2TRTA 2ZB9A 5F08A 3S1NJ 1WGXA 5DTDA 3HB9A 4D7NA 2NVXJ 2JN6A 4A3FJ 5J1YA 2DMPA 3JRHA 2OPTA 3BR6A 3HEFA 2FD5A 4B4CA 4MFDA 1WI3A 2LK2A 4A93J 2R0QC 1QRYA 1OCPA 1GUUA 4X1EA 4A3KJ 4BBSJ 3GTJJ 2EZIA 1IDZA 3ZQIA 2FJ1A 5FLVA 3HOYJ 3RZOJ 1QPIA 3OSFA 1MBKA 3FIWA 3SFIA 4AUXA 1B72B 5HODA 2YU9J 4B1RA 2IEKA 2IAIA 5BNGA 1H8AC 3LSRA 2JA7J 4W97A 2JMWA 4S0HB 2L7MP 2TCTA 5IPAA 2EH3A 1U8BA 1WH5A 1IRZA 4M3BA 3TP3A 4DYQA 1RPWA 1ZTRA 4HNVA 1ZQ3P 1Y1VJ 4AC0A 2ID3A 3QQAA 1JT0A 5K7HA 4JX5A 2G0EA 2XB5A 2CUFA 4A3GJ 1X2MA 2NOGA 1FEXA 2LFBA 1VF9A 2XGDA 4A69C 3LOCA 4C2MJ 1JKPC 5GPAA 3BG5A 1MBGA 2CU7A 1ENHA 3ZQGA 3GTOJ 1VFCA 1MH3A 4Y7NJ 4JYKA 4MLOA 3GTQJ 3ZOBA 2Y9YA 5M5WJ 3BQZA 2EZLA 2E19A 1S7EA 4JX6A 3TEDA 2JK3A 3O8HA 1VNDA 1QVTA 4A3EJ 4XICA 3GTPJ 1Z77A 1JGGA 4J19A 5IP6A 2ECCA 2MGQA 1GV2A 1F36A 1PUFA 1FJLA 1POGA 4BXXJ 3IH3A 2QF7A 5K7ZA 3SDGA 3PO3J 2O8KA 3MKLA 2FQ4A 1HDPA 2H1KA 1NK2P 1TWGJ 1X58A 1AHDP 2NS7A 1Z0XA 5E3NA 1GV5A 3OIOA 1NK3P 2MW8A 1UMQA
chains in the Genus database with same CATH superfamily
1Z05A 2MD0A 2H94A 4CCJA 2W84A 5K5QA 2VQGA 5D6FA 1B8IA 2V9PA 1WKMA 2RQQA 3O6BB 3MMYB 3TW7A 4C9YA 3AL0B 1JUSA 2LDUA 3A4CA 2ZFWA 3OYAA 2MABA 4UHTA 3L2RA 2STWA 5JVGF 2CV2A 2CW7A 2HOEA 1I6XA 4EMSA 2K9MA 2DFFA 3UKGA 1USTA 3IH4A 4AYBN 3BR3A 1R22A 2DI3A 3H5NA 3K69A 3Q0VA 3HM5A 3H0GJ 3D0SA 4BY7J 2MH9A 1D5YA 3GTLJ 3J7ZI 1KA8A 3PNVA 3BCAA 2E34A 1ZN2A 3BR1A 3FMRA 1RNLA 3CMYA 3DPUA 3ABUA 4XOTA 3IWFA 2V9KA 4F92B 5B3SH 1I3AA 4UVCA 1GDTA 3K4LA 3I4MJ 4MGRA 2E35A 1IXSB 2DT6A 1D1CA 4GFBA 4A3MJ 4M9ZA 4ZYAA 3G1LA 3HBLA 4RGUA 3S3MA 2IA0A 5CVRA 3H9JA 5ERIA 3EUHA 3ZMDA 5E3OA 4N4OB 4HNUA 1P92A 3KZZA 2WAEA 3K70C 1BW6A 2V7FA 4XLCA 5GADJ 2L54A 3QU3A 3X2QH 2H6CA 1J75A 5EG0B 3LNQA 3BG9A 4XK4A 2DFIA 2XUBA 4IVNA 2NVQJ 2VPRA 3CJTB 2CS3A 5EF6A 2OQGA 3D1NI 2R7XA 3WHBA 4FETA 1IZ1A 3WTXC 3I53A 2MG4A 2XASA 4A3IJ 1FOWA 3NWTA 2RREA 3M1CA 2OF7A 1BW5A 1Y0NA 4BQOA 3BG6A 2DQRA 5EEAA 1MBJA 1ETYA 1BOBA 2BBYA 3BP8A 3F8NA 1I1GA 2B7EA 3T8RA 3HHHA 3MFKA 1LNWA 1OQYA 2K9NA 2JA5J 4UY8I 2RKHA 3DXJF 2AS5F 4P96A 2WWYA 1AOYA 4GRIA 3TQNA 2XAHA 3FXRA 1R1VA 1BI2A 2IXSA 2F5EA 2VBZA 3FX3A 3R60A 5FB2A 1LFBA 5E1ZB 2R5ZA 2WY8Q 1MJBA 2X9DA 4ZDLA 4UNOA 1BI1A 1B59A 3CUQB 3MZHA 2MSYA 1Y8QB 2FBKA 3W3CA 4B09A 4RA2A 2IT0A 2DTRA 1Q1HA 5J1UA 1PUEE 2QA4I 3GCMA 2K9QA 2JA6J 1VQ4I 3GEZA 2XRLA 3L1PA 1KYWA 4I01A 5LRSA 3BTLA 5DS9A 3GVAA 4IHWA 2JRTA 1HOMA 1LQ1A 1WJBA 2Q0OA 4GDFA 1S6LA 4R79A 2Q2EA 4HAMA 4XRSA 2HXIA 2O7OA 1SFEA 1YW9A 2MLGA 3F8BA 3CZ6A 3FK7A 1JGSA 1YIJI 3JR9A 5KHDA 3KETA 1MKMA 5LHGA 3CDLA 4C2TA 4BXFA 1T33A 2VKDA 3OV8A 3SJMA 3F72A 1NG7A 2CQ7A 1OCZH 2QSHX 1R4MB 2P6SA 1TLHB 3ABLH 4XN3A 1XN7A 2BY3A 2K86A 2XV4S 4G7OF 2HNHA 4MIMA 4XKVA 3OYFA 3T8TA 2H27A 1U9NA 3K1PA 3TW6A 4B47A 4CCOA 1GHCA 5EJCA 3E3VA 3GMEA 4IEJA 5M5XJ 3K0LA 2J5PA 1R5GA 4BXUA 3I9V2 5GAHJ 3B6AA 3KYDB 3VPRA 9ANTA 2FA5A 4L9VA 2X4HA 5F64A 3ZGKA 4CCKA 1R4NB 1BI3A 3H5RA 4D5FA 4JP0A 3MVPA 1H88C 1UAAA 2QQ9A 4ENNA 3R6SA 5DV5A 2EBIA 3E6CC 1OCCH 2V6CA 1P4WA 1XMKA 1W36C 1SVOA 2Z16A 4I09A 3LA2A 2XSJC 1KONA 1FC3A 1W5CC 3CCRI 2YSRA 2NS0A 1YHQI 3IRQA 3R61A 2EV0A 4BJ6C 4LLNA 1LPQA 1SFUA 3MWMA 1DP3A 1YI2I 4LIVA 2ZJRF 4BNCA 3A01B 4OWRB 3DEEA 2VE8A 1JI8A 1TQPA 2KRFA 4IOAF 3E0JB 2XAJA 3VOEA 1FBSA 2K4JA 5L3GA 5BMZA 1O57A 4ESBA 5HS8A 2DOAA 1XD7A 2DT5A 3LSTA 3PO2J 4Y13A 3L7WA 3KEOA 2CO5A 1Z6TA 3KP6A 1ZLKA 4B48A 3S15J 1UJ8A 2E1NA 4RAYA 5IYBJ 1W0UA 3I71A 2QQ8A 1BR1A 4DW6A 2XAFA 3BOQA 4JOMA 4DYCA 3OYHA 4PJ0C 3M3YJ 4RAGA 4QSHA 2ECBA 1WRJA 2LF7A 3BJ6A 1MIJA 2R5YA 1O7LA 1IAWA 1B8IB 3SZPA 2Y75A 2HR3A 5CKTA 4BQNA 2Z33A 1Z7LA 2CMPA 2EZKA 2R7WA 2P4WA 2HTJA 4Y17A 3KCCA 4PGHA 3RJPA 3JRDA 4XLEA 3CF5F 3PQJA 2L9NA 2E1OA 4MTDA 4I99C 4ZH4F 3TMOA 2COBA 3RYPA 3HRTA 4ZJZA 2KLOA 1VI0A 2ELJA 2P6TA 2Z3YA 3WODF 5J1RA 1BJAA 3S3OA 3QAHA 4YFKF 1PP7U 1IUFA 1F1ZA 2CW8A 4ZZDA 4XL9A 5GPCA 5FLMJ 2CUJA 1TWFJ 4LB6B 2ZXHA 3CCUI 2VL8A 3RTRA 1OKRA 1T8IA 3S2DJ 4EM1A 2ZJ2A 2QGUA 2XROA 4KIFA 2LNBA 3H3ZA 3Q3SA 4QIWN 4W1UA 4A3LJ 1AU7A 2WB1A 4I7HA 5H2FC 3HKZA 2PLYA 3GBGA 2IS4A 2B63J 2ETHA 1IG7A 3WG7H 3S1RJ 3A0BC 3WGGA 4AIHA 1DUXC 3JTGA 2KP6A 1MNEA 2FXAA 2BY1A 4BBRJ 1TL8A 1Z3YA 1TWAJ 1YX5A 3FXMA 5FGMA 4M3GA 3QOEA 4ON0A 2LD5A 2R92J 2NVYJ 5EEGA 2RNGA 3U1KA 1V3FA 3L2QA 1YJNI 3QPHA 5D8LB 1VZ0A 1BC7C 2R7ZJ 1IUYA 4DYRA 4HOBA 2MC3A 4I2OA 1E0EA 3HSFA 5M3MJ 3CMEI 4IHVA 2DA2A 2ZMEC 5B1BH 4A3DJ 1N78A 5K1YA 5E8IA 2WB1N 3ELKA 2VKVA 3W6VA 2V79A 3QRFF 5AIQA 1FSEA 4IHYA 1T0FC 1QO0D 2EILH 2R5ZB 1O3RA 2KFDA 3I5UA 5J4VA 3MKYB 4OMYA 1IDYA 3M8JA 3HOSA 1HW1A 4CUGA 1LE8A 4CZCA 3L00A 1ETXA 4MEYF 2I10A 4E4HA 2VIXA 1O3TA 3I3LA 2VJ5A 2YX7A 4CA0A 3M8EA 2K5CA 4A0XA 3HRSA 3HTSB 1P9QC 2LTPA 4FQGA 3J80Z 3I64A 3S1NJ 2XAGA 2OJED 3AG2H 3B02A 3W2AA 3HB9A 2VJ4A 2JN6A 2TDXA 3BG7A 2NRAC 3K4BA 1C0WA 2Q2EB 3C2GA 3I56I 3CD6I 3OYKA 2MH2A 1TW2A 1KU9A 2OPTA 3JRHA 1SEUA 1BBYA 4WX9A 4MFDA 1WI3A 2ZO4A 3DLAA 2R0QC 2KISA 2VOOA 3HIFA 3RPUA 3PIPF 4BBSJ 4XORA 2GQQA 4IQJA 1LDKB 2EZIA 3ZQIA 3HPGA 3DU5A 2L9VA 3HOYJ 3RZOJ 3OSFA 1WJDA 3SFIA 2CSOA 2XKPA 1SD6A 3SQNA 3VYUB 4EJUA 2F5VA 1J7KA 2FF4A 4J01A 1GXQA 3SZGA 3VWBA 3I4PA 2BY2A 3BDDA 1E3HA 4NC7A 4S0HB 2KIFA 2QQAA 1V54H 3PNTA 3ZQQA 2PBIA 3DU6A 3BROA 4P1WA 4DYQA 1OYYA 4XLAA 1Y1VJ 1VQOI 3RKXA 4DJAA 4MHGA 3ZP5A 2G0EA 1WVRA 1JXSA 2DJIA 2XB5A 4ZDOA 5K5RA 1X1PA 4A3GJ 5FRMA 3MQ0A 4IHTA 3QU6A 2LFBA 3L2VA 3GF2A 1JKPC 3QP5A 5GPAA 3BG5A 1IN8A 1IRXA 2VXDA 1ENHA 3CP8A 1R58A 3OR2C 4JYKA 1S9HA 3QP6A 4MLOA 2M4KA 3ZQ7A 2L01A 3CMAI 4NQWA 5M5WJ 3BQZA 1UELB 2V1NA 1VQ6I 3HRUA 2G9WA 3K4JA 3LWFA 1FWZA 2X0LA 2ZSIB 2E19A 3WTVC 3S93A 4EGYA 1TBXA 1J9IA 2K4BA 1VNDA 4XICA 1YO5C 2R7RA 3GTPJ 2JSCA 4KIBA 3CCJI 4J19A 2L02A 5IP6A 1MMDA 1ULYA 3SEZA 1F36A 3IH3A 2QENA 2QF7A 4HQMA 4E7LA 3BZCA 3PJRA 1HDPA 2H1KA 1WJ5A 2R7OA 3N97A 2HZTA 1TWGJ 1U8RA 1X58A 2R7QA 2JUGA 5A2QZ 4A5NA 1NK3P 1GV5A 5DEQA 4XQFA 2M45A 2EFWA 3G3ZA 2MW8A 1UMQA 3W2VA 2QBYA 1OCRH 3A0HC 5IP9J 5IYDJ 1JKRC 1KU2A 1U9OA 1Z67A 3HGGA 1MDMA 4YFXF 3J81K 5TRDA 3Q0WA 2HQAA 3LFKA 1ZAOA 3K9TA 4HX4A 2BXYA 2ZSHB 2F5CA 2HWVA 3HHGA 3RI4A 4FASD 2H8WA 1T38A 2R7TA 3E5XA 4E7KA 2HYGD 3BJAA 2K3PA 2O03A 2KMUA 4ZTFA 2LKXA 2D1VA 2H8RA 2GWRA 1S29A 2LLKA 3E1SA 4M3DA 3K10A 4N9HA 2UZKA 2XF7A 3OSGA 1VQ7I 3CESA 3HL2A 1GXPA 4U88A 4CH7A 4N9IA 2L0KA 2LH9A 5AIPA 3WTTC 1MMAA 2ZNYA 2XPUA 3GX4X 2DPUA 1P2FA 3JAMZ 4L9JA 1M1EB 2QYOA 1IXCA 5GP9A 1V5GA 2L7ZA 4KUMA 3SDBA 3CCMI 2JRMA 1XC5A 4FE7A 1EA3A 1X1CA 4F91B 3ML6A 3GTGJ 3G1OA 3LMMA 1ZG1A 3GFIA 2CFOA 1B9MA 2F48A 3DTKA 2Y0MA 5CVVA 2ZNZA 1GVDA 3V8LA 1B1BA 3CQZJ 4ENJA 2FNPA 1YS7A 5LHHA 4C3HJ 1BIAA 2PJPA 2O3FA 2Z99A 5ILUA 5C44J 2JA2A 1MZBA 3ASOH 2V1DA 3EQLF 3LL7A 5FKLA 2DA1A 1QQIA 1HKQA 4S04A 3FXKA 4HV5A 1HKSA 5FKOA 2PX9A 2BVMA 2X6YA 3OWTA 1AA7A 3KE2A 3T5XA 1F5TA 3R0AA 1YQAA 3JW4A 3IAM2 2QVOA 1IW7F 1XG1A 3F0CA 1YITI 5EGOA 5F6FA 3DKWA 2V6EA 1UG0A 2D45A 2W25A 4CCLA 3OYDA 4RM3A 1FNNA 1XMXA 4PCQA 4CGZA 4O6JA 4AM3A 5FRNA 1STZA 2Y69H 2GM4A 2MD5A 3CCYA 3IHUA 1XSXA 1WFXA 2DA4A 2X1DA 2O61A 1B6AA 2JSPA 2VI6A 2K85A 1X1AA 3OOUA 3K4CA 4NNJA 4X0GA 1WH7A 4XKBA 2ME6A 1LE8B 6PAXA 2OBPA 2RN7A 2P0WA 1IO2A 1J59A 3H92A 5F0FA 4GGGA 4MO7A 1AKHA 2EZHA 2K40A 4HYEA 3WTSC 2ISZA 3WTWC 3PSFA 1H9TA 3S1QJ 1FSHA 2GOXB 3GZ5A 3F23A 3KEQA 3IKTA 3A01A 4A3JJ 5F27A 1IV6A 1QZYA 1A6QA 1WCMJ 1ZYRF 3F9KA 1TQMA 3FHNA 4OU0A 2UUZA 3GYHX 2BE5F 1U3EM 2W48A 1LKXA 2F2EA 2H6BA 4IOCF 2KRCA 3QPTA 1WPKA 2DU9A 4IZZA 3QODA 5KAFC 5D4SA 3OIPA 3ABKH 1LDDA 4HA8A 1ZRFA 2P7CB 2DMUA 2IP2A 2LG4A 4DZPA 5CPRB 4BE2A 4QPQA 1LJ9A 3UR3C 2D5VA 2VUMJ 2CQKA 5JHUA 5M3FJ 2ZXIA 2H1LA 3H9QA 2GBYA 5D8KB 1SANA 2HDDA 3FDYA 4UUVA 1R23A 1W36D 1L0OC 2MA3A 2GIZA 1JTYA 1B72A 2HOAA 3V8JA 1USSA 3K2AA 3ZCOA 3HYIA 2NS8A 2A5WA 2M5WA 5EZGA 1FIAA 2XF5A 3J7AY 2CUZA 4Y33A 2ADUA 3HUGA 2A61A 4EV0A 1TP4A 2VJIA 4C3IJ 2DFEA 4YELA 3DTEA 3CC2I 4KA4A 5LD2C 1T56A 4AIDA 4RB3C 1PDNC 4N0BA 2CUEA 3KP3A 3NRVA 3RPQA 4LFUA 5C4JJ 2M34A 2MYSA 1W4MA 4YRVA 2XDVA 1BM9A 2D2WA 1CF7B 3KLNA 4YIFA 2ESNA 2ZXWH 4JX4A 1MNMC 3TO7A 1VQ8I 2VPLA 3DWLE 2QM3A 2RNJA 4BH9A 1TT5B 2R4GA 3BC8A 2FOWA 4NQWB 4EM2A 2CYYA 2JPBA 2K3FA 1PJRA 1ZHFA 1U5TA 1KZHA 1I5ZA 3BPXA 1DU0A 1QNTA 1VQ9I 2E7XA 2PG4A 1WQ2A 2WBMA 4FCYA 4FX4A 4M71A 2LY9A 1XGNA 1LFUP 1LB2A 1KQ8A 3HTUA 3U21A 1RETA 4EM0B 1E17A 4GCVA 1DQUA 2IGNA 2XPWA 4B44A 1Z91A 5FROA 2V9VA 3DEWA 4HV6A 1V55H 4L9TA 4M9SA 4HF1A 1IN5A 2FRHA 2P5LC 3FXQA 2L9SA 2V1XA 1RESA 2QBYB 4ITVA 4CYCA 1N75A 2BW3A 2BY0A 5JFRA 1MDMB 1ETQA 3VYTB 2XGXA 4RDUA 2VXZA 4H4KC 1SVMA 3KFWX 3U1DA 2HKOA 2AXLA 2QSFX 5IYCJ 4A3CJ 1ZK8A 1JKQC 1D1AA 3G73A 5CYVA 1XSDA 4HNTA 4WXDA 2ZKZA 3S2HJ 2YUSA 4OAYA 4E7HA 1MBFA 3CTAA 2HEOA 2DODA 3PSIA 4C30A 3RPUD 2QCOA 5E1WA 3LFUA 1PVEA 3DCFA 1VQLI 1S7AA 1TWCJ 3C18A 3MN2A 3L09A 1FYKA 2RAEA 3WTUC 4TV7A 3IV5A 1JJ6C 3KZYA 2PI0A 2EB7A 5J6XA 1X4PA 2M9HA 4DBRA 5DM6F 2W24A 3LSGA 4D9JA 3S14J 2XGCA 3ZMZA 3CCEI 4ENMA 1P4XA 4UVBA 1BA5A 1RI7A 1RKWA 1F4KA 5TGTA 5J4YA 1BL0A 3FHZA 4OIRF 3DKYA 2G7HA 1O3QA 2OQRA 3GFLA 3WTZA 4RAZA 4UV8A 5DD8A 1JT6A 2P5KA 3ZQLA 4P9UA 4HX8A 1Q1VA 3JRBA 4Y52J 3WTYC 2MBFA 4JQFA 3B73A 2KZGA 1KYZA 2MC4A 2VONA 4YG2F 1ONVA 3F8FA 1Z9CA 2AQEA 3J80K 1HCRA 3OOPA 1I6HJ 5CVUA 3OYGA 1CQTA 2EIKH 3PUFA 5FD5A 1T6SA 3D5RC 4M3FA 4YIIA 4BDZA 1JUMA 2DMQA 2EA2A 2L7KA 2X48A 5EGOB 5H6QA 1WI9A 2QWWA 3JTHA 4LIUA 3KEYA 3RQ4A 2CQNA 2EFQA 2DMNA 3WG9A 1G8XA 2NAZA 5F0CA 4MQVA 3U9GA 1GLNA 3DBLB 3RQIA 1VQPI 3PUBA 2KQRA 4MQ9F 1GT0C 3HPHA 2M87A 2DA6A 2FX0A 2VBYA 2V26A 4GYIA 4YEJA 5JLXA 3G71I 2WV1A 5E3LA 1AKHB 5IY5H 3O3KA 1RR7A 4N4NB 3TDUC 2PEXA 4U0YA 3E7LA 2OTLI 1WHUA 1K83J 4F55A 1X3WB 2W7NA 1KU3A 2EQRA 5DYMA 3GFJA 4UB8C 2TRTA 5F08A 2QSGX 5DTDA 3LA3A 1YJ9I 3FBNB 4D7NA 2NVXJ 1HBXG 2O8XA 3C7JA 3DEUA 2DOFA 1CGPA 3LSHA 1ON1A 4Q48A 3M7GA 1Y39A 3ONQA 2FD5A 4AU7A 3KYCB 2LK2A 1JHFA 4A93J 4M6XA 1OCPA 5HNFA 4IX7A 1P6RA 4A3KJ 1SD4A 4OAZA 3GTJJ 3DBHB 1IDZA 2IRFG 1V4RA 3IUOA 3KP7A 4MEXF 3DLLF 2RV8A 1EH7A 3RSNA 4RMNA 1QPIA 4ASNA 2E1MC 2ZFUA 1D3YA 1DPUA 1B72B 4G6DA 2DW4A 4RAFA 4Q5SF 2IEKA 3I59B 5BNGA 1X3UA 1H9GA 2JTVA 2JA7J 1YIOA 3WGIA 3BPVA 4E7SA 2TCTA 5IPAA 4AIJA 4KT5C 2LF8A 3OS0A 2FBHA 2CW0F 2VC1A 3HUGB 1U8BA 5FFZA 4M9XA 1WH5A 3I55I 3ZMSA 2CG4A 3TP3A 3P9IA 4XRFA 1WJCA 1YLFA 4AC0A 4RGXA 5ICFA 1JT0A 5K7HA 4HDVA 1REPC 1E3PA 2JQ7A 2QEXI 2DPDA 4BJTA 2CUFA 4HDUA 1X2MA 2NOGA 2EFPA 4M74A 1VF9A 2XGDA 1D5VA 2JVGA 1SAXA 5IT9Z 3GZNB 1FT9A 1FMVA 1MBGA 2F5DA 1VQKI 4G94A 2UWMA 2LOOA 2DK5A 2BV6A 1MH3A 4Y7NJ 1WWXA 3DKXA 1BIBA 3M07A 1O3SA 3IC7A 4CDGA 2R7DA 2HKXA 1U5TB 3EYIA 3HRMA 2HVSA 5DUIA 4H0EA 5DCMA 1S7EA 2ZXJA 3GFMA 3DP7A 4RB0A 1UHWA 3TEDA 4BGDA 5L3BA 1YYVA 3OMYA 3OYNA 3AAFA 3RIRA 4ZYGA 1R1TA 1XPXA 4AWXB 1JGGA 1QZEA 2ECCA 2ZC2A 1GV2A 3VODA 1PUFA 5K7ZA 4NC8A 1FYMA 1BC8C 3E6MA 2O8KA 2FQ4A 2WTEA 1LEBA 4BU2A 3ABTA 3PQKA 1AHDP 3JAMK 2E7WA 1MNDA 5KK1A 1Z0XA 3OIOA 3BLYA 2DOEA 1K4SA 4CYCB 2E5ZA 2BW3B 3V7CA 1EJ9A 3F21A 4DNCA 3JRAA 3HKZN 2PJRA 2I8DA 4NC6A 2LY1A 4XSXF 4BUPA 2GOMA 1HA8A 3Q0UA 2VLAA 1AWCA 2KIQA 3AL0C 1ZGAA 4HSTA 3TOBA 5FKNA 4IQ4A 1A36A 3GWZA 5E17F 1MMGA 3GZ6A 4LLLA 3GO5A 3IAS2 1XSVA 2W4SA 4RGSA 2O5RA 4FT8A 2PMZA 1UFMA 2M8EA 2ME0A 4BHBA 1Z1DA 3KP2A 4B3AA 1G3WA 1YRNA 4XRMA 5FO5A 5J40A 3T0YA 1P7IA 3DPLC 1UCRA 3WHCA 3BTCA 2M7BA 1FOKA 1W7PD 1R5ID 3QYFA 4D7MA 4FTHA 2ZJPF 3BQYA 4HRIA 1YTYA 3W2WA 3KPHA 4P55A 4UUSA 3B6CA 4I0BA 5FLXZ 2R93J 3BR5A 1F9NA 3IL2A 4M3EA 4QPOA 3TOAA 2H09A 1PP8F 2L4MA 2AQFA 3L9FA 1K4TA 1SFOJ 2NXNB 3OYBA 4UXNA 2ZMEA 4OINF 3COAC 2PMZN 4G6QA 4KT6A 3GTMJ 2HVQA 1ETKA 2FSWA 1Z3XA 1T0FA 1P4AA 4KN4X 1HSJA 4O5VA 4GYGA 3RCOA 2NNYA 2CRGA 2N8GA 2HU9A 2PQ8A 2W85A 1Y6IA 3HJEA 2EINH 3MKZA 4AD9A 3F6VA 2DQLA 3CMMA 3PFYA 1CF7A 4NBQA 4PJLA 3V7SA 2L2OA 2LVSA 3ECOA 1TZLA 3AKZA 4AIKA 4LMYA 4M6VA 4DOZA 3FF5A 1IV8A 1MBEA 5J47A 3K6GA 2VB6A 2KDZA 4ZYEA 4X6AJ 4GXOA 3FXUA 2CWEA 2QKLB 1RZ4A 4KMUX 4EEFG 4DGWB 2A69F 2O6GE 3CUQC 3H36A 2HZDA 3RZDJ 4XOPA 1ZR4A 2KL4A 4C2UA 2Y0SA 1QHGA 3CJQB 1IJWC 4BKXA 3OL3A 2KIMA 1K6YA 2M1BA 4D0PA 3OYLA 1IN6A 2ESHA 4LD5A 5DD4A 5D4RA 2R7SA 1XB4A 3LSKA 3MKWB 4O3MA 3QWLA 2DLLA 2L9RA 4BAYA 2FMLA 3VEPA 2ID6A 4V2GA 2DDBA 3JREA 4ZYDA 3G4SI 3P9CA 4RGRA 4XONA 1EV7A 2HPMA 2CJJA 2KT0A 4HX7A 1SC7A 1FY7A 3WGHA 3BZKA 1V5FA 1JJ8C 1L3LA 3S16J 1MH4A 4BHCA 4RB1A 2PMUA 2HI3A 3HSRA 4CYDA 3CC7I 4KYWA 4CCNA 2F6CA 4G12A 3K70D 1A35A 2P5VA 3H35A 1JUPA 1RKTA 2DA5A 4E7IA 2VQHA 2HXOA 3MZYA 2CFXA 3K7AJ 4D5CA 4ESFA 3MAJA 3H0DA 3GTKJ 5BS6A 2F4OB 2LKPA 2EK5A 2VT2A 3VFZA 4UVAA 3RYRA 3S17J 3BT9A 1QHHD 4ZDPA 1FYLA 3BR2A 4IO9F 2K9LA 5JHFA 3PNYA 1E3OC 3UNGC 3IH2A 5DM7F 4QTRA 1ETWA 2FQ3A 3ZQFA 3KYLA 4XKCA 1R49A 3FMQA 1OR7C 3O8GA 4ETSA 5JLWA 2M2EA 3HGYA 5HLIA 4WK8F 1G3SA 4MTEA 1HSTA 2A6TA 4ZC3A 2NOJB 3E5UA 2X6WA 1ZREA 2BVLA 2D1HA 3LAPA 4LITA 3WU2C 1TNSA 4Q4ZF 3GUDA 1S8NA 2OC6A 2YPRA 5DCMB 3V4GA 3OYIA 2B9SA 2A07F 4DQ2A 3OYCA 4RS8A 3R0JA 2RDPA 2IGMA 2GXBA 4B8XA 5ED4A 4V2FA 4K2EA 2L5QA 2BHZA 4EGZA 1ITYA 1I50J 1LUJB 1PUFB 4ENKA 4B3XA 4XIDA 5JI6A 3A02A 4G8XA 1MSEC 3C2BA 3W6JB 3ECHA 1YOVB 2P81A 4LOCA 2XC7A 3FWEA 2DO7A 2WAFA 5CVIA 3MZ8A 3PM1A 5EEHA 5C4XJ 2KIUA 1D8JA 2FNAA 2JWTA 4BJ5C 2PJRB 1J09A 1F43A 5LHIA 2LBFB 2X85A 3OY9A 2MFZA 3H3VK 3FXLA 5KAIC 5C3EJ 4L5IA 1H89C 3M9AA 2OAZA 5D5UB 5D6EA 1DGRM 4IHSA 1YX3A 3EDPA 1HXDA 1RR8C 3G1MA 1I1SA 1DP7P 3ZQHA 2E2HJ 2X1CA 4KDPA 3BY6A 2ZJQF 3I54A 3PFIA 2Y9ZA 3G6EI 4LGWA 2JJ7A 3I0TA 4DBQA 5ICGA 4HLYA 3SXYA 3BTIA 1B4AA 2LR8A 5EZHA 2E2IJ 1YRNB 2OUMA 2IGKA 3VSLA 3ABMH 4HQEA 2KDOA 1QGPA 3BG3A 4LJZF 4M73A 5F0HA 1T2KA 2LMDA 4CO8A 4UUSB 4D1QA 1O4XA 1X2NA 5LLQA 3RKQA 4MFEA 2XRNA 5EYRA 2DYSH 2EFOA 3FISA 1RUOA 3W6KB 3EUHC 4KMFA 5L3CA 2ELHA 4YFNF 4JBAA 5D5VB 1UG2A 3HG9A 1APLC 2R7VA 1R5HA 4AYBA 3I59A 1K7AA 4F52A 5F04A 2V1UA 2ZMEB 3FK6A 4HF0A 2HYJA 3A03A 1W7PA 2XHKA 1OYIA 1ZH5A 2QKMB 1S5LC 2K9SA 1NTCA 2VOPA 3TDZC 1KU7A 3ASNH 1MW7A 4PJNA 2RVCA 3ROUA 2GXAA 1FLIA 1QZZA 4KJZA 4LG3A 2KRHA 1IRGA 4JK1X 2V4JC 3CCQI 1MSFC 2EJRA 1HW2A 1IF1A 1BJZA 5IOYA 5IOZA 2UV1A 1Y56A 5TJJA 4WWCA 2GLOA 3A1YA 2STTA 2VODA 2DTZA 4HSRA 4AVZA 4M6YA 4ZYHA 2Z9OA 4II3A 1TQIA 3WE2A 3MD2A 2PFBA 1G3TA 4I76A 1YJWI 4UB6C 1XS9A 5HDKA 3C3WA 1BI0A 3G2BA 2M7AA 5HS7A 3EUKL 5EDNA 3JRFA 1XCBA 2HGCA 3OL4A 3PL8A 5IT3A 2GXGA 3ZMTA 2OD5A 2IGOA 3GLLA 4A0YA 3PIOF 1K79A 1R1UA 3IRRA 1JE8A 2ZB9A 3OR1C 1WGXA 4XBFA 1IXRC 1JHHA 4IXAA 4S05A 5JR3A 2VC0A 1X3ZB 4OOIA 3NWSA 3H1CA 4A3FJ 5J1YA 1WSUA 4BACA 2IA1A 2C6YA 5HVQC 4RB2C 3K1MA 3BR6A 3HEFA 3D5LA 3TGNA 4ANJA 5CQEA 3J81Z 4HW0A 2DAOA 1ZRCA 4X1EA 2RC4A 3VYRB 2HVRA 4XKWA 5FLVA 3EETA 4A0ZA 3ZPLA 3N05A 2ZBKA 5CVJA 1XTAA 5IT9K 3CP2A 3FIWA 5GAGJ 4PJMA 3F6OA 3H5AA 3KZIC 4B1RA 4UV9A 2IAIA 4A2UA 3U2RA 5HOOA 4HPQA 4W97A 1IN7A 3HZJA 2ISYA 3RKWA 2VE9A 5BOXA 2FUG2 4Z2YA 4FX0A 2L7MP 4ZTJA 2F5FA 1Y0UA 4RM2A 1A31A 4XNFA 2JPCA 3OS1A 1FPQA 1MMNA 1ZTRA 1S72I 3LQQA 1D1BA 2Q8KA 3OYMA 1U0JA 2QQBA 4PK4A 2HTSA 5KCMA 2ID3A 4BL0B 2X1EA 2HDWA 2OCCH 4JX5A 4OIOF 2YU3A 2XVCA 3LSIA 3F8CA 1KQ9A 4XM3A 3FXOA 4A5MA 4CICA 1W1WE 2FU4A 4A69C 3C1DA 4C2MJ 2COMA 5ICCA 4NB5A 1B9NA 4BEHA 2CV0A 1SFXA 3ZQGA 4BYYA 5JVTA 1VFCA 2Z5UA 1HC8A 1K78A 2W1OA 2K27A 4BHPA 1BR2A 2Y9YA 3TBIA 5HLGA 3CCVI 3FM5A 3J7AO 1QBJA 3JCUC 1MGTA 3BCBA 1SMTA 3T1BA 2XKOA 3E6DA 2LYCA 4JX6A 1J2XA 2BHYA 3O8HA 1QVTA 1OLTA 2DCEA 3ZN0A 3DTIA 2HYFA 2DT7B 2KJBA 4EQQA 2EV6A 1OCOH 1POGA 4IKFA 4BXXJ 2VJJA 3PO3J 3MKLA 3AG3H 4L9NA 1NK2P 1FMWA 2A6HF 4PDKA 3LQRA 1XX5A 5E3NA 1V5EA 2QZ8A 3ZMVA 2L4AA 2OA4A 4G7HF 3TKYA 4HF2A 4F7ZA 1QA6A 1U2WA 2BYVE 4PGGA 2K7LA 2CGPA 4CSWA 3DV8A 1XGMA 1ZR2A 4OIPF 5E20A 5FD6A 3LSPA 2YR2A 2LP0A 3F3XA 1U78A 5FLXK 3HOVJ 4ZZLA 5LGUA 1MD0A 3S8PA 2G7UA 3V7RA 3JRGA 2IS1A 1YE9A 2VKEA 2Y2ZA 3CC4I 4L18B 2E1CA 1J5YA 4WXCA 3Q9VA 1JTXA 1D0YA 3LAJA 2FBIA 1XCVA 2MLKA 3EPZA 3VSKA 4XLFA 4II2A 3QYBA 1HDDC 2F4IA 2OU2A 4EATA 2ELKA 3ZMUA 3RKYA 1FOYA 3GLXA 4WCGA 2DXIA 2GIVA 1EH6A 2X6OA 1ON2A 3K2ZA 2XAQA 4EVIA 5E3MA 2K02A 1ETVA 4LG0A 2XIGA 2NYXA 1BR4A 2XPVA 4KITB 5KNLA 3K4MA 3QOPA 4U7DA 3S1MJ 5CLSA 1DDNA 3ERMA 3P9KA 3JSPA 1U6GA 4L0YB 3P5JA 5J8FA 3HOZJ 4CZZA 1UHMA 2BOLA 3SEQA 2IW5A 4F93B 3OIQA 3SYTA 2XAUA 4IRHA 5IP7J 1OCTC 4Q47A 4Z6YA 3HOUJ 2EWNA 2DA3A 3CCSI 4DIQA 1FOXA 2CQXA 1T98A 1DGWY 1EH8A 1LVKA 1TT0A 1W7PB 2A6EF 3TO6A 4NHJA 5ICEA 1K61A 2M30A 3C2HA 1XMAA 1T08B 2Q1ZB 3CDIA 2VT3A 3L2CA 4U7BA 4I0AA 1R6RA 3ISPA 2VBWA 2LREA 2NVUB 1ZELA 1YG2A 3GXOA 2XSDC 3IKVA 2KKOA 1SVLA 4IPAA 1NHAA 3ZN1A 2FMYA 2P8TA 5D5XB 2GA1A 4A6DA 1D0ZA 1RC9A 1ZRDA 3AFHA 5A2QK 2M0CA 3OS2A 1HF0A 2HQNA 1J0RA 3ZRGA 3J7YJ 2PMHA 4I6ZA 3Q5FA 3BWGA 5LEKA 4A3BJ 1ZG3A 4Y3OA 5J8CA 1FBUA 1YS6A 2Y31A 2Y48A 4Y15A 5M5YJ 3L2UA 4WF2A 3N4MA 1G2HA 4HBLA 3DBRB 3H9GA 2LC2A 3P7NA 4E7ZA 3Q9SA 2RGVA 5DDGA 3ZQCA 4FE4A 1IC8A 1BOAA 2DN0A 2YS9A 5BPDA 1MJAA 3BJOA 3V42A 1QVUA 4XRSG 5FKMA 3ZXSA 4EJWA 2VQLA 3S3NA 2WAQA 3SHFA 5HDGA 3SZTA 1HLVA 3S2WA 1ORKA 2IS2A 1QPMA 1P7JA 3CJNA 3MCZA 1UHSA 4BS9A 2M8GX 1R9TJ 1RUNA 1LVAA 3I58A 2NVTJ 1YW7A 4L5JA 4XR6A 1NH3A 4R8HA 3HOTA 1BN5A 5B1AH 3TP0A 5HLHA 4HLXA 1EKEA 4NDLA 2DDAA 1SD7A 4CHUA 1VQNI 3ZR8X 5LBQA 1Z21A 3QYEA 4R1HA 3EYYA 1I39A 4IRIA 4LK1F 4PUSA 2LBFA 5LGTA 3A2KA 2Y30A 1FIPA 2ZCWA 4J00A 3DPTA 2EA4A 1FX7A 4PJJA 1XGOA 2AXTC 2WAQN 3ERED 3D5SC 4DZJA 1ETOA 1K6OA 4XN0A 1DU6A 1ZLJA 3JSOA 3JRIA 5K7FA 1IN4A 2PN6A 4EJOA 1FP2A 4G9YA 3AG4H 2KHMA 5E8GA 4CXFA 3BZ6A 1MBHA 2CQQA 4P5OA 2HOTA 2EFNA 2LKSA 3BTJA 3DQVC 2HPIA 5GTHC 1FTZA 1TNTA 5HS9A 3TO9A 4BEHB 2DBBA 3FKJA 2F4MB 5F1RA 2VN2A 1JKOC 2JA8J 1K78B 5E18F 5GAEJ 5F1JA 2O0YA 3DF8A 1RRJA 5DCFA 2E71A 1W5TA 3FBIB 1WJAA 2OV7A 3F22A 1LEAA 2XGEA 1VTNC 1XDSA 4EJTA 3JRCA 2P7VB 3HOWJ 2XF6A 3IWZA 3E5QA 3HSEA 3KP5A 3FKIJ 3E6BA 4HZFA 4ABZA 4EJVA 2EIJH 2QLZA 3CLOA 3CO7C 4Y4RA 3RDIA 1ACIA 1HKTA 2GZWA 3NARA 1H0MA 1OMIA 2EIMH 1SFKA 3LSMA 1OFCX 2FE3A 4XMYA 2UXNA 4RBOA 3OYJA 3LSJA 5BQTA 2JUCA 3K4KA 2L3DA 1W0TA 1T39A 3CF2A 5LEJA 5L3DA 5HLTA 2LY2A 2HDCA 5BPIA 4U0VA 3BR0A 4PZJA 3SFZA 2M0MA 4L5EA 2E36A 5KVRA 4I98B 3S32A 4F3QA 1NG6A 2J5OA 4BE0A 2Z1DA 3M8FA 3VYSB 1I3QJ 3M4OJ 1Y1WJ 2LSOA 2WC2A 3CCLI 2W00A 4RLQA 5E1XA 2JVHA 3IP4B 4XLPF 4LB5A 4U87A 1ZKGA 1IRFA 2X6XA 1X4OA 5GTIC 2DMTA 1N25A 2IPQX 1N77A 1OISA 4IHXA 3F8MA 4OIQF 1G59A 1Z7UA 5HDNA 1MJ9A 3NEUA 4KIGA 5ILVA 4V19K 2E5NA 3NAUA 4BE1A 2BEOA 3HOXJ 2L7FP 4IF4A 4BY1J 4LG0B 3ULQB 5H6RA 4G7ZF 1RIOH 1OJLA 1ZARA 1G6NA 4UUTA 1A04A 1Y8RB 5AONA 4FISA 2IBDA 5CJ9A 3E97A 2AO9A 2FEZA 1VQMI 2DA7A 4E6KG 2A5YB 5EG0A 1R00A 2OZUA 3M1EA 1HQCA 1ZGWA 2QUFA 5FKKA 1FTTA 2DJNA 1S3JA 3QPLA 1A5JA 5J3LA 1PYVA 1YW8A 2HOSA 4C3JJ 4PFOA 2NNNA 5LGNA 1X1DA 2BXZA 4KN7X 5L3FA 2AHQA 3CJRB 1EF4A 4IJAA 2CV1A 2EV5A 2IJLA 4BQQA 2Y0SN 1O7FA 3I4NJ 3HC7A 4XSZF 4QWQA 2XB0X 1TWHJ 2JZYA 2YX4A 2X51A 1UB9A 3DFGA 4I02A 3OYEA 2DFHA 3QPSA 4HEA2 1YFHA 5TISC 1TC3C 1TW3A 2R5YB 4YIRX 2VKHA 5DUKA 4KISA 2CH0A 3REOA 1UZCA 3K1NA 5L3EA 3ESWB 1MMSA 1DPRA 3VDXA 2E2JJ 2RQPA 2HQ5A 1OPCA 1G4DA 4L0ZB 5LFAA 3O2PE 1X19A 3CUQA 2EPFA 4PSXA 5FFXA 1VQ5I 2O9LA 1WJFA 1LFPA 4G6TB 3AG1H 5FJ8J 3HDDA 2IVMA 1A6IA 4IL6C 5K5OA 2WV0A 1IGNA 1OYWA 1G3YA 3MEXA 3TL4X 2UXXA 2VBXA 2E60A 3LA7A 5H20A 4E70A 2R3SA 3NQOA 1W5SA 1ZG5A 3R4KA 1S7OA 2WA0A 4B43A 2M4GA 5B66C 5LRRA 2Z2SB 2DMPA 2JT1A 2ACJA 3KLOA 4NUBA 5E79C 4B4CA 1TTYA 2E1MB 2WADA 1QRYA 1QU3A 1GUUA 2GA2A 4KNYA 1FP1D 3V8KA 2FJ1A 3L2WA 5B5EC 4XLNF 3KIOA 4P9FA 4PSWA 2OTJI 4BDYA 1MBKA 1LDJA 1E2XA 4E7JA 2BGCA 4AUXA 4M72A 5ILSA 5HODA 3HXLA 2YU9J 1X1BA 2LRDA 1H8AC 2I5UA 3LSRA 1SD5A 2HFHA 4A6EA 2ICWG 1ZGJA 2JMWA 3WU0A 3K4NA 1R71A 3VB2A 5CQGA 2DYRH 2OCEA 2EH3A 2W82A 1WJEA 1ODDA 4KFCA 3WU1B 4CCMA 1IRZA 4M3BA 1R7JA 1RPWA 4MNUA 2OZ6A 4A12A 4AVPA 2M3AA 2R7FA 4HNVA 1ZQ3P 3CLQA 1OR7A 3QQAA 4LK0F 4GO1A 1I27A 2GAUA 1SMYF 2IS6A 2KZVA 4LLGF 3WE3A 1D8KA 1ERDA 1FEXA 4QLCU 2HQRA 1XDUA 2KJCA 3LOCA 2A3SA 3FZVA 2CU7A 2A68F 3GTOJ 2DK8A 1FBQA 2BZTA 2FOKA 1HW5A 4FHTA 3GTQJ 4IRGA 1KGSA 1WZ2A 3ZOBA 5HNHA 2HS5A 4OMZA 4RLFA 4BQAA 4KICA 1R36A 2VASA 3FXJA 1T95A 1D0XA 2EZLA 3CUOA 4WXHA 3FMSA 2W57A 2JK3A 1SAUA 4A3EJ 2WY7Q 1U5TC 1Z77A 1Z6RA 3H3UA 2A05A 1KQ0A 5D5WB 2KPMA 2MGQA 1FJLA 3GW2A 1XGSA 2R7UA 3SDGA 4ESJA 3CDHA 4U0WA 2B0LA 4XLHA 3KX2A 4PFPA 2NS7A 1GVJA 3KP4A 2IA2A 3EUAA 4HG2A 1FZPB 2VQCA 3CO6C 3FM3A
chains in the Genus database with same CATH topology
4CYCB 5IP9J 5IYDJ 1JKRC 1U9OA 3HGGA 1B8IA 3Q0WA 3HKZN 3TW7A 3JRAA 1JUSA 1ZR2A 3LSPA 1U78A 2LP0A 3UKGA 3Q0UA 3HOVJ 3IH4A 4AYBN 3BR3A 2LKXA 2H8RA 3JRGA 2LLKA 4M3DA 2Y2ZA 2VKEA 3Q0VA 3HM5A 3H0GJ 1D5YA 4BY7J 3GTLJ 5FKNA 3OSGA 1JTXA 3BR1A 3CMYA 2L0KA 1HDDC 2XPUA 1GDTA 2ELKA 3I4MJ 2ME0A 4GFBA 4B3AA 2X6OA 5GP9A 4A3MJ 1YRNA 2L7ZA 3G1LA 3HBLA 5E3MA 1ETVA 4XRMA 1P7IA 2XPVA 5E3OA 3WHCA 3BTCA 1XC5A 4FE7A 3GTGJ 4FTHA 4D7MA 3G1OA 1BW6A 3BQYA 3S1MJ 4UUSA 1GVDA 3B6CA 3CQZJ 5EG0B 3LNQA 3BG9A 4XK4A 4C3HJ 3HOZJ 2R93J 5C44J 3BR5A 5FKLA 2DA1A 4M3EA 5IP7J 2NVQJ 1OCTC 2VPRA 3HOUJ 2DA3A 5EF6A 2CQXA 1SFOJ 3D1NI 5FKOA 3WHBA 2PMZN 2MG4A 1K61A 4A3IJ 2OF7A 1BW5A 3GTMJ 5EEAA 1ETKA 1MBJA 1ETYA 1XG1A 3F0CA 5EGOA 2K9NA 2JA5J 2XSDC 2CRGA 2N8GA 2GM4A 3CCYA 2DA4A 1LFBA 2VI6A 2R5ZA 3OOUA 2LVSA 2X9DA 2M0CA 1HF0A 1WH7A 2ME6A 1LE8B 2MSYA 4I6ZA 4M6VA 4A3BJ 5F0FA 4MO7A 5J1UA 2EZHA 1MBEA 2K40A 1AKHA 2JA6J 2K9QA 2Y31A 5M5YJ 1G2HA 2KDZA 2XRLA 3L1PA 3S1QJ 4X6AJ 3BTLA 4A3JJ 4EEFG 3A01A 5DS9A 3ZQCA 5F27A 4FE4A 1IC8A 1IV6A 1WCMJ 2DN0A 2YS9A 3RZDJ 4IHWA 1ZR4A 1HOMA 2W48A 1QVUA 4XRSG 4BKXA 5FKMA 1IJWC 1WPKA 4XRSA 2HXIA 2O7OA 1HLVA 1ORKA 1P7JA 3FK7A 2DMUA 1UHSA 3JR9A 4DZPA 2M8GX 1R9TJ 3CDLA 2L9RA 1T33A 2D5VA 2NVTJ 3SJMA 2ID6A 2VUMJ 4V2GA 3JREA 5M3FJ 3TP0A 2GBYA 4NDLA 1SANA 2HDDA 2CJJA 2KT0A 4MIMA 1B72A 1JTYA 1U9NA 2HOAA 3TW6A 3K2AA 1JJ8C 3S16J 1MH4A 2NS8A 5EZGA 2HI3A 2Y30A 1FIPA 1FIAA 4G12A 4IEJA 5M5XJ 1JUPA 1RKTA 2DA5A 2WAQN 2HXOA 3B6AA 4DZJA 1ETOA 3VPRA 3K7AJ 4D5CA 4C3IJ 9ANTA 3GTKJ 1DU6A 3JRIA 5K7FA 1T56A 4D5FA 3S17J 4JP0A 3BT9A 3MVPA 2CUEA 1H88C 3BR2A 5C4JJ 2M34A 1E3OC 1MBHA 2CQQA 2EBIA 3IH2A 4QTRA 2HOTA 1ETWA 3BTJA 3ZQFA 1FTZA 4JX4A 1MNMC 3O8GA 5JLWA 2M2EA 3HGYA 1JKOC 2JA8J 5F1JA 3A01B 2XGEA 1DU0A 3JRCA 3HOWJ 4FCYA 2LY9A 3FKIJ 1LFUP 4V2FA 3PO2J 4ABZA 1RETA 1ITYA 1I50J 1PUFB 2XPWA 4XIDA 3S15J 3NARA 3DEWA 3A02A 1MSEC 3C2BA 5IYBJ 1W0UA 1OFCX 2P81A 4DW6A 4LOCA 4RBOA 3LSJA 4DYCA 1W0TA 1RESA 3M3YJ 4CYCA 4QSHA 2ECBA 3PM1A 2R5YA 5C4XJ 1ETQA 3BR0A 1B8IB 2JWTA 4RDUA 4L5EA 1F43A 5IYCJ 2EZKA 3H3VK 4A3CJ 1ZK8A 1JKQC 5C3EJ 1H89C 1I3QJ 3M4OJ 1Y1WJ 3JRDA 3G1MA 2E1OA 3ZQHA 2E2HJ 3S2HJ 2YUSA 1MBFA 1ZKGA 2COBA 2Y9ZA 2QCOA 2JJ7A 2DMTA 1VI0A 5J1RA 4IHXA 3DCFA 1IUFA 1TWCJ 3MN2A 2RAEA 5GPCA 5FLMJ 3BTIA 3IV5A 1JJ6C 3NAUA 1TWFJ 2LR8A 5EZHA 2E2IJ 1YRNB 3S2DJ 3HOXJ 2L7FP 4BY1J 2M9HA 1OJLA 3LSGA 3S14J 4UUTA 2XGCA 4FISA 3BG3A 3Q3SA 2IBDA 5F0HA 4QIWN 4W1UA 2AO9A 4A3LJ 1AU7A 4UUSB 2DA7A 1O4XA 1X2NA 1BA5A 3RKQA 1RKWA 4MFEA 5EYRA 3FISA 1BL0A 5EG0A 3GBGA 2B63J 1ZGWA 1IG7A 5FKKA 1FTTA 2DJNA 1JT6A 3S1RJ 3QPLA 1UG2A 1A5JA 5J3LA 3ZQLA 1APLC 1Q1VA 3JRBA 4BBRJ 2HOSA 4C3JJ 4Y52J 1TWAJ 4M3GA 2LD5A 2R92J 2NVYJ 1EF4A 2AHQA 5F04A 3FK6A 2HYJA 3A03A 2Y0SN 1HCRA 1I6HJ 2K9SA 1NTCA 1CQTA 3I4NJ 2R7ZJ 4M3FA 1JUMA 2XB0X 4DYRA 2DMQA 5M3MJ 4IHVA 1TWHJ 2X48A 5EGOB 2DA2A 1MSFC 3QPSA 4A3DJ 2DMNA 1TC3C 2R5YB 1BJZA 5IOYA 2WB1N 2VKVA 3W6VA 5IOZA 5F0CA 2GLOA 2DTZA 4IHYA 3RQIA 2R5ZB 2E2JJ 1GT0C 2HQ5A 1IDYA 4I76A 2DA6A 2FX0A 1XS9A 5JLXA 1LE8A 2WV1A 1ETXA 5E3LA 2O9LA 1AKHB 5EDNA 3JRFA 2I10A 5FJ8J 1RR7A 3E7LA 3HDDA 1A6IA 1K83J 1IGNA 2LTPA 2EQRA 2TRTA 2ZB9A 5F08A 3S1NJ 1WGXA 5DTDA 3HB9A 4D7NA 2NVXJ 2JN6A 4A3FJ 5J1YA 2DMPA 3JRHA 2OPTA 3BR6A 3HEFA 2FD5A 4B4CA 4MFDA 1WI3A 2LK2A 4A93J 2R0QC 1QRYA 1OCPA 1GUUA 4X1EA 4A3KJ 4BBSJ 3GTJJ 2EZIA 1IDZA 3ZQIA 2FJ1A 5FLVA 3HOYJ 3RZOJ 1QPIA 3OSFA 1MBKA 3FIWA 3SFIA 4AUXA 1B72B 5HODA 2YU9J 4B1RA 2IEKA 2IAIA 5BNGA 1H8AC 3LSRA 2JA7J 4W97A 2JMWA 4S0HB 2L7MP 2TCTA 5IPAA 2EH3A 1U8BA 1WH5A 1IRZA 4M3BA 3TP3A 4DYQA 1RPWA 1ZTRA 4HNVA 1ZQ3P 1Y1VJ 4AC0A 2ID3A 3QQAA 1JT0A 5K7HA 4JX5A 2G0EA 2XB5A 2CUFA 4A3GJ 1X2MA 2NOGA 1FEXA 2LFBA 1VF9A 2XGDA 4A69C 3LOCA 4C2MJ 1JKPC 5GPAA 3BG5A 1MBGA 2CU7A 1ENHA 3ZQGA 3GTOJ 1VFCA 1MH3A 4Y7NJ 4JYKA 4MLOA 3GTQJ 3ZOBA 2Y9YA 5M5WJ 3BQZA 2EZLA 2E19A 1S7EA 4JX6A 3TEDA 2JK3A 3O8HA 1VNDA 1QVTA 4A3EJ 4XICA 3GTPJ 1Z77A 1JGGA 4J19A 5IP6A 2ECCA 2MGQA 1GV2A 1F36A 1PUFA 1FJLA 1POGA 4BXXJ 3IH3A 2QF7A 5K7ZA 3SDGA 3PO3J 2O8KA 3MKLA 2FQ4A 1HDPA 2H1KA 1NK2P 1TWGJ 1X58A 1AHDP 2NS7A 1Z0XA 5E3NA 1GV5A 3OIOA 1NK3P 2MW8A 1UMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYC B;  5IP9 J;  5IYD J;  1JKR C;  1U9O A;  3HGG A;  1B8I A;  3Q0W A;  3HKZ N;  3TW7 A;  3JRA A;  1JUS A;  1ZR2 A;  3LSP A;  1U78 A;  2LP0 A;  3UKG A;  3Q0U A;  3HOV J;  3IH4 A;  4AYB N;  3BR3 A;  2LKX A;  2H8R A;  3JRG A;  2LLK A;  4M3D A;  2Y2Z A;  2VKE A;  3Q0V A;  3HM5 A;  3H0G J;  1D5Y A;  4BY7 J;  3GTL J;  5FKN A;  3OSG A;  1JTX A;  3BR1 A;  3CMY A;  2L0K A;  1HDD C;  2XPU A;  1GDT A;  2ELK A;  3I4M J;  2ME0 A;  4GFB A;  4B3A A;  2X6O A;  5GP9 A;  4A3M J;  1YRN A;  2L7Z A;  3G1L A;  3HBL A;  5E3M A;  1ETV A;  4XRM A;  1P7I A;  2XPV A;  5E3O A;  3WHC A;  3BTC A;  1XC5 A;  4FE7 A;  3GTG J;  4FTH A;  4D7M A;  3G1O A;  1BW6 A;  3BQY A;  3S1M J;  4UUS A;  1GVD A;  3B6C A;  3CQZ J;  5EG0 B;  3LNQ A;  3BG9 A;  4XK4 A;  4C3H J;  3HOZ J;  2R93 J;  5C44 J;  3BR5 A;  5FKL A;  2DA1 A;  4M3E A;  5IP7 J;  2NVQ J;  1OCT C;  2VPR A;  3HOU J;  2DA3 A;  5EF6 A;  2CQX A;  1SFO J;  3D1N I;  5FKO A;  3WHB A;  2PMZ N;  2MG4 A;  1K61 A;  4A3I J;  2OF7 A;  1BW5 A;  3GTM J;  5EEA A;  1ETK A;  1MBJ A;  1ETY A;  1XG1 A;  3F0C A;  5EGO A;  2K9N A;  2JA5 J;  2XSD C;  2CRG A;  2N8G A;  2GM4 A;  3CCY A;  2DA4 A;  1LFB A;  2VI6 A;  2R5Z A;  3OOU A;  2LVS A;  2X9D A;  2M0C A;  1HF0 A;  1WH7 A;  2ME6 A;  1LE8 B;  2MSY A;  4I6Z A;  4M6V A;  4A3B J;  5F0F A;  4MO7 A;  5J1U A;  2EZH A;  1MBE A;  2K40 A;  1AKH A;  2JA6 J;  2K9Q A;  2Y31 A;  5M5Y J;  1G2H A;  2KDZ A;  2XRL A;  3L1P A;  3S1Q J;  4X6A J;  3BTL A;  4A3J J;  4EEF G;  3A01 A;  5DS9 A;  3ZQC A;  5F27 A;  4FE4 A;  1IC8 A;  1IV6 A;  1WCM J;  2DN0 A;  2YS9 A;  3RZD J;  4IHW A;  1ZR4 A;  1HOM A;  2W48 A;  1QVU A;  4XRS G;  4BKX A;  5FKM A;  1IJW C;  1WPK A;  4XRS A;  2HXI A;  2O7O A;  1HLV A;  1ORK A;  1P7J A;  3FK7 A;  2DMU A;  1UHS A;  3JR9 A;  4DZP A;  2M8G X;  1R9T J;  3CDL A;  2L9R A;  1T33 A;  2D5V A;  2NVT J;  3SJM A;  2ID6 A;  2VUM J;  4V2G A;  3JRE A;  5M3F J;  3TP0 A;  2GBY A;  4NDL A;  1SAN A;  2HDD A;  2CJJ A;  2KT0 A;  4MIM A;  1B72 A;  1JTY A;  1U9N A;  2HOA A;  3TW6 A;  3K2A A;  1JJ8 C;  3S16 J;  1MH4 A;  2NS8 A;  5EZG A;  2HI3 A;  2Y30 A;  1FIP A;  1FIA A;  4G12 A;  4IEJ A;  5M5X J;  1JUP A;  1RKT A;  2DA5 A;  2WAQ N;  2HXO A;  3B6A A;  4DZJ A;  1ETO A;  3VPR A;  3K7A J;  4D5C A;  4C3I J;  9ANT A;  3GTK J;  1DU6 A;  3JRI A;  5K7F A;  1T56 A;  4D5F A;  3S17 J;  4JP0 A;  3BT9 A;  3MVP A;  2CUE A;  1H88 C;  3BR2 A;  5C4J J;  2M34 A;  1E3O C;  1MBH A;  2CQQ A;  2EBI A;  3IH2 A;  4QTR A;  2HOT A;  1ETW A;  3BTJ A;  3ZQF A;  1FTZ A;  4JX4 A;  1MNM C;  3O8G A;  5JLW A;  2M2E A;  3HGY A;  1JKO C;  2JA8 J;  5F1J A;  3A01 B;  2XGE A;  1DU0 A;  3JRC A;  3HOW J;  4FCY A;  2LY9 A;  3FKI J;  1LFU P;  4V2F A;  3PO2 J;  4ABZ A;  1RET A;  1ITY A;  1I50 J;  1PUF B;  2XPW A;  4XID A;  3S15 J;  3NAR A;  3DEW A;  3A02 A;  1MSE C;  3C2B A;  5IYB J;  1W0U A;  1OFC X;  2P81 A;  4DW6 A;  4LOC A;  4RBO A;  3LSJ A;  4DYC A;  1W0T A;  1RES A;  3M3Y J;  4CYC A;  4QSH A;  2ECB A;  3PM1 A;  2R5Y A;  5C4X J;  1ETQ A;  3BR0 A;  1B8I B;  2JWT A;  4RDU A;  4L5E A;  1F43 A;  5IYC J;  2EZK A;  3H3V K;  4A3C J;  1ZK8 A;  1JKQ C;  5C3E J;  1H89 C;  1I3Q J;  3M4O J;  1Y1W J;  3JRD A;  3G1M A;  2E1O A;  3ZQH A;  2E2H J;  3S2H J;  2YUS A;  1MBF A;  1ZKG A;  2COB A;  2Y9Z A;  2QCO A;  2JJ7 A;  2DMT A;  1VI0 A;  5J1R A;  4IHX A;  3DCF A;  1IUF A;  1TWC J;  3MN2 A;  2RAE A;  5GPC A;  5FLM J;  3BTI A;  3IV5 A;  1JJ6 C;  3NAU A;  1TWF J;  2LR8 A;  5EZH A;  2E2I J;  1YRN B;  3S2D J;  3HOX J;  2L7F P;  4BY1 J;  2M9H A;  1OJL A;  3LSG A;  3S14 J;  4UUT A;  2XGC A;  4FIS A;  3BG3 A;  3Q3S A;  2IBD A;  5F0H A;  4QIW N;  4W1U A;  2AO9 A;  4A3L J;  1AU7 A;  4UUS B;  2DA7 A;  1O4X A;  1X2N A;  1BA5 A;  3RKQ A;  1RKW A;  4MFE A;  5EYR A;  3FIS A;  1BL0 A;  5EG0 A;  3GBG A;  2B63 J;  1ZGW A;  1IG7 A;  5FKK A;  1FTT A;  2DJN A;  1JT6 A;  3S1R J;  3QPL A;  1UG2 A;  1A5J A;  5J3L A;  3ZQL A;  1APL C;  1Q1V A;  3JRB A;  4BBR J;  2HOS A;  4C3J J;  4Y52 J;  1TWA J;  4M3G A;  2LD5 A;  2R92 J;  2NVY J;  1EF4 A;  2AHQ A;  5F04 A;  3FK6 A;  2HYJ A;  3A03 A;  2Y0S N;  1HCR A;  1I6H J;  2K9S A;  1NTC A;  1CQT A;  3I4N J;  2R7Z J;  4M3F A;  1JUM A;  2XB0 X;  4DYR A;  2DMQ A;  5M3M J;  4IHV A;  1TWH J;  2X48 A;  5EGO B;  2DA2 A;  1MSF C;  3QPS A;  4A3D J;  2DMN A;  1TC3 C;  2R5Y B;  1BJZ A;  5IOY A;  2WB1 N;  2VKV A;  3W6V A;  5IOZ A;  5F0C A;  2GLO A;  2DTZ A;  4IHY A;  3RQI A;  2R5Z B;  2E2J J;  1GT0 C;  2HQ5 A;  1IDY A;  4I76 A;  2DA6 A;  2FX0 A;  1XS9 A;  5JLX A;  1LE8 A;  2WV1 A;  1ETX A;  5E3L A;  2O9L A;  1AKH B;  5EDN A;  3JRF A;  2I10 A;  5FJ8 J;  1RR7 A;  3E7L A;  3HDD A;  1A6I A;  1K83 J;  1IGN A;  2LTP A;  2EQR A;  2TRT A;  2ZB9 A;  5F08 A;  3S1N J;  1WGX A;  5DTD A;  3HB9 A;  4D7N A;  2NVX J;  2JN6 A;  4A3F J;  5J1Y A;  2DMP A;  3JRH A;  2OPT A;  3BR6 A;  3HEF A;  2FD5 A;  4B4C A;  4MFD A;  1WI3 A;  2LK2 A;  4A93 J;  2R0Q C;  1QRY A;  1OCP A;  1GUU A;  4X1E A;  4A3K J;  4BBS J;  3GTJ J;  2EZI A;  1IDZ A;  3ZQI A;  2FJ1 A;  5FLV A;  3HOY J;  3RZO J;  1QPI A;  3OSF A;  1MBK A;  3FIW A;  3SFI A;  4AUX A;  1B72 B;  5HOD A;  2YU9 J;  4B1R A;  2IEK A;  2IAI A;  5BNG A;  1H8A C;  3LSR A;  2JA7 J;  4W97 A;  2JMW A;  4S0H B;  2L7M P;  2TCT A;  5IPA A;  2EH3 A;  1U8B A;  1WH5 A;  1IRZ A;  4M3B A;  3TP3 A;  4DYQ A;  1RPW A;  1ZTR A;  4HNV A;  1ZQ3 P;  1Y1V J;  4AC0 A;  2ID3 A;  3QQA A;  1JT0 A;  5K7H A;  4JX5 A;  2G0E A;  2XB5 A;  2CUF A;  4A3G J;  1X2M A;  2NOG A;  1FEX A;  2LFB A;  1VF9 A;  2XGD A;  4A69 C;  3LOC A;  4C2M J;  1JKP C;  5GPA A;  3BG5 A;  1MBG A;  2CU7 A;  1ENH A;  3ZQG A;  3GTO J;  1VFC A;  1MH3 A;  4Y7N J;  4JYK A;  4MLO A;  3GTQ J;  3ZOB A;  2Y9Y A;  5M5W J;  3BQZ A;  2EZL A;  2E19 A;  1S7E A;  4JX6 A;  3TED A;  2JK3 A;  3O8H A;  1VND A;  1QVT A;  4A3E J;  4XIC A;  3GTP J;  1Z77 A;  1JGG A;  4J19 A;  5IP6 A;  2ECC A;  2MGQ A;  1GV2 A;  1F36 A;  1PUF A;  1FJL A;  1POG A;  4BXX J;  3IH3 A;  2QF7 A;  5K7Z A;  3SDG A;  3PO3 J;  2O8K A;  3MKL A;  2FQ4 A;  1HDP A;  2H1K A;  1NK2 P;  1TWG J;  1X58 A;  1AHD P;  2NS7 A;  1Z0X A;  5E3N A;  1GV5 A;  3OIO A;  1NK3 P;  2MW8 A;  1UMQ A; 
#chains in the Genus database with same CATH topology
 1Z05 A;  2MD0 A;  2H94 A;  4CCJ A;  2W84 A;  5K5Q A;  2VQG A;  5D6F A;  1B8I A;  2V9P A;  1WKM A;  2RQQ A;  3O6B B;  3MMY B;  3TW7 A;  4C9Y A;  3AL0 B;  1JUS A;  2LDU A;  3A4C A;  2ZFW A;  3OYA A;  2MAB A;  4UHT A;  3L2R A;  2STW A;  5JVG F;  2CV2 A;  2CW7 A;  2HOE A;  1I6X A;  4EMS A;  2K9M A;  2DFF A;  3UKG A;  1UST A;  3IH4 A;  4AYB N;  3BR3 A;  1R22 A;  2DI3 A;  3H5N A;  3K69 A;  3Q0V A;  3HM5 A;  3H0G J;  3D0S A;  4BY7 J;  2MH9 A;  1D5Y A;  3GTL J;  3J7Z I;  1KA8 A;  3PNV A;  3BCA A;  2E34 A;  1ZN2 A;  3BR1 A;  3FMR A;  1RNL A;  3CMY A;  3DPU A;  3ABU A;  4XOT A;  3IWF A;  2V9K A;  4F92 B;  5B3S H;  1I3A A;  4UVC A;  1GDT A;  3K4L A;  3I4M J;  4MGR A;  2E35 A;  1IXS B;  2DT6 A;  1D1C A;  4GFB A;  4A3M J;  4M9Z A;  4ZYA A;  3G1L A;  3HBL A;  4RGU A;  3S3M A;  2IA0 A;  5CVR A;  3H9J A;  5ERI A;  3EUH A;  3ZMD A;  5E3O A;  4N4O B;  4HNU A;  1P92 A;  3KZZ A;  2WAE A;  3K70 C;  1BW6 A;  2V7F A;  4XLC A;  5GAD J;  2L54 A;  3QU3 A;  3X2Q H;  2H6C A;  1J75 A;  5EG0 B;  3LNQ A;  3BG9 A;  4XK4 A;  2DFI A;  2XUB A;  4IVN A;  2NVQ J;  2VPR A;  3CJT B;  2CS3 A;  5EF6 A;  2OQG A;  3D1N I;  2R7X A;  3WHB A;  4FET A;  1IZ1 A;  3WTX C;  3I53 A;  2MG4 A;  2XAS A;  4A3I J;  1FOW A;  3NWT A;  2RRE A;  3M1C A;  2OF7 A;  1BW5 A;  1Y0N A;  4BQO A;  3BG6 A;  2DQR A;  5EEA A;  1MBJ A;  1ETY A;  1BOB A;  2BBY A;  3BP8 A;  3F8N A;  1I1G A;  2B7E A;  3T8R A;  3HHH A;  3MFK A;  1LNW A;  1OQY A;  2K9N A;  2JA5 J;  4UY8 I;  2RKH A;  3DXJ F;  2AS5 F;  4P96 A;  2WWY A;  1AOY A;  4GRI A;  3TQN A;  2XAH A;  3FXR A;  1R1V A;  1BI2 A;  2IXS A;  2F5E A;  2VBZ A;  3FX3 A;  3R60 A;  5FB2 A;  1LFB A;  5E1Z B;  2R5Z A;  2WY8 Q;  1MJB A;  2X9D A;  4ZDL A;  4UNO A;  1BI1 A;  1B59 A;  3CUQ B;  3MZH A;  2MSY A;  1Y8Q B;  2FBK A;  3W3C A;  4B09 A;  4RA2 A;  2IT0 A;  2DTR A;  1Q1H A;  5J1U A;  1PUE E;  2QA4 I;  3GCM A;  2K9Q A;  2JA6 J;  1VQ4 I;  3GEZ A;  2XRL A;  3L1P A;  1KYW A;  4I01 A;  5LRS A;  3BTL A;  5DS9 A;  3GVA A;  4IHW A;  2JRT A;  1HOM A;  1LQ1 A;  1WJB A;  2Q0O A;  4GDF A;  1S6L A;  4R79 A;  2Q2E A;  4HAM A;  4XRS A;  2HXI A;  2O7O A;  1SFE A;  1YW9 A;  2MLG A;  3F8B A;  3CZ6 A;  3FK7 A;  1JGS A;  1YIJ I;  3JR9 A;  5KHD A;  3KET A;  1MKM A;  5LHG A;  3CDL A;  4C2T A;  4BXF A;  1T33 A;  2VKD A;  3OV8 A;  3SJM A;  3F72 A;  1NG7 A;  2CQ7 A;  1OCZ H;  2QSH X;  1R4M B;  2P6S A;  1TLH B;  3ABL H;  4XN3 A;  1XN7 A;  2BY3 A;  2K86 A;  2XV4 S;  4G7O F;  2HNH A;  4MIM A;  4XKV A;  3OYF A;  3T8T A;  2H27 A;  1U9N A;  3K1P A;  3TW6 A;  4B47 A;  4CCO A;  1GHC A;  5EJC A;  3E3V A;  3GME A;  4IEJ A;  5M5X J;  3K0L A;  2J5P A;  1R5G A;  4BXU A;  3I9V 2;  5GAH J;  3B6A A;  3KYD B;  3VPR A;  9ANT A;  2FA5 A;  4L9V A;  2X4H A;  5F64 A;  3ZGK A;  4CCK A;  1R4N B;  1BI3 A;  3H5R A;  4D5F A;  4JP0 A;  3MVP A;  1H88 C;  1UAA A;  2QQ9 A;  4ENN A;  3R6S A;  5DV5 A;  2EBI A;  3E6C C;  1OCC H;  2V6C A;  1P4W A;  1XMK A;  1W36 C;  1SVO A;  2Z16 A;  4I09 A;  3LA2 A;  2XSJ C;  1KON A;  1FC3 A;  1W5C C;  3CCR I;  2YSR A;  2NS0 A;  1YHQ I;  3IRQ A;  3R61 A;  2EV0 A;  4BJ6 C;  4LLN A;  1LPQ A;  1SFU A;  3MWM A;  1DP3 A;  1YI2 I;  4LIV A;  2ZJR F;  4BNC A;  3A01 B;  4OWR B;  3DEE A;  2VE8 A;  1JI8 A;  1TQP A;  2KRF A;  4IOA F;  3E0J B;  2XAJ A;  3VOE A;  1FBS A;  2K4J A;  5L3G A;  5BMZ A;  1O57 A;  4ESB A;  5HS8 A;  2DOA A;  1XD7 A;  2DT5 A;  3LST A;  3PO2 J;  4Y13 A;  3L7W A;  3KEO A;  2CO5 A;  1Z6T A;  3KP6 A;  1ZLK A;  4B48 A;  3S15 J;  1UJ8 A;  2E1N A;  4RAY A;  5IYB J;  1W0U A;  3I71 A;  2QQ8 A;  1BR1 A;  4DW6 A;  2XAF A;  3BOQ A;  4JOM A;  4DYC A;  3OYH A;  4PJ0 C;  3M3Y J;  4RAG A;  4QSH A;  2ECB A;  1WRJ A;  2LF7 A;  3BJ6 A;  1MIJ A;  2R5Y A;  1O7L A;  1IAW A;  1B8I B;  3SZP A;  2Y75 A;  2HR3 A;  5CKT A;  4BQN A;  2Z33 A;  1Z7L A;  2CMP A;  2EZK A;  2R7W A;  2P4W A;  2HTJ A;  4Y17 A;  3KCC A;  4PGH A;  3RJP A;  3JRD A;  4XLE A;  3CF5 F;  3PQJ A;  2L9N A;  2E1O A;  4MTD A;  4I99 C;  4ZH4 F;  3TMO A;  2COB A;  3RYP A;  3HRT A;  4ZJZ A;  2KLO A;  1VI0 A;  2ELJ A;  2P6T A;  2Z3Y A;  3WOD F;  5J1R A;  1BJA A;  3S3O A;  3QAH A;  4YFK F;  1PP7 U;  1IUF A;  1F1Z A;  2CW8 A;  4ZZD A;  4XL9 A;  5GPC A;  5FLM J;  2CUJ A;  1TWF J;  4LB6 B;  2ZXH A;  3CCU I;  2VL8 A;  3RTR A;  1OKR A;  1T8I A;  3S2D J;  4EM1 A;  2ZJ2 A;  2QGU A;  2XRO A;  4KIF A;  2LNB A;  3H3Z A;  3Q3S A;  4QIW N;  4W1U A;  4A3L J;  1AU7 A;  2WB1 A;  4I7H A;  5H2F C;  3HKZ A;  2PLY A;  3GBG A;  2IS4 A;  2B63 J;  2ETH A;  1IG7 A;  3WG7 H;  3S1R J;  3A0B C;  3WGG A;  4AIH A;  1DUX C;  3JTG A;  2KP6 A;  1MNE A;  2FXA A;  2BY1 A;  4BBR J;  1TL8 A;  1Z3Y A;  1TWA J;  1YX5 A;  3FXM A;  5FGM A;  4M3G A;  3QOE A;  4ON0 A;  2LD5 A;  2R92 J;  2NVY J;  5EEG A;  2RNG A;  3U1K A;  1V3F A;  3L2Q A;  1YJN I;  3QPH A;  5D8L B;  1VZ0 A;  1BC7 C;  2R7Z J;  1IUY A;  4DYR A;  4HOB A;  2MC3 A;  4I2O A;  1E0E A;  3HSF A;  5M3M J;  3CME I;  4IHV A;  2DA2 A;  2ZME C;  5B1B H;  4A3D J;  1N78 A;  5K1Y A;  5E8I A;  2WB1 N;  3ELK A;  2VKV A;  3W6V A;  2V79 A;  3QRF F;  5AIQ A;  1FSE A;  4IHY A;  1T0F C;  1QO0 D;  2EIL H;  2R5Z B;  1O3R A;  2KFD A;  3I5U A;  5J4V A;  3MKY B;  4OMY A;  1IDY A;  3M8J A;  3HOS A;  1HW1 A;  4CUG A;  1LE8 A;  4CZC A;  3L00 A;  1ETX A;  4MEY F;  2I10 A;  4E4H A;  2VIX A;  1O3T A;  3I3L A;  2VJ5 A;  2YX7 A;  4CA0 A;  3M8E A;  2K5C A;  4A0X A;  3HRS A;  3HTS B;  1P9Q C;  2LTP A;  4FQG A;  3J80 Z;  3I64 A;  3S1N J;  2XAG A;  2OJE D;  3AG2 H;  3B02 A;  3W2A A;  3HB9 A;  2VJ4 A;  2JN6 A;  2TDX A;  3BG7 A;  2NRA C;  3K4B A;  1C0W A;  2Q2E B;  3C2G A;  3I56 I;  3CD6 I;  3OYK A;  2MH2 A;  1TW2 A;  1KU9 A;  2OPT A;  3JRH A;  1SEU A;  1BBY A;  4WX9 A;  4MFD A;  1WI3 A;  2ZO4 A;  3DLA A;  2R0Q C;  2KIS A;  2VOO A;  3HIF A;  3RPU A;  3PIP F;  4BBS J;  4XOR A;  2GQQ A;  4IQJ A;  1LDK B;  2EZI A;  3ZQI A;  3HPG A;  3DU5 A;  2L9V A;  3HOY J;  3RZO J;  3OSF A;  1WJD A;  3SFI A;  2CSO A;  2XKP A;  1SD6 A;  3SQN A;  3VYU B;  4EJU A;  2F5V A;  1J7K A;  2FF4 A;  4J01 A;  1GXQ A;  3SZG A;  3VWB A;  3I4P A;  2BY2 A;  3BDD A;  1E3H A;  4NC7 A;  4S0H B;  2KIF A;  2QQA A;  1V54 H;  3PNT A;  3ZQQ A;  2PBI A;  3DU6 A;  3BRO A;  4P1W A;  4DYQ A;  1OYY A;  4XLA A;  1Y1V J;  1VQO I;  3RKX A;  4DJA A;  4MHG A;  3ZP5 A;  2G0E A;  1WVR A;  1JXS A;  2DJI A;  2XB5 A;  4ZDO A;  5K5R A;  1X1P A;  4A3G J;  5FRM A;  3MQ0 A;  4IHT A;  3QU6 A;  2LFB A;  3L2V A;  3GF2 A;  1JKP C;  3QP5 A;  5GPA A;  3BG5 A;  1IN8 A;  1IRX A;  2VXD A;  1ENH A;  3CP8 A;  1R58 A;  3OR2 C;  4JYK A;  1S9H A;  3QP6 A;  4MLO A;  2M4K A;  3ZQ7 A;  2L01 A;  3CMA I;  4NQW A;  5M5W J;  3BQZ A;  1UEL B;  2V1N A;  1VQ6 I;  3HRU A;  2G9W A;  3K4J A;  3LWF A;  1FWZ A;  2X0L A;  2ZSI B;  2E19 A;  3WTV C;  3S93 A;  4EGY A;  1TBX A;  1J9I A;  2K4B A;  1VND A;  4XIC A;  1YO5 C;  2R7R A;  3GTP J;  2JSC A;  4KIB A;  3CCJ I;  4J19 A;  2L02 A;  5IP6 A;  1MMD A;  1ULY A;  3SEZ A;  1F36 A;  3IH3 A;  2QEN A;  2QF7 A;  4HQM A;  4E7L A;  3BZC A;  3PJR A;  1HDP A;  2H1K A;  1WJ5 A;  2R7O A;  3N97 A;  2HZT A;  1TWG J;  1U8R A;  1X58 A;  2R7Q A;  2JUG A;  5A2Q Z;  4A5N A;  1NK3 P;  1GV5 A;  5DEQ A;  4XQF A;  2M45 A;  2EFW A;  3G3Z A;  2MW8 A;  1UMQ A;  3W2V A;  2QBY A;  1OCR H;  3A0H C;  5IP9 J;  5IYD J;  1JKR C;  1KU2 A;  1U9O A;  1Z67 A;  3HGG A;  1MDM A;  4YFX F;  3J81 K;  5TRD A;  3Q0W A;  2HQA A;  3LFK A;  1ZAO A;  3K9T A;  4HX4 A;  2BXY A;  2ZSH B;  2F5C A;  2HWV A;  3HHG A;  3RI4 A;  4FAS D;  2H8W A;  1T38 A;  2R7T A;  3E5X A;  4E7K A;  2HYG D;  3BJA A;  2K3P A;  2O03 A;  2KMU A;  4ZTF A;  2LKX A;  2D1V A;  2H8R A;  2GWR A;  1S29 A;  2LLK A;  3E1S A;  4M3D A;  3K10 A;  4N9H A;  2UZK A;  2XF7 A;  3OSG A;  1VQ7 I;  3CES A;  3HL2 A;  1GXP A;  4U88 A;  4CH7 A;  4N9I A;  2L0K A;  2LH9 A;  5AIP A;  3WTT C;  1MMA A;  2ZNY A;  2XPU A;  3GX4 X;  2DPU A;  1P2F A;  3JAM Z;  4L9J A;  1M1E B;  2QYO A;  1IXC A;  5GP9 A;  1V5G A;  2L7Z A;  4KUM A;  3SDB A;  3CCM I;  2JRM A;  1XC5 A;  4FE7 A;  1EA3 A;  1X1C A;  4F91 B;  3ML6 A;  3GTG J;  3G1O A;  3LMM A;  1ZG1 A;  3GFI A;  2CFO A;  1B9M A;  2F48 A;  3DTK A;  2Y0M A;  5CVV A;  2ZNZ A;  1GVD A;  3V8L A;  1B1B A;  3CQZ J;  4ENJ A;  2FNP A;  1YS7 A;  5LHH A;  4C3H J;  1BIA A;  2PJP A;  2O3F A;  2Z99 A;  5ILU A;  5C44 J;  2JA2 A;  1MZB A;  3ASO H;  2V1D A;  3EQL F;  3LL7 A;  5FKL A;  2DA1 A;  1QQI A;  1HKQ A;  4S04 A;  3FXK A;  4HV5 A;  1HKS A;  5FKO A;  2PX9 A;  2BVM A;  2X6Y A;  3OWT A;  1AA7 A;  3KE2 A;  3T5X A;  1F5T A;  3R0A A;  1YQA A;  3JW4 A;  3IAM 2;  2QVO A;  1IW7 F;  1XG1 A;  3F0C A;  1YIT I;  5EGO A;  5F6F A;  3DKW A;  2V6E A;  1UG0 A;  2D45 A;  2W25 A;  4CCL A;  3OYD A;  4RM3 A;  1FNN A;  1XMX A;  4PCQ A;  4CGZ A;  4O6J A;  4AM3 A;  5FRN A;  1STZ A;  2Y69 H;  2GM4 A;  2MD5 A;  3CCY A;  3IHU A;  1XSX A;  1WFX A;  2DA4 A;  2X1D A;  2O61 A;  1B6A A;  2JSP A;  2VI6 A;  2K85 A;  1X1A A;  3OOU A;  3K4C A;  4NNJ A;  4X0G A;  1WH7 A;  4XKB A;  2ME6 A;  1LE8 B;  6PAX A;  2OBP A;  2RN7 A;  2P0W A;  1IO2 A;  1J59 A;  3H92 A;  5F0F A;  4GGG A;  4MO7 A;  1AKH A;  2EZH A;  2K40 A;  4HYE A;  3WTS C;  2ISZ A;  3WTW C;  3PSF A;  1H9T A;  3S1Q J;  1FSH A;  2GOX B;  3GZ5 A;  3F23 A;  3KEQ A;  3IKT A;  3A01 A;  4A3J J;  5F27 A;  1IV6 A;  1QZY A;  1A6Q A;  1WCM J;  1ZYR F;  3F9K A;  1TQM A;  3FHN A;  4OU0 A;  2UUZ A;  3GYH X;  2BE5 F;  1U3E M;  2W48 A;  1LKX A;  2F2E A;  2H6B A;  4IOC F;  2KRC A;  3QPT A;  1WPK A;  2DU9 A;  4IZZ A;  3QOD A;  5KAF C;  5D4S A;  3OIP A;  3ABK H;  1LDD A;  4HA8 A;  1ZRF A;  2P7C B;  2DMU A;  2IP2 A;  2LG4 A;  4DZP A;  5CPR B;  4BE2 A;  4QPQ A;  1LJ9 A;  3UR3 C;  2D5V A;  2VUM J;  2CQK A;  5JHU A;  5M3F J;  2ZXI A;  2H1L A;  3H9Q A;  2GBY A;  5D8K B;  1SAN A;  2HDD A;  3FDY A;  4UUV A;  1R23 A;  1W36 D;  1L0O C;  2MA3 A;  2GIZ A;  1JTY A;  1B72 A;  2HOA A;  3V8J A;  1USS A;  3K2A A;  3ZCO A;  3HYI A;  2NS8 A;  2A5W A;  2M5W A;  5EZG A;  1FIA A;  2XF5 A;  3J7A Y;  2CUZ A;  4Y33 A;  2ADU A;  3HUG A;  2A61 A;  4EV0 A;  1TP4 A;  2VJI A;  4C3I J;  2DFE A;  4YEL A;  3DTE A;  3CC2 I;  4KA4 A;  5LD2 C;  1T56 A;  4AID A;  4RB3 C;  1PDN C;  4N0B A;  2CUE A;  3KP3 A;  3NRV A;  3RPQ A;  4LFU A;  5C4J J;  2M34 A;  2MYS A;  1W4M A;  4YRV A;  2XDV A;  1BM9 A;  2D2W A;  1CF7 B;  3KLN A;  4YIF A;  2ESN A;  2ZXW H;  4JX4 A;  1MNM C;  3TO7 A;  1VQ8 I;  2VPL A;  3DWL E;  2QM3 A;  2RNJ A;  4BH9 A;  1TT5 B;  2R4G A;  3BC8 A;  2FOW A;  4NQW B;  4EM2 A;  2CYY A;  2JPB A;  2K3F A;  1PJR A;  1ZHF A;  1U5T A;  1KZH A;  1I5Z A;  3BPX A;  1DU0 A;  1QNT A;  1VQ9 I;  2E7X A;  2PG4 A;  1WQ2 A;  2WBM A;  4FCY A;  4FX4 A;  4M71 A;  2LY9 A;  1XGN A;  1LFU P;  1LB2 A;  1KQ8 A;  3HTU A;  3U21 A;  1RET A;  4EM0 B;  1E17 A;  4GCV A;  1DQU A;  2IGN A;  2XPW A;  4B44 A;  1Z91 A;  5FRO A;  2V9V A;  3DEW A;  4HV6 A;  1V55 H;  4L9T A;  4M9S A;  4HF1 A;  1IN5 A;  2FRH A;  2P5L C;  3FXQ A;  2L9S A;  2V1X A;  1RES A;  2QBY B;  4ITV A;  4CYC A;  1N75 A;  2BW3 A;  2BY0 A;  5JFR A;  1MDM B;  1ETQ A;  3VYT B;  2XGX A;  4RDU A;  2VXZ A;  4H4K C;  1SVM A;  3KFW X;  3U1D A;  2HKO A;  2AXL A;  2QSF X;  5IYC J;  4A3C J;  1ZK8 A;  1JKQ C;  1D1A A;  3G73 A;  5CYV A;  1XSD A;  4HNT A;  4WXD A;  2ZKZ A;  3S2H J;  2YUS A;  4OAY A;  4E7H A;  1MBF A;  3CTA A;  2HEO A;  2DOD A;  3PSI A;  4C30 A;  3RPU D;  2QCO A;  5E1W A;  3LFU A;  1PVE A;  3DCF A;  1VQL I;  1S7A A;  1TWC J;  3C18 A;  3MN2 A;  3L09 A;  1FYK A;  2RAE A;  3WTU C;  4TV7 A;  3IV5 A;  1JJ6 C;  3KZY A;  2PI0 A;  2EB7 A;  5J6X A;  1X4P A;  2M9H A;  4DBR A;  5DM6 F;  2W24 A;  3LSG A;  4D9J A;  3S14 J;  2XGC A;  3ZMZ A;  3CCE I;  4ENM A;  1P4X A;  4UVB A;  1BA5 A;  1RI7 A;  1RKW A;  1F4K A;  5TGT A;  5J4Y A;  1BL0 A;  3FHZ A;  4OIR F;  3DKY A;  2G7H A;  1O3Q A;  2OQR A;  3GFL A;  3WTZ A;  4RAZ A;  4UV8 A;  5DD8 A;  1JT6 A;  2P5K A;  3ZQL A;  4P9U A;  4HX8 A;  1Q1V A;  3JRB A;  4Y52 J;  3WTY C;  2MBF A;  4JQF A;  3B73 A;  2KZG A;  1KYZ A;  2MC4 A;  2VON A;  4YG2 F;  1ONV A;  3F8F A;  1Z9C A;  2AQE A;  3J80 K;  1HCR A;  3OOP A;  1I6H J;  5CVU A;  3OYG A;  1CQT A;  2EIK H;  3PUF A;  5FD5 A;  1T6S A;  3D5R C;  4M3F A;  4YII A;  4BDZ A;  1JUM A;  2DMQ A;  2EA2 A;  2L7K A;  2X48 A;  5EGO B;  5H6Q A;  1WI9 A;  2QWW A;  3JTH A;  4LIU A;  3KEY A;  3RQ4 A;  2CQN A;  2EFQ A;  2DMN A;  3WG9 A;  1G8X A;  2NAZ A;  5F0C A;  4MQV A;  3U9G A;  1GLN A;  3DBL B;  3RQI A;  1VQP I;  3PUB A;  2KQR A;  4MQ9 F;  1GT0 C;  3HPH A;  2M87 A;  2DA6 A;  2FX0 A;  2VBY A;  2V26 A;  4GYI A;  4YEJ A;  5JLX A;  3G71 I;  2WV1 A;  5E3L A;  1AKH B;  5IY5 H;  3O3K A;  1RR7 A;  4N4N B;  3TDU C;  2PEX A;  4U0Y A;  3E7L A;  2OTL I;  1WHU A;  1K83 J;  4F55 A;  1X3W B;  2W7N A;  1KU3 A;  2EQR A;  5DYM A;  3GFJ A;  4UB8 C;  2TRT A;  5F08 A;  2QSG X;  5DTD A;  3LA3 A;  1YJ9 I;  3FBN B;  4D7N A;  2NVX J;  1HBX G;  2O8X A;  3C7J A;  3DEU A;  2DOF A;  1CGP A;  3LSH A;  1ON1 A;  4Q48 A;  3M7G A;  1Y39 A;  3ONQ A;  2FD5 A;  4AU7 A;  3KYC B;  2LK2 A;  1JHF A;  4A93 J;  4M6X A;  1OCP A;  5HNF A;  4IX7 A;  1P6R A;  4A3K J;  1SD4 A;  4OAZ A;  3GTJ J;  3DBH B;  1IDZ A;  2IRF G;  1V4R A;  3IUO A;  3KP7 A;  4MEX F;  3DLL F;  2RV8 A;  1EH7 A;  3RSN A;  4RMN A;  1QPI A;  4ASN A;  2E1M C;  2ZFU A;  1D3Y A;  1DPU A;  1B72 B;  4G6D A;  2DW4 A;  4RAF A;  4Q5S F;  2IEK A;  3I59 B;  5BNG A;  1X3U A;  1H9G A;  2JTV A;  2JA7 J;  1YIO A;  3WGI A;  3BPV A;  4E7S A;  2TCT A;  5IPA A;  4AIJ A;  4KT5 C;  2LF8 A;  3OS0 A;  2FBH A;  2CW0 F;  2VC1 A;  3HUG B;  1U8B A;  5FFZ A;  4M9X A;  1WH5 A;  3I55 I;  3ZMS A;  2CG4 A;  3TP3 A;  3P9I A;  4XRF A;  1WJC A;  1YLF A;  4AC0 A;  4RGX A;  5ICF A;  1JT0 A;  5K7H A;  4HDV A;  1REP C;  1E3P A;  2JQ7 A;  2QEX I;  2DPD A;  4BJT A;  2CUF A;  4HDU A;  1X2M A;  2NOG A;  2EFP A;  4M74 A;  1VF9 A;  2XGD A;  1D5V A;  2JVG A;  1SAX A;  5IT9 Z;  3GZN B;  1FT9 A;  1FMV A;  1MBG A;  2F5D A;  1VQK I;  4G94 A;  2UWM A;  2LOO A;  2DK5 A;  2BV6 A;  1MH3 A;  4Y7N J;  1WWX A;  3DKX A;  1BIB A;  3M07 A;  1O3S A;  3IC7 A;  4CDG A;  2R7D A;  2HKX A;  1U5T B;  3EYI A;  3HRM A;  2HVS A;  5DUI A;  4H0E A;  5DCM A;  1S7E A;  2ZXJ A;  3GFM A;  3DP7 A;  4RB0 A;  1UHW A;  3TED A;  4BGD A;  5L3B A;  1YYV A;  3OMY A;  3OYN A;  3AAF A;  3RIR A;  4ZYG A;  1R1T A;  1XPX A;  4AWX B;  1JGG A;  1QZE A;  2ECC A;  2ZC2 A;  1GV2 A;  3VOD A;  1PUF A;  5K7Z A;  4NC8 A;  1FYM A;  1BC8 C;  3E6M A;  2O8K A;  2FQ4 A;  2WTE A;  1LEB A;  4BU2 A;  3ABT A;  3PQK A;  1AHD P;  3JAM K;  2E7W A;  1MND A;  5KK1 A;  1Z0X A;  3OIO A;  3BLY A;  2DOE A;  1K4S A;  4CYC B;  2E5Z A;  2BW3 B;  3V7C A;  1EJ9 A;  3F21 A;  4DNC A;  3JRA A;  3HKZ N;  2PJR A;  2I8D A;  4NC6 A;  2LY1 A;  4XSX F;  4BUP A;  2GOM A;  1HA8 A;  3Q0U A;  2VLA A;  1AWC A;  2KIQ A;  3AL0 C;  1ZGA A;  4HST A;  3TOB A;  5FKN A;  4IQ4 A;  1A36 A;  3GWZ A;  5E17 F;  1MMG A;  3GZ6 A;  4LLL A;  3GO5 A;  3IAS 2;  1XSV A;  2W4S A;  4RGS A;  2O5R A;  4FT8 A;  2PMZ A;  1UFM A;  2M8E A;  2ME0 A;  4BHB A;  1Z1D A;  3KP2 A;  4B3A A;  1G3W A;  1YRN A;  4XRM A;  5FO5 A;  5J40 A;  3T0Y A;  1P7I A;  3DPL C;  1UCR A;  3WHC A;  3BTC A;  2M7B A;  1FOK A;  1W7P D;  1R5I D;  3QYF A;  4D7M A;  4FTH A;  2ZJP F;  3BQY A;  4HRI A;  1YTY A;  3W2W A;  3KPH A;  4P55 A;  4UUS A;  3B6C A;  4I0B A;  5FLX Z;  2R93 J;  3BR5 A;  1F9N A;  3IL2 A;  4M3E A;  4QPO A;  3TOA A;  2H09 A;  1PP8 F;  2L4M A;  2AQF A;  3L9F A;  1K4T A;  1SFO J;  2NXN B;  3OYB A;  4UXN A;  2ZME A;  4OIN F;  3COA C;  2PMZ N;  4G6Q A;  4KT6 A;  3GTM J;  2HVQ A;  1ETK A;  2FSW A;  1Z3X A;  1T0F A;  1P4A A;  4KN4 X;  1HSJ A;  4O5V A;  4GYG A;  3RCO A;  2NNY A;  2CRG A;  2N8G A;  2HU9 A;  2PQ8 A;  2W85 A;  1Y6I A;  3HJE A;  2EIN H;  3MKZ A;  4AD9 A;  3F6V A;  2DQL A;  3CMM A;  3PFY A;  1CF7 A;  4NBQ A;  4PJL A;  3V7S A;  2L2O A;  2LVS A;  3ECO A;  1TZL A;  3AKZ A;  4AIK A;  4LMY A;  4M6V A;  4DOZ A;  3FF5 A;  1IV8 A;  1MBE A;  5J47 A;  3K6G A;  2VB6 A;  2KDZ A;  4ZYE A;  4X6A J;  4GXO A;  3FXU A;  2CWE A;  2QKL B;  1RZ4 A;  4KMU X;  4EEF G;  4DGW B;  2A69 F;  2O6G E;  3CUQ C;  3H36 A;  2HZD A;  3RZD J;  4XOP A;  1ZR4 A;  2KL4 A;  4C2U A;  2Y0S A;  1QHG A;  3CJQ B;  1IJW C;  4BKX A;  3OL3 A;  2KIM A;  1K6Y A;  2M1B A;  4D0P A;  3OYL A;  1IN6 A;  2ESH A;  4LD5 A;  5DD4 A;  5D4R A;  2R7S A;  1XB4 A;  3LSK A;  3MKW B;  4O3M A;  3QWL A;  2DLL A;  2L9R A;  4BAY A;  2FML A;  3VEP A;  2ID6 A;  4V2G A;  2DDB A;  3JRE A;  4ZYD A;  3G4S I;  3P9C A;  4RGR A;  4XON A;  1EV7 A;  2HPM A;  2CJJ A;  2KT0 A;  4HX7 A;  1SC7 A;  1FY7 A;  3WGH A;  3BZK A;  1V5F A;  1JJ8 C;  1L3L A;  3S16 J;  1MH4 A;  4BHC A;  4RB1 A;  2PMU A;  2HI3 A;  3HSR A;  4CYD A;  3CC7 I;  4KYW A;  4CCN A;  2F6C A;  4G12 A;  3K70 D;  1A35 A;  2P5V A;  3H35 A;  1JUP A;  1RKT A;  2DA5 A;  4E7I A;  2VQH A;  2HXO A;  3MZY A;  2CFX A;  3K7A J;  4D5C A;  4ESF A;  3MAJ A;  3H0D A;  3GTK J;  5BS6 A;  2F4O B;  2LKP A;  2EK5 A;  2VT2 A;  3VFZ A;  4UVA A;  3RYR A;  3S17 J;  3BT9 A;  1QHH D;  4ZDP A;  1FYL A;  3BR2 A;  4IO9 F;  2K9L A;  5JHF A;  3PNY A;  1E3O C;  3UNG C;  3IH2 A;  5DM7 F;  4QTR A;  1ETW A;  2FQ3 A;  3ZQF A;  3KYL A;  4XKC A;  1R49 A;  3FMQ A;  1OR7 C;  3O8G A;  4ETS A;  5JLW A;  2M2E A;  3HGY A;  5HLI A;  4WK8 F;  1G3S A;  4MTE A;  1HST A;  2A6T A;  4ZC3 A;  2NOJ B;  3E5U A;  2X6W A;  1ZRE A;  2BVL A;  2D1H A;  3LAP A;  4LIT A;  3WU2 C;  1TNS A;  4Q4Z F;  3GUD A;  1S8N A;  2OC6 A;  2YPR A;  5DCM B;  3V4G A;  3OYI A;  2B9S A;  2A07 F;  4DQ2 A;  3OYC A;  4RS8 A;  3R0J A;  2RDP A;  2IGM A;  2GXB A;  4B8X A;  5ED4 A;  4V2F A;  4K2E A;  2L5Q A;  2BHZ A;  4EGZ A;  1ITY A;  1I50 J;  1LUJ B;  1PUF B;  4ENK A;  4B3X A;  4XID A;  5JI6 A;  3A02 A;  4G8X A;  1MSE C;  3C2B A;  3W6J B;  3ECH A;  1YOV B;  2P81 A;  4LOC A;  2XC7 A;  3FWE A;  2DO7 A;  2WAF A;  5CVI A;  3MZ8 A;  3PM1 A;  5EEH A;  5C4X J;  2KIU A;  1D8J A;  2FNA A;  2JWT A;  4BJ5 C;  2PJR B;  1J09 A;  1F43 A;  5LHI A;  2LBF B;  2X85 A;  3OY9 A;  2MFZ A;  3H3V K;  3FXL A;  5KAI C;  5C3E J;  4L5I A;  1H89 C;  3M9A A;  2OAZ A;  5D5U B;  5D6E A;  1DGR M;  4IHS A;  1YX3 A;  3EDP A;  1HXD A;  1RR8 C;  3G1M A;  1I1S A;  1DP7 P;  3ZQH A;  2E2H J;  2X1C A;  4KDP A;  3BY6 A;  2ZJQ F;  3I54 A;  3PFI A;  2Y9Z A;  3G6E I;  4LGW A;  2JJ7 A;  3I0T A;  4DBQ A;  5ICG A;  4HLY A;  3SXY A;  3BTI A;  1B4A A;  2LR8 A;  5EZH A;  2E2I J;  1YRN B;  2OUM A;  2IGK A;  3VSL A;  3ABM H;  4HQE A;  2KDO A;  1QGP A;  3BG3 A;  4LJZ F;  4M73 A;  5F0H A;  1T2K A;  2LMD A;  4CO8 A;  4UUS B;  4D1Q A;  1O4X A;  1X2N A;  5LLQ A;  3RKQ A;  4MFE A;  2XRN A;  5EYR A;  2DYS H;  2EFO A;  3FIS A;  1RUO A;  3W6K B;  3EUH C;  4KMF A;  5L3C A;  2ELH A;  4YFN F;  4JBA A;  5D5V B;  1UG2 A;  3HG9 A;  1APL C;  2R7V A;  1R5H A;  4AYB A;  3I59 A;  1K7A A;  4F52 A;  5F04 A;  2V1U A;  2ZME B;  3FK6 A;  4HF0 A;  2HYJ A;  3A03 A;  1W7P A;  2XHK A;  1OYI A;  1ZH5 A;  2QKM B;  1S5L C;  2K9S A;  1NTC A;  2VOP A;  3TDZ C;  1KU7 A;  3ASN H;  1MW7 A;  4PJN A;  2RVC A;  3ROU A;  2GXA A;  1FLI A;  1QZZ A;  4KJZ A;  4LG3 A;  2KRH A;  1IRG A;  4JK1 X;  2V4J C;  3CCQ I;  1MSF C;  2EJR A;  1HW2 A;  1IF1 A;  1BJZ A;  5IOY A;  5IOZ A;  2UV1 A;  1Y56 A;  5TJJ A;  4WWC A;  2GLO A;  3A1Y A;  2STT A;  2VOD A;  2DTZ A;  4HSR A;  4AVZ A;  4M6Y A;  4ZYH A;  2Z9O A;  4II3 A;  1TQI A;  3WE2 A;  3MD2 A;  2PFB A;  1G3T A;  4I76 A;  1YJW I;  4UB6 C;  1XS9 A;  5HDK A;  3C3W A;  1BI0 A;  3G2B A;  2M7A A;  5HS7 A;  3EUK L;  5EDN A;  3JRF A;  1XCB A;  2HGC A;  3OL4 A;  3PL8 A;  5IT3 A;  2GXG A;  3ZMT A;  2OD5 A;  2IGO A;  3GLL A;  4A0Y A;  3PIO F;  1K79 A;  1R1U A;  3IRR A;  1JE8 A;  2ZB9 A;  3OR1 C;  1WGX A;  4XBF A;  1IXR C;  1JHH A;  4IXA A;  4S05 A;  5JR3 A;  2VC0 A;  1X3Z B;  4OOI A;  3NWS A;  3H1C A;  4A3F J;  5J1Y A;  1WSU A;  4BAC A;  2IA1 A;  2C6Y A;  5HVQ C;  4RB2 C;  3K1M A;  3BR6 A;  3HEF A;  3D5L A;  3TGN A;  4ANJ A;  5CQE A;  3J81 Z;  4HW0 A;  2DAO A;  1ZRC A;  4X1E A;  2RC4 A;  3VYR B;  2HVR A;  4XKW A;  5FLV A;  3EET A;  4A0Z A;  3ZPL A;  3N05 A;  2ZBK A;  5CVJ A;  1XTA A;  5IT9 K;  3CP2 A;  3FIW A;  5GAG J;  4PJM A;  3F6O A;  3H5A A;  3KZI C;  4B1R A;  4UV9 A;  2IAI A;  4A2U A;  3U2R A;  5HOO A;  4HPQ A;  4W97 A;  1IN7 A;  3HZJ A;  2ISY A;  3RKW A;  2VE9 A;  5BOX A;  2FUG 2;  4Z2Y A;  4FX0 A;  2L7M P;  4ZTJ A;  2F5F A;  1Y0U A;  4RM2 A;  1A31 A;  4XNF A;  2JPC A;  3OS1 A;  1FPQ A;  1MMN A;  1ZTR A;  1S72 I;  3LQQ A;  1D1B A;  2Q8K A;  3OYM A;  1U0J A;  2QQB A;  4PK4 A;  2HTS A;  5KCM A;  2ID3 A;  4BL0 B;  2X1E A;  2HDW A;  2OCC H;  4JX5 A;  4OIO F;  2YU3 A;  2XVC A;  3LSI A;  3F8C A;  1KQ9 A;  4XM3 A;  3FXO A;  4A5M A;  4CIC A;  1W1W E;  2FU4 A;  4A69 C;  3C1D A;  4C2M J;  2COM A;  5ICC A;  4NB5 A;  1B9N A;  4BEH A;  2CV0 A;  1SFX A;  3ZQG A;  4BYY A;  5JVT A;  1VFC A;  2Z5U A;  1HC8 A;  1K78 A;  2W1O A;  2K27 A;  4BHP A;  1BR2 A;  2Y9Y A;  3TBI A;  5HLG A;  3CCV I;  3FM5 A;  3J7A O;  1QBJ A;  3JCU C;  1MGT A;  3BCB A;  1SMT A;  3T1B A;  2XKO A;  3E6D A;  2LYC A;  4JX6 A;  1J2X A;  2BHY A;  3O8H A;  1QVT A;  1OLT A;  2DCE A;  3ZN0 A;  3DTI A;  2HYF A;  2DT7 B;  2KJB A;  4EQQ A;  2EV6 A;  1OCO H;  1POG A;  4IKF A;  4BXX J;  2VJJ A;  3PO3 J;  3MKL A;  3AG3 H;  4L9N A;  1NK2 P;  1FMW A;  2A6H F;  4PDK A;  3LQR A;  1XX5 A;  5E3N A;  1V5E A;  2QZ8 A;  3ZMV A;  2L4A A;  2OA4 A;  4G7H F;  3TKY A;  4HF2 A;  4F7Z A;  1QA6 A;  1U2W A;  2BYV E;  4PGG A;  2K7L A;  2CGP A;  4CSW A;  3DV8 A;  1XGM A;  1ZR2 A;  4OIP F;  5E20 A;  5FD6 A;  3LSP A;  2YR2 A;  2LP0 A;  3F3X A;  1U78 A;  5FLX K;  3HOV J;  4ZZL A;  5LGU A;  1MD0 A;  3S8P A;  2G7U A;  3V7R A;  3JRG A;  2IS1 A;  1YE9 A;  2VKE A;  2Y2Z A;  3CC4 I;  4L18 B;  2E1C A;  1J5Y A;  4WXC A;  3Q9V A;  1JTX A;  1D0Y A;  3LAJ A;  2FBI A;  1XCV A;  2MLK A;  3EPZ A;  3VSK A;  4XLF A;  4II2 A;  3QYB A;  1HDD C;  2F4I A;  2OU2 A;  4EAT A;  2ELK A;  3ZMU A;  3RKY A;  1FOY A;  3GLX A;  4WCG A;  2DXI A;  2GIV A;  1EH6 A;  2X6O A;  1ON2 A;  3K2Z A;  2XAQ A;  4EVI A;  5E3M A;  2K02 A;  1ETV A;  4LG0 A;  2XIG A;  2NYX A;  1BR4 A;  2XPV A;  4KIT B;  5KNL A;  3K4M A;  3QOP A;  4U7D A;  3S1M J;  5CLS A;  1DDN A;  3ERM A;  3P9K A;  3JSP A;  1U6G A;  4L0Y B;  3P5J A;  5J8F A;  3HOZ J;  4CZZ A;  1UHM A;  2BOL A;  3SEQ A;  2IW5 A;  4F93 B;  3OIQ A;  3SYT A;  2XAU A;  4IRH A;  5IP7 J;  1OCT C;  4Q47 A;  4Z6Y A;  3HOU J;  2EWN A;  2DA3 A;  3CCS I;  4DIQ A;  1FOX A;  2CQX A;  1T98 A;  1DGW Y;  1EH8 A;  1LVK A;  1TT0 A;  1W7P B;  2A6E F;  3TO6 A;  4NHJ A;  5ICE A;  1K61 A;  2M30 A;  3C2H A;  1XMA A;  1T08 B;  2Q1Z B;  3CDI A;  2VT3 A;  3L2C A;  4U7B A;  4I0A A;  1R6R A;  3ISP A;  2VBW A;  2LRE A;  2NVU B;  1ZEL A;  1YG2 A;  3GXO A;  2XSD C;  3IKV A;  2KKO A;  1SVL A;  4IPA A;  1NHA A;  3ZN1 A;  2FMY A;  2P8T A;  5D5X B;  2GA1 A;  4A6D A;  1D0Z A;  1RC9 A;  1ZRD A;  3AFH A;  5A2Q K;  2M0C A;  3OS2 A;  1HF0 A;  2HQN A;  1J0R A;  3ZRG A;  3J7Y J;  2PMH A;  4I6Z A;  3Q5F A;  3BWG A;  5LEK A;  4A3B J;  1ZG3 A;  4Y3O A;  5J8C A;  1FBU A;  1YS6 A;  2Y31 A;  2Y48 A;  4Y15 A;  5M5Y J;  3L2U A;  4WF2 A;  3N4M A;  1G2H A;  4HBL A;  3DBR B;  3H9G A;  2LC2 A;  3P7N A;  4E7Z A;  3Q9S A;  2RGV A;  5DDG A;  3ZQC A;  4FE4 A;  1IC8 A;  1BOA A;  2DN0 A;  2YS9 A;  5BPD A;  1MJA A;  3BJO A;  3V42 A;  1QVU A;  4XRS G;  5FKM A;  3ZXS A;  4EJW A;  2VQL A;  3S3N A;  2WAQ A;  3SHF A;  5HDG A;  3SZT A;  1HLV A;  3S2W A;  1ORK A;  2IS2 A;  1QPM A;  1P7J A;  3CJN A;  3MCZ A;  1UHS A;  4BS9 A;  2M8G X;  1R9T J;  1RUN A;  1LVA A;  3I58 A;  2NVT J;  1YW7 A;  4L5J A;  4XR6 A;  1NH3 A;  4R8H A;  3HOT A;  1BN5 A;  5B1A H;  3TP0 A;  5HLH A;  4HLX A;  1EKE A;  4NDL A;  2DDA A;  1SD7 A;  4CHU A;  1VQN I;  3ZR8 X;  5LBQ A;  1Z21 A;  3QYE A;  4R1H A;  3EYY A;  1I39 A;  4IRI A;  4LK1 F;  4PUS A;  2LBF A;  5LGT A;  3A2K A;  2Y30 A;  1FIP A;  2ZCW A;  4J00 A;  3DPT A;  2EA4 A;  1FX7 A;  4PJJ A;  1XGO A;  2AXT C;  2WAQ N;  3ERE D;  3D5S C;  4DZJ A;  1ETO A;  1K6O A;  4XN0 A;  1DU6 A;  1ZLJ A;  3JSO A;  3JRI A;  5K7F A;  1IN4 A;  2PN6 A;  4EJO A;  1FP2 A;  4G9Y A;  3AG4 H;  2KHM A;  5E8G A;  4CXF A;  3BZ6 A;  1MBH A;  2CQQ A;  4P5O A;  2HOT A;  2EFN A;  2LKS A;  3BTJ A;  3DQV C;  2HPI A;  5GTH C;  1FTZ A;  1TNT A;  5HS9 A;  3TO9 A;  4BEH B;  2DBB A;  3FKJ A;  2F4M B;  5F1R A;  2VN2 A;  1JKO C;  2JA8 J;  1K78 B;  5E18 F;  5GAE J;  5F1J A;  2O0Y A;  3DF8 A;  1RRJ A;  5DCF A;  2E71 A;  1W5T A;  3FBI B;  1WJA A;  2OV7 A;  3F22 A;  1LEA A;  2XGE A;  1VTN C;  1XDS A;  4EJT A;  3JRC A;  2P7V B;  3HOW J;  2XF6 A;  3IWZ A;  3E5Q A;  3HSE A;  3KP5 A;  3FKI J;  3E6B A;  4HZF A;  4ABZ A;  4EJV A;  2EIJ H;  2QLZ A;  3CLO A;  3CO7 C;  4Y4R A;  3RDI A;  1ACI A;  1HKT A;  2GZW A;  3NAR A;  1H0M A;  1OMI A;  2EIM H;  1SFK A;  3LSM A;  1OFC X;  2FE3 A;  4XMY A;  2UXN A;  4RBO A;  3OYJ A;  3LSJ A;  5BQT A;  2JUC A;  3K4K A;  2L3D A;  1W0T A;  1T39 A;  3CF2 A;  5LEJ A;  5L3D A;  5HLT A;  2LY2 A;  2HDC A;  5BPI A;  4U0V A;  3BR0 A;  4PZJ A;  3SFZ A;  2M0M A;  4L5E A;  2E36 A;  5KVR A;  4I98 B;  3S32 A;  4F3Q A;  1NG6 A;  2J5O A;  4BE0 A;  2Z1D A;  3M8F A;  3VYS B;  1I3Q J;  3M4O J;  1Y1W J;  2LSO A;  2WC2 A;  3CCL I;  2W00 A;  4RLQ A;  5E1X A;  2JVH A;  3IP4 B;  4XLP F;  4LB5 A;  4U87 A;  1ZKG A;  1IRF A;  2X6X A;  1X4O A;  5GTI C;  2DMT A;  1N25 A;  2IPQ X;  1N77 A;  1OIS A;  4IHX A;  3F8M A;  4OIQ F;  1G59 A;  1Z7U A;  5HDN A;  1MJ9 A;  3NEU A;  4KIG A;  5ILV A;  4V19 K;  2E5N A;  3NAU A;  4BE1 A;  2BEO A;  3HOX J;  2L7F P;  4IF4 A;  4BY1 J;  4LG0 B;  3ULQ B;  5H6R A;  4G7Z F;  1RIO H;  1OJL A;  1ZAR A;  1G6N A;  4UUT A;  1A04 A;  1Y8R B;  5AON A;  4FIS A;  2IBD A;  5CJ9 A;  3E97 A;  2AO9 A;  2FEZ A;  1VQM I;  2DA7 A;  4E6K G;  2A5Y B;  5EG0 A;  1R00 A;  2OZU A;  3M1E A;  1HQC A;  1ZGW A;  2QUF A;  5FKK A;  1FTT A;  2DJN A;  1S3J A;  3QPL A;  1A5J A;  5J3L A;  1PYV A;  1YW8 A;  2HOS A;  4C3J J;  4PFO A;  2NNN A;  5LGN A;  1X1D A;  2BXZ A;  4KN7 X;  5L3F A;  2AHQ A;  3CJR B;  1EF4 A;  4IJA A;  2CV1 A;  2EV5 A;  2IJL A;  4BQQ A;  2Y0S N;  1O7F A;  3I4N J;  3HC7 A;  4XSZ F;  4QWQ A;  2XB0 X;  1TWH J;  2JZY A;  2YX4 A;  2X51 A;  1UB9 A;  3DFG A;  4I02 A;  3OYE A;  2DFH A;  3QPS A;  4HEA 2;  1YFH A;  5TIS C;  1TC3 C;  1TW3 A;  2R5Y B;  4YIR X;  2VKH A;  5DUK A;  4KIS A;  2CH0 A;  3REO A;  1UZC A;  3K1N A;  5L3E A;  3ESW B;  1MMS A;  1DPR A;  3VDX A;  2E2J J;  2RQP A;  2HQ5 A;  1OPC A;  1G4D A;  4L0Z B;  5LFA A;  3O2P E;  1X19 A;  3CUQ A;  2EPF A;  4PSX A;  5FFX A;  1VQ5 I;  2O9L A;  1WJF A;  1LFP A;  4G6T B;  3AG1 H;  5FJ8 J;  3HDD A;  2IVM A;  1A6I A;  4IL6 C;  5K5O A;  2WV0 A;  1IGN A;  1OYW A;  1G3Y A;  3MEX A;  3TL4 X;  2UXX A;  2VBX A;  2E60 A;  3LA7 A;  5H20 A;  4E70 A;  2R3S A;  3NQO A;  1W5S A;  1ZG5 A;  3R4K A;  1S7O A;  2WA0 A;  4B43 A;  2M4G A;  5B66 C;  5LRR A;  2Z2S B;  2DMP A;  2JT1 A;  2ACJ A;  3KLO A;  4NUB A;  5E79 C;  4B4C A;  1TTY A;  2E1M B;  2WAD A;  1QRY A;  1QU3 A;  1GUU A;  2GA2 A;  4KNY A;  1FP1 D;  3V8K A;  2FJ1 A;  3L2W A;  5B5E C;  4XLN F;  3KIO A;  4P9F A;  4PSW A;  2OTJ I;  4BDY A;  1MBK A;  1LDJ A;  1E2X A;  4E7J A;  2BGC A;  4AUX A;  4M72 A;  5ILS A;  5HOD A;  3HXL A;  2YU9 J;  1X1B A;  2LRD A;  1H8A C;  2I5U A;  3LSR A;  1SD5 A;  2HFH A;  4A6E A;  2ICW G;  1ZGJ A;  2JMW A;  3WU0 A;  3K4N A;  1R71 A;  3VB2 A;  5CQG A;  2DYR H;  2OCE A;  2EH3 A;  2W82 A;  1WJE A;  1ODD A;  4KFC A;  3WU1 B;  4CCM A;  1IRZ A;  4M3B A;  1R7J A;  1RPW A;  4MNU A;  2OZ6 A;  4A12 A;  4AVP A;  2M3A A;  2R7F A;  4HNV A;  1ZQ3 P;  3CLQ A;  1OR7 A;  3QQA A;  4LK0 F;  4GO1 A;  1I27 A;  2GAU A;  1SMY F;  2IS6 A;  2KZV A;  4LLG F;  3WE3 A;  1D8K A;  1ERD A;  1FEX A;  4QLC U;  2HQR A;  1XDU A;  2KJC A;  3LOC A;  2A3S A;  3FZV A;  2CU7 A;  2A68 F;  3GTO J;  2DK8 A;  1FBQ A;  2BZT A;  2FOK A;  1HW5 A;  4FHT A;  3GTQ J;  4IRG A;  1KGS A;  1WZ2 A;  3ZOB A;  5HNH A;  2HS5 A;  4OMZ A;  4RLF A;  4BQA A;  4KIC A;  1R36 A;  2VAS A;  3FXJ A;  1T95 A;  1D0X A;  2EZL A;  3CUO A;  4WXH A;  3FMS A;  2W57 A;  2JK3 A;  1SAU A;  4A3E J;  2WY7 Q;  1U5T C;  1Z77 A;  1Z6R A;  3H3U A;  2A05 A;  1KQ0 A;  5D5W B;  2KPM A;  2MGQ A;  1FJL A;  3GW2 A;  1XGS A;  2R7U A;  3SDG A;  4ESJ A;  3CDH A;  4U0W A;  2B0L A;  4XLH A;  3KX2 A;  4PFP A;  2NS7 A;  1GVJ A;  3KP4 A;  2IA2 A;  3EUA A;  4HG2 A;  1FZP B;  2VQC A;  3CO6 C;  3FM3 A; 
#chains in the Genus database with same CATH homology
 4CYC B;  5IP9 J;  5IYD J;  1JKR C;  1U9O A;  3HGG A;  1B8I A;  3Q0W A;  3HKZ N;  3TW7 A;  3JRA A;  1JUS A;  1ZR2 A;  3LSP A;  1U78 A;  2LP0 A;  3UKG A;  3Q0U A;  3HOV J;  3IH4 A;  4AYB N;  3BR3 A;  2LKX A;  2H8R A;  3JRG A;  2LLK A;  4M3D A;  2Y2Z A;  2VKE A;  3Q0V A;  3HM5 A;  3H0G J;  1D5Y A;  4BY7 J;  3GTL J;  5FKN A;  3OSG A;  1JTX A;  3BR1 A;  3CMY A;  2L0K A;  1HDD C;  2XPU A;  1GDT A;  2ELK A;  3I4M J;  2ME0 A;  4GFB A;  4B3A A;  2X6O A;  5GP9 A;  4A3M J;  1YRN A;  2L7Z A;  3G1L A;  3HBL A;  5E3M A;  1ETV A;  4XRM A;  1P7I A;  2XPV A;  5E3O A;  3WHC A;  3BTC A;  1XC5 A;  4FE7 A;  3GTG J;  4FTH A;  4D7M A;  3G1O A;  1BW6 A;  3BQY A;  3S1M J;  4UUS A;  1GVD A;  3B6C A;  3CQZ J;  5EG0 B;  3LNQ A;  3BG9 A;  4XK4 A;  4C3H J;  3HOZ J;  2R93 J;  5C44 J;  3BR5 A;  5FKL A;  2DA1 A;  4M3E A;  5IP7 J;  2NVQ J;  1OCT C;  2VPR A;  3HOU J;  2DA3 A;  5EF6 A;  2CQX A;  1SFO J;  3D1N I;  5FKO A;  3WHB A;  2PMZ N;  2MG4 A;  1K61 A;  4A3I J;  2OF7 A;  1BW5 A;  3GTM J;  5EEA A;  1ETK A;  1MBJ A;  1ETY A;  1XG1 A;  3F0C A;  5EGO A;  2K9N A;  2JA5 J;  2XSD C;  2CRG A;  2N8G A;  2GM4 A;  3CCY A;  2DA4 A;  1LFB A;  2VI6 A;  2R5Z A;  3OOU A;  2LVS A;  2X9D A;  2M0C A;  1HF0 A;  1WH7 A;  2ME6 A;  1LE8 B;  2MSY A;  4I6Z A;  4M6V A;  4A3B J;  5F0F A;  4MO7 A;  5J1U A;  2EZH A;  1MBE A;  2K40 A;  1AKH A;  2JA6 J;  2K9Q A;  2Y31 A;  5M5Y J;  1G2H A;  2KDZ A;  2XRL A;  3L1P A;  3S1Q J;  4X6A J;  3BTL A;  4A3J J;  4EEF G;  3A01 A;  5DS9 A;  3ZQC A;  5F27 A;  4FE4 A;  1IC8 A;  1IV6 A;  1WCM J;  2DN0 A;  2YS9 A;  3RZD J;  4IHW A;  1ZR4 A;  1HOM A;  2W48 A;  1QVU A;  4XRS G;  4BKX A;  5FKM A;  1IJW C;  1WPK A;  4XRS A;  2HXI A;  2O7O A;  1HLV A;  1ORK A;  1P7J A;  3FK7 A;  2DMU A;  1UHS A;  3JR9 A;  4DZP A;  2M8G X;  1R9T J;  3CDL A;  2L9R A;  1T33 A;  2D5V A;  2NVT J;  3SJM A;  2ID6 A;  2VUM J;  4V2G A;  3JRE A;  5M3F J;  3TP0 A;  2GBY A;  4NDL A;  1SAN A;  2HDD A;  2CJJ A;  2KT0 A;  4MIM A;  1B72 A;  1JTY A;  1U9N A;  2HOA A;  3TW6 A;  3K2A A;  1JJ8 C;  3S16 J;  1MH4 A;  2NS8 A;  5EZG A;  2HI3 A;  2Y30 A;  1FIP A;  1FIA A;  4G12 A;  4IEJ A;  5M5X J;  1JUP A;  1RKT A;  2DA5 A;  2WAQ N;  2HXO A;  3B6A A;  4DZJ A;  1ETO A;  3VPR A;  3K7A J;  4D5C A;  4C3I J;  9ANT A;  3GTK J;  1DU6 A;  3JRI A;  5K7F A;  1T56 A;  4D5F A;  3S17 J;  4JP0 A;  3BT9 A;  3MVP A;  2CUE A;  1H88 C;  3BR2 A;  5C4J J;  2M34 A;  1E3O C;  1MBH A;  2CQQ A;  2EBI A;  3IH2 A;  4QTR A;  2HOT A;  1ETW A;  3BTJ A;  3ZQF A;  1FTZ A;  4JX4 A;  1MNM C;  3O8G A;  5JLW A;  2M2E A;  3HGY A;  1JKO C;  2JA8 J;  5F1J A;  3A01 B;  2XGE A;  1DU0 A;  3JRC A;  3HOW J;  4FCY A;  2LY9 A;  3FKI J;  1LFU P;  4V2F A;  3PO2 J;  4ABZ A;  1RET A;  1ITY A;  1I50 J;  1PUF B;  2XPW A;  4XID A;  3S15 J;  3NAR A;  3DEW A;  3A02 A;  1MSE C;  3C2B A;  5IYB J;  1W0U A;  1OFC X;  2P81 A;  4DW6 A;  4LOC A;  4RBO A;  3LSJ A;  4DYC A;  1W0T A;  1RES A;  3M3Y J;  4CYC A;  4QSH A;  2ECB A;  3PM1 A;  2R5Y A;  5C4X J;  1ETQ A;  3BR0 A;  1B8I B;  2JWT A;  4RDU A;  4L5E A;  1F43 A;  5IYC J;  2EZK A;  3H3V K;  4A3C J;  1ZK8 A;  1JKQ C;  5C3E J;  1H89 C;  1I3Q J;  3M4O J;  1Y1W J;  3JRD A;  3G1M A;  2E1O A;  3ZQH A;  2E2H J;  3S2H J;  2YUS A;  1MBF A;  1ZKG A;  2COB A;  2Y9Z A;  2QCO A;  2JJ7 A;  2DMT A;  1VI0 A;  5J1R A;  4IHX A;  3DCF A;  1IUF A;  1TWC J;  3MN2 A;  2RAE A;  5GPC A;  5FLM J;  3BTI A;  3IV5 A;  1JJ6 C;  3NAU A;  1TWF J;  2LR8 A;  5EZH A;  2E2I J;  1YRN B;  3S2D J;  3HOX J;  2L7F P;  4BY1 J;  2M9H A;  1OJL A;  3LSG A;  3S14 J;  4UUT A;  2XGC A;  4FIS A;  3BG3 A;  3Q3S A;  2IBD A;  5F0H A;  4QIW N;  4W1U A;  2AO9 A;  4A3L J;  1AU7 A;  4UUS B;  2DA7 A;  1O4X A;  1X2N A;  1BA5 A;  3RKQ A;  1RKW A;  4MFE A;  5EYR A;  3FIS A;  1BL0 A;  5EG0 A;  3GBG A;  2B63 J;  1ZGW A;  1IG7 A;  5FKK A;  1FTT A;  2DJN A;  1JT6 A;  3S1R J;  3QPL A;  1UG2 A;  1A5J A;  5J3L A;  3ZQL A;  1APL C;  1Q1V A;  3JRB A;  4BBR J;  2HOS A;  4C3J J;  4Y52 J;  1TWA J;  4M3G A;  2LD5 A;  2R92 J;  2NVY J;  1EF4 A;  2AHQ A;  5F04 A;  3FK6 A;  2HYJ A;  3A03 A;  2Y0S N;  1HCR A;  1I6H J;  2K9S A;  1NTC A;  1CQT A;  3I4N J;  2R7Z J;  4M3F A;  1JUM A;  2XB0 X;  4DYR A;  2DMQ A;  5M3M J;  4IHV A;  1TWH J;  2X48 A;  5EGO B;  2DA2 A;  1MSF C;  3QPS A;  4A3D J;  2DMN A;  1TC3 C;  2R5Y B;  1BJZ A;  5IOY A;  2WB1 N;  2VKV A;  3W6V A;  5IOZ A;  5F0C A;  2GLO A;  2DTZ A;  4IHY A;  3RQI A;  2R5Z B;  2E2J J;  1GT0 C;  2HQ5 A;  1IDY A;  4I76 A;  2DA6 A;  2FX0 A;  1XS9 A;  5JLX A;  1LE8 A;  2WV1 A;  1ETX A;  5E3L A;  2O9L A;  1AKH B;  5EDN A;  3JRF A;  2I10 A;  5FJ8 J;  1RR7 A;  3E7L A;  3HDD A;  1A6I A;  1K83 J;  1IGN A;  2LTP A;  2EQR A;  2TRT A;  2ZB9 A;  5F08 A;  3S1N J;  1WGX A;  5DTD A;  3HB9 A;  4D7N A;  2NVX J;  2JN6 A;  4A3F J;  5J1Y A;  2DMP A;  3JRH A;  2OPT A;  3BR6 A;  3HEF A;  2FD5 A;  4B4C A;  4MFD A;  1WI3 A;  2LK2 A;  4A93 J;  2R0Q C;  1QRY A;  1OCP A;  1GUU A;  4X1E A;  4A3K J;  4BBS J;  3GTJ J;  2EZI A;  1IDZ A;  3ZQI A;  2FJ1 A;  5FLV A;  3HOY J;  3RZO J;  1QPI A;  3OSF A;  1MBK A;  3FIW A;  3SFI A;  4AUX A;  1B72 B;  5HOD A;  2YU9 J;  4B1R A;  2IEK A;  2IAI A;  5BNG A;  1H8A C;  3LSR A;  2JA7 J;  4W97 A;  2JMW A;  4S0H B;  2L7M P;  2TCT A;  5IPA A;  2EH3 A;  1U8B A;  1WH5 A;  1IRZ A;  4M3B A;  3TP3 A;  4DYQ A;  1RPW A;  1ZTR A;  4HNV A;  1ZQ3 P;  1Y1V J;  4AC0 A;  2ID3 A;  3QQA A;  1JT0 A;  5K7H A;  4JX5 A;  2G0E A;  2XB5 A;  2CUF A;  4A3G J;  1X2M A;  2NOG A;  1FEX A;  2LFB A;  1VF9 A;  2XGD A;  4A69 C;  3LOC A;  4C2M J;  1JKP C;  5GPA A;  3BG5 A;  1MBG A;  2CU7 A;  1ENH A;  3ZQG A;  3GTO J;  1VFC A;  1MH3 A;  4Y7N J;  4JYK A;  4MLO A;  3GTQ J;  3ZOB A;  2Y9Y A;  5M5W J;  3BQZ A;  2EZL A;  2E19 A;  1S7E A;  4JX6 A;  3TED A;  2JK3 A;  3O8H A;  1VND A;  1QVT A;  4A3E J;  4XIC A;  3GTP J;  1Z77 A;  1JGG A;  4J19 A;  5IP6 A;  2ECC A;  2MGQ A;  1GV2 A;  1F36 A;  1PUF A;  1FJL A;  1POG A;  4BXX J;  3IH3 A;  2QF7 A;  5K7Z A;  3SDG A;  3PO3 J;  2O8K A;  3MKL A;  2FQ4 A;  1HDP A;  2H1K A;  1NK2 P;  1TWG J;  1X58 A;  1AHD P;  2NS7 A;  1Z0X A;  5E3N A;  1GV5 A;  3OIO A;  1NK3 P;  2MW8 A;  1UMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...