4RBUA

Pdua k26a s40q mutant, from salmonella enterica serovar typhimurium lt2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
EALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGQGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica serovar typhimurium
molecule tags Structural protein
molecule keywords Propanediol utilization protein PduA
total genus 18
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rbuA00
3NWGA 2A1BA 3MPYA 2G13A 3I6PA 3NGKA 3VCDA 3MPWA 4AXIA 4RBTA 3CIMA 4OX7A 3BN4A 3CGIA 3I96A 4OX6A 4QIVA 4RBVA 4DDFA 4RBUA 3N79A 2A10A 4OX8A 4LIWA 4OLPA 3SSQA 4P7VA 3DNCA 5L38A 4P2SA 2EWHA 4QIFA 4AXJA 4PPDA 4P7TA 5DJBA 3DN9A 4QIEA 2A18A 3PACA 3SSRA 3H8YA 4OLOA 4QIGA 3SSSA 3IA0A
chains in the Genus database with same CATH superfamily
1H2UX 3C14B 4WIQA 4EMDA 5HP1B 2B5JB 2Y8WA 1RWVB 1Q7YT 2DEIA 5FJ4A 1UWBB 2BW2A 4XDCA 4K4VA 5EDWA 2HGMA 1VI7A 3W2VA 5KFDA 2EBGA 4EO8A 1TMJA 5L39A 4OZNA 5E3AA 2HHSA 4DU7A 4R8UB 2MDAA 4MKBA 4ED5A 5ETTA 2JEGA 4B3OB 3HHLB 2PMHA 4IFVB 2F63A 5KT4A 1FJCA 2WVDA 1Q1KA 4Y2IA 2IMWP 3OHAA 3DDNA 2VICA 4I64A 1S48A 4ICLA 1NLKL 1Y5NB 1S49A 2V2VA 2XULA 1V3SA 3MCNA 4C8KA 5EWGA 3W5XA 4I69A 2FJVA 5KTQA 2LKZA 4ECZA 2E5IA 1EETB 1PJ7A 3B4MA 3D54A 2R9LA 3BR9A 5ETOA 2BABA 1I94J 1RHQB 4DR3J 4ECWA 2E9TA 1R43A 2XB2D 2O5DA 3MM5A 3TVYA 1EETA 3AFGA 5BYRA 3FBCA 1LWFB 2XSJB 3QBCA 2OTJS 1VFJA 3LALA 1RHMB 2R7OA 4LF2A 4X62J 1FWPA 4IDKB 3W63A 2DO4A 2EBEA 1O8BA 1WF1A 3O1LA 3A8KA 5GVQA 3ZTSA 2ZH1A 4DR5J 2PI4A 5LOQA 2KHDA 4LF8F 1OY8A 3DLGA 2ALZA 3RAMA 4ZHRB 2H3EB 2BUNA 1L3TA 1KQGB 4JI2J 1M5HA 4P2MA 1WELA 4RZRA 3L7OA 2KXNB 1ELOA 3FZ2A 4FF1A 1FNXH 1D0EA 1UVKA 3UN5A 1JWWA 1JKHA 2ATCB 2CKWA 4KGVB 1KTVA 2V6AA 3B54A 2F8HA 3SMZA 2DRDA 4YQWA 1TP7A 3TZXA 3BREA 3THVA 1DAXA 1SIZA 3M32A 4CYUA 5RUBA 1RAJA 3FMWA 3TARA 4FYDA 5J1EB 3M2VA 4DL3A 3OXLA 5IQQA 4CLPA 4EZ6A 3MOJB 1HBNA 2OPRB 2V0NA 1KSPA 2YTCA 7FD1A 1G1XA 4OZLA 1Q8IA 4C0OC 1VRUA 1KDNA 4Y2MA 4ID8A 2YNGA 1M5OC 5L1IA 4C8MA 3Q2TC 2COLA 5A0YB 4WXWA 4DPYA 1U49A 3B8HA 1RT3A 1VJQA 4WU2A 3D2WA 3GP9A 4NLSA 1C1CB 3M6UA 1RCXB 3THPA 2ZBIA 2QA4G 5SZTA 4BBYA 4CM2A 5KOWA 4DL2A 3PKMA 2CZ4A 3EUNA 2CUYA 1YQHA 5IM0B 2IDEA 4P72A 3PRDA 2H5IB 4OYBA 2I8EA 2W4CA 3ZZUA 3FBBA 2JEIA 2IPOB 4OI4A 1G4CA 5ITHA 1FE4A 5C2CA 3FKBA 4TU7A 3FSYA 3MTKA 1TL1A 4N8OA 3BZQA 2ROGA 4HHUA 1S6OA 3BSCA 2NS1B 3SQGA 6FDRA 3UCUP 2NSBA 2OELA 5K8PA 2H1YA 3Q8VA 2NXCA 2WBRA 4DR7F 2EG1A 2H51B 4TKTA 2D69A 4ZJQA 5HK4A 1J2VA 1C4AA 1O0PA 1T9UA 1IBLJ 3B6BA 2IM0A 3GG0A 1UEUA 4HR2A 2OKQA 1UWBA 3R5BA 4MIBA 2XLJA 4NLPA 1IKVB 4DR4J 3TA1A 4JI3F 2ZBQA 1D3WA 4NCAA 2VFUA 1RBAA 2YQ0A 3ELHA 3NGRA 1HNXF 3NBPA 1HR0F 1GXLA 1H7WA 2MGZA 2G1HA 1VQ5S 3MXHP 2FD2A 3K7RA 4NPOA 2AYEA 1MU2B 3GONA 4PG7A 2L3MA 1RGVA 5IM0A 1HNIA 1RWOB 2VG6A 2X1GA 1KBRA 4UT4A 5KT3A 2ALYB 1U1RA 1FRIA 4N76A 4WZMA 1VRQC 4C97A 4OLPA 5DDRC 2K3IA 1RTHA 1Z2LA 1IR2A 2EFQA 3GCXP 4DR3F 2JDJA 3BM7A 3QSYB 3RBEA 4WF9Q 3VGTA 1NJIT 2HLTA 1NB2A 1TL1B 3JB9k 4K4YA 1T05A 2N4DA 4LUBA 1XEZA 4AFFA 2CADA 1DRZA 5CHCB 2XGQA 3ZFVA 4J9QA 3CVKA 4QQBA 5JVHQ 4JI0F 3CPWR 1GH8A 4G1QB 4ECTA 2PT0A 3RRHA 3M2UA 4WJBA 3VVUA 1RT4B 3I6PA 2E7XA 4I7FA 3D3CJ 3DOLA 3H7HB 3I0RA 4JI1F 3IXQA 2YY3A 5A76A 3VZIA 5KFBA 3ENVA 3T3FA 3QT6A 2DK2A 4PQUB 4NLWA 2EEYA 2WB4A 2DGTA 3SQOP 1PBUA 2DNLA 3PFEA 4DLGA 3DC2A 1X0PA 2MKIA 5F8JA 4AE5A 2IA0A 2OAUA 3C6TB 4ZVGA 5HATA 2UVWA 1S77D 2BACA 4L3KA 2HRYA 5GAGI 2B9YA 2VG6B 3DOLB 4MJKA 3UN3A 4CT9A 4EK2A 4W98A 3A3OB 1CQNA 1P9YA 1RA6A 1BXNA 3L7PA 1NJZA 3MD3A 3GFXA 3UDVA 4Y00A 3LP1A 3QLHA 5H9EJ 2D74B 3F56A 2XCAA 5E3QA 2AIRB 1DY3A 2E1CA 1WOOA 3LP0A 3HDSA 2WVFA 2OMOA 1SKWA 4MIAA 5B08A 3C6TA 2NYIA 5LJ3Y 5C24A 4IOBA 1FFSB 5G0RA 2LLZA 6AT1B 2MB0B 4JV5F 2ZVIA 3TEGA 2ZH4A 1U09A 3Q8UA 2VA3A 2RIJA 3VAKA 4FN5A 1CJVA 2MQNA 2FHOB 2JVRA 2GHVC 5CYMB 4M5NA 3G6VA 4ER8A 3DN9A 2PC6A 2O66A 2MHNA 4UOFA 3D5MA 1LQ9A 1MN7A 1FNMA 1Y10A 4LF4F 4JV0A 5HI7A 3IN5A 3NNCA 3W9JA 4KKOA 4FNIA 2O1PA 3KLVA 1FX4A 4DCJB 1PC4A 4DV6F 3W65A 4QWDA 2C1EB 3CCUS 2I1RA 4NL5A 3DCAA 4LF1A 1F9EB 3KKFA 4A8WA 3QMQA 1VQNS 1KLNA 3DGPA 1KFSA 1FKPA 3M8RA 3HT3A 2KZMA 1GEHA 4HH0A 3KLIB 4ZVOB 1M5KC 4DCPB 1UJ6A 2W8KA 3LW5C 3G6XA 2GIQA 4KFBB 5IWAF 1Z2ZA 3H20A 4MFBB 2MKKA 4HEA9 1VQ8S 1WD6A 4DSLA 4V19X 2E9RX 1IKWA 2U2FA 3KHRA 4ES2A 2VHGA 4NZ7A 1CULA 5HMXA 4GO5X 1RAFB 2XYPB 3CD5A 4KFBA 5I4MA 3Q8PB 6FD1A 2FHJD 5L1LA 2RQKA 1N36J 1RSCA 1KONA 3A4TA 4EFAC 4KC5A 1PILA 2L9WA 3D1QA 4WFNQ 2UXCF 5LXRA 3MCSA 1P9QC 1UW4A 2VIHA 2BJ8A 1AFJA 2G0CA 2VPWB 3W9IA 2V5HG 1T3NA 4ZVRB 2VJVA 2RQ4A 2XYHB 2YWGA 1S1VB 1ZBTA 4YB7A 1TFYA 1OIAA 5DGBA 4WP8A 3QGGA 2UVRA 2J76E 1IR0A 1L5UA 2SXLA 4J9RA 1J5EF 2V4JB 3MPUB 2HFNA 3THTA 3NKYA 1VQYA 1M1KT 1U1PA 1U6FA 2ABYA 5DLGA 1KVIA 3KDNA 3J80U 4CZCA 4K5SA 2F9DA 3ET6B 4I6AA 2VG5A 1MW7A 2GS8A 4MAKA 4X65F 1QAIA 2HHXA 1RTJB 5DDPC 4B3RJ 3BH6B 5DG9A 1EHWA 1XERA 5AXKA 3PNIA 2KFZA 2WTFA 2A2DA 4ZP7A 4H4KA 1LW0B 3OHBA 1WORA 3OFHA 4F3QA 3PIOQ 2X1FA 4F67A 1K0VA 1KLMA 2NZ4A 1FWKA 4O44A 4LR8A 5FDLB 4CP5A 5DM7Q 1S76D 3QSIA 1WHVA 3TJ8A 3PM9A 1REVB 2RE1A 3GV7B 2FJXA 2PGCA 1I3OB 4U6PA 2RQCA 1RYSA 3EWGA 2EC2A 2ZVSA 2WVBA 1RTJA 2Z2LA 3CJ3A 2FVSA 2UXDJ 1SJ3P 2R7SA 2JZ5A 2Q3PA 1NCLA 1RE1B 2NPFA 2KYXA 5D4NA 4EU0A 5ETRA 4DV3F 2VFTA 5J2MB 2C2EA 3RB3A 1WF0A 1XIQA 2R42A 5IFMA 4DV1J 1IBMJ 2BYCA 1HYSB 1Q7LB 4HDGA 4QU7A 1TV6A 2KRBA 2PSZA 2MYFA 1RTIA 4GKKJ 4EGLA 1C1BA 3HMJG 1N5TA 4UZCA 4JI6J 3I0RB 3AA8A 4DQQA 3GR0A 1U2FA 1T9TA 2HEKA 1MMNA 2ZH9A 2FVPA 3OXFA 2YKNA 4RX6A 3OR2A 1R8PA 1C0UB 5DZ6A 4RUBA 2HYIB 3HFZB 5K14B 4LSLB 2Y9HA 1R27B 3H90A 1RACB 2RKIB 4HACB 2KM8B 2VOOA 3PVXA 2XSFA 4O3NA 3QZ7A 2V8GA 4TN2A 4RKUC 4JI7J 3BQ1A 2F40A 5LM7E 3DDKA 3I4HX 3O44A 2UVUA 5CD4A 3UDEA 2HPUA 1MWYA 1VRTB 3T6BA 9RUBA 4JB8B 3T1HF 4O4RA 4F2SA 1SKRA 3CIZA 2LQ5A 3HFKA 1RHJB 4PXEA 3GIJA 1APSA 5L9XA 1WC1A 4JI7F 4OX9J 1PC5A 1SC6A 5KFEA 4FBTA 1NPKA 3US5A 2ZWOA 2CQ2A 5K5MA 3H42A 3KLIA 4NEZA 4WIIA 4RW8A 8AT1B 5GMKa 4DG1A 5IWAJ 4CIOA 2A0FB 2DNRA 3DYAB 1ZM3A 5KFHA 2D9PA 2MJNA 1W25A 4FS1A 1OYEA 1S1TA 1XTZA 3U7JA 1R0CB 4CH0S 5KFCA 1YIJS 1HWIA 1VBZA 2MLYA 3MPWA 3ZTPA 1OMSA 2MLZA 2V4QA 4RW8B 1U48A 1S6QA 3LPEA 3L09A 2I9SA 4X64J 3P3DA 5K8MA 3HKWA 1JX4A 3CULA 2AZ1A 1VIXA 4ALZA 3V6HA 4RUAA 2XY7A 4DV5J 2V2KA 1UJ5A 2CPJA 2LQJA 4LJMA 3M6VA 1V3RA 2C3YA 2QGFB 3IAM9 1I51B 4YFUA 5ETNA 3FFIB 1MG7A 3DLGB 1A0OB 2HKEA 2DXFA 4OYWA 4WYWA 3T19A 1FXLA 3KLHA 3DI6A 4ZVUB 4F04B 3VALA 1TKXA 2JNJA 2ZZTA 2AJ1A 3T6JA 2G2OA 1VQKS 2R7XA 2DBBA 1S6QB 2CDRB 2GIFA 4IO9Q 3CB4A 5BR8J 4IR9A 3DLKA 1HBNB 3A1YG 3IA0A 1YG0A 4HTJA 4PRFA 4IFYB 2WRMA 2OLWA 3AQOA 3GMGA 2YNFB 5IZHA 5EX0A 1X9SA 3WBZA 2DVIA 5DQIA 1LXNA 3AQPA 4RWWA 3IRXB 4M5IA 3ZZ0A 2LDYA 5F8LA 1WC6A 2BEFA 4ILMA 2R7VA 2PMZD 3FEYB 3ENWA 1P8GA 2C2KB 2MQ8A 2F9JA 3H98A 4LBIA 4TU9A 1S97A 3POTB 2IM1A 2XS5A 1XBWA 3MPVA 4U7UD 2CQBA 1X8DA 3GYGA 4N8NA 3TAMB 4MTPA 4WU3A 4DFKA 4ELVA 4LMZA 2ZOGA 4R5PB 4K2JA 4F0KA 4P7TA 5F3TA 1HNVA 1NHUA 2JLEA 4NRTA 5CZVA 3V2UC 3G8SA 1RCOB 1Q82T 2WOMA 1ICEB 4ZVQB 3H8YA 3MD1A 4F0MA 3DGPB 2JJ4D 4DPOA 2HQFA 4IOAQ 3T5JA 5J1EA 1UVJA 2GJIA 4USWA 3KK1B 1NK6A 1QVFR 1K8AT 2DIUA 1DZ5A 1Q4RA 3I87A 1YZ7A 3OUYB 2UUBF 4DSFA 1NDPA 1F5AA 3I31A 3IR6B 5I3UA 2W7PA 2AJ2A 1S1XB 4KGMA 3A3PB 1N5YA 5BYSA 3G96A 2W24A 4LVNP 4QWBA 3FEXB 1RTIB 1LNQA 1U45A 2C3UA 4ECXA 4B9TA 3C3LA 1GXUA 3O6QA 4BS2A 3ET6A 4MKYA 2FDNA 3EGNA 4OHVA 4ANDA 3CCLS 1B4SA 5EWEA 2RS2A 3KLEB 1XNRJ 3Q89A 2C3PA 4CLFA 2LCWA 1HI0P 1H2TZ 1HBMB 1GNKA 1T94A 4KBIA 1WOPA 2V63A 3JQMA 4EBEA 2D3OR 4DSJA 5DS7A 1A6LA 2DRBA 1F2GA 2AJ4A 3JSBA 4K4XA 2E5LJ 1S4FA 1TVRB 3FVYA 3IRWP 2VF3A 1RT4A 1G6BA 3DRRA 1SQGA 1DLOA 2IRXA 3MMAB 1HHQA 3I0SA 3M2RB 1TR0A 4ID5B 3LUYA 1FRKA 1PIEA 1YJTA 1YK9A 2J7WA 2XTJP 4KIAA 4NASA 3SCJE 1B0PA 2FVQA 1FVQA 4FP9A 4J90A 3CIMA 4K4SA 4NXMF 2F7VA 4RJVA 4LF9F 1JLAA 5GAGU 5DGAA 2B4UA 1VQPS 3HHKA 3N79A 2GAHC 3RW7A 4C0BA 3UFCX 4S0MA 3MPDA 5MLCV 2LEAA 4OQJA 4F36A 3H4DA 3HHEA 3NMAA 2CDQA 5L38A 5LSLA 1RKIA 4G1PA 2BQRA 2YNIA 1GMVA 2NR0A 2WSFC 2J9DA 3DMJA 2A2CA 3WX4A 4YR2A 3CCSS 4K0KF 1X4EA 4ZDNA 2CJQA 1SH0A 2BX6A 2DTJA 4OYOA 4ZVTB 3PIPQ 4ZCIA 2JSXA 1FDAA 3UW1A 3W62A 4GVBB 4LSNB 5FIIA 4MIWA 3I5CA 5C42A 4DEZA 4DV0J 3C14A 3Q22A 4ZCLA 1X9MA 4DN9A 2YX1A 2IAJB 2XBPA 1Y00A 4JI8F 2XZDB 2J9DE 2N4CA 4FYYB 3IBWA 1GMUA 4FNHA 3RZAA 2CXEA 5KG4A 3W1YC 1XQIA 3BKFA 3GB0A 4Q2MA 3KLHB 2B3TB 1U4BA 2ZOMA 3M8YA 3OL8A 3GILA 1WEZA 1AB8A 4ZP6A 3OTEA 1XK8A 3AT1B 2W2OP 2H5EA 5KFXA 3W66A 4ZHRA 4YN3B 1NU4A 3J81U 4FYXB 4UZBA 1HWUA 2M5YA 2OPSB 4URSA 1WTFA 2LVWA 3CDWA 2FUG9 1U2RA 1U0HA 4DMZA 3A3NB 4EZ9A 1JLAB 3CCTA 1N56A 3P45B 4KTQA 4Q8EA 2YQ1A 1Y3JA 4NI2B 2ATLA 2UXBJ 1CBKA 3CJTA 3SEOA 3V6KA 3VVTA 2NLWA 4H4OA 4QYZK 1OPIA 1L3KA 3M2VB 2ZH6A 3CO0P 2ZM6J 2B0GA 2EVZA 1QE1B 5A8KA 1D9FA 1N33J 5HQ8A 5CYQB 2Q6CA 2RHSB 3EVMA 1FT8A 3FDSA 3UO0A 1BQMA 3MHYA 3IGVA 2ZHAA 4DL7A 2YH1A 5CAAA 3KUGA 1V6HA 3HVTA 3W61A 2HAFA 4CNYA 1AW0A 4B9NA 2HS4A 1HLWA 1BD6A 5E2QA 2HZAA 4FXWA 2RDJA 2M8DB 1BUXA 4IRKA 3LAMA 4FF4A 2OUGA 3RBZA 2JVOA 2VU5A 3A13A 2VKZG 3Q24A 3GYXB 3H2VE 1HQEA 1X0FA 4W92B 4DR6J 2AGOA 1EX8A 3KFWX 4WK3A 4KGKA 5D3GA 1GK8A 3NCPA 1UWAA 1HHTP 1FHTA 2OP5A 1JJ2R 3V4IB 3AJ2A 4Y2KA 2Z2ZA 2DXDA 3T1YF 4LF8J 2Z57B 1CJTA 1S9EB 2FHJA 3TWZA 1M90T 1MN9A 2CQPA 3WC2A 3CT9A 3V6DB 1U1QA 5K8NA 5CYMA 3KG1A 2R7WA 3TAQA 3I82A 2VG5B 4LRFA 3QWPA 2QG9B 5E7OB 4C2MA 2KT3A 3RB4A 3JTOA 1YI2S 3R2DJ 1WKKA 2XS2A 3OTCA 1S9GA 2IYIA 2HZCA 3TUIC 2HHVA 2CPIA 1H98A 2YNHA 3M6XA 3K5NA 2HHUA 1RWNB 3G82B 1YITS 1YVFA 4OZ0A 3U02A 1D9AA 1S1VA 3HJFA 2YPYA 3R5GA 4H4KC 4AYBD 4C11B 4RUHA 4ED4A 5HROB 1HPZA 3MMCB 3KWMA 4ED0A 4NLOA 1WJ9A 3D28A 5C25B 4N41A 1VQ7S 1CC7A 2HRTA 2X3DA 3CCJS 2IMOA 3AXKA 5GADI 3QIPB 4ZIVA 2JX2A 2ROPA 2BKNA 2Y0BB 2HG4A 1MMLA 2YX4A 3SYZA 5F3ZA 4M94A 1R3NA 2CQ4A 4DS5A 1VOMA 4U96A 2FJWA 4ED7A 2BMBA 2OD4A 3EVOA 3HHLA 4KE5A 2DH9A 2QRRA 4YS2A 1HNWJ 4C8YA 2EK6A 4EUVA 4D3GA 5KFNA 4WP3A 4IH6A 1UEVA 1OQ3A 4O0IA 3T1AA 3VGUA 4CNZA 1S79A 3BB5A 5KFTA 4CLKA 5LMUF 1S0MA 3E01A 2QX0A 2CPZA 1KQFB 5L1JA 4CLTA 2V50A 2FZKB 3JSRA 2OPPB 1FK9A 1YJ9S 2J6UA 5B0FA 2DIVA 3VAFA 4U67Q 3D67A 2UUTA 2UUCJ 1JLCA 2N7CA 1AYEA 1JNRB 2L08A 1WKJA 2DNNA 4I2QA 4J9PA 1M5PC 1VK3A 5KG3A 2YNIB 5KT5A 2DY9A 4LFBJ 2XG8A 3CE8A 4P73A 3EVWA 2XQCA 2W01A 2X3GA 3DOMB 1Y3KA 2YKMA 1WG4A 2G2YA 5KOXA 3OJSA 3OVBA 3EMTA 3W8GA 3R7SB 2CAJA 3G6ES 4N77A 3PW4A 2GQCA 4R0EA 4EYHB 5CH7B 4C3KA 4RO0A 4FBUA 2VFRA 2ZHOA 4RW6B 3VV2B 1T03B 5D8HB 5CQGA 1S10A 4UOCA 2F65A 4CLWA 4DSKA 3FCHA 4DN0A 1UMJA 3IG1B 1Q8LA 1IBLF 3N01A 3QJJA 2M88A 4GVLA 3FBFA 4QW9A 3LWMA 5HLFB 2MLXA 4LF5J 3EXYA 3J7Z5 3CGIA 2QV6A 2CYYA 2VUGA 3AOCA 4QIVA 3VAIA 3I5BA 2Y0SD 2RU9A 2K7KA 3PCOB 5ETVA 1HNXJ 8RUCA 1HR0J 2OMLA 3I55S 1XMOJ 2KJWA 2B7BB 2R8GA 3KG4A 4B9VA 2GVZA 2KVIA 3GG1A 2VFSA 3KDOA 1U6BA 2O3DA 1R6VA 2MKYA 1N52B 3QNWB 2RHQB 1WG5A 1VR6A 5T7LA 2E29A 3UN2A 5KFZA 3CJQA 3P96A 4ZLJA 1FKOA 3JSYA 3OXGA 4YY3F 3MCOA 2XZTB 3HCXA 2AYBA 1WDTA 2FLLA 1U2CA 5ETSA 2HHWA 2BV3A 4RPFA 3TJAA 1K47A 2ZH5A 2D1CA 1VBYA 3N4WA 1GQEA 2J8SA 4KGZB 1T95A 2W4DA 3OTOJ 1QAJA 1URNA 3D0HE 3BSOA 4X4SA 3BYRA 1UFLA 2F1FA 2PA8D 3CCZA 3DMJB 2ZWPA 3HHLD 4P52A 4RBVA 5HO4A 2P8IA 2VL1A 1VRTA 2XHWA 4IUFA 2APOA 3MM9B 2IVFB 2K2PA 4MT1A 2QEXS 4N7TA 2RUGA 3G6YA 4Q45A 4LRCA 4PPDA 4IDKA 2HFVA 1HQ2A 4MH8A 1IBCB 1VBXA 4ZOSA 3R6GB 4DR1F 1TKTB 2KO1A 1UCNA 2DY1A 2RQMA 2VBWA 3HKZD 2RSQA 2WK4A 1K0TA 4ECYA 2MZQA 2P6TA 3DLJA 2HHPA 4ZIWA 2W2NP 2GIRA 2YNFA 1HMVA 4KT0C 1IBMF 3NS7B 3L7UA 1G2EA 4DL4A 4NLYA 4Y34A 1DFDA 4OI3A 5A8RA 4Q0BB 2UP1A 4ZITA 5KAKA 1VBKA 3R6LB 3M1VB 4B3MF 1FI4A 3CJ0A 4U95A 4F0HA 1SH3A 3KHGA 3UDCA 1QAXA 1E6VB 1Y0HA 3PJ9A 1NK5A 3MEGB 3ZTOA 2WCXA 1VK8A 1F5CA 3BQ2A 1IKWB 2QL5B 4J9SA 2OH2A 3M9MB 2HFZA 4HKQA 2BZ2A 2HIQA 3CJKA 1T9WA 3U1LA 1KOHA 2KXFA 2A18A 2XCPA 4ED8A 3D1HA 3H0PA 5JVGQ 4QR1A 1L3SA 1BQMB 4OHWA 1U1NA 2HMIA 2V4RA 3IO1A 1AA1B 1KLMB 2CNKB 3LH2S 1OJ4A 3PX4A 4LFCF 2EC0A 1YJVA 1KWMA 4QR2A 3DU6A 1LV5A 2Z0GA 4GKJF 2CRLA 2G13A 2CIMA 2FVRA 2HNDB 4PYAA 4DFPA 1RP5A 2PO4A 3FZBA 5KT2A 4ZJLA 2HS0A 1W26A 1RAGB 2FHMA 2G2ZA 3G4SS 4DR4F 2M70A 4TY8A 4BC7A 4DPWA 2FB0A 2MKJA 3AD9C 3LF0A 1H38A 1IKYA 2V4JA 4NZ6A 5HSPA 5EGYA 2DT9A 3S7RA 4KAIA 5IT4A 2JC1A 3J80Y 4LR9A 3W5YA 1S59A 1V5IB 2FQQB 2UV8A 3D4JA 1PCAA 2QLFB 4NMXA 4X66F 1RHRB 4IYQA 4RW9B 4LQ3A 1WNEA 1NSKL 4NXNF 1EIYB 1HD0A 4DV7J 3JS9A 5I3PA 3EZUA 3HFVA 3V6DA 3FMBA 4YR3A 1A9NB 3HJVA 4HHJA 3NGTA 2BANB 3ZZRA 2H54B 1SJFA 2VONA 3KLGB 3LO3A 4ID5A 1EAYC 2DH7A 2N3OA 2BE2A 1BQXA 2CWXA 4FVMA 4DV2J 1QDUB 2NXEA 3TVZA 4YMEA 3MR3A 1J5OA 4M5GA 2HBQB 1NNDA 2W9CB 1RWMB 4LBPA 4ECQA 4NLTA 5D4OA 3N6MA 5B0AA 4Z37A 3M4XA 2EG2A 4WYLA 2YNHB 2CQ0A 3Q8RB 2UXCJ 3HHDA 3J7AN 1VLYA 4DSEA 1ULRA 3OD2A 5EWFA 4USMA 2HVZA 3A8IA 1YDLA 3HLUA 4PEOA 2CQ1A 3TX8A 1FERA 3IS9A 4KV8B 2I6WA 5KG1A 3TYTA 1FCAA 2DCUB 3MEDA 2P6SA 1UA1A 4JI4J 1NAQA 2KKHA 2IAJA 2ADCA 1QVGR 1D8YA 2K3KA 1KVKA 2HURA 1OY6A 2AHOB 3D6HB 3GIKA 1VCTA 2UXDF 3OFFA 5C42B 2OD6A 1CJUB 3OTBA 4J9VA 5A6WA 2QO3A 4A48A 4YP3A 1UETA 2YWWA 3BS9A 4FDFA 4X2BA 3R2CJ 1RDRA 4ZN1A 2KL8A 1VQ9S 4G1IA 1BE4A 1MLAA 3L95X 4M5DA 4I6YA 2ZH2A 1Q79A 3G86A 4DQPA 4KHPF 1XMBA 4J9UE 2E1PA 4K7QA 4R25A 3ZNUA 4GC7A 3M8PA 3VHQA 2BVZA 5DG8A 4Q5VA 3CCMS 1N6QB 3EE3A 2Y1LB 1JMTA 4UTGA 3NMRA 5B0CA 3P8BB 4O4GA 4X4PA 3EYZA 1RU1A 1JJCB 3NOCA 5C5JA 2JC0A 5JMNA 1YJ7A 1CQMA 2GC8A 3PRVA 1R89A 4X84A 5B09A 5CXTA 4KHPJ 3C15B 2E7VA 4USTA 4YHHJ 3PDNA 2G4BA 5GADU 4DV3J 2CPXA 1P1TA 2DGOA 1X4DA 3TW0A 3UNYA 1N34F 5I3QA 5A8KB 1XNRF 1MSWD 3RB6A 4ANCA 2HNYB 2HQIA 4RNHA 3GJQB 4YB6A 3HO1A 2O01C 2ASYA 2QLJB 1HW8A 5CA5A 4NLDA 3KNAA 4O4GB 5D0HA 4OX9F 3J81j 1JLFB 2BJ3A 1WHYA 4CH7A 4DDFA 2DKOB 4YB5A 3H5YA 5IT9U 3J81Y 2KB2A 2VASA 1F3FA 2W9AA 2D3ZA 2OSRA 2EI5A 2V8VA 4DI6A 3QRPA 2W4PA 1R7IA 1RK8A 4DUYJ 2BDPA 4NA3A 1TQLA 4L6V3 4LSZB 5KFKA 2BJEA 3BGRB 4B3OA 3BGLA 1RT3B 1WWHA 1CJVB 1S57A 2JHEA 2O67A 4OYZA 3TVKA 4TQRA 2IBKA 4IR1A 2NZCA 2YVSA 2IC3B 2YH0A 4CO2A 1UPMB 3CCWA 1RT2A 4ETZA 3JAMY 2AYGA 2B6AA 5A8RB 1S1TB 4Z7YA 4JP8A 5U47A 3RRKA 3ISND 4N5SA 2DNQA 5A6PA 3ISNC 3ULHA 4GC6A 1R8CA 2XY6A 1UAWA 4HT7A 3C15A 4ZVSB 1WEXA 1YX2A 2HVIA 3RBDA 4OX8A 5M2UA 4P2FA 3CD6S 2ASLA 1EP4A 1HBUA 2NPIA 2RJZA 3DOKA 2AKWB 3J7YU 3F0NA 3O2IA 3N6NA 1HNIB 1SC4B 5KFVA 3CMES 3K8VA 2I5JB 1PJ6A 2VG7B 1RU2A 1JLEB 2DISA 4MK9A 4NLUA 4PABA 1T8EA 4WPAA 4OYMA 3GPAA 2DGXA 4O23A 3WC0A 2KG1A 4CO4A 3R8YA 2HBYB 2HK2A 2XWYA 2ZE2B 4CCHA 3D6MB 2X51A 5GMEA 4Q0BA 2FIUA 2P9EA 4H4MB 4OI0A 2JOQA 1HWLA 2WW4A 5GMDA 5T41A 1HPZB 4K50A 1SPBP 2QLBB 5BXIA 1W2IA 1KR4A 1DTTA 1T3OA 2FC9A 2R7TA 1FTRA 5LMNJ 3M8QA 1Q0NA 4FF3A 3VGSA 1K1SA 3CWJA 3GYNA 3G8TA 2K8GA 4PPZA 4C8NA 1YBUA 4WCEQ 1MROB 5HVHA 2CPHA 2MQOA 4USIA 4F4WA 2HVDA 4ED3A 4ZVFA 3MZIA 4RW7A 1NZAA 1ZETA 1HBMA 1B7YB 2H5JB 1IJFB 1S9GB 5KFSA 4CO3A 2BJ7A 4MFBA 4DXLA 4UY85 2XNRA 4A8QA 3RJMB 1EARA 2IYGA 3C6UA 5HMWA 3I56S 1RTHB 2DNKA 5LSRA 4J9KA 5AXNA 3ZC4A 1PAEX 1RT1A 3BBBA 3DGVA 4NZ0A 4YOEA 4M5DB 4I67A 3M8WA 3LAKA 3GTYX 3HF5A 1RJJA 2LU2A 3X3UA 2Z58B 2Z2YB 3OR2B 5HQMA 5HLFA 3DRRB 2PEBA 4DV1F 1XR5A 2Q6BA 1QSLA 2DNZA 1Z4UA 2VQEF 1FTCA 3K2YA 4B9MA 4F2RA 4NOHA 4PUOB 3CJKB 2YBVA 3C19A 1RT6B 3ZNJ1 2ZE2A 3K59A 4FPRA 4QIWD 1RXOB 3NAHA 2WZ1A 5I42B 3M9OB 1U1KA 1U25A 4B3TF 4RW9A 2B56A 1Y5IB 1OWXA 1IQZA 4P74A 2IDLA 4H54A 1N34J 4FKYA 4QIFA 4PWUA 2D7SA 1S72S 1S0OA 1F0XA 1WKLA 5G0RB 2MMYA 3K89A 3PHEA 4CLZA 2HNZB 4R0JA 2KH9A 2NREA 3VAJA 1UFKA 1OYDA 3BPSP 4LF6J 2XWXA 2V2ZA 1LW2A 4V1Ak 1UJ4A 2CVEA 4ES3A 5K20B 3DKDA 2PFDA 4M5HA 2RILA 1NKBA 4N56A 2E7WA 2RF2B 2W2MP 5DQHA 4ZP8A 2OSQA 2A1BA 1FWLA 3DXBA 4QOTA 1KS2A 5KFYA 4DUYF 3GE9A 5K9FA 1Y5LB 2VPXB 3HVRA 1VQ4S 1UZDA 2V8PA 2X1AA 5KG2A 4M1KA 4DG1B 1ZM4A 5IOLA 2FC8A 4XDDA 1WOSA 5J2NB 2E5LF 3IS9B 4KV8A 1F2HA 1SUQB 1N8RT 2LXUA 4KRWA 5AE3A 2OPSA 2CG4A 1HA1A 2XHCA 3IM9A 2FLPA 1U6ZA 1MWQA 8ATCB 4PQUA 3M8ZA 3K5OA 4LF7F 1PSDA 1BWEA 3TZWA 2DITA 3D0GE 4J5OA 4J7CA 1XR7A 4ES1A 2XLIA 4F4ZA 2OO4A 2Q1LA 2W7AA 3MM5B 3RUBL 4OLOA 2ILYA 1IM6A 1SJ1A 1WUUA 1HBOB 2E5GA 3BKTA 3KK3B 1VQ6S 3IG1A 2RH3A 2POKA 3E8OA 4M95A 2B9WA 4AL7A 3WDOA 2ZJQQ 5IXUA 1I6JA 4M5MA 1ZAXA 2KN4A 1C4CA 3CDEA 2VC1A 3QO9A 1HNWF 4P6QA 4LSLA 3MMJA 4ATNA 4CDIA 3HPOA 3B78A 4IQMA 1T9YA 4C0HA 4M5JA 3VGVA 2MKHA 4V19J 3BO4A 3ITHA 1AT1B 2J5AA 1ZM9A 3A8EA 2VG7A 5D0EA 2P2CB 1JLGB 1SL1A 3DLHA 2XMAA 3OQ2A 1TKTA 2HQGA 2ZJRQ 3DLEA 4DV0F 1P6TA 2QMUB 2PDAA 2UU9J 2MQLA 4J9LA 2FYXA 2CNOB 4DX5A 2AMCB 3H59A 2M0GB 1JLGA 4QCLA 1GX5A 4MKVA 1FEHA 3KTQA 2LQ8A 3MGJA 4PG6A 3SQGB 3ZZOA 1K9MT 4AQYJ 2MTLA 4XIUA 3D6TB 2Q43A 5J2NA 2B4PA 2JH3A 1NMEB 2IVMA 2MPUA 1S12A 2R8KA 4NEYA 2FJDB 1RB0A 4EBDA 4QYZJ 2MY7A 1FNOA 2IHR1 5KFQA 4QU6A 2HAIA 3DYAA 1X4HA 4N47A 4WTOB 5H9EK 3KK2B 3QRQA 4ELUA 3OUYA 3RB0A 4MYTA 1ZA1B 3BH7B 4ZKAA 1UEKA 1JLEA 3ENQA 2GMJA 4QZVB 1FKAF 1JKHB 3LPYA 4BWJA 2OEMA 2FZGB 3GIRA 4KHRA 4ETXA 5B7WA 1CVJA 1F9FA 3CXCR 1KHVA 5F8HA 1RT1B 4B02A 4A8YA 2DNOA 5CABA 2QSFA 3MEGA 2M4MA 3Q86A 5E3CA 5EUHA 1UZHA 3C16A 4EO6A 4DUZJ 4TU8A 3E3XA 4O3PA 1RYRA 2JEJA 1PGZA 5KFIA 1TAUA 4F02A 1QSYA 3PACA 1WI8A 1NDCA 3B82A 4DPTA 2RRAA 4FXVA 3G87A 2HK3A 4OI1A 1QAYA 1WC5A 4X62F 3OW2R 2C28A 2ZFHA 3MMCA 3OLAA 1CPZA 3QFHA 4JI5J 1FRHA 2W9CA 2CQGA 1SQFA 1NO8A 4ENOA 1XMOF 3CJ2A 3DHWC 3L4BC 4KKOB 4Q43A 2KTQA 1RAAB 1H74A 3VCDA 2VZ9A 2AX1A 5ETMA 4DF8A 4RBTA 1SC3B 2XY5A 4LBHA 9ATCB 3O5TB 3MFIA 4J9NA 1HI1A 2UZAA 3D68A 4YY3J 2YPZA 1AROP 4CQ1A 4DL5A 2B9EA 3IFEA 5IC4B 4OYXA 3KLEA 2R8IA 3NCRA 1JJ4A 5BYQA 2WSCC 2QSWA 1SI9A 4P75A 4DU8A 4F4KA 1I5OB 3KXDA 2BOPA 1M5VC 2WVEA 1U7LA 3UWTA 4ILRA 2UUAJ 4PUOA 4HDHA 4B9LA 4LF9J 3MR2A 2KFNA 2M52A 4FYVB 3MUVP 2L9NA 3MMAA 4EBCA 2GQ2A 3D0IE 4DR5F 1R0AA 1FA0A 4URGA 2KFYA 4YDXA 5AXLA 3C66A 3NGDA 4ZPVR 5D77A 1TVRA 2ZITA 2C3OA 4OYPA 1YZ6A 2GQQA 1XJWB 4Y3CA 3U1MA 3UVJB 4CTAA 1XNQF 1EB0A 1F9HA 1C1BB 1M1GA 1PAUB 4MK7A 2A6OA 2OEJA 3H2LA 3QGIA 4E8UA 2UUAF 2GJ2A 3EPIA 4OX6A 1XC9A 5HN0A 1U47A 4I2PA 2Z2MA 2P9GA 2A6MA 1YRUA 4FS2A 2DNYA 4RU9A 1N88A 5DDQC 3SZ2A 2B4OA 3KG0A 5D0RA 2DR5A 4MYUA 4L74A 1UVLA 4IOCQ 5KG7A 2FPHX 3IC1A 3O8WA 4FVCA 2GJFA 4QR0A 3W7BA 2DNGA 3PFOA 4B17A 2UUCF 2DHHA 2OFGX 4ZVEA 1IWGA 4A46A 3W2WA 1MMDA 1U0SA 2LA6A 3MM6B 4OJ1A 3KJVA 2MJUA 3P5TL 3R9LA 4Q44A 3Q23A 4H4OB 2UU9F 4PXDA 4IG0B 1VLOA 1N32J 4AUKA 2EFPA 4J91A 1OSDA 3MUMP 1QSSA 4AQYF 2DNHA 5LXYA 1SIWB 1P1LA 2GVZB 1GMWD 3IGNA 3SI8A 2UXBF 1RI7A 5LMUJ 3KNGA 4NYZA 4ECUA 1TL7B 1UTAA 3QATA 1FXDA 4OZ3A 2J0QD 1N33F 2H4WB 1Q53A 4UF4A 5ADZA 4WFYA 2H9ZA 3HM9A 3NRBA 4QJVA 3MAQA 2E5JA 4LVOP 1LWXA 4RWXA 1UL3A 4RR5A 2XYGB 2ERRA 3PG9A 3Q2SC 3VWSA 4DR7J 2GMLA 3MOZA 3PTWA 4ZPAA 3RGIA 5JUMA 2D3O1 1ZZNA 3DLKB 3SCKE 2WSEC 4NI2A 3W5ZA 3ZXWA 2CQ3A 1VQSA 2K06A 2OEKA 4DL0C 2W9BB 3H40A 2YKNB 5DG7A 1HARA 2VV5A 3HI9A 1NHKL 3FCWA 3N28A 3GIIA 3T5LA 3KK1A 3N6LA 1YTYA 1U8SA 4DV7F 1S0NA 4WZQA 4JI3J 2JFKA 2VKRA 4FXDA 1JLBB 2P5VA 5GAHI 3NGUA 3EXCX 4TNOA 3UQSA 2YWKA 2YKOA 1B0TA 5JJBA 4Y28C 3QPIA 3OTOF 3PO5A 1SV5A 1ZS6A 2CJXB 2P9CA 5F41A 2MQPA 4F4AA 5C24B 2GFFA 5KFPA 1DTQB 2GGPB 3BSAA 3DU5A 3SCIE 4UOHA 3HXMA 1VQLS 1X4BA 3R7BB 1TU0B 1S7HA 4PKDB 2R2SA 2HNYA 2LMIA 2K1RB 3O3LA 1DQAA 2RT3A 4FKXA 2OPQB 3H5SA 2HQ3A 2V68A 3V4IA 1FDBA 2MKSA 1ZZFA 4K5RA 3R7NB 1JK9B 4XK8C 1RZMA 4B3RF 1VJWA 4C3LA 2HHHF 2HGLA 3RYLA 1NB7A 2HBZB 3T5HA 2RDIA 1KP6A 3AJDA 1W7WA 5AXMA 2VQFF 1EQMA 1IM4A 4PG5A 2MEWA 2NXUA 5L1KA 2ZD1A 4OV1A 1HKAA 1RT7B 3KJFB 1YBTA 3Q0AA 3AA9A 4CLSA 3FC9A 3AAWB 4CTAB 4M63A 3DLLQ 1Z1ZA 2H4YB 5J2PA 1N48A 2IBOA 2NUUG 2QE5A 3T9NA 1RAEB 3MI7X 4CT8A 2B43A 1WTBA 1RKJA 2CPEA 2HQCA 1WEYA 1GMWA 4KGXB 3QT7A 2HIYA 2Z30B 2XEXA 1HQUA 3UI3A 5KFOA 3KHHA 4WFXA 3VAHA 2M3DA 1IKXA 3FBEA 2IJRA 2QA2A 2DPIA 2Y3YA 4JI6F 1IKVA 2HLUA 4DQRA 1QD1A 3QQCD 1ZPVA 2ZC4A 3N5FA 4DV6J 3RR7A 1ZTWA 3NOGA 4LFCJ 5E33A 4CO0A 1JNZB 1JXVA 5ETQA 3ZTRA 1YKWA 4DBQA 2KM8C 1PYSB 1UA0A 1SKSA 1NKEA 2JWNA 3POTA 4OZJA 2PA3A 2J0SD 3NNAA 3S01A 3AHPA 2XO7A 4I2QB 1ZTTA 2DPJA 4DR2F 1CSJA 2E1MC 1IVZA 4DFMA 5F9LA 3H5XA 4JV5J 1N0VC 3OSNA 2BE2B 3HULA 1SJRA 3U1NA 3OVAA 1WHXA 4O3RA 2OPPA 3HSGA 2LEBA 3OSPA 4C4WA 1FO1A 1BWVA 3D9BA 3U27A 3LGHA 2BQUA 2C22A 1PYTA 3UCZP 4D3HA 3HD1A 4WFAQ 4U8YA 5D78A 4DR2J 3I96A 2KJVA 3GSDA 5F0UA 5J2PB 1NEEA 1NJWA 1BC6A 4CO1A 4DS4A 2CZVC 3KLFB 4IFVA 2CPFA 2LQ9A 4ZMMA 1NDLA 3BV8A 1SKUB 3UD4P 1H6KX 5AT1B 3I32A 3F41A 2PFFB 4HTIA 4M5KA 1NJYA 1IR1A 1TL3A 4WFZA 2QT7A 2QMXA 4WE1A 2YXLA 1RQ0A 3H4BA 4AL5A 3MM8A 3D1OA 5SUHA 3TNVA 2QFIA 5G4DA 3TEHB 2XO6A 4ITSA 2XSJA 2BANA 1CS4A 1SXLA 4LFAJ 4GVBA 4LSNA 2E44A 5HQLA 4RW6A 1SL0A 2M9KA 1C2PA 1XN9A 2ADBA 3R5JB 4W90B 1QM9A 2R8HA 3RW6A 1HIYA 4X4RA 1U26A 1T9VA 3QYYA 4Y6IA 3BDEA 5AE2A 2KI2A 4XPEA 5IQ6A 3RAQA 3JAMU 1SJ4P 4QBUA 4NXNJ 3DM2B 1CEZA 3VF0B 1N4LA 1HYSA 5ETLA 1DTQA 2GGPA 3CDAA 4Y65A 4USVA 1BHNA 2B9XA 3MM7A 4KO0A 4KB7A 1NKCA 1S0VA 1HL6A 2IM3A 4LQ9A 1N6QA 2BKOA 3TZYA 5LMNF 1S1WA 2AGPA 1QTNB 4ERDA 2CA9A 3F73A 1B99A 5E3PA 5C7PA 5FLXY 3M9NB 1IWAA 4BWMA 2CJYB 3PJWA 2B8QA 1IN0A 2MZTA 3WX8A 1AZSB 2R4FA 3DXSX 3TP2A 4QWAA 3KYLA 1TFWA 3M32B 2U1AA 3PJXA 2HMIB 3QT5A 1M1HA 2G9OA 2LU1A 4DOZA 1VHIA 1YJUA 1I1GA 3QGHA 2G1DA 4ZPDA 2L41A 4B3SF 1YGYA 5GAEI 1HWKA 4YR0A 1JXLA 3MEEB 1FDNA 5J2QA 3D7SB 3V81B 1TK8A 2C2ZB 1FF2A 3W60A 2AP6A 3I9V9 1RT7A 2HFSA 2KT2A 3S1TA 4ZN3A 1O51A 2Q79A 2DB1A 2QA4S 1BMQB 3MCMA 3Q8SB 1F3VA 3R97A 4BDPA 2I5JA 1SVDA 4KH1B 2PD1A 1XMQF 5C2GA 4BCAA 2BM1A 4ED6A 4GRSA 2DR7A 2F8EX 4ILLA 4C8ZA 1HQUB 1ROFA 3CJSA 4OHZA 3QAEA 3DRSB 3MUTP 1XR6A 1F6TA 1URRA 4B3MJ 2EFVA 2ZZMA 2DXEA 2R3VA 3MR5A 3C46A 1OQ6A 3EZOA 4L72B 1XWLA 2W2QP 1DTTB 3L9ZA 1L3VA 2MY8A 5HJYA 1RWWB 2AEFA 2CNLB 4G65A 1XMQJ 1HD1A 2VOPA 2I0XA 4YEAA 3MR6A 3CF5Q 3EDRB 3IWXA 1O5JA 1FD2A 4DZ6A 2HBRB 1T7PA 2BJ9A 1Q78A 2FJEB 4NLVA 4IRCA 3C16B 3HZEA 4WFBQ 2EWHA 1RTZA 3W8PA 5HMYA 1JJHA 2BR0A 4TLQA 4KH0B 1E6VA 1YWXA 4TY8B 1REVA 3NLCA 4USUA 3RRGA 4NXMJ 3G9CA 3RU0A 5LJ5Y 4PAAA 2NXJA 4JBCA 2GHPA 1YJRA 4G3IA 3TUZC 1EJ7L 3GIMA 5E3RA 2R7QA 4C98A 1KD1T 2R8JA 1C0TA 1TZ0A 4ZVPB 4F4XA 3NCQA 1UFWA 2Z8QA 2WB1D 3LP2B 3E01B 4HI1A 4ZPCA 1FVSA 4DV4F 1UVMA 3QRRA 4K0KJ 3J7YI 1RWKB 1FJEB 3R5AA 1SV5B 5F8MA 1TK5A 2V9WA 1LEOA 4RW4A 3QZ8A 3SXLA 1PJ5A 3VR1A 3QT8A 2YQ3A 4P7VA 1EP4B 3DOKB 4RW7B 1AUSL 1RT5B 3P5BP 2QC3A 2LDIA 2ZKUA 3OV7A 1FEEA 1BQNA 2F5GA 1Q16B 1PKUA 4RW4B 1DURA 1R8AA 4Z7CA 5K8OA 3UE2A 1NSQA 2D41A 4X64F 2EFNA 2LP4A 2ZBPA 4U9RA 3TAPA 4I4BA 1H7XA 1X5PA 2FZCB 4LREA 4NMLA 4CWBA 3QFWA 3WZ0A 4CLLA 3ADAC 3CJ5A 1ACMB 3LP0B 4P71A 3SDEB 3ISZA 4ZLLA 5J1PA 3FQKA 1T03A 1QTMA 1F5BA 3R27A 4ELTA 1P27B 1S6PB 5CYJA 2GX8A 2HVEA 3CCRS 1U0HB 2AGQA 2J6SA 1X4AA 3BSNA 2V9KA 4WE1B 3V6JA 1VC0A 1Q8KA 1S1UB 4G6VB 4O3SA 2KZZA 3CJ8A 3UD3P 3ZZPA 2B7CB 2HNZA 1NH7A 2RNEA 4ED2A 5KG0A 1T11A 5F8IA 2ZM6F 4OYIA 3CC7S 2L9DA 4CRJA 4OJ3A 3CDBA 2Y1RI 2QL9B 1QJHA 2DHXA 2FGCA 3NS6A 4KHMA 1S7IA 4JV1A 1FX2A 1SB6A 1X4GA 5THWA 1S4EA 5IC6B 3T5KA 2NXNA 1PG5B 3T41A 1KC8T 4J9OA 1Q5YA 4KPYA 3MEEA 3SSSA 2QLWA 2WONA 2HGNA 3A12A 5J2QB 4OI6A 3ILIA 2GO8A 2F4VJ 1RT2B 2AV5A 1N5VA 3FUYA 3H25A 3PY8A 4WP9A 1HNZJ 2LXIA 2WONB 4F26A 2OIHA 3PYDA 3K8WA 4OX7A 4C3MA 3GV5B 4AD6A 3BYPA 4LRAA 3N0VA 4K4TA 2R2TA 5LSOA 2DO0A 4YHHF 4USKA 4ECVA 1T05B 2KDOA 1SC1B 3AODA 3MM8B 1KFDA 2DHAA 2G0JA 4TVAB 2HRUA 2AU0A 3E51A 1R8HA 2ZUAA 3IWLA 3M1VA 3GFYA 3MM9A 1VC5A 1K73T 2UUBJ 2YWEA 4I68A 5HL7Q 3IBCB 4F25A 2ROEA 1YJWS 4KJIA 2GZOA 5KFJA 4Q2LA 3V81A 4X4VA 3GLJA 5IT9Y 3D3BJ 2C2MB 3QGPA 3DHXA 5EN1A 3LP1B 3QLHB 2KYZA 2OPQA 3BF4A 3I4PA 3GU0A 2OJ3A 3ENAA 2QN6B 5ETPA 4DHVA 3KK2A 3FRZA 1VDHA 3HHLC 4X4TA 3FSIA 2ZC3A 3NWRA 3PHTA 1VYAA 3VTIA 4H4MA 1PO6A 4ZK7M 1LKZA 4U8VA 2ZOFA 3NG8A 2CZ9A 1FJGF 3FGVA 4LF6F 4L75A 2PEHA 1IBKF 4DL6A 3GJSB 2W1BA 2DHSA 1UW9A 2MKCA 1WI6A 2ILZA 4OMFG 4ICLB 1SJQA 3SSQA 4XO0A 1NZ8A 1RWXB 1MNEA 1V9OA 2DR8A 1UVNA 3M8PB 4P2SA 3BGRA 1HBUB 3DLEB 3L3CA 3IAS9 3UD5A 2XZWA 1HI8A 4F8RA 3HVTB 2VPZB 1OY9A 3MTJA 3NP5A 2EW9A 1NK0A 1J27A 3JTNA 3K5LA 5D6GA 4RNOA 3HSDA 4GO7X 3HSZA 5DO2A 5B0BA 2IA6A 2AT1B 4ZCKA 1KTQA 1IKXB 2IJFA 3MMBB 3EGWB 4DPXA 1KRPA 4JOUA 3DRXA 5M2PA 1QLNA 3BGFA 2VJUA 4IKAA 4A4JA 2B6AB 2C2RA 1VS3A 3M30A 3JSMB 4C11A 1NH8A 1RLCL 3TR5A 2JLFA 1FDDA 1NRKA 4U7CA 1GTEA 2W25A 5D0GA 4TQSA 2MZRA 3IBFB 4LR7A 2IJNA 4OZ5A 4TXSA 2RRNA 3HP6A 4DQIA 5A2QY 4DUTA 5KT7A 1KNZA 3HVAA 3NL0A 2BA9A 3PRBA 3AD7C 4USHA 3RR8A 3CCQS 1C1CA 2ZUGA 1JIHA 3NGSA 1LWCB 4HLBA 3IR7B 3R3TA 2LA4A 5H9FJ 5KFWA 3FK4A 4FF2A 2NUHA 3CD7A 3LANA 5A8WA 2RU3A 4TLRA 4PWDB 5GAEU 4JUZA 3RBXA 4RU2A 1R0BG 1LOUA 1S6PA 1UP1A 3M30B 2MQMA 3LGMA 5EHHA 2MGZB 3R1LA 3AXMA 3UR3C 3UNGC 5B0EA 1S1XA 1MWZA 4NA1A 3K0JA 2RRBA 3PKYA 2VBXA 3MECA 3MPYA 5E5NA 1WSRA 3ONQA 3K5PA 5KG6A 1KKHA 1T0TV 3PX6A 4PWDA 1X4CA 3G82A 3BO2A 2I38A 1U02A 3OTDA 2HS3A 5LT5A 5IS2A 3GJRB 4LIWA 4Q7AA 1VQMS 1B64A 2V69A 1FRXA 2V2QA 3C6UB 3EGVA 4IQXA 1GT8A 2V8DA 2EFOA 4C8LA 1ITPA 1FRMA 2RVJA 3JSMA 2VA2A 4C8OA 2MXYA 3QJPA 3DRPA 2XMTA 1YSJA 1K1QA 3LP2A 1G3OA 3PEJA 3R5DA 3MURP 2ZH3A 1KVJA 3UVJA 5HBMB 1FESA 4B3TJ 2J8AA 2Z4PA 4I7FB 2I2YA 2QYCA 1OS5A 4E2FB 3PR4A 3KK3A 2KU7A 2XC9A 1R0AB 2MZJA 1SQEA 4A8OA 2QFJA 1X5TA 1CJUA 2VFVA 3PYFA 3TQEA 1S9FA 5HBMA 2HFUA 2HW3A 2FJAB 3PW2A 5DETA 2EFGA 4I6WA 1NPRA 3JQKA 2AJQA 1V5VA 4L3NA 3D6FB 2HWIA 1NJXA 1S1WB 2HZVA 4JI0J 1L3UA 1DARA 2L48A 5D4PA 4ZPWR 3CJRA 4AXJA 3AD8C 2ZZNA 1TMMA 1M0SA 3SIPB 3P6YC 3DFEA 4OHYA 4EEYA 1IKYB 3CO9A 1KQSR 3CD0A 2CG8A 3RG6A 1WG1A 3AH6A 1R6YA 1NBEB 1FXRA 1RHUB 3D66A 5K14A 3W9HA 3M8SA 3PV8A 1VQOS 2GCFA 3PZPA 1TKDA 3LA0A 4UW2A 4OI2A 1TUGB 2CPDA 3RAXA 1FKPB 5HP1A 3LGNA 3SV3A 4QYRA 2DH8A 5DZ7A 5T14A 4NCGB 2DR6A 1T02A 3MFHA 3OR1A 3TANA 3DRPB 4DR1J 1YJNS 5CZXA 4C9DA 1WC0A 1WHWA 5B0DA 4IO1A 3UR0A 2XI3A 2AJ0A 3OL7A 3ZZTA 4AL6A 1TKXB 1HNVB 1N0UA 3SV4A 2EKNA 4F3OA 2Y1JA 4E98A 2EK1A 1B0VA 1NM2A 1TTHB 2VBYA 1YBAA 1CULB 2D9OA 3MM7B 3FFIA 1RLDA 2CVIA 4KO0B 3NEKA 4NRUA 1TL7A 2IRYA 1HWJA 3BGUA 3HZGA 4NLGA 1N32F 4IG3B 3BGOP 4F4YA 3K57A 3JYTB 1VHFA 3FCVA 2ACYA 4WWSA 4NYPA 5KFUA 3IRXA 1IUJA 2J7KA 4WK1A 3M2UB 1QY7A 4HHHA 2W9BA 4LIRA 3GV8B 3NWGA 1LXJA 4O3QA 3R1HA 2HQDA 3QO9B 1W2BR 2FLNA 4DX7A 5KFMA 1NXIA 4LFBF 2ZDOA 5IT0A 2R7UA 2XMUA 2C42A 3TUPA 3PR5B 3KOAA 2JEFA 1JXEA 2AX0A 3PYEA 4KYZA 4OJGA 4RL1A 3ZO7A 4ZCMA 2CJKA 2IC3A 4X4UA 1LWEB 5A8WB 1T9XA 3GWCA 2W7OA 4JYAF 4DLEA 2JLGA 1SH2A 4A8FA 2W2PP 2ZD1B 3OT9A 4PQAA 3EGZA 3CSKA 4PG4A 4DCOB 5A0YA 5CD4H 4BLGA 1D8ZA 2F4FA 4QIEA 3CTRA 3FRYA 3G71S 1E6YA 2OI2A 4TYAA 2X7IA 2ZDPA 2KHCA 2XS7A 2MHEA 2RUSA 2B4VA 1TAQA 4P9SA 4Y0FA 4ZVHA 2HSEB 1X9WA 1RABB 2XI2A 1H72C 1N5YB 4ZJOA 2ACMA 4WKYA 3JQJA 4DUZF 4FPIA 3TO8A 3CCVS 2ASDA 3PW5A 3IMQJ 4DX6A 1TKZB 2PN6A 4PYDA 3JYTA 4I0WA 3R5CA 3OL9A 2H48B 3KUEA 4A8MP 4HYKA 1Q5VA 5D3GB 2FY8A 3GFZA 1YRXA 2J9CA 4OZ2A 1TUVA 3VAGA 1CC8A 1NSPA 2DR9A 1UKUA 2A3JA 2F8MA 2V94A 4PCQA 4PWWA 1DJ0A 3T1YJ 3SFGA 2FY1A 2CJ9A 1GTHA 2CPYA 3A8JA 4FZVA 4C6AA 3LTOA 2MZSA 3QIPA 5IV4A 1KOOA 2NQPA 1R31A 1FJ7A 2BW7A 2HHHJ 3CNQP 2WVCA 4F7VA 4I1TA 2MQQA 5LL6d 4TY9A 2R2UA 2VQFJ 2OTLS 4QWEA 1JQGA 2N3LA 4DX8H 3TQ1A 2E5HA 3HT0A 2BXJA 2ZHBA 3AOBA 4K4UA 3S6EA 2B5JA 4X65J 2XLKA 3NBPB 1EKRA 3LQVA 3FQLA 3Q83A 5CCMA 3DLBA 1S6UA 2MSSA 2QA1A 4NLXA 1G7CB 3ILJA 1KEKA 1RAHB 3AJ1A 4EWTA 3H2UB 4NLQA 3X1LB 3BQ0A 2UV8G 3JTPA 1TL3B 1DQ9A 1BQNB 2KVQE 3FJ2A 3KJNB 4B3SJ 3HK2A 2C3MA 2DGQA 4DR6F 2RS8A 4ANEA 5KFAA 4Q8FA 4WXOA 4JI1J 5L9NA 1NK8A 1QUVA 1ZH5A 1NSAA 5CCLA 2EXUA 2GNKA 5I3UB 3M05A 3OJUA 1FRJA 1WC4A 2GHWA 2XMMA 3G8QA 1LK7A 3GSIA 3ZTQA 5GAHU 4ECSA 4DJBA 3IWNC 2DRAA 5KFGA 1GAOA 2BRKA 4HI2A 4IG0A 3PXGa 3WIVA 1ZAWA 4F50A 3HHNB 1RISA 3EJMA 4AXIA 3OPKA 3KMSA 1EKSA 1F1BB 2DNPA 3CUNA 4LF4J 2WBMA 4NLRA 1TV6B 2HWHA 5DM6Q 3GR1A 1X5OA 3BPDA 4RBUA 4BHQA 4CLUA 1AUDA 4DWIA 2CNNB 1U1LA 1X60A 2QYGA 3SBMA 4K4WA 2XMWA 2CJAA 3EX7B 1FE0A 4CH1A 2DEJA 3Q8YA 4EYIB 5AE1A 3MR7A 1A7GE 3M7VA 5B0GA 3V5RA 3C8YA 1RWPB 2NSCA 5A2QU 2J7UA 3BDPA 1Q95G 2JRSA 1CG2A 4FYWB 1TL5A 3CMQA 5FDLA 4JYAJ 1LFPA 1H2VZ 3UCGA 2GA7A 3TZZA 2LECA 3OBIA 4I56A 4OYAA 3NXZA 3AB2B 4NCGA 4K2XA 1CS4B 4J37A 5HVFA 2DD8S 2RKIA 2X1BA 3MM6A 4WTYA 3TA2A 4CYUB 4XPCA 1Q81T 2LYVA 2NCKL 1RBOB 1N5SA 2ZNZA 4CO5A 4ZLNA 4DQSA 2FTRA 2LQBA 1QUPA 2ZJPQ 1AXQA 3PX0A 1OO0B 3TX0A 4XTTA 2BE7D 2JL9A 2M8HA 2AQ4A 1JLBA 1R8BA 4ZS6A 1KQKA 1Q8BA 5DQGA 1H3DA 2WW8A 4P10A 4R8UA 4GKJJ 2IVYA 4UUXA 1WSVA 5JXSA 5D4LA 4PR6A 4JV2A 2HFOA 5H9FK 5HAOA 3E2EA 4LF5F 1GX6A 1JLQB 3VQSA 4XAKA 1TK0A 3PO4A 1HFEL 1SCJB 3MF5A 2BOAA 2J9EA 4OV6A 3UDLA 5DLFA 4C48A 1K44A 4EI2A 4F3MA 2CJBA 2Y1IA 4HACA 3P4UB 3P49B 2OHDA 3KJVB 3FNNA 2BJ1A 4UQTA 1ZA2B 1ZAVA 2N82B 4X4QA 1VISA 1Y7PA 1D09B 3MAAA 1TUWA 2YX7A 3W64A 4X66J 2IRUA 3HSJA 2C2OB 5BR8F 3H5UA 1LWCA 4OHXA 1VIOA 3W3SA 2AF6A 2E1RA 4QW8A 4RNMA 2XM3A 3K58A 1AFIA 2RAQA 2WOMB 3IM8A 2Y8YA 2C2NA 2RMLA 5J1NA 1SUQA 7AT1B 3ITHB 3CC4S 4R5PA 1GXTA 1EQ0A 1VRUB 3BBFA 1ZPWX 3ILOA 2DGUA 4DSIA 5DRKA 3TA0A 4RNFA 5DDOC 2R2RA 2E1AA 2VDHA 1FFGB 3M6WA 5C25A 3GQCA 5E0OA 4OL8A 2YKAA 1U24A 4NCBA 2FHKA 3PW7A 1U8WA 3I0SB 3EM1A 3M2RA 5HROA 1M5SA 2ZBRA 1VGYA 3FSXA 2GW8A 1HBOA 4O44B 4X4NA 2XMVA 2QIFA 3NGKA 5F9NA 4BC9A 2BBEA 2YKQA 2AW0A 4GKKF 3Q8QB 4RLEA 1NK9A 3GJTB 4KY3A 3MWBA 1VMBA 1PBAA 1JB0C 2BM0A 2IFXA 4YUDA 2B8PA 4GMKA 1E6YB 2VC0A 2EKYA 3RTVA 3DRYA 3DI6B 1D9DA 3BKUA 1NPPA 1UPPA 1ZM2A 2KXHA 2GMHA 4K59A 4ZLPA 1N5QA 4J9MA 1RADB 2IM2A 1IJEB 5DJBA 5FD1A 5F8NA 1S99A 1REGX 3MAHA 3N5BA 2ASJA 4HL9A 2V67A 2AYMA 1O6XA 4KQZA 2QL7B 3MDFA 2XGPA 4UY8T 1LWEA 1V3ZA 1TKZA 4ZPTR 1SBRA 3I9ZA 4Y2AA 4ZPBA 3K17A 3TRGA 1H0HB 2DGSA 5AJ3F 3VAMA 3MECB 1UVIA 2UVVA 3KHLA 1C0TB 3OFEA 2AEMA 1WDDA 4OFZA 3TOQA 2VH7A 1CLFA 3MEDB 3CJ4A 4X4OA 4A8XA 3OVSA 1Y9OA 1X31C 2B51A 4WKRA 5J2MA 1H73A 2QJ3A 2MZ1A 1TL4A 1B7FA 4YB1P 3DOMA 4Z2XA 3OL6A 4LT6A 2Q66A 4ZA1A 1RT6A 1LK5A 2VB6A 4NE9C 1LWFA 2E66A 1RAIB 4M8LA 4USJC 3SSRA 2BKPA 3EICA 1IBKJ 1JLCB 4K4ZA 4QIGA 3BR8A 3BO3A 2DHGA 2XMJA 2GO9A 4KPCA 2CQDA 1Y4ZB 4MMOA 2KG0A 3ICLA 1LW0A 3ILLA 3CDUA 4ED1A 3SDEA 2F3JA 2LXFA 4U7UK 1RA7A 2GVDB 1RTDB 3PW0A 2BE9B 2RF2A 1N36F 3FEZA 2UUWA 2PE8A 3HX9A 4UQGA 2ZNYA 2LFVA 4DPUA 2FGOA 1DQ8A 4AT1B 3I5AA 1EZZB 1NUEA 2BJDA 1RT5A 1NK7A 2RB7A 3JXOA 4LFAF 2C2DA 2CQCA 1YRTA 2AJFE 2VPYB 4DV2F 4DV4J 2XMKA 7FDRA 2NYHA 2RDDA 3W2VB 2HVHA 1RBLA 5D15A 2V8HA 4YDDB 2K7JA 2GVDA 2QMWA 4P2XA 1JLFA 1Q86T 1J5EJ 3NNHA 1QE1A 3BBCA 4PZVA 3OR1B 3CMAS 3AY0A 2WHOA 2J6TA 2BQ3A 1RUSA 3EDQB 3GFHA 4OJHA 4A8KA 3CW2C 1YHQS 2KRRA 1BGXT 2GV1A 2E9ZA 1C0UA 1NHVA 1WACA 2YKPA 3AOAA 3F44A 3NAIA 4HH1A 4CI0B 3W2WB 1SL2A 1X5SA 2XNQA 4G1QA 4JI4F 1AZSA 1LW2B 4ECRA 1ZYQA 4PG8A 4IRDA 2PIIA 4IG3A 3IR5B 3OFGA 2ZBCA 1FKOB 4IH7A 4L73A 1FD8A 1DHMA 3ETMA 3HVWA 3TJ9A 1IXKA 1DBDA 3ETOA 5KG5A 3ZZZA 3J7A1 2QTWA 5T7LB 3T9ZA 3PEHA 3NS5A 4NA2A 5BJRA 2DNMA 2PMWA 4KR0B 3UPFA 5MAOA 4PXCA 2WAQD 1WF2A 1RHKB 2Z56B 1BLUA 4TYBA 1VC6A 2VODA 2ZEJA 2OGUA 4OIXA 2J0WA 3WIUA 1F60B 1Y11A 3G2XA 4LRBA 4W4MA 3MMBA 1BY9A 1CJTB 1S9EA 5L46A 4B9UA 3EPGA 5KT6A 4O0NA 5IV3A 4PXBA 2VBZA 2EPIA 3SFUA 2CFXA 4QPTA 3DRSA 4IFYA 5HMZA 1CJKB 3SCLE 4E0DA 2AD9A 2BRLA 3QAUA 3VZHA 1HQEB 1U1OA 2A10A 5FLXU 2ZH7A 5HANA 1U1MA 4JI5F 5AJ3J 1FRLA 1I94F 2MSTA 2F4VF 2CQIA 2YNGB 3GCWP 2LEPA 2CWKA 3GZ7A 2ZH8A 4DF4A 3C2PA 3QWUA 2D3UA 1HNZF 2OPRA 3WHIA 3LWLA 1B3TA 4L76A 2R7RA 3NY0A 2KT5A 4O3OA 1PYOB 2ZKTA 1HMVB 2YWHA 5HJXA 3BJYA 1IQTA 2J0XA 4CLYA 5E41A 2RD5C 2DJWA 5CYQA 5M2RA 2W8LA 2CQHA 2K1RA 4RUCA 1FK9B 3HD2A 3IP0A 5HVGA 3K5MA 1B70B 1KHWA 2V34A 2VDIA 4C7QA 3T1HJ 2FJBB 4JI2F 2DYAA 2N7YA 3V4MA 2IIHA 5F8GA 4Y2CA 5KFLA 1GFWB 3MEKA 2VD3A 3QIDA 1NK4A 1JLQA 4B9SA 2AZ3A 5KFFA 2HHQA 5KFRA 3DNCA 4CM0A 1HHSA 1OSCA 1FFWB 2YKMB 2JFDA 1OPZA 3TAMA 3ZZYA 3J7ZT 2VQEJ 2AWZA 2DGWA 2M2BA 3S8SA 1XNQJ 3KJQB 2FVCA 4JI8J 4QWCA 1CJKA 1RAOA 2DGVA 1MROA 4URQU 3KLFA 2YWFA 3EZ5A 3TI0A 1FJGJ 5EX3A 3MAAB 4I2PB 1D1UA 1YLXA 1J5OB 3QJLA 2DCLA 3M8QB 4HT5A 2IY5B 1RTDA 4HVZA 4DV5F 1TELA 2M7SA 1HW9A 2HNDA 4QPXA 3KLGA 3CEDA 3AB4B 4IH5A 3PYGA 1WC3A 4KSEB 4ZP9A 1KN6A 4LF7J 4A8SA 1NDKA 2HHTA 2PI5A 2H65B 3CCES 5ETKA 1DLOB 4A47A 3B4DA 3BN4A 2QZ8A 4RNNA 4M5LA 2QLXA 3CC2S 1X4FA 3OLBA 1N54B 1X7VA 3N9UC 4MKAA 3KMQA 2FLOA 2OFHX 4B08A 3DDIA 2G0IA 3BEGB 4K8RA 4OZ1A 1S5ZA 2AEJA 3DM2A 1S1UA 3LOUA 3VQTA 1RWUA 4NYOA 5F0WA 4UUWA 5L8RC 1MU2A 4LRDA 3KUHA 4NWBA 2HWTA 5H1SV 1LFWA 4UOGA 1ZOTA 5I42A 4DFJA 4MK8A 2GAGC 4WBFA 3TUJC 3WQPA 3BN7A 4DZDA 4NX9A
chains in the Genus database with same CATH topology
1H2UX 5HP1B 2B5JB 1Q7YT 5FJ4A 1UWBB 2BW2A 4XDCA 4K4VA 5EDWA 2HGMA 1VI7A 3W2VA 5KFDA 2EBGA 4EO8A 2HHSA 5L39A 4OZNA 5E3AA 4R8UB 2MDAA 4MKBA 4ED5A 4B3OB 2JEGA 3HHLB 2PMHA 4IFVB 5KT4A 1FJCA 1Q1KA 4Y2IA 2IMWP 3OHAA 3DDNA 4I64A 1S48A 4ICLA 1Y5NB 1S49A 2XULA 1V3SA 4C8KA 5EWGA 4I69A 2FJVA 5KTQA 2LKZA 4ECZA 2E5IA 1EETB 3B4MA 3D54A 2R9LA 3BR9A 2BABA 4ECWA 2E9TA 1R43A 2XB2D 2O5DA 3MM5A 3TVYA 1EETA 5BYRA 1LWFB 2XSJB 2OTJS 1VFJA 3LALA 2R7OA 4IDKB 2DO4A 2EBEA 1O8BA 1WF1A 3O1LA 5GVQA 2ZH1A 2PI4A 2KHDA 4LF8F 3DLGA 2ALZA 3RAMA 4ZHRB 1L3TA 2BUNA 1KQGB 1M5HA 1WELA 4RZRA 3L7OA 2KXNB 1ELOA 3FZ2A 1FNXH 1D0EA 1UVKA 1JWWA 1JKHA 2CKWA 1KTVA 2F8HA 3SMZA 4YQWA 1TP7A 3BREA 3THVA 1DAXA 1SIZA 3M32A 1RAJA 3FMWA 3TARA 4FYDA 5J1EB 3M2VA 4DL3A 3OXLA 5IQQA 3MOJB 4EZ6A 1HBNA 2OPRB 2V0NA 1KSPA 2YTCA 7FD1A 1G1XA 4OZLA 1Q8IA 4C0OC 1VRUA 4Y2MA 4ID8A 2YNGA 1M5OC 5L1IA 4C8MA 3Q2TC 2COLA 5A0YB 4WXWA 1U49A 3B8HA 1RT3A 4WU2A 3D2WA 4NLSA 3THPA 1C1CB 3M6UA 2QA4G 2ZBIA 5SZTA 4BBYA 5KOWA 4DL2A 3PKMA 2CZ4A 3EUNA 1YQHA 5IM0B 3PRDA 2I8EA 2W4CA 3ZZUA 2JEIA 4OI4A 5ITHA 1FE4A 4TU7A 3FSYA 3MTKA 1TL1A 4N8OA 3BZQA 2ROGA 1S6OA 3BSCA 2NS1B 3SQGA 6FDRA 3UCUP 2NSBA 5K8PA 2WBRA 4DR7F 2EG1A 4TKTA 1J2VA 1C4AA 1O0PA 2IM0A 3GG0A 1UEUA 2OKQA 1UWBA 3R5BA 4MIBA 2XLJA 4NLPA 1IKVB 3TA1A 4JI3F 4NCAA 1D3WA 2VFUA 1HNXF 1HR0F 3NBPA 1GXLA 1H7WA 2MGZA 1VQ5S 3MXHP 2FD2A 3K7RA 4NPOA 2AYEA 1MU2B 4PG7A 5IM0A 2L3MA 1RGVA 1HNIA 2VG6A 2X1GA 5KT3A 1U1RA 4N76A 1FRIA 4C97A 4OLPA 5DDRC 2K3IA 1RTHA 1Z2LA 2EFQA 4DR3F 2JDJA 3BM7A 4WF9Q 3RBEA 1NJIT 2HLTA 1TL1B 1T05A 3JB9k 4K4YA 2N4DA 4LUBA 1XEZA 4AFFA 1DRZA 5CHCB 2XGQA 3ZFVA 4J9QA 3CVKA 4QQBA 5JVHQ 4JI0F 3CPWR 4G1QB 4ECTA 2PT0A 3RRHA 3M2UA 4WJBA 1RT4B 3I6PA 2E7XA 4I7FA 3DOLA 3I0RA 4JI1F 3IXQA 2YY3A 3VZIA 5KFBA 3ENVA 3T3FA 2DK2A 4PQUB 4NLWA 2WB4A 2DGTA 2DNLA 3PFEA 4DLGA 3DC2A 1X0PA 2MKIA 5F8JA 4AE5A 2IA0A 2OAUA 3C6TB 4ZVGA 1S77D 2UVWA 2BACA 2HRYA 5GAGI 2B9YA 2VG6B 3DOLB 4MJKA 4CT9A 1CQNA 1RA6A 3L7PA 1NJZA 3MD3A 3GFXA 4Y00A 3LP1A 3QLHA 5H9EJ 2D74B 3F56A 2XCAA 5E3QA 2E1CA 3LP0A 3HDSA 2OMOA 1SKWA 4MIAA 5B08A 3C6TA 2NYIA 5LJ3Y 5C24A 4IOBA 5G0RA 2LLZA 2MB0B 4JV5F 2ZH4A 2VA3A 1U09A 2RIJA 3VAKA 4FN5A 2MQNA 2FHOB 2JVRA 2GHVC 5CYMB 3G6VA 3DN9A 2PC6A 2O66A 2MHNA 3D5MA 1LQ9A 1FNMA 4LF4F 3NNCA 4JV0A 5HI7A 3IN5A 4KKOA 4FNIA 2O1PA 3KLVA 1PC4A 4DV6F 4QWDA 3CCUS 2I1RA 4NL5A 3DCAA 4A8WA 3KKFA 3QMQA 1VQNS 1KLNA 3DGPA 1KFSA 1FKPA 3M8RA 3HT3A 2KZMA 4HH0A 3KLIB 1M5KC 1UJ6A 2W8KA 3LW5C 3G6XA 2GIQA 4KFBB 5IWAF 1Z2ZA 3H20A 4MFBB 2MKKA 4HEA9 1VQ8S 1WD6A 4DSLA 4V19X 2E9RX 1IKWA 2U2FA 3KHRA 4ES2A 4NZ7A 5HMXA 4GO5X 3CD5A 4KFBA 5I4MA 3Q8PB 6FD1A 2FHJD 5L1LA 2RQKA 1KONA 4EFAC 4KC5A 1PILA 2L9WA 3D1QA 4WFNQ 2UXCF 5LXRA 3MCSA 1P9QC 1UW4A 1AFJA 2G0CA 2VPWB 2V5HG 1T3NA 2RQ4A 2YWGA 1S1VB 1ZBTA 4YB7A 1TFYA 1OIAA 5DGBA 3QGGA 2UVRA 2J76E 1IR0A 1L5UA 2SXLA 4J9RA 1J5EF 2V4JB 2HFNA 3THTA 3NKYA 1VQYA 1M1KT 1U1PA 1U6FA 2ABYA 5DLGA 1KVIA 4CZCA 4K5SA 2F9DA 2HHXA 4I6AA 2VG5A 1MW7A 4MAKA 4X65F 1QAIA 1RTJB 5DDPC 5DG9A 1XERA 5AXKA 3PNIA 2KFZA 2WTFA 2A2DA 4ZP7A 4H4KA 1LW0B 3OHBA 3OFHA 4F3QA 3PIOQ 2X1FA 4F67A 1K0VA 1KLMA 2NZ4A 4O44A 5FDLB 5DM7Q 1S76D 1WHVA 3PM9A 1REVB 2RE1A 3GV7B 2FJXA 2PGCA 4U6PA 2RQCA 1RYSA 2ZVSA 3CJ3A 1RTJA 2Z2LA 2FVSA 1SJ3P 2R7SA 2JZ5A 2Q3PA 2NPFA 4EU0A 2KYXA 5D4NA 4DV3F 2C2EA 2VFTA 5J2MB 3RB3A 1WF0A 5IFMA 1HYSB 2BYCA 4QU7A 1Q7LB 4HDGA 1TV6A 2KRBA 2PSZA 2MYFA 1RTIA 4EGLA 1C1BA 3HMJG 1N5TA 3I0RB 3AA8A 4DQQA 3GR0A 1U2FA 2ZH9A 1MMNA 2FVPA 3OXFA 2YKNA 4RX6A 3OR2A 1R8PA 1C0UB 5K14B 4LSLB 1R27B 2RKIB 2KM8B 2VOOA 3PVXA 2XSFA 4O3NA 3QZ7A 2V8GA 4TN2A 4RKUC 3BQ1A 2F40A 3DDKA 3I4HX 3O44A 2UVUA 2HPUA 1MWYA 1VRTB 3T6BA 3T1HF 4O4RA 4F2SA 1SKRA 3CIZA 2LQ5A 3HFKA 4PXEA 3GIJA 1APSA 5L9XA 4JI7F 1PC5A 1SC6A 5KFEA 4FBTA 3US5A 5K5MA 2CQ2A 4WIIA 3KLIA 5GMKa 4RW8A 4CIOA 4DG1A 2DNRA 3DYAB 1ZM3A 5KFHA 2D9PA 2MJNA 1W25A 4FS1A 1S1TA 1XTZA 3U7JA 4CH0S 5KFCA 1YIJS 1VBZA 1HWIA 3MPWA 2V4QA 4RW8B 1U48A 1S6QA 3L09A 2I9SA 3CULA 3P3DA 5K8MA 3HKWA 1JX4A 1VIXA 4ALZA 3V6HA 4RUAA 2XY7A 2V2KA 1UJ5A 2CPJA 2LQJA 4LJMA 3M6VA 1V3RA 2C3YA 3IAM9 4YFUA 3FFIB 3DLGB 4WYWA 3T19A 1FXLA 3KLHA 3DI6A 1VQKS 2R7XA 3VALA 1TKXA 3T6JA 2AJ1A 2DBBA 1S6QB 4IO9Q 3CB4A 4IR9A 3DLKA 1HBNB 3A1YG 3IA0A 1YG0A 4HTJA 4PRFA 4IFYB 2WRMA 2OLWA 3AQOA 3GMGA 2YNFB 5IZHA 5EX0A 1X9SA 3WBZA 2DVIA 5DQIA 1LXNA 3AQPA 4RWWA 3IRXB 5F8LA 3ZZ0A 2LDYA 4ILMA 2R7VA 2PMZD 3FEYB 3ENWA 1P8GA 3H98A 2F9JA 4TU9A 1S97A 3POTB 2IM1A 2XS5A 1XBWA 3MPVA 2CQBA 1X8DA 4N8NA 3TAMB 4MTPA 4WU3A 4DFKA 4ELVA 4LMZA 2ZOGA 4R5PB 4F4KA 4P7TA 5F3TA 1HNVA 1NHUA 2JLEA 4NRTA 5CZVA 3V2UC 3G8SA 1Q82T 2WOMA 3H8YA 3MD1A 2JJ4D 4DPOA 4IOAQ 3T5JA 5J1EA 1UVJA 2GJIA 3KK1B 1NK6A 1QVFR 1K8AT 2DIUA 1DZ5A 1Q4RA 3I87A 3OUYB 2UUBF 4DSFA 1F5AA 3I31A 3IR6B 5I3UA 2W7PA 1S1XB 4KGMA 1N5YA 5BYSA 3G96A 2W24A 4LVNP 4QWBA 3FEXB 1RTIB 1U45A 2C3UA 4ECXA 4B9TA 3C3LA 1GXUA 3O6QA 4BS2A 4MKYA 2FDNA 3EGNA 4OHVA 3CCLS 2RS2A 3KLEB 2C3PA 2LCWA 1HI0P 1H2TZ 1HBMB 1GNKA 1T94A 4KBIA 2D3OR 4DSJA 4EBEA 1F2GA 5DS7A 1A6LA 2DRBA 2AJ4A 3JSBA 4K4XA 1S4FA 1TVRB 3FVYA 3IRWP 1RT4A 1G6BA 3DRRA 1DLOA 2IRXA 3MMAB 3I0SA 3M2RB 1TR0A 4ID5B 3LUYA 1FRKA 1YJTA 2J7WA 4KIAA 2VQEF 3SCJE 2FVQA 1B0PA 1FVQA 4FP9A 3CIMA 4K4SA 4NXMF 2F7VA 4LF9F 1JLAA 5GAGU 5DGAA 2B4UA 1VQPS 3HHKA 3N79A 3RW7A 4C0BA 3UFCX 5MLCV 2LEAA 4OQJA 3H4DA 3NMAA 3HHEA 2CDQA 5L38A 5LSLA 1RKIA 4G1PA 2BQRA 2YNIA 2NR0A 4K0KF 2WSFC 2J9DA 3DMJA 2A2CA 3WX4A 4YR2A 3CCSS 1X4EA 4ZDNA 2CJQA 1SH0A 2DTJA 3PIPQ 4ZCIA 2JSXA 1FDAA 3UW1A 5C42A 4LSNB 5EWEA 5FIIA 4MIWA 3I5CA 1X9MA 4DEZA 3Q22A 4ZCLA 4DN9A 2YX1A 2IAJB 2XBPA 1Y00A 4JI8F 2J9DE 2N4CA 3IBWA 4FNHA 5KG4A 3RZAA 4Q2MA 3GB0A 3KLHB 2B3TB 1U4BA 2ZOMA 3OL8A 3GILA 1WEZA 4ZP6A 3OTEA 1XK8A 2H5EA 5KFXA 4ZHRA 1NU4A 1HWUA 2M5YA 2OPSB 4URSA 1WTFA 2LVWA 3CDWA 2FUG9 1U2RA 4KTQA 4DMZA 4EZ9A 3CCTA 1JLAB 1N56A 4Q8EA 1Y3JA 2ATLA 3SEOA 3V6KA 2NLWA 4H4OA 1OPIA 1L3KA 3M2VB 2ZH6A 2B0GA 2EVZA 1QE1B 5A8KA 1D9FA 5HQ8A 5CYQB 2Q6CA 3FDSA 1FT8A 2ZHAA 4DL7A 1BQMA 3MHYA 3IGVA 2YH1A 2HHUA 1V6HA 3HVTA 4CNYA 1AW0A 4B9NA 2HS4A 1BD6A 5E2QA 4FXWA 2RDJA 2M8DB 4IRKA 3LAMA 4FF4A 2JVOA 1X0FA 2VKZG 3Q24A 3GYXB 3H2VE 1HQEA 4W92B 2AGOA 3KFWX 4WK3A 4KGKA 5D3GA 3NCPA 1FHTA 1HHTP 2OP5A 1JJ2R 3V4IB 3AJ2A 4Y2KA 3T1YF 1S9EB 2FHJA 1M90T 2CQPA 3WC2A 3CT9A 3V6DB 1U1QA 5K8NA 5CYMA 3KG1A 2R7WA 3TAQA 3I82A 2VG5B 3QWPA 5E7OB 4C2MA 2KT3A 3RB4A 3JTOA 1YI2S 2XS2A 3OTCA 1S9GA 2IYIA 2HZCA 3TUIC 2HHVA 2CPIA 1H98A 2YNHA 3M6XA 3K5NA 1YITS 1YVFA 4OZ0A 3U02A 1D9AA 1S1VA 3HJFA 4H4KC 4AYBD 4C11B 4RUHA 5HROB 1HPZA 3MMCB 3KWMA 4ED0A 4NLOA 3D28A 5C25B 4N41A 1VQ7S 1CC7A 3CCJS 2IMOA 5GADI 3QIPB 2JX2A 2ROPA 2HG4A 1MMLA 2YX4A 3SYZA 5F3ZA 4M94A 1R3NA 2CQ4A 4DS5A 1VOMA 2FJWA 4ED7A 2OD4A 4KE5A 3HHLA 2DH9A 2QRRA 4C8YA 2EK6A 4EUVA 4D3GA 5KFNA 4IH6A 1UEVA 1OQ3A 4O0IA 3T1AA 4CNZA 1S79A 3BB5A 5KFTA 5LMUF 1S0MA 3E01A 2CPZA 1KQFB 5L1JA 3JSRA 2OPPB 1FK9A 1YJ9S 2J6UA 5B0FA 2DIVA 3VAFA 4U67Q 2UUTA 1JLCA 2N7CA 1JNRB 2L08A 2DNNA 4I2QA 1M5PC 4J9PA 1VK3A 5KG3A 2YNIB 5KT5A 2XG8A 3CE8A 2X3GA 3OVBA 1Y3KA 2YKMA 1WG4A 5KOXA 3OJSA 3G6ES 4N77A 3PW4A 2GQCA 4R0EA 4EYHB 5CH7B 4C3KA 4FBUA 2VFRA 2ZHOA 4RW6B 1T03B 5D8HB 5CQGA 1S10A 4UOCA 4DSKA 3FCHA 1UMJA 3IG1B 1Q8LA 1IBLF 3N01A 3QJJA 2M88A 4QW9A 3LWMA 5HLFB 3EXYA 3J7Z5 3CGIA 2QV6A 2CYYA 2VUGA 4QIVA 3VAIA 3I5BA 2Y0SD 2RU9A 2K7KA 2OMLA 3I55S 2KJWA 2B7BB 2R8GA 3KG4A 4B9VA 2KVIA 3GG1A 2VFSA 1U6BA 2O3DA 1N52B 1WG5A 5T7LA 2E29A 5KFZA 3P96A 1FKOA 3JSYA 3OXGA 4YY3F 2FLLA 2AYBA 2BV3A 2ZH5A 2D1CA 1VBYA 3N4WA 1GQEA 1QAJA 1T95A 2W4DA 1URNA 3D0HE 3BSOA 4X4SA 3CCZA 1UFLA 2F1FA 2PA8D 3DMJB 3HHLD 4RBVA 5HO4A 2XHWA 2VL1A 1VRTA 4IUFA 2APOA 3MM9B 2IVFB 2K2PA 2QEXS 3G6YA 2RUGA 4Q45A 4PPDA 4IDKA 4MH8A 1VBXA 4ZOSA 4DR1F 1TKTB 2KO1A 2RQMA 2VBWA 3HKZD 2RSQA 2WK4A 1K0TA 4ECYA 2MZQA 2P6TA 3DLJA 2HHPA 2GIRA 2YNFA 1HMVA 4KT0C 1IBMF 1G2EA 4DL4A 4NLYA 4Y34A 4OI3A 5A8RA 4Q0BB 2UP1A 5KAKA 3M1VB 4B3MF 3CJ0A 1SH3A 3KHGA 3UDCA 1QAXA 1E6VB 1Y0HA 1NK5A 3MEGB 2WCXA 1VK8A 1F5CA 3BQ2A 1IKWB 4J9SA 2OH2A 4HKQA 3M9MB 2HFZA 2BZ2A 2HIQA 3CJKA 3U1LA 1KOHA 2KXFA 2A18A 2XCPA 4ED8A 3D1HA 5JVGQ 4QR1A 1L3SA 1BQMB 4OHWA 1U1NA 2HMIA 2V4RA 3IO1A 1KLMB 3LH2S 3PX4A 4LFCF 2EC0A 1YJVA 4QR2A 4GKJF 3DU6A 1LV5A 2Z0GA 2CRLA 2G13A 2CIMA 2FVRA 2HNDB 4DFPA 1RP5A 2PO4A 3FZBA 5KT2A 2HS0A 2FHMA 3G4SS 4DR4F 2M70A 4TY8A 4BC7A 2FB0A 2MKJA 3LF0A 1H38A 1IKYA 2V4JA 4NZ6A 5EGYA 2DT9A