4RBUA

Pdua k26a s40q mutant, from salmonella enterica serovar typhimurium lt2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
b'EALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGQGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propanediol utilization protein PduA
molecule tags Structural protein
source organism Salmonella enterica serovar typhimurium
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
total genus 18
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rbuA00
4PPDA 3I96A 4RBUA 5DJBA 3IA0A 3MPYA 3NWGA 4QIEA 4P2SA 4QIFA 4OX6A 3BN4A 3H8YA 5L38A 3MPWA 4OX7A 4LIWA 4RBTA 3CIMA 2A1BA 3I6PA 4QIVA 3SSRA 3SSSA 2G13A 3DN9A 3VCDA 2A18A 3N79A 3PACA 4OLPA 4DDFA 2EWHA 4P7TA 4QIGA 3SSQA 3CGIA 3DNCA 4OX8A 4AXIA 4OLOA 4RBVA 2A10A 4P7VA 3NGKA 4AXJA
chains in the Genus database with same CATH superfamily
3ADAC 4C3MA 1N32F 2VA3A 3IBCB 4KFBB 4ES1A 1FNXH 1D3WA 1EHWA 2WHOA 3CJ2A 4RR5A 1F3VA 5A8RB 4USJC 3Q24A 4XPEA 3PW0A 2DNQA 2C2RA 1FERA 4ED5A 1Q4RA 1S6UA 1DLOA 3QWUA 4ECXA 4CWBA 2JEIA 2DHXA 2QSFA 3K5LA 3M6VA 2W8KA 1BQXA 1SIWB 3PW4A 2I0XA 2CQGA 1GMVA 3T5HA 4NA1A 5CZXA 1I5OB 1HBNA 1PYTA 2GQQA 3BGRA 1NK8A 4TLRA 3VR1A 2G0JA 2DCLA 1XMQF 3LA0A 4FKXA 1AZSB 2MKHA 2LFVA 4NMLA 1HMVB 3ILJA 5B0CA 3FK4A 3GILA 4M94A 2HAIA 2IBOA 3I0RB 4OZ0A 2MKCA 2ZBQA 2JHEA 3A3OB 2J7UA 4DV6F 1S6QB 4LIRA 1D9AA 2CPZA 2EI5A 3OBIA 1FDNA 1HA1A 3MR7A 4OYAA 1RAGB 4PG5A 2MGZB 4B9VA 3J7ZT 4USTA 1H98A 3V6JA 1O5JA 2PI5A 1FCAA 3W9HA 4P2FA 5CZVA 1FK9A 1TKZA 2C3YA 5EDWA 3BO4A 3HK2A 4ZP7A 4I56A 2J9CA 1IJFB 2VG5A 4NASA 4ZP8A 3CIMA 5LXRA 5C25B 2BV3A 2GC8A 2XO6A 3SFGA 3NNCA 2YNFA 2RKIA 1W26A 3HJFA 1HYSA 2HIQA 5D4LA 4AL5A 1S0NA 4RW7B 2VU5A 3AD7C 3DGPB 2C3OA 4RW9B 1NK6A 4FBUA 4DL3A 3RW6A 2CYYA 2CQ3A 4FYWB 3U1MA 4JUZA 2HK3A 4X66J 2E1MC 5GAHU 4NLPA 4L74A 2ADCA 2V8PA 4JI3J 2M88A 4PPDA 3DHXA 3TYTA 2LQ9A 1FXRA 5CYJA 4QWCA 3MMAA 2AX0A 3SBMA 4ECSA 4MTPA 2BABA 4Q0BB 3GFHA 1TK0A 4E0DA 3AHPA 5FIIA 3OD2A 1WTFA 4DSKA 2XS7A 4WZQA 2LXUA 2DK2A 1S0OA 2B4UA 2D9OA 3R6LB 4FDFA 4Y0FA 2B5JB 2CNKB 4FZVA 3M8WA 2W01A 1TL1B 3S7RA 2AT1B 2ZBIA 4DCOB 2KJWA 4CRJA 4DQRA 3IO1A 1UA0A 4XTTA 2C3UA 3PACA 1R0CB 4J90A 4PXBA 3GJSB 4DV1J 3T5KA 4P10A 3K0JA 2AW0A 2RDIA 4PRFA 1U1PA 2J6UA 2NSBA 1XNQJ 1CLFA 1UA1A 1NJWA 1QAJA 4PQUB 3PJWA 5EHHA 5L1LA 3J7AN 5CHCB 3OHBA 4U67Q 2MZQA 4QW8A 1VQ9S 1JLAA 1QTNB 5L39A 3I87A 2XS2A 2FY8A 1T0TV 3UN3A 4DPTA 2PN6A 3VAGA 2NUUG 4G1QA 5HO4A 5KG7A 3B4MA 1X9MA 1U2CA 1FVSA 2EC2A 3SDEA 4F4KA 2M9KA 1V3RA 2CPIA 4FXWA 1F2GA 2M4MA 1RB0A 2HHPA 3MM6B 4KBIA 4ES3A 3THPA 3UW1A 4RW8A 1IWAA 1TFYA 3T3FA 1UPMB 2MQLA 3R5AA 1NSQA 4ECZA 2HFSA 3CMES 3ZZUA 2OPPA 4X4TA 4RLEA 4DN0A 4O3SA 1FEHA 4KB7A 5E0OA 2HHHF 5DM6Q 1JIHA 3NXZA 2HRUA 2DR5A 4F50A 5J2QB 2OHDA 2FJBB 2OPRA 4FYVB 3G82B 1SPBP 2ADBA 3DRPB 2NXUA 1S79A 4QW9A 1HWIA 1A0OB 2IJFA 4KGMA 2GVZB 4I4BA 1XMBA 3CDAA 1GMWD 5GADI 3IC1A 3MD3A 3J7YU 1LWFA 3PYEA 2RDJA 3IWLA 1FDBA 2IMWP 4O4GB 2GIRA 3CCVS 1SI9A 2YQ1A 1TR0A 4U6PA 1CJTA 1H3DA 2EVZA 3RW7A 2WSEC 4OZ2A 2C3PA 5H9FJ 4S0MA 5LSRA 2LDIA 3CCTA 2MKJA 4Q43A 2ZZNA 2C1EB 4XO0A 4DR6J 4DPUA 5KFWA 2B0GA 4A8MP 3RYLA 5HBMB 4O3OA 2DJWA 2I38A 2DEJA 2XYPB 3R5JB 3VWSA 3NBPA 4WP8A 2OFHX 2KU7A 5KFLA 2ERRA 4KRWA 2J0WA 5HLFB 2V50A 2J0XA 2V5HG 4QOTA 1SJQA 3JXOA 3N9UC 4ID5B 4ATNA 2PE8A 3G6XA 2OAUA 1NLKL 2W7AA 3IR5B 4J9KA 4B3SJ 1U6BA 1VQLS 4LR8A 1FJ7A 2AKWB 1CQNA 2MEWA 3MEKA 3MUVP 1BUXA 4MIWA 3OTOF 1M5VC 2DHAA 4TY9A 5KOWA 4PG4A 3V4IA 2OP5A 4ZKAA 5AT1B 2JNJA 2PIIA 3R6GB 4ZA1A 1BY9A 1BLUA 4ZMMA 2VG6B 5A2QU 4K4TA 2ZD1B 2NYHA 2FDNA 4CDIA 2HIYA 2CQHA 1ZS6A 3CCQS 3V81B 4IFYB 4U7UD 4DPYA 1F60B 2HNZA 3BR8A 4LSLB 2WBRA 2WOMA 4K4ZA 3K8VA 3EPGA 2VQEF 2R2SA 2R7QA 2Q6CA 3MCOA 5ETVA 4UQTA 5KFSA 5GAEI 1VYAA 1V5VA 2FZCB 3D66A 4GC7A 1XR7A 1L3UA 1C0UA 1D1UA 3CJ0A 4KGKA 5HJXA 3BN4A 4K4WA 2FLLA 3WC2A 4IQXA 4LF6J 1RWVB 1B0TA 1F5AA 2R7XA 1NHVA 4DLEA 3HKZD 3ZZ0A 2E5GA 4WZMA 1DAXA 4OI6A 3TUZC 1JXEA 1NDPA 2FD2A 2P9CA 1NJZA 1HI0P 5GMKa 4WFNQ 2YWWA 4NXNJ 4RJVA 3SSSA 5GAHI 4DLGA 3GYGA 4K4XA 4O44B 3PEJA 3BR9A 3GMGA 3M2VA 4WCEQ 3HHLB 2FHJD 5L8RC 3NCRA 3C2PA 2UVUA 1F5BA 2JJ4D 3UE2A 4JV2A 2LU1A 5IV4A 3HSJA 3T41A 5JUMA 1K44A 4FPRA 2KVIA 3I96A 1IM4A 5FLXY 5LMUJ 4NI2A 5IC4B 3M9NB 3GFZA 1G2EA 4A48A 1RTZA 2XHCA 3OTDA 1IBKJ 4DL6A 3TQ1A 3A8JA 1WDDA 1VR6A 5IT9Y 4HH0A 4CI0B 2DGXA 3FEZA 4ZIVA 4A46A 2E7XA 4CYUB 4QCLA 5HROB 4RNMA 3H40A 3A3PB 1SQGA 4L6V3 4HI2A 2X7IA 1FO1A 2JH3A 4M8LA 5EWEA 4PAAA 2R7VA 4LFBJ 1RI7A 4M5HA 1U8SA 4DXLA 5KFPA 3HFZB 4LF2A 3Q8YA 1IJEB 2A18A 2R2RA 4F2RA 1N5SA 4Q0BA 4QR1A 3D2WA 2DGQA 4MIBA 2LU2A 3AA8A 1SJ3P 2GIQA 4PYDA 4QQBA 4UT4A 1VBYA 5J2MB 2I8EA 1F6TA 2HQIA 2MYFA 2YPYA 4K5SA 4R0JA 4Y00A 4DMZA 5F8NA 2DXDA 4ZPCA 2ATCB 4HKQA 2E5LJ 3GTYX 2GJIA 4YHHJ 2IA6A 2YWHA 3NCPA 1HNWF 4C7QA 1RU1A 4IG0A 1HNZJ 1YVFA 1DQ8A 3LP0B 3KOAA 3JAMU 3TZYA 4RW7A 2ZH8A 4F3QA 1P6TA 1TFWA 1JLBB 1FWKA 3MCNA 3TNVA 2GVDA 2OI2A 3LH2S 2BE9B 2X3DA 4DR4F 2DHSA 2B7BB 3FRZA 3O8WA 3JS9A 2F4FA 4CH1A 1YHQS 2C22A 2GQ2A 4HHUA 4MMOA 3DRRB 3GLJA 2MZ1A 4AL7A 2XSJA 1ZYQA 4O23A 2NSCA 4GC6A 3MEDA 5J1EB 2MDAA 1UAWA 4KYZA 3KJQB 3PDNA 4NLDA 1TKTB 4RWWA 4ZK7M 3S8SA 3N6LA 1RKJA 3KNAA 4F0HA 2HLTA 4J9LA 3LP2B 3DDNA 4ICLA 4P9SA 4Y6IA 1IKXB 2XBPA 4H4OA 1T3NA 2CQ0A 2R7TA 3OL7A 2EFOA 1B0PA 2DHHA 1S1TA 1RCOB 3QGPA 3FCWA 1U47A 5A6WA 3FBEA 2IVMA 2K06A 3IRXB 1RABB 2HW3A 4RNHA 4MK8A 4NMXA 3TA2A 5KFGA 3G6VA 3D1HA 4ZJQA 1UVJA 1RWWB 1U0HA 2KT3A 1H38A 2K7JA 1JQGA 5EWGA 1R0AB 2I6WA 2U2FA 2H5IB 1Y5LB 2CWKA 5D4NA 5IV3A 4F8RA 4K4SA 1MU2B 4K0KJ 3CSKA 4M5DB 1N8RT 1CSJA 2VFSA 1SL1A 1P1LA 2E1PA 3GR0A 4OLPA 4QIGA 3M2UA 4UOHA 2M8DB 1BMQB 3KMSA 2JEJA 4I6YA 3VQSA 2WONB 2EG1A 4USIA 4DF8A 1B64A 4ZPBA 2EFPA 2GFFA 3UNYA 5B0GA 4ZHRA 1T95A 4CLTA 3JQMA 5DDOC 2KHCA 4DX8H 1NU4A 1R8AA 2FC9A 5A8WA 5DG9A 1IN0A 3W60A 3RBXA 3VGSA 2RH3A 1NPKA 5H1SV 4IQMA 1CJVA 2PMWA 3AD9C 1I6JA 1A7GE 3DOKB 2HBYB 2XMWA 4ECTA 3F56A 5CYQA 4DV2J 3MOZA 3CEDA 3DN9A 2QLJB 4ZVUB 3MEDB 4TLQA 2GAHC 1HNVA 2LEAA 3N5BA 1EP4B 2EBGA 1Z4UA 3Q86A 2HWHA 4UUWA 3Q22A 3R1LA 1JKHA 5I3UA 5C7PA 1HMVA 3EZOA 1VRQC 2MXYA 2BQRA 4AXIA 3MM7A 2QLWA 3CO9A 4B3OA 4DL2A 1RTHB 2CADA 4DV7F 3R5BA 2FZGB 2Y8WA 4C8KA 2RHSB 3S6EA 2HHVA 1TP7A 3WIUA 4DSFA 2XZWA 3QPIA 4KR0B 4DUTA 2HHSA 4LR9A 2F3JA 3EM1A 2V2ZA 3OVAA 2ZH7A 3JQJA 3LP0A 4I7FA 2DNRA 4WTYA 1CS4B 1FRIA 1WEYA 2Z56B 1HPZB 3K2YA 4ZCMA 1U7LA 2N4DA 3V6DB 3IG1B 3A1YG 4K59A 2R9LA 4IO1A 3Q8PB 2GNKA 3PYDA 1JLQA 2JZ5A 3TVKA 3KTQA 2RHQB 3KKFA 3T6JA 3MR2A 5L1KA 4ZJLA 1VBKA 4OIXA 4WBFA 1SJ1A 2HMIA 2IFXA 2R8JA 2HK2A 4NLRA 1S4FA 2Z2YB 1WC0A 1PJ7A 4FBTA 2DH8A 3QT6A 4M5MA 4DV5J 5HROA 2Y8YA 4IOCQ 1SL0A 4JB8B 5LM7E 3U1LA 1WSVA 3BO2A 3M30B 3CJKB 3M7VA 1OMSA 4AE5A 2FJXA 2DIVA 2OKQA 1P9QC 4JV5F 3D0HE 2B56A 1B7YB 1RT4A 4ELTA 3UN5A 5IT0A 4QJVA 4DR2F 1IBMJ 4C8ZA 3P96A 1SKRA 5BR8J 3LO3A 1UEVA 3R2CJ 4I64A 1NDKA 3BBFA 4RBTA 3R5GA 2BJ3A 4CLUA 3D0GE 1C0TA 5F0WA 5KFVA 4DFMA 1FD8A 1MMLA 1FRJA 1G4CA 1VCTA 3HDSA 1FTCA 1P8GA 5B08A 4DR2J 1SUQA 1UP1A 3A4TA 2WONA 3EE3A 3HHLA 1S9EB 3Q89A 3QMQA 3R7SB 1S4EA 4DUYF 4Q5VA 3M2UB 1EX8A 3EICA 3EGNA 1KLNA 2XMKA 2ZFHA 5IQQA 3RGIA 2F7VA 2IVFB 1UVMA 5GAEU 1QVGR 2C2OB 1VIXA 4DUYJ 4MH8A 2E9TA 3I32A 4M5KA 3CC4S 1TKXA 4ZVPB 3U1NA 1JNRB 3T1YJ 1T03A 2FVSA 3CD7A 3MTJA 2G4BA 3CW2C 1ZA2B 3R5DA 1LK7A 5U47A 2W8LA 4R5PA 2PI4A 2E7VA 3TI0A 1S1TB 1RSCA 4WK1A 2DNPA 2MHEA 5B0FA 4YFUA 2D3UA 3T1YF 1IKXA 1RTJA 2FHKA 4H4OB 4OYXA 3SEOA 5DG7A 1C1CA 1HD1A 5JXSA 3IFEA 4LSZB 3TX0A 1PIEA 2ILYA 5BYQA 4ZP6A 4EZ9A 2HNYA 5DQIA 3NS7B 5AJ3F 1RADB 4CO4A 3T5LA 2IMOA 4WPAA 4TYBA 2HQDA 1RT2B 1RWOB 4XIUA 2H54B 2VPZB 2DR8A 3DRRA 2ZZMA 2HHTA 4ZVFA 3J7A1 3QRRA 3PX6A 4CQ1A 1VDHA 5K20B 4LF5J 1LXNA 2GVDB 2WSFC 3DRSB 5IOLA 4RNFA 1K1QA 1JLBA 1FKPA 2MMYA 3F44A 4YB5A 3LP1B 4DR1F 4R25A 2F4VF 1MROA 2KXNB 4ID5A 4QPTA 2L41A 5CAAA 3O1LA 4OJ1A 5K14B 3UDCA 4EBCA 1IQTA 3I6PA 2BJEA 2YWKA 2AEMA 4X4PA 1FJEB 4JI5J 2OTLS 5K8NA 1XMOF 3AY0A 2ZH3A 3HZEA 4O3RA 4JI4J 3P8BB 2MQ8A 4LQ9A 3TP2A 3MFHA 3FSXA 4O3PA 2P9GA 5HSPA 4YQWA 1RE1B 2GS8A 2PT0A 5C42A 3HO1A 1KN6A 1QE1B 2F40A 1APSA 1G6BA 1I3OB 2QGFB 3GG0A 2AJ1A 1FXDA 2AD9A 2UVRA 1SC3B 2HHUA 3MCMA 2HQFA 1VGYA 1EJ7L 4TU8A 3CO0P 1M5SA 1N4LA 1UVKA 4NLOA 5IM0A 1OYEA 1YJRA 5I3UB 3DFEA 1OY8A 4FVMA 1UFLA 4C3LA 5HN0A 3IBFB 2RS2A 2HWTA 2FC8A 5DETA 1WNEA 3FMBA 2W4PA 5LMNF 2CZVC 1S1WA 1T11A 1R7IA 2RS8A 2Y1JA 1YJWS 3HXMA 3JSYA 3RR8A 3C6TA 1ITPA 3BGUA 2EFGA 3QBCA 2JVOA 1YX2A 4WP9A 5HAOA 1R3NA 2V2VA 2XGQA 1SC1B 2BMBA 3KJNB 2CZ9A 4RUCA 3WZ0A 4GO5X 3PJXA 3Q23A 1WC6A 4DL4A 1GXLA 1OO0B 1WDTA 4CH7A 1VQMS 4QYZK 5E2QA 4PG8A 3BM7A 4Y28C 3MD1A 4USMA 4AT1B 3AOBA 1NK7A 3TUPA 2HLUA 3DU5A 3OXLA 3V2UC 2QLFB 1MU2A 1REVB 4F0KA 3HF5A 1Q82T 1UETA 3HVAA 2JVRA 5DDQC 3K7RA 1GMUA 1U0HB 1S1VB 4KT0C 4UOGA 2ASDA 4DG1A 3P5TL 2WOMB 1NK4A 1VC0A 2JC1A 4DZDA 3AQPA 3L09A 4LFCJ 1B99A 4N41A 1FNOA 4JV0A 2IAJB 4CT9A 5A8KB 3CD0A 2UZAA 3NMRA 1VHFA 2K1RB 2XCPA 3LP2A 3VAMA 4KE5A 6FDRA 4IRDA 4Z7CA 2E5HA 1TKTA 2UXDF 1C4AA 1KKHA 1JMTA 3AA9A 4K2XA 2Q6BA 1RTIA 4FF2A 5KFTA 1JWWA 4U8VA 5J2PB 2VPYB 4DG1B 3EGVA 4DU8A 3EMTA 2GO9A 3ETMA 4C11A 1X5PA 4FYDA 1S10A 1YJVA 1Q79A 1HR0J 1QUVA 5F3TA 3M9OB 1RYRA 2OIHA 1N5QA 1YRUA 2W7PA 1JLEB 1NM2A 3I82A 5E3RA 4NXMJ 1KVJA 2FHMA 4KQZA 2VQFF 1H7XA 5HBMA 1MN9A 3ENQA 2PFDA 2HHHJ 1NSPA 4G6VB 1RP5A 1AFIA 1XK8A 3UWTA 1KD1T 3GIMA 2QLXA 4ZPWR 4DR3J 2YNFB 2XWXA 4OLOA 2ZM6F 4CM2A 2Q79A 3IWNC 1LKZA 2ZUGA 4K0KF 2PEBA 1KBRA 2VQFJ 1JLGB 2WZ1A 3H5YA 1HHSA 4PEOA 4QIWD 4DJBA 1YJNS 2J5AA 3CCMS 2Z4PA 3LTOA 1N32J 3MMJA 1SIZA 2ZOMA 3CMQA 2EKNA 3PRVA 4NRUA 3DDIA 3ILIA 1GXUA 1P9YA 1U26A 5GMEA 4F36A 1L3VA 2BZ2A 2XB2D 1N5TA 4LBIA 4X4RA 2QYCA 4I2PA 4Y3CA 4KV8A 1GT8A 1F5CA 2EKYA 4PR6A 3OT9A 2CAJA 4IFYA 4OZ1A 1PO6A 1VQYA 4QZVB 3KK2A 3GQCA 3CCLS 4WKRA 1F1BB 5D0RA 3T6BA 3KK1A 2ZD1A 1Y7PA 3CDWA 1YRXA 3E01A 3EUNA 3ZXWA 4UQGA 4EEYA 3C3LA 2IM0A 2B9EA 4OHWA 2DNKA 4ER8A 4JI7F 3HLUA 3DLHA 2EW9A 1WWHA 3VTIA 2BQ3A 4ZPDA 2OTJS 4DOZA 3SQGB 3R5CA 4J5OA 5F3ZA 5E3PA 2I1RA 3ILOA 1ZBTA 1U1MA 4K5RA 4JYAJ 3IRWP 2E44A 3BBCA 4LRDA 2XMTA 4CLLA 3KHLA 2ZH5A 1LW0A 2G1HA 4OYZA 4IH6A 2ZBRA 5KTQA 3Q8QB 1S49A 1WKJA 2YX7A 3LUYA 2DXEA 2ZDPA 2WVDA 4MKVA 2KL8A 4PQUA 2CPEA 4RO0A 1L3TA 2WVCA 1FKPB 2VPXB 3GCXP 3OVBA 4ZVOB 2ILZA 2YKMB 5B0DA 3FEYB 3DRSA 4C3KA 3G96A 2R7UA 3UNGC 1ZPWX 3TUIC 5CD4H 4OI2A 1CJTB 2NLWA 3TO8A 4DR4J 4FNHA 6AT1B 3KFWX 1Y00A 2I5JB 2CQPA 4RL1A 2BJ8A 1HHTP 3BN7A 1NPPA 4ELUA 2C2KB 2L3MA 3BGFA 3N5FA 3DLGB 2ZH9A 1OY9A 1TMMA 1IKWB 1CULB 1TVRA 3IS9A 4J9NA 1F3FA 5C24A 5J2NA 2NCKL 5HQ8A 4J7CA 1YGYA 4URQU 5G0RA 2OPRB 1FRLA 5B0EA 3MM5B 3TVZA 3CT9A 3T1HF 2EC0A 1C1CB 5F9NA 3VAJA 3R97A 4QIVA 1I1GA 3KDNA 2A6OA 4YMEA 2CVIA 1FESA 5FD1A 1VK3A 2KFZA 1URNA 3ENWA 1U02A 2GGPB 3QLHA 3G8TA 2RT3A 3OR1B 2MZSA 4DFPA 4RW9A 5HMXA 2KTQA 4JI2F 4LF8J 1JX4A 1JLGA 1FNMA 1MWZA 1R8CA 2GHWA 3MPUB 3QFWA 4ILRA 5DO2A 1TV6A 2IHR1 1N0UA 2ZVSA 3BF4A 3Q8VA 5ETMA 4DCPB 1XC9A 3BB5A 2Y9HA 4CO0A 3HX9A 4RW4A 2W9BA 2C42A 3IA0A 4YN3B 4DS4A 1U45A 2JEFA 4K4VA 1R27B 3PKMA 2GMLA 1KS2A 2G1DA 2EBEA 2PSZA 3H8YA 1X8DA 2RRNA 3KWMA 1SKUB 1SJFA 4OX7A 3DYAA 1CQMA 4DQSA 4CO1A 3MPDA 4UZBA 2CNLB 2DY9A 4NX9A 3MECA 2AIRB 3IXQA 5I42B 3HT0A 4XK8C 3FNNA 4I69A 2M0GB 4KTQA 5AXKA 3N4WA 4IR1A 3P3DA 2RRBA 4BLGA 2N3OA 4X4OA 2ZKTA 2MGZA 1H7WA 2OPSA 1KLMA 3VVTA 2O01C 3J80U 3HSGA 1RJJA 2QA1A 3RR7A 3UCUP 2RSQA 2QFJA 1SH3A 1XWLA 5CCMA 1RT4B 3QIDA 2KG0A 5IM0B 4YY3J 2QC3A 2HGNA 2Z2MA 1KSPA 1DARA 2FGCA 5HMWA 2D3ZA 1ZM3A 3G2XA 3BBBA 2FJAB 2ZE2B 4PG7A 1HBNB 5MAOA 3FEXB 3LGMA 1T9VA 1GK8A 4BCAA 1FX4A 4X4UA 1FJGJ 3QO9B 1Y3JA 2H65B 5CYMB 1HD0A 2VICA 4NCAA 1X4HA 2GO8A 4WE1B 3HVWA 3P5BP 4L3KA 2Z2ZA 4F04B 4LBHA 1Q1KA 2HS3A 4IUFA 3QIPA 2NXEA 2HNDB 1PJ5A 1VLYA 2PMHA 5KFAA 2V9WA 2V2QA 3H2UB 2CJKA 4F3MA 2P6TA 1YJTA 3LALA 4ES2A 2Z2LA 2DPIA 1PGZA 2L08A 2BX6A 4PXEA 5KFQA 4L72B 3SDEB 2JEGA 1FXLA 4KSEB 4P72A 4F25A 3TAMB 2ZOGA 3DNCA 3MCSA 5J1PA 2GW8A 2AP6A 1RHKB 1RLDA 1TTHB 1B4SA 2B4VA 4P7VA 3GSDA 3PXGa 5C25A 1YK9A 4AYBD 4YS2A 2B8QA 3M32A 5KG0A 1K0TA 4OHVA 4ZN3A 3RZAA 2C3MA 1O8BA 1HARA 1RT6A 1VS3A 1QY7A 3D5MA 3ITHB 4N8NA 4XAKA 4JV1A 2DO4A 1K47A 4B3TF 2A3JA 3OFHA 7FD1A 2UUAJ 3VV2B 4BWJA 3TAQA 3C66A 2CQ4A 1T9XA 3W65A 3HT3A 3HPOA 4DBQA 5H9FK 4WXWA 1RKIA 1EIYB 3DOMB 4C0OC 5CD4A 3M32B 4BC7A 2PEHA 4AFFA 3VAKA 2J76E 4DI6A 3M2RB 4V19J 3JTOA 4LJMA 3CF5Q 3Q2SC 2Y0SD 3AB4B 2DIUA 4R5PB 1CJKB 3EZ5A 1D8YA 2KYXA 1PC5A 4CLSA 4J9RA 4DFKA 2C2ZB 3B54A 4IYQA 3W5YA 3KLFB 2R8GA 4B9SA 4PXCA 4JI3F 2MTLA 4OYOA 2YKNA 5C42B 3LWMA 2CVEA 3ZZRA 1N34F 3H42A 5JVGQ 1DHMA 2VQEJ 3L95X 3HD2A 3CCJS 3DC2A 1EKSA 1TELA 2KRRA 1X5OA 5KFMA 5THWA 1RHRB 3TA0A 3M8QA 4OJHA 2GHPA 2RQ4A 2NPFA 3LAKA 3ZC4A 1RBOB 1S9EA 1VK8A 3C6UB 2WW8A 4FS2A 1E6YB 4CP5A 3GYXB 4CLPA 2CWXA 2V4JB 2PD1A 4LFAJ 3UDVA 1D9FA 2OEJA 4Q44A 5KG1A 1A9NB 2OEMA 3IRXA 2ASYA 3CNQP 3KLGA 1MROB 2BW7A 3BZQA 3DKDA 3SQOP 3TJ9A 1U1RA 2VA2A 3EJMA 1KONA 4PWUA 3GV8B 3DLBA 4NCBA 2OELA 1FWLA 3LPEA 4ZPAA 2ZH2A 1J5EJ 2B3TB 4ECUA 2KT5A 2LQJA 2VKZG 2J0QD 1VQ6S 3A12A 1X4CA 3H20A 4NYOA 4A8OA 4WFYA 3NGTA 1NJXA 1RUSA 5DJBA 1QTMA 3BV8A 2DITA 1L3SA 5SUHA 3SV3A 4OL8A 1S5ZA 4MFBB 2JDJA 3DM2B 3MMBB 4OHZA 3QJJA 3ISND 1RHJB 4NLUA 4ZLNA 4JI6J 3G87A 3K59A 1RISA 1UTAA 3B4DA 1URRA 3UCZP 1HWLA 3MUTP 1BQNA 4RW6B 4J9SA 3UI3A 2J7KA 3OSNA 3U02A 1BQMB 1YRTA 1JXVA 4M95A 2UUTA 3HMJG 1LW2B 3CMAS 4MKYA 3WQPA 4WU2A 1DTQB 1NB2A 4U8YA 4JI8J 2AJQA 2CDRB 3KLIA 4CLZA 3D67A 1QLNA 1FFSB 4EO8A 4OYBA 2DRBA 1HQ2A 2OPQB 4RUBA 4ILLA 3DCAA 4USWA 1EETB 4JV5J 2HVIA 3CJ5A 2CQCA 4OYWA 1J2VA 4YDDB 4GVLA 3FFIB 3MR3A 2KFNA 3EPIA 3M9MB 4Y65A 4ZVGA 1HNWJ 1BGXT 1JKHB 1IKYA 1HNZF 3LF0A 3E2EA 2IA0A 5CH7B 2JLFA 4WIIA 5HL7Q 4DV1F 4NLXA 1UWAA 3WC0A 4ANEA 2IPOB 1RTDA 3NL0A 3MGJA 4TXSA 2CPXA 5D4OA 5DDRC 4CT8A 1WJ9A 4NPOA 1RT5B 2MLXA 5LSLA 1GX6A 1ZAXA 3V6HA 1CJVB 3PTWA 4J9MA 4C0HA 2YKMA 4RU9A 3EZUA 5E5NA 2AGPA 3HHEA 3JSMB 2VFUA 1KVIA 3NP5A 4I2QA 3BKFA 4D3GA 2W1BA 3SMZA 1ZA1B 1Q0NA 4ZDNA 1X31C 3IAS9 4IG3A 4GKKJ 3OV7A 2DB1A 3MECB 1WHYA 3F0NA 1GAOA 4ZVTB 4X4SA 4U9RA 1UFKA 1VQKS 4JI7J 1RAJA 3OTOJ 1S76D 1KFSA 3UCGA 1ULRA 3KUHA 4ED3A 2DKOB 1XIQA 4ZPVR 2ZHAA 4Q8EA 4R8UB 1YITS 4I6WA 2CZ4A 2FYXA 3CD5A 2WAQD 3KLEA 4WK3A 1KHWA 1TV6B 1KVKA 3B82A 3PRDA 3WHIA 1UW4A 1XBWA 1LWCB 3GIJA 4ECQA 2XZTB 1ZM4A 2V67A 2AYMA 5FDLA 4DPWA 5IQ6A 4EBDA 4W90B 1CS4A 2EFVA 2QIFA 1T05A 3UO0A 3OR1A 4BWMA 2V0NA 2MPUA 2O3DA 3NGDA 4E2FB 4DL5A 2AYGA 3P49B 3J7Z5 1WHVA 2Q1LA 2CA9A 2CPHA 5AE3A 3CCES 2CDQA 2MLZA 5CXTA 1KC8T 3C15B 4OJGA 1U1KA 1TU0B 5HATA 1HL6A 1WSRA 1AUSL 1BHNA 3FMWA 3HVTB 1G3OA 5IZHA 1PC4A 5J1EA 3EDQB 1NKCA 4M5JA 5DZ7A 1F9HA 4U7UK 2BOPA 4DR7F 2HQGA 5GMDA 1IKVB 2VG6A 3HSDA 3TEHB 3J81Y 1NDCA 3RRGA 2M3DA 4PZVA 2BACA 3WIVA 5DQGA 3CJ3A 2LQBA 3C14A 3IM9A 4ZLLA 3I9V9 1TL3B 4H4KA 3K5PA 3NOGA 4NRTA 1JJ4A 2B51A 4JI4F 5KFBA 3ISZA 4MK7A 3TAMA 2KJVA 2N7YA 1TMJA 2CG4A 1HBOA 3LGHA 2EWHA 3DLJA 4X4QA 3OUYB 2HYIB 4DR7J 5FJ4A 4F67A 2UUCJ 1HBMB 2QO3A 4NEYA 4KGVB 1RWKB 3RU0A 1RT1B 3BSCA 1DTTB 1WC1A 2KVQE 3IWXA 2OEKA 4Y2KA 3QIPB 4JI0F 3GSIA 5M2PA 4MIAA 2NXCA 4OI1A 2QT7A 2QV6A 4U95A 3W8PA 1Q7LB 5H9EJ 3ZTRA 4EUVA 4QPXA 3J81U 3CE8A 1J27A 1XERA 3I0SB 2RRAA 1D8ZA 5D15A 1WF1A 4UY85 4YR0A 1OS5A 4DV3F 3I55S 3EGZA 1X0PA 3D1OA 5A6PA 4OMFG 4NZ0A 3VF0B 3H5SA 5LMNJ 3OPKA 2VFRA 1M1KT 3BJYA 5D4PA 1UWBA 2B9XA 3OLAA 2K1RA 2I2YA 1HNXJ 1UZDA 2O67A 1AA1B 2H5JB 2Q43A 1VC5A 2MKIA 1LK5A 1Z2LA 1M90T 2CPJA 2IAJA 5A8KA 3VAIA 3KLVA 4C8OA 4DQIA 3KHGA 1S6OA 3ZTOA 2LLZA 4LF6F 3OR2A 4O4RA 3EVMA 3T9ZA 4NI2B 5LOQA 3KHRA 4LT6A 3H5XA 1H2VZ 2D1CA 4LF4F 3NGRA 3PM9A 4DSJA 3R7NB 2BXJA 1QVFR 4B3RF 4LR7A 4X65F 4P6QA 4PXDA 4XDCA 2FJDB 4NXNF 5IT4A 2CJYB 2IJRA 2EEYA 3SCKE 1VIOA 3DYAB 4P2XA 3TZZA 4EI2A 3NGSA 4OHYA 1YLXA 2XI2A 4ZIWA 5JVHQ 3M8PA 3RBDA 4CCHA 5DG8A 1X9SA 1KP6A 4B3RJ 1EQMA 3NS6A 1T8EA 1NH8A 2BVZA 1LV5A 4H4MB 2HURA 3SIPB 4YUDA 3C19A 3SCIE 3OUYA 2C28A 1PAUB 3RBEA 2YQ0A 5T14A 3Q2TC 3D54A 5C5JA 3O6QA 1VC6A 1PAEX 1Y0HA 1YBUA 3BYPA 4IG0B 3H25A 2GGPA 3C6TB 2LCWA 3D6MB 3QLHB 2H4YB 3AB2B 3CXCR 1WI6A 4ZLPA 4PG6A 2QMXA 3M6WA 1SL2A 4N47A 2V8HA 3KJVB 1RT7A 2IRXA 1WTBA 4UUXA 5E7OB 2MKKA 3PW5A 1F2HA 4NLWA 1SV5A 1W7WA 4B3MF 2HBRB 2YVSA 3V6KA 4OI0A 4MAKA 3BKUA 3BPDA 1U25A 4KGXB 3HVTA 1RGVA 3AFGA 3QNWB 1PYSB 2MQQA 4LUBA 1N48A 3SXLA 4ZP9A 3TQEA 1YG0A 4Q2LA 3TOQA 5JMNA 1QE1A 3ET6A 3UR0A 5D0HA 3SYZA 3V4IB 2XGPA 4WF9Q 1S48A 2IM3A 5HVFA 4DR3F 3DLEB 4HR2A 4U96A 3QRPA 4EBEA 2HFVA 1JLFA 3CC2S 1T05B 4WJBA 3D9BA 1MSWD 1FRMA 2WW4A 2CPYA 1S1VA 3FVYA 3EYZA 1RT7B 2BKPA 3N28A 1RQ0A 1N36F 2NZ4A 1EARA 5IXUA 1LWXA 2N82B 4AXJA 1R8PA 1HBUB 2W2NP 1RT1A 2DNMA 3UFCX 1UEKA 2W2OP 3ENVA 2UU9J 2UVVA 2HZVA 3M2VB 1Q8IA 4O44A 2LXFA 2D3O1 3MPWA 3U7JA 1R0BG 1DJ0A 4YR2A 2ZJPQ 3QSYB 2QMWA 2SXLA 3MF5A 4KKOB 2UXCF 3IR6B 2CJBA 2MZJA 3FUYA 2FZKB 1EZZB 2XYHB 4IG3B 1AB8A 4OZ5A 2AV5A 2VFVA 4O3NA 3G71S 3TANA 1X0FA 3SSRA 5KT2A 4DV6J 4HDGA 2ASJA 1YJ9S 1UVLA 5BXIA 1M0SA 4EU0A 1QM9A 2V69A 3HHKA 3ZO7A 4LF9J 2COLA 3I5AA 4ZVRB 2DGVA 1RT2A 3VHQA 1PG5B 2Y3YA 4J37A 5EUHA 4DV7J 1ZZFA 2H3EB 3HFVA 3OFGA 2DGSA 4M1KA 2GA7A 3W3SA 4LSNB 3AJ2A 2AEFA 2KXFA 3G82A 3JTPA 4B9NA 3KUEA 5KFEA 3LAMA 3VGTA 4AUKA 3GU0A 3LWLA 1YI2S 2J9DA 2YXLA 3PO5A 3KMQA 2ROPA 4HHJA 3W61A 2VC0A 1O6XA 4KIAA 3AAWB 4J9VA 4XPCA 4RU2A 4LRCA 1GEHA 3BQ1A 1J5EF 4BS2A 2VDIA 3TEGA 2MY7A 4M5GA 4OI3A 5HP1A 3L4BC 4DFJA 3GYNA 1BWVA 2F65A 2RD5C 2V8DA 4DCJB 2IIHA 2DHGA 2VBYA 2FVPA 4I67A 3LGNA 3OTEA 3IBWA 3MM6A 1C4CA 3K17A 3FZ2A 2LYVA 3PRBA 3TVYA 2ATLA 5B0BA 2OMOA 3BKTA 1XNRJ 3N79A 1V6HA 2GHVC 2HEKA 2JX2A 4NYPA 2C2MB 4F0MA 4N7TA 4ERDA 2XLJA 4ZCKA 2B4OA 2MJNA 3CGIA 3NWRA 4OX8A 3MURP 1JNZB 1SUQB 1EQ0A 2ROEA 2PO4A 1NJIT 2HHQA 4GRSA 1CC8A 3HHDA 3KLHB 4DUZJ 2E66A 5F8MA 4IH5A 1AROP 2BDPA 1B7FA 5J2PA 3VZIA 1WG1A 2Q3PA 4MFBA 2UUBF 2IY5B 2CQIA 2WSCC 2DRDA 3MEEB 3PR5B 4NYZA 4NLQA 3GONA 3UVJB 1KQGB 1OIAA 1X60A 2CJXB 4ANDA 4WXOA 1TZ0A 2JRSA 8ATCB 5FLXU 1RAOA 3F73A 3EVOA 4G1IA 2Y1LB 1ZAVA 1Q53A 2ACMA 2HZCA 2KM8B 1BE4A 3A8EA 4FYYB 3TRGA 4WKYA 5IT9U 4IOBA 3MUMP 2AHOB 2M8HA 2XMVA 4EFAC 4LFCF 1J5OA 4IDKA 1GH8A 1ELOA 4FKYA 1GX5A 1KTQA 1OSDA 1NH7A 5KFHA 2DNLA 2OO4A 1BXNA 1EETA 4DV4F 1E6YA 1YKWA 1GTEA 3L9ZA 5E3AA 3HM9A 3VGUA 1SQFA 3MAHA 2BYCA 3PHTA 4AQYF 2XNRA 4B08A 2H4WB 2QL5B 2RU3A 1KR4A 2YNGA 3POTA 4RZRA 1NKEA 4V19X 4C4WA 1QUPA 3RAQA 3BPSP 3CDBA 2YKPA 5ETPA 2PA8D 2RKIB 2G2YA 2J8SA 5KFOA 2CXEA 2G0IA 4KHRA 2YNIB 5KFNA 2RQKA 5GAGI 3R8YA 4NCGA 2XEXA 4MYUA 5DS7A 2ZJRQ 4DV5F 1N5VA 2H1YA 2G0CA 4YY3F 3NOCA 3X1LB 1S9GB 1MWQA 1DFDA 2LP4A 1GMWA 3RRHA 4QU7A 1EP4A 4F26A 1JLAB 2BRKA 2VJVA 3RB0A 5E41A 3THTA 1NK5A 4FF1A 1WEZA 4ZVQB 1VQSA 3R3TA 2YY3A 5ETKA 4DZ6A 2AYEA 4X2BA 1GTHA 4Z37A 2XMJA 5L46A 1FVQA 5D78A 4F2SA 2O1PA 1H73A 1VHIA 1P27B 2AJFE 3LOUA 1MNEA 3L3CA 4DR1J 2F4VJ 3RG6A 4YB1P 5DDPC 3L7UA 2QA4G 5AE1A 2J6TA 2NZCA 3OL6A 2ASLA 1Q86T 4ETXA 1AFJA 2B6AB 4B02A 3B6BA 1UWBB 5D6GA 3DGVA 4WTOB 4KH0B 4TNOA 3PNIA 2XM3A 2ZKUA 3R27A 1XMOJ 1RTDB 5CCLA 5IFMA 4OX9J 1HLWA 2DNHA 2RE1A 5CA5A 3K5OA 5K8OA 4DHVA 2KB2A 1WI8A 1LFPA 3BEGB 3ISNC 4KGZB 5IC6B 2DR9A 1TKDA 1FE0A 5L9NA 2MJUA 3BREA 3KJFB 1JLCA 4YEAA 2HG4A 3GE9A 1S77D 1U0SA 2M52A 2YKQA 2LMIA 4DPOA 5GAGU 4DL7A 5H9EK 4KJIA 1MW7A 5A0YA 2DISA 3D28A 4F7VA 1S0VA 2RUGA 5K14A 4GKKF 3BYRA 2BRLA 2V94A 2WVEA 1UPPA 4OX6A 1M1GA 5D3GB 2UUAF 1LW2A 1D0EA 3W8GA 4IOAQ 2HQ3A 3GB0A 1SKSA 3R2DJ 5F8LA 3EDRB 4HLBA 4LVNP 2DY1A 3OVSA 4WIQA 4GKJJ 1TL3A 1HW8A 4B3SF 1QSSA 2P8IA 4HHHA 2MKSA 2F9JA 5T41A 1WOPA 2B9YA 4P74A 1H6KX 3W1YC 2ZH4A 1IKVA 1S99A 4F4XA 2E1RA 2QYGA 1EB0A 3OLBA 3OL9A 3CIZA 2GX8A 3H0PA 1RT3B 1RK8A 3H5UA 3J81j 4BDPA 5KFIA 3KYLA 1NNDA 2VUGA 5I42A 1YIJS 2R2UA 2BBEA 2LDYA 1FX2A 5IS2A 1C1BA 3NWGA 3I0RA 4FXDA 3HKWA 4QWBA 5AXMA 2F8MA 2WB1D 1LXJA 1Q8LA 2IRYA 1MMNA 3NLCA 3UN2A 1AW0A 2BJ9A 2KRBA 5K5MA 3BH7B 4CM0A 4WFAQ 1NMEB 2YNIA 3BGRB 3UR3C 4UZCA 2DR6A 3CVKA 1U1LA 2Y1RI 3FBBA 4DEZA 5F8GA 1VQ7S 2NR0A 4ECVA 4WE1A 2NPIA 2YNGB 3POTB 3H4BA 1JLCB 3DU6A 3O2IA 1I94J 1NPRA 1U48A 2ROGA 1NDLA 3TJAA 2OLWA 2DGOA 1ROFA 2G9OA 4CO2A 1IBKF 1N33F 3N6MA 4JI2J 3UD3P 5JJBA 5G0RB 4YR3A 3KUGA 1IKWA 1CULA 1KHVA 4RPFA 2J0SD 1DQAA 2RAQA 3EX7B 2YKOA 2W7OA 4GVBA 3FJ2A 3QAUA 2GAGC 3BDEA 1S7IA 3PYFA 3CD6S 2I5JA 2RMLA 2OPSB 3MAAA 1ZH5A 5T7LA 3JB9k 4DV3J 5KT6A 5F8HA 2OGUA 1RWXB 3BGLA 4OZNA 4C6AA 1BD6A 3NY0A 1FRKA 2AZ3A 1WOSA 4RNNA 3KXDA 1HNXF 3MMCB 2NUHA 1RT6B 2QE5A 1S9GA 3ITHA 3UD5A 2IJNA 1U24A 2FQQB 5KT4A 3FSYA 3KG0A 3PZPA 3GWCA 4NA3A 4CH0S 1SH0A 2P5VA 3JQKA 3U27A 4DU7A 3IG1A 2IC3A 1WOOA 2PA3A 2XO7A 4WFBQ 3H98A 3RUBL 4Y2AA 7FDRA 2R8HA 2FLOA 1E6VB 2RIJA 4I7FB 4C8MA 4ID8A 1IQZA 3DMJB 2HBQB 1NKBA 4K50A 4N5SA 3RB3A 4X4VA 1NHKL 2UU9F 4A8QA 4WWSA 3O5TB 1V5IB 1V9OA 5J2MA 3NCQA 4L73A 1QAXA 2HNZB 3E01B 1B70B 5EX0A 2FJVA 1FE4A 1J5OB 1VQ4S 1X4FA 2ABYA 2CQDA 2O5DA 1MWYA 3QT5A 4OYMA 4Y2CA 3S01A 3T1AA 4TU9A 3PV8A 1K0VA 4YB6A 3RB4A 3W62A 2R8IA 3PCOB 2QSWA 2KXHA 3J80Y 2ZE2A 3HZGA 2W9AA 4I2PB 2V63A 3OJSA 2EK6A 4B9UA 5KG6A 2XWYA 4FXVA 3A8IA 4LSNA 3RRKA 2X3GA 3H2VE 4C9DA 4RUAA 3IGVA 1QAYA 3PYGA 4DX7A 2OUGA 2YX4A 1HR0F 4OHXA 2DGUA 3GJQB 4JI1J 3OTCA 3MM9B 4UTGA 2W4DA 2A2DA 4LREA 1JB0C 1HNIA 1H0HB 4NZ6A 1RA6A 2IYIA 1C2PA 2VF3A 2XZDB 2ZBPA 3RBZA 5BYSA 2QFIA 1RAFB 4ZOSA 3QQCD 4ZHRB 3KLGB 3OHAA 5HLFA 2RF2A 4MKAA 3QT7A 1WELA 1RHQB 2YKAA 3NKYA 4KKOA 1N52B 3ZZYA 2XG8A 4RUHA 1YBAA 4P71A 3SCLE 3P6YC 3MZIA 2MHNA 4NLTA 4KHPJ 2HSEB 1TUGB 3DI6A 1LW0B 1AUDA 5DGAA 4IFVA 1GXTA 1DURA 1OQ3A 1CBKA 1V3ZA 1YBTA 3LQVA 4I6AA 2UXBJ 1D09B 2ZNZA 5M2RA 3DRXA 3VVUA 1YJUA 2KH9A 1HNIB 2N4CA 3NRBA 4O4GA 3MEGA 2EFNA 2HAFA 4OZLA 3D7SB 7AT1B 4R0EA 4HEA9 2DGTA 2MQOA 3T9NA 5HP1B 4C0BA 1OSCA 5C2CA 4G3IA 4N8OA 1JJHA 4W4MA 2XC9A 3M2RA 4EWTA 1RA7A 1Y9OA 1VLOA 3N0VA 3PFOA 5ETSA 4Q7AA 2YTCA 3H4DA 4QR0A 4XDDA 1RAAB 3HCXA 4DS5A 2CJ9A 3P4UB 1B3TA 1TK8A 3D68A 1SV5B 4LF7J 1XMQJ 3MDFA 4LF9F 3K57A 1ZPVA 3I31A 1VRUB 2QZ8A 2W9CB 1SCJB 4F02A 1NAQA 1SC4B 4TQSA 3CWJA 1WEXA 5IWAJ 4FF4A 2D7SA 1WUUA 5HJYA 4CLWA 4PUOA 1ZZNA 1MG7A 2ALYB 2GCFA 4KH1B 1VQNS 1HQEB 2BOAA 3OTBA 1VQ5S 4IO9Q 4ECWA 3DLKA 1Y5NB 1CEZA 3WX4A 2OFGX 4OFZA 1Y4ZB 2HGMA 5HMZA 3CDUA 2ZH1A 4ED7A 2E9RX 1G1XA 1XEZA 3FGVA 4LF1A 3OJUA 2OD4A 4ZVHA 4AQYJ 2LXIA 2DGWA 3GFYA 4P2MA 3NBPB 2YBVA 4UW2A 4WFZA 4A8SA 1FHTA 2B43A 3VZHA 4Y2IA 2DEIA 2WK4A 3J7YI 1UFWA 2VIHA 1VRUA 2W9CA 1RYSA 2OH2A 1TUWA 2AJ4A 1RTIB 1UMJA 4N56A 1X5SA 2MB0B 2L9DA 3QO9A 4QR2A 3TWZA 4OQJA 3W2WB 2VJUA 2DPJA 4IRCA 4LF8F 3VALA 3SQGA 1IBMF 3NGKA 4C8NA 5DQHA 3SI8A 1M5HA 5BR8F 3QFHA 4ZN1A 4DR5F 3MFIA 2JFDA 4X66F 3MR5A 1NZAA 4UOFA 3K58A 2O66A 5HQLA 4L3NA 5KG4A 3TR5A 2XCAA 3BH6B 1M5KC 4DWIA 1OPIA 2K7KA 2UUBJ 1RWNB 1KLMB 2VG7A 2MSTA 1H74A 3W9IA 1OPZA 4DN9A 4EZ6A 1FJCA 3ETOA 5KT3A 2DT9A 1IBLJ 2UXDJ 4QWAA 4C48A 1RWPB 2XHWA 1H2UX 2EK1A 3OFFA 2OSRA 4CIOA 1FRHA 3KHHA 2FVCA 4DV0F 1D9DA 3IP0A 4G1PA 1YZ7A 3FRYA 1S12A 4NLSA 2MZTA 4OV6A 1H72C 2BKOA 2BW2A 4RW4B 4BBYA 2W9BB 3IN5A 1XNQF 4DR6F 3G8QA 1SKWA 2ZWPA 3AOCA 3N01A 2YX1A 4IKAA 3I9ZA 3I56S 4DV4J 4RWXA 2QL7B 3G8SA 1IUJA 3HJVA 1KFDA 4RKUC 2RU9A 4ED0A 3HP6A 5BYRA 4KPCA 8AT1B 4ZPTR 2WBMA 1JLEA 3NG8A 3PG9A 1L5UA 4CTAA 2XMAA 3A3NB 2APOA 2FVRA 2OMLA 4YB7A 3CJQA 4X84A 3VQTA 2DNNA 2J9EA 3VGVA 4TY8A 3QJPA 2PMZD 3OR2B 3QGHA 3MM5A 1S6QA 4AD6A 1WF0A 2CG8A 3ELHA 2HGLA 2C2EA 2ZZTA 4EYHB 5C24B 4LF5F 1TVRB 1IR0A 2VC1A 2AYBA 2HVEA 2XLIA 1KEKA 2DVIA 3OFEA 1N34J 4ZCIA 2JLEA 2Z8QA 5AJ3J 3NNHA 3AOAA 2IM2A 4K7QA 3BSNA 4QIEA 2K3KA 3W64A 2P6SA 2B7CB 4ZVSB 2ZJQQ 4LRAA 4MYTA 1BC6A 3BQ0A 3FBFA 1ICEB 2UXCJ 2W2PP 5AE2A 5E33A 3GZ7A 3HD1A 4QYRA 1OYDA 2FGOA 3NGUA 4UY8T 4NEZA 4LFAF 2AF6A 2W24A 4HDHA 4KFBA 3QGGA 2OD6A 2QG9B 4ETZA 2NS1B 1RACB 2V9KA 3NAHA 3MAQA 1P1TA 2IRUA 2N3LA 3CPWR 2JLGA 3KG1A 1Q7YT 2MSSA 4KO0B 2ZEJA 5M2UA 1TL5A 2AX1A 2FIUA 2RQMA 4X64F 4V1Ak 2CNOB 1W25A 4WYWA 3QT8A 4ENOA 2BM1A 3LP1A 1X4DA 4QBUA 3OW2R 4DQPA 2MQNA 2BM0A 3M8YA 3BO3A 1HYSB 1Q8KA 4FF3A 4JI5F 4CNZA 4B3TJ 2JOQA 4OI4A 3M4XA 3TX8A 2LQ5A 2ZC3A 4EGLA 3JSMA 4NA2A 4JI0J 4C98A 4B9TA 3C16A 5L38A 5AXNA 1R6VA 1RLCL 2VDHA 2KN4A 1FFGB 2DYAA 2UV8A 4RX6A 3KK2B 4NOHA 1WHXA 2WVBA 3PIPQ 3H90A 1RAEB 1RAHB 5KG3A 2BEFA 4ECRA 1NCLA 2ZWOA 2R7RA 2FB0A 3OXGA 2J8AA 2KT2A 2U1AA 3K8WA 3HHLD 4JI8F 4DSEA 4ED1A 5EGYA 3FQKA 2E1CA 2K8GA 3FFIA 1G7CB 4LFBF 2F8HA 1OQ6A 4X62J 4FNIA 4N77A 3SCJE 4DUZF 1TKXB 1T03B 1NB7A 1Q8BA 4P73A 1LWCA 4N76A 2HRYA 2XY6A 1ZOTA 1T9UA 1HWKA 2HVDA 1LOUA 3DMJA 5EN1A 1CJUB 3A8KA 1Y5IB 4CO5A 2B4PA 1S72S 4X65J 2BJ1A 4G1QB 4IR9A 2K3IA 4KY3A 3HHNB 3SV4A 1C1BB 2VZ9A 5ETRA 2VBXA 3GJRB 4CO3A 2MLYA 3CCRS 3W63A 2RF2B 3D3BJ 1S1UA 2X51A 3HI9A 5KG5A 4ILMA 1N56A 3MM7B 1C0TB 2NXNA 4HVZA 3RJMB 4B3OB 2JWNA 2R7OA 4I2QB 3D6HB 3QAEA 3HFKA 3ONQA 4G65A 4F4YA 1U49A 1VRTA 2K2PA 2Z0GA 5HK4A 4DDFA 2FJWA 3NMAA 3BQ2A 4B9MA 4J9PA 2YNHB 3FQLA 3QSIA 4PWDA 2A2CA 2X1GA 2DCUB 2D3OR 2VPWB 1UCNA 1RWMB 2A10A 5T7LB 1VMBA 2VD3A 3FCHA 1EAYC 3MAAB 4DPXA 3G86A 3Q8RB 1IM6A 2BR0A 3HVRA 1N33J 4PWWA 2C2NA 2YNHA 5I3PA 2CQ2A 2E1AA 1VRTB 1WKKA 3NAIA 2HFNA 1WG5A 2JL9A 1IKYB 4NXMF 4U7CA 2JSXA 3MR6A 4A47A 2HMIB 5CQGA 4C8YA 2ZVIA 5CABA 4K4YA 3QJLA 1JLQB 2CUYA 1X7VA 4MJKA 1PBUA 3G6YA 3PEHA 5EWFA 3C6UA 5F9LA 2QA4S 1IR1A 4JI1F 2ZM6J 1FEEA 3JTNA 2V4RA 2UUWA 2CNNB 1S7HA 4KHPF 1Z2ZA 4NWBA 4OYPA 4M5DA 5GADU 1FRXA 3DOLA 3TA1A 2DR7A 1NBEB 1MLAA 1PYOB 2L9WA 2XY7A 2AGOA 4DSLA 2VOPA 2P9EA 3PY8A 4HTIA 4J91A 1UW9A 1K1SA 4LVOP 1DQ9A 2VL1A 3AODA 1WD6A 2LEPA 2X1BA 2L48A 1N36J 3NEKA 1QDUB 3ZTSA 2E5LF 1UVIA 2VG5B 4FPIA 2ZBCA 1QJHA 3EXCX 2FY1A 1KRPA 1KQKA 2AWZA 1FDDA 2DNGA 2UXBF 5HI7A 3MMBA 4LIWA 4DL0C 2ZDOA 4LRFA 2EFQA 1UJ4A 2YQ3A 5CYQB 1HQUB 4WP3A 3W5XA 1QAIA 4HACA 1U1OA 2VOOA 1Q16B 1RT3A 3CJ4A 1REGX 4HH1A 3TZXA 2F1FA 3I5CA 2KKHA 2NYIA 1KTVA 4Z2XA 2VASA 4ED4A 4JYAF 3IMQJ 1QD1A 4LMZA 3M30A 4ZITA 4DV2F 4DX5A 1VI7A 4WFXA 1XTZA 4OZJA 3GV7B 1CG2A 2V4JA 3SFUA 4ALZA 5HANA 2QX0A 1VJQA 4UOCA 2JC0A 5HVHA 5LT5A 1RWUA 3GCWP 4M63A 5AXLA 4QWDA 4HYKA 3X3UA 4EO6A 5SZTA 1DLOB 2GIFA 5D0EA 1RXOB 3D6TB 1X9WA 1FF2A 2DH9A 1V3SA 4I0WA 2KZMA 4K4UA 3CJ8A 1KOOA 1FA0A 1T9TA 5A8RA 3ZTQA 4B17A 4B9LA 1Y11A 2HNDA 3QYYA 4ZLJA 4Q45A 3PW7A 4URSA 1GQEA 1RAIB 2PC6A 3N6NA 5C2GA 1NUEA 2I9SA 4FS1A 4ZJOA 1R31A 5KFZA 2ZOFA 3V6DA 1VQ8S 1ZM2A 2LKZA 3IM8A 2OJ3A 1Q5YA 2QL9B 1NSAA 2PGCA 1TL4A 4IDKB 5E3CA 3OQ2A 2EXUA 3CCWA 3PJ9A 4L75A 1XNRF 4ED2A 1GFWB 2VBZA 1WC5A 4FP9A 1IVZA 1DBDA 2WCXA 3M1VB 1ZM9A 1L3KA 1TQLA 5F0UA 1M5OC 2AJ0A 2AMCB 1XR6A 2H48B 2B6AA 2LVWA 3AH6A 3CTRA 3S1TA 4YP3A 2RQCA 1UJ6A 1MMDA 2YH1A 2HZAA 4QIFA 4QU6A 1HNVB 2GMHA 1U6FA 4L76A 2RDDA 1UEUA 2HNYB 2HFZA 4M5IA 2NREA 4KPYA 3KJVA 2A1BA 5DZ6A 1HHQA 3OXFA 3Q8UA 2DBBA 2NXJA 1NXIA 2EPIA 1U6ZA 2GJFA 3CB4A 3ZNJ1 3MWBA 3KK3B 1VFJA 3R1HA 2C2DA 4Q8FA 1VJWA 2Y0BB 5ETTA 1N5YB 1KNZA 4Q2MA 3FCVA 2GV1A 2VH7A 2XQCA 2Z57B 3THVA 4DX6A 2E29A 1RBAA 1X4EA 2UV8G 5LJ3Y 4O3QA 4LF7F 5D3GA 2Q66A 2X1FA 5LMUF 2BUNA 3L7PA 2XMUA 1FDAA 1BWEA 2CKWA 1M1HA 2HWIA 4A4JA 2RVJA 2VKRA 2RJZA 3FDSA 1IBLF 2KZZA 3DOLB 5LSOA 4C97A 2CQ1A 1IR2A 4USHA 2N7CA 2DRAA 1F9FA 5I4MA 1C0UB 5A76A 2VFTA 5KG2A 2XLKA 3PR4A 5L1IA 3ZZOA 3ICLA 3DHWC 3LW5C 1FKAF 4I1TA 1R0AA 1VBXA 5LL6d 4ZS6A 3M6UA 3DDKA 3ZZPA 4F4WA 2VG7B 3MTKA 2XY5A 2DO0A 2AZ1A 4CYUA 5HMYA 3IAM9 5D77A 2GQCA 2KM8C 3GG1A 4LF4J 4HI1A 3UPFA 1H2TZ 1S57A 3C16B 2LEBA 4WU3A 2FVQA 2BJDA 1VQOS 1YQHA 2ACYA 2M7SA 4ICLB 4K2JA 3RTVA 1S97A 1FJGF 4CZCA 4ED8A 1LEOA 2BA9A 4A8WA 3CCSS 1UKUA 2YWFA 4PYAA 1CVJA 3PO4A 2QA2A 5HVGA 1Q5VA 4PWDB 5F8JA 2AJ2A 2IDEA 2IM1A 2R4FA 2ZUAA 3QATA 1VQPS 2UUCF 3M8ZA 5ITHA 1S0MA 2HPUA 4I68A 2F5GA 5K9FA 2WVFA 3KLHA 4ECYA 1R8BA 5RUBA 1NRKA 1SB6A 1S6PA 1DTTA 2CJQA 2DNYA 3DXSX 4KO0A 4NCGB 3QZ7A 3FSIA 2IDLA 2BE2B 1HBUA 2BE7D 4PCQA 2HKEA 1T02A 2HFOA 1HFEL 1PSDA 1XR5A 2F63A 5KFYA 1FFWB 2FJEB 4ED6A 5K8MA 2BANB 2XNQA 2H5EA 3B8HA 3DRYA 1X4BA 1JLFB 2DNOA 1CJUA 2DTJA 4D3HA 1OJ4A 3DLEA 4ZCLA 1HQEA 3AQOA 2V6AA 1U4BA 1WACA 4TVAB 4PUOB 3MI7X 1S1XB 5DRKA 3JSBA 4DV0J 1YTYA 3GIKA 2D41A 1WHWA 2YWGA 5HQMA 1HI1A 3K89A 3VAFA 4QYZJ 1AXQA 1FKOB 3MPYA 5B7WA 3H7HB 5F41A 2OSQA 4Y34A 3GP9A 1R6YA 4LBPA 5G4DA 3KK1B 5J2NB 3PFEA 2XS5A 2VONA 2ZITA 3DRPA 3IS9B 2WB4A 3DLGA 2A0FB 2KO1A 1VBZA 2EG2A 3WX8A 3C15A 3Q0AA 4F4AA 1S1XA 3DOKA 4NL5A 1DZ5A 1QSLA 4GKJF 4JBCA 2F9DA 2AEJA 1T9YA 3UVJA 2ZNYA 2M2BA 3TUJC 4CTAB 1LNQA 3MEEA 8RUCA 3PVXA 5DGBA 3FKBA 4CLFA 4P7TA 2CQBA 3D1QA 2ZC4A 4TQRA 2YH0A 3F41A 4HTJA 4OZ3A 2YPZA 1RHUB 4H4MA 3KLEB 3O44A 3TZWA 2J9DE 4RBUA 3W5ZA 2HHXA 3CCUS 3IGNA 4TKTA 2P2CB 4A8FA 2R7WA 4CLYA 1ZETA 1N6QB 3K5MA 5LJ5Y 2R42A 2WRMA 1KWMA 1HWJA 1NO8A 2W4CA 4AL6A 1RZMA 3G9CA 4C11B 4H4KC 1W2IA 1SBRA 2VB6A 2V4QA 4DF4A 3GR1A 3BDPA 1RDRA 2QJ3A 2DD8S 1LWFB 2V68A 1B0VA 1F0XA 3MM9A 4PPZA 1U1QA 3KG4A 4W98A 1NHUA 5IWAF 3FBCA 4X64J 1N0VC 3ET6B 5KFFA 3AXKA 1M5PC 2B8PA 2B9WA 4KV8B 4LSLA 3W7BA 3MOJB 3NS5A 2GJ2A 5D8HB 5KFXA 3W2WA 3V81A 3SZ2A 1JJCB 3I4PA 1PBAA 3NNAA 2XULA 1AT1B 3PHEA 5ETLA 3OSPA 2H51B 2IVYA 2XSJB 1T3OA 3PX4A 4ELVA 4KAIA 4TY8B 3WDOA 3UDLA 4RW8B 1NSKL 3MM8A 1IWGA 3OL8A 2ZHBA 1IXKA 3ZZTA 2HS0A 3KLIB 4JI6F 5MLCV 4E8UA 4KC5A 1HBMA 4M5NA 3TJ8A 1TAUA 4BHQA 1FD2A 4ITSA 3PKYA 2BANA 4UF4A 2CIMA 2FHJA 3Q83A 1Y10A 1Y3KA 2IC3B 4YDXA 3BSAA 1GNKA 4DR5J 2XI3A 3AD8C 2BE2A 3CJRA 2DH7A 2PFFB 4F3OA 4X62F 1FT8A 3MM8B 2D69A 3CJSA 2HBZB 3A13A 3GIIA 5DLFA 3G6ES 1K8AT 5DLGA 1JJ2R 4CLKA 2NQPA 2W25A 3CJTA 4NLGA 1HW9A 2MZRA 3E51A 1S1WB 1U2RA 3JSRA 1U1NA 2HHWA 3EXYA 2MQMA 1X5TA 2CFXA 5KOXA 1VOMA 2D9PA 1F9EB 2HQCA 1TL1A 3CUNA 2F8EX 1T94A 4X4NA 3V5RA 2E5JA 1K9MT 4JP8A 3M8RA 4FVCA 5D0GA 2CPDA 3L7OA 4GVBB 4USUA 3I5BA 2BQUA 1CC7A 2QEXS 3EGWB 3E8OA 4WYLA 1TK5A 5LXYA 2G2OA 4FYXB 2QMUB 1AZSA 5KT5A 1A6LA 5KFCA 3CULA 3WBZA 3QWPA 3ZNUA 3MEGB 5J2QA 4CNYA 4PABA 4A8XA 1RHMB 3W9JA 1RBLA 4KHMA 1R89A 2HRTA 1REVA 1Z1ZA 2L9NA 3IR7B 1W2BR 4C8LA 2PDAA 3M8QB 4NE9C 3BGOP 4J9QA 1EKRA 3M6XA 1N6QA 1FTRA 3D6FB 5KFUA 2Z58B 3H2LA 4OV1A 1CPZA 2RB7A 3PW2A 2BJ7A 3R9LA 2WTFA 2E9ZA 1KDNA 4EMDA 2RILA 1XN9A 3TARA 3QGIA 4BC9A 5KFDA 2UP1A 3M8PB 3ZZZA 3DLKB 1OY6A 9ATCB 2AU0A 1N5YA 2FLPA 3US5A 4USVA 1N88A 1FK9B 1TKZB 1KQSR 2MKYA 1PCAA 9RUBA 3RAXA 1HIYA 4OYIA 1UVNA 3LANA 1YWXA 2XSFA 3H59A 3DOMA 3C14B 1YJ7A 2QRRA 3O3LA 4FN5A 2H9ZA 4HACB 4ZVEA 2MQPA 2R2TA 2AGQA 3RAMA 2ALZA 1UJ5A 1UL3A 4OX9F 1NK9A 3HSZA 5ETNA 2KHDA 3M8SA 4LQ3A 1WG4A 2POKA 1SVDA 2V8GA 4NLYA 3GV5B 4Y2MA 1WKLA 1VISA 1LQ9A 3HHLC 1AYEA 1FKOA 2GMJA 3AT1B 3D0IE 2KG1A 1YSJA 3JAMY 1NEEA 2CJAA 4MK9A 5GVQA 4J9OA 2M5YA 1JK9B 2G13A 2KI2A 5ADZA 3Q8SB 4A8YA 1I94F 3T5JA 3CC7S 1PKUA 3GJTB 1WORA 3T1HJ 1DTQA 5KFRA 3I0SA 1KOHA 2HVHA 3MMAB 2IYGA 4ANCA 3SSQA 4E98A 3W2VB 1XQIA 1SXLA 1YZ6A 5A0YB 2D74B 1BQMA 1PILA 5KFJA 5KAKA 2FPHX 3MXHP 3G4SS 2JFKA 2LA6A 1IBCB 4TYAA 4IFVB 1FI4A 1S6PB 4W92B 2DNZA 1JXLA 3UQSA 4LRBA 1SC6A 3DI6B 5CYMA 3D3CJ 2X1AA 2IBKA 3DGPA 2CRLA 3KNGA 3ULHA 1HBOB 1TAQA 1U8WA 3DXBA 3GPAA 3MMCA 1NZ8A 1OWXA 3DM2A 1NJYA 2J6SA 1DRZA 2LA4A 1X4GA 2R8KA 2VBWA 3HULA 3I4HX 2FLNA 1LWEB 1Q78A 1XJWB 2XMMA 2V8VA 5E3QA 5K8PA 4MKBA 2QLBB 3RB6A 1HI8A 4JOUA 2QTWA 5ETQA 4DQQA 4IH7A 1ZTTA 1NK0A 1ZTWA 1UZHA 3UDEA 2FHOB 2YWEA 3FZBA 4PKDB 4RNOA 1DY3A 1SH2A 1PJ6A 1WF2A 2GVZA 3AJDA 3BS9A 4M5LA 4O0NA 4Z7YA 2RNEA 3C46A 3EVWA 1RT5A 1HWUA 5A2QY 1O0PA 1SJRA 4RBVA 3QZ8A 2G2ZA 2R3VA 1LWEA 1HQUA 1R8HA 2E7WA 1MN7A 2HS4A 2V34A 2VV5A 3EWGA 3ILLA 4NZ7A 2HFUA 4TN2A 5BJRA 3PIOQ 2KFYA 1I51B 2ZH6A 1RTJB 1ACMB 1N54B 4HT5A 3V4MA 3BSOA 2KYZA 3VAHA 1YDLA 4OJ3A 3GFXA 1TL7B 4QWEA 3UD4P 1R43A 2A6MA 2OPPB 2XYGB 3TW0A 2LECA 4J9UE 1SJ4P 4NLVA 1Q95G 1QSYA 3D4JA 4MT1A 2UVWA 2E5IA 4YOEA 1RCXB 2FUG9 4GMKA 2OPQA 4P52A 1X4AA 5FDLB 2YKNB 3K5NA 3W2VA 4K8RA 1HPZA 5KFKA 2MY8A 3VCDA 3KLFA 1O51A 3AXMA 4H54A 1E6VA 4R8UA 1CJKA 2V2KA 5ETOA 1K73T 1RU2A 1TL7A 1T9WA 1U09A 2M70A 5B09A 4IRKA 3KDOA 3MHYA 1T7PA 2ZHOA 3DLLQ 4B3MJ 3KK3A 3PX0A 1BQNB 4RW6A 1S9FA 2BKNA 4EK2A 1RTHA 4URGA 5I3QA 1S59A 2VODA 3C8YA 2R7SA 1HKAA 3AJ1A 2CPFA 5B0AA 2LQ8A 4O0IA 3JYTA 4P2SA 1WC3A 2XTJP 4F4ZA 4HT7A 2Z30B 3E3XA 4GO7X 4HL9A 4USKA 3CCZA 1LFWA 2HVZA 3FC9A 1FWPA 1SQEA 3TAPA 2W2MP 4TU7A 2AQ4A 2J7WA 3M05A 3CJKA 1WC4A 2DXFA 1KQFB 2W2QP 2QN6B 2RUSA 2B5JA 3GIRA 3ZFVA 6FD1A 4EYIB 1Q81T 1TUVA 5EX3A 2VHGA 3M1VA 3B78A 2KDOA 5J1NA 3T19A 4DSIA 3R7BB 4C2MA 4YHHF 3ZTPA 5L9XA 3QRQA 3LPYA 4A8KA 2FTRA 1U2FA 1ZAWA 3W66A 5A8WB 4P75A 5F8IA 3JYTB 3P45B 2Y1IA 2GZOA 1S1UB 5DM7Q 5KT7A 5L1JA 3MPVA 3ENAA 3CDEA 4PQAA
chains in the Genus database with same CATH topology
4C3MA 1N32F 2VA3A 4KFBB 4ES1A 1FNXH 1D3WA 2WHOA 3CJ2A 5A8RB 3PW0A 3Q24A 4USJC 4XPEA 4ED5A 2DNQA 2C2RA 1FERA 1Q4RA 1S6UA 1DLOA 3QWUA 4ECXA 2JEIA 2DHXA 2QSFA 3K5LA 3M6VA 2W8KA 1BQXA 1SIWB 3PW4A 2I0XA 2CQGA 3T5HA 4NA1A 5CZXA 1NK8A 1HBNA 2GQQA 3BGRA 4TLRA 3VR1A 2DCLA 1XMQF 2MKHA 4NMLA 1HMVB 5B0CA 3GILA 4M94A 2HAIA 2IBOA 3I0RB 4OZ0A 2MKCA 2JHEA 4DV6F 2J7UA 1S6QB 4LIRA 1D9AA 2CPZA 2EI5A 3OBIA 1FDNA 1HA1A 4PG5A 2MGZB 4B9VA 3J7ZT 1H98A 1O5JA 2PI5A 1FCAA 5CZVA 1FK9A 1TKZA 2C3YA 5EDWA 3BO4A 3HK2A 4ZP7A 4I56A 2J9CA 1IJFB 2VG5A 4ZP8A 3CIMA 5LXRA 5C25B 2BV3A 2GC8A 3SFGA 3NNCA 2YNFA 2RKIA 3HJFA 1HYSA 2HIQA 5D4LA 4AL5A 1S0NA 4RW7B 2C3OA 4RW9B 1NK6A 4FBUA 4DL3A 3RW6A 2CYYA 2CQ3A 3U1MA 4JUZA 2E1MC 5GAHU 4NLPA 2ADCA 2M88A 4PPDA 3DHXA 3TYTA 2LQ9A 1FXRA 5CYJA 4QWCA 3MMAA 2AX0A 4ECSA 4MTPA 2BABA 4Q0BB 3GFHA 1TK0A 4E0DA 3AHPA 5FIIA 1WTFA 4DSKA 2XS7A 4WZQA 2LXUA 2DK2A 1S0OA 2B4UA 2D9OA 4Y0FA 2B5JB 4FZVA 1TL1B 3S7RA 4DQRA 2ZBIA 2KJWA 3IO1A 1UA0A 2C3UA 3PACA 4PXBA 3T5KA 3K0JA 2AW0A 2RDIA 4PRFA 1U1PA 2J6UA 2NSBA 1CLFA 1UA1A 1NJWA 1QAJA 4PQUB 3PJWA 5EHHA 5L1LA 5CHCB 3OHBA 4U67Q 2MZQA 4QW8A 1VQ9S 1JLAA 5L39A 3I87A 2XS2A 3VAGA 2PN6A 2NUUG 4G1QA 5HO4A 5KG7A 3B4MA 1X9MA 3SDEA 1FVSA 4F4KA 2M9KA 1V3RA 2CPIA 4FXWA 1F2GA 2M4MA 2HHPA 3MM6B 4KBIA 4ES3A 3THPA 3UW1A 4RW8A 1TFYA 3T3FA 2MQLA 3R5AA 4ECZA 3CMES 3ZZUA 2OPPA 4X4TA 4RLEA 4DN0A 4O3SA 1FEHA 4KB7A 5E0OA 2HHHF 5DM6Q 1JIHA 2DR5A 2HRUA 4F50A 5J2QB 2FJBB 2OPRA 2ADBA 3DRPB 2NXUA 1S79A 4QW9A 1HWIA 4KGMA 2IJFA 5GADI 4I4BA 1XMBA 3CDAA 3IC1A 3MD3A 3J7YU 1LWFA 2RDJA 2IMWP 3IWLA 1FDBA 4O4GB 2GIRA 3CCVS 1SI9A 4U6PA 1TR0A 1IQTA 5LSRA 1H3DA 2EVZA 3RW7A 2WSEC 5H9FJ 2C3PA 2LDIA 3CCTA 2MKJA 4Q43A 2ZZNA 4XO0A 5KFWA 2B0GA 4A8MP 3RYLA 5HBMB 4O3OA 2DJWA 2I38A 3VWSA 3NBPA 2OFHX 2KU7A 5KFLA 2ERRA 4KRWA 2J0WA 5HLFB 2J0XA 2V5HG 4QOTA 1SJQA 3N9UC 4ID5B 4ATNA 2PE8A 3G6XA 2OAUA 4J9KA 2W7AA 3IR5B 1U6BA 1VQLS 1FJ7A 3MEKA 1CQNA 3MUVP 1M5VC 4MIWA 3OTOF 2DHAA 4TY9A 5KOWA 4PG4A 3V4IA 2OP5A 4ZKAA 2PIIA 4ZA1A 1BY9A 1BLUA 4ZMMA 2VG6B 4K4TA 2ZD1B 2FDNA 2CQHA 3V81B 3CCQS 4IFYB 1F60B 2HNZA 3BR8A 4LSLB 2WBRA 2WOMA 4K4ZA 3K8VA 3EPGA 2VQEF 2R2SA 2R7QA 2Q6CA 4UQTA 5KFSA 5GAEI 1L3UA 1D1UA 4GC7A 1XR7A 1C0UA 3CJ0A 4KGKA 4K4WA 3BN4A 2FLLA 3WC2A 4IQXA 1B0TA 1F5AA 2R7XA 1NHVA 4DLEA 3HKZD 3ZZ0A 2E5GA 4WZMA 1DAXA 4OI6A 3TUZC 1JXEA 1NJZA 2FD2A 2P9CA 1HI0P 2HHWA 5GMKa 4WFNQ 3SSSA 5GAHI 4DLGA 4K4XA 4O44B 3PEJA 3BR9A 3GMGA 3M2VA 4WCEQ 3HHLB 2FHJD 5L8RC 3NCRA 3C2PA 2UVUA 1F5BA 2JJ4D 3UE2A 4JV2A 2LU1A 5JUMA 4FPRA 2KVIA 3I96A 1IM4A 5FLXY 3M9NB 3GFZA 4A48A 3OTDA 4DL6A 3TQ1A 5IT9Y 4HH0A 4CI0B 2DGXA 3FEZA 4A46A 2E7XA 4QCLA 5HROB 4RNMA 3H40A 4M8LA 4L6V3 4HI2A 5EWEA 1FO1A 2JH3A 2R7VA 1RI7A 1U8SA 5KFPA 2R2RA 1IJEB 2A18A 4F2RA 1N5SA 4Q0BA 4QR1A 3D2WA 2DGQA 4MIBA 2LU2A 3AA8A 1SJ3P 2GIQA 4QQBA 1VBYA 5J2MB 2I8EA 2HQIA 2MYFA 4K5SA 4Y00A 4DMZA 4R0JA 5F8NA 1FHTA 4ZPCA 4HKQA 2IA6A 2GJIA 2YWHA 3NCPA 1HNWF 4C7QA 4IG0A 1YVFA 1DQ8A 3LP0B 3KOAA 4RW7A 2ZH8A 4F3QA 1P6TA 1TFWA 1JLBB 3TNVA 3LH2S 2DHSA 2B7BB 3FRZA 3O8WA 4CH1A 1YHQS 4Q8FA 2C22A 2GQ2A 4MMOA 3DRRB 4AL7A 2MZ1A 2XSJA 1ZYQA 4O23A 2NSCA 4GC6A 3MEDA 5J1EB 2MDAA 1UAWA 3PDNA 4NLDA 1TKTB 4RWWA 4ZK7M 3S8SA 3N6LA 1RKJA 3KNAA 2HLTA 4J9LA 3LP2B 3DDNA 4ICLA 4Y6IA 1IKXB 2XBPA 4H4OA 1T3NA 2CQ0A 2R7TA 3OL7A 2EFOA 1B0PA 1S1TA 3QGPA 1U47A 5A6WA 2IVMA 3IRXB 2HW3A 4RNHA 4MK8A 3TA2A 5KFGA 3G6VA 3D1HA 1UVJA 2KT3A 1H38A 2K7JA 5EWGA 1R0AB 2U2FA 4F8RA 1Y5LB 5D4NA 4K4SA 1MU2B 3CSKA 4M5DB 1N8RT 1CSJA 2VFSA 1SL1A 1P1LA 4OLPA 3GR0A 2M8DB 4QIGA 3M2UA 2JEJA 3KMSA 4I6YA 3VQSA 2WONB 2EG1A 4USIA 4DF8A 1B64A 4ZPBA 2EFPA 2GFFA 5B0GA 4ZHRA 1T95A 5DDOC 2KHCA 4DX8H 1NU4A 1R8AA 2FC9A 5A8WA 5DG9A 1IN0A 2RH3A 5H1SV 4IQMA 1I6JA 1A7GE 3DOKB 2XMWA 4ECTA 3F56A 5CYQA 3MOZA 3CEDA 3DN9A 3MEDB 4TLQA 1HNVA 2LEAA 3N5BA 1EP4B 2EBGA 1Z4UA 4UUWA 2HWHA 3Q22A 5I3UA 3R1LA 1JKHA 2BQRA 4X4VA 1HMVA 2MXYA 4AXIA 3MM7A 2QLWA 3CO9A 4B3OA 4DL2A 1RTHB 4DV7F 3R5BA 4C8KA 3S6EA 2HHVA 1TP7A 4DSFA 2XZWA 3QPIA 4KR0B 2HHSA 2F3JA 3OVAA 2ZH7A 3LP0A 4I7FA 2DNRA 4WTYA 1FRIA 4ZCMA 1WEYA 3K2YA 1HPZB 1U7LA 2N4DA 3V6DB 3IG1B 3A1YG 4K59A 2R9LA 4IO1A 3Q8PB 2GNKA 3KTQA 1JLQA 2JZ5A 3TVKA 3KKFA 3T6JA 3MR2A 5L1KA 2R8JA 4OIXA 2HMIA 4DR4F 1SJ1A 2IFXA 4NLRA 1S4FA 4FBTA 2DH8A 5HROA 4IOCQ 1SL0A 3U1LA 3BO2A 3M30B 3CJKB 4AE5A 2FJXA 2DIVA 2OKQA 1P9QC 4JV5F 3D0HE 2B56A 1RT4A 4ELTA 5IT0A 4QJVA 4DR2F 4C8ZA 3P96A 1SKRA 3LO3A 1UEVA 4I64A 4RBTA 4DFMA 3D0GE 1C0TA 5F0WA 5KFVA 1FD8A 1MMLA 1FRJA 3HDSA 1FTCA 1P8GA 5B08A 1SUQA 1UP1A 2WONA 4DUYF 3HHLA 1S9EB 3QMQA 4Q5VA 3M2UB 3EGNA 1KLNA 2XMKA 2ZFHA 5IQQA 1UVMA 2F7VA 2IVFB 5GAEU 1QVGR 1VIXA 4MH8A 2E9TA 3I32A 3CC4S 1TKXA 3U1NA 1T03A 1JNRB 2FVSA 3CD7A 3MTJA 2G4BA 3R5DA 1LK7A 5U47A 2W8LA 4R5PA 2PI4A 3TI0A 1S1TB 4WK1A 4YFUA 2DNPA 2MHEA 5B0FA 2D3UA 3T1YF 1IKXA 1RTJA 2FHKA 4H4OB 3SEOA 5DG7A 1C1CA 1HD1A 5JXSA 3IFEA 2ILYA 5BYQA 4ZP6A 4EZ9A 2HNYA 5DQIA 5AJ3F 4CO4A 3T5LA 2IMOA 4TYBA 1RT2B 4XIUA 2VPZB 2DR8A 3DRRA 2ZZMA 2HHTA 4ZVFA 3J7A1 3PX6A 4CQ1A 1LXNA 2WSFC 3DRSB 4RNFA 1K1QA 1JLBA 1FKPA 2MMYA 3F44A 4YB5A 3LP1B 4DR1F 4R25A 2F4VF 1MROA 2KXNB 4ID5A 4QPTA 2L41A 3O1LA 4OJ1A 5K14B 3UDCA 4EBCA 3I6PA 2BJEA 2YWKA 1FJEB 4X4PA 2OTLS 5K8NA 1XMOF 3AY0A 2ZH3A 3HZEA 4O3RA 4LQ9A 3TP2A 3MFHA 3FSXA 4O3PA 2P9GA 4YQWA 2PT0A 5C42A 3HO1A 1KN6A 1QE1B 2F40A 1APSA 1G6BA 2AD9A 2HHUA 3GG0A 2AJ1A 1FXDA 2UVRA 1VGYA 4TU8A 1M5SA 1N4LA 1UVKA 4NLOA 5IM0A 1YJRA 5I3UB 3DFEA 4FVMA 1UFLA 4C3LA 5HN0A 2RS2A 2HWTA 2FC8A 5DETA 1WNEA 3FMBA 2W4PA 5LMNF 2CZVC 1S1WA 2RS8A 1R7IA 2Y1JA 1YJWS 3HXMA 3JSYA 3RR8A 3C6TA 3BGUA 2EFGA 2JVOA 1R3NA 2XGQA 4RUCA 3WZ0A 4GO5X 3PJXA 3Q23A 4DL4A 1GXLA 1OO0B 4CH7A 1VQMS 5E2QA 4PG8A 3BM7A 4Y28C 3MD1A 1NK7A 2HLUA 3DU5A 3OXLA 3V2UC 1MU2A 1REVB 1Q82T 3HF5A 1UETA 3HVAA 2JVRA 5DDQC 3K7RA 4KT0C 1VC0A 1S1VB 2ASDA 4DG1A 3P5TL 2WOMB 1NK4A 2JC1A 3AQPA 3L09A 4N41A 1FNOA 4JV0A 2IAJB 4CT9A 5A8KB 3CD0A 2UZAA 3NMRA 1VHFA 2K1RB 2XCPA 3LP2A 3VAMA 4KE5A 6FDRA 4IRDA 2E5HA 1TKTA 2UXDF 1C4AA 1JMTA 3AA9A 4K2XA 2Q6BA 1RTIA 4FF2A 5KFTA 1JWWA 5J2PB 2VPYB 4DG1B 2GO9A 4C11A 1X5PA 4FYDA 1S10A 1YJVA 1Q79A 1QUVA 5F3TA 3M9OB 1RYRA 2OIHA 1N5QA 1YRUA 2W7PA 1JLEB 3I82A 5E3RA 2FHMA 4KQZA 2VQFF 1H7XA 5HBMA 1AFIA 3ENQA 4G6VB 1RP5A 1XK8A 3UWTA 1KD1T 3GIMA 2QLXA 4ZPWR 2YNFB 2XWXA 4OLOA 2ZM6F 2Q79A 3IWNC 1LKZA 2ZUGA 4K0KF 1JLGB 3H5YA 1HHSA 4QIWD 4DJBA 1YJNS 2J5AA 3CCMS 2Z4PA 3MMJA 1SIZA 2ZOMA 4DSJA 4NRUA 1L3VA 1GXUA 1U26A 2BZ2A 2XB2D 1N5TA 4X4RA 2QYCA 4I2PA 4Y3CA 4KV8A 1GT8A 1F5CA 2EKYA 4PR6A 4IFYA 4OZ1A 1PO6A 1VQYA 4QZVB 3KK2A 3GQCA 3CCLS 4WKRA 3T6BA 3KK1A 4EEYA 2ZD1A 1Y7PA 3CDWA 1YRXA 3E01A 3EUNA 4UQGA 2UUCF 3C3LA 2IM0A 4JI7F 4OHWA 2DNKA 3HLUA 3DLHA 2EW9A 1WWHA 3VTIA 2BQ3A 4ZPDA 2OTJS 4DOZA 3SQGB 3R5CA 4J5OA 5F3ZA 5E3PA 2I1RA 1ZBTA 1U1MA 4K5RA 3IRWP 2E44A 3KHLA 2XMTA 2ZH5A 1LW0A 4IH6A 5KTQA 3Q8QB 1S49A 2YX7A 3LUYA 2ZDPA 4PQUA 2CPEA 1L3TA 1FKPB 2VPXB 3OVBA 5B0DA 2ILZA 2YKMB 3FEYB 3DRSA 4C3KA 3G96A 2R7UA 3UNGC 1ZPWX 3TUIC 5CD4H 4OI2A 2NLWA 3TO8A 4FNHA 3KFWX 1Y00A 2I5JB 2CQPA 1HHTP 3BN7A 4ELUA 3N5FA 2L3MA 3BGFA 3DLGB 2ZH9A 4J9NA 3IS9A 1IKWB 1TVRA 5J2NA 5C24A 5HQ8A 5G0RA 1YGYA 4URQU 5B0EA 2OPRB 1FRLA 3TVZA 3MM5B 3T1HF 3CT9A 2EC0A 1C1CB 5F9NA 3VAJA 4QIVA 1I1GA 4YMEA 2CVIA 1FESA 5FD1A 1VK3A 2KFZA 1URNA 3ENWA 2GGPB 3QLHA 3G8TA 2RT3A 3OR1B 2MZSA 4DFPA 4RW9A 5HMXA 2KTQA 4JI2F 1JX4A 1JLGA 1FNMA 1MWZA 1R8CA 2GHWA 5DO2A 4ILRA 3V6JA 1XC9A 2ZVSA 1TV6A 1N0UA 2IHR1 3BF4A 3BB5A 4CO0A 3HX9A 4RW4A 2W9BA 2C42A 3IA0A 4DS4A 1U45A 2JEFA 4K4VA 2HHQA 1R27B 3PKMA 2GMLA 1KS2A 2G1DA 2EBEA 2PSZA 3H8YA 1X8DA 2RRNA 3KWMA 1SJFA 4OX7A 3DYAA 1CQMA 4DQSA 4CO1A 4NX9A 3MECA 3IXQA 5I42B 4XK8C 4KTQA 3FNNA 4I69A 2M0GB 5AXKA 3N4WA 4IR1A 3P3DA 2RRBA 2N3OA 4X4OA 2MGZA 2ZKTA 1H7WA 2OPSA 1KLMA 2O01C 1RJJA 2QA1A 3RR7A 3UCUP 2RSQA 2QFJA 1SH3A 1XWLA 5CCMA 1RT4B 3QIDA 2KG0A 5IM0B 2HGNA 2Z2MA 1KSPA 1DARA 2FGCA 5HMWA 2D3ZA 1ZM3A 2ZE2B 2FJAB 4PG7A 1HBNB 5MAOA 3FEXB 3LGMA 4X4UA 4BCAA 3QO9B 1Y3JA 5CYMB 1HD0A 4NCAA 1X4HA 2GO8A 4WE1B 3HVWA 4IUFA 1Q1KA 2HS3A 3QIPA 2HNDB 1VLYA 2PMHA 5KFAA 2V9WA 3H2UB 2CJKA 4F3MA 2P6TA 1YJTA 3LALA 4ES2A 2Z2LA 2DPIA 1PGZA 2L08A 5KFQA 4PXEA 2JEGA 4L72B 3SDEB 1FXLA 4KSEB 4F25A 3TAMB 2ZOGA 3DNCA 3MCSA 5J1PA 2GW8A 2AP6A 2B4VA 3PXGa 4P7VA 3GSDA 5C25A 4AYBD 3M32A 5KG0A 1K0TA 4OHVA 3RZAA 2C3MA 1O8BA 1HARA 1RT6A 1VS3A 1QY7A 3D5MA 3ITHB 4N8NA 4XAKA 4JV1A 2DO4A