4RBUA

Pdua k26a s40q mutant, from salmonella enterica serovar typhimurium lt2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
EALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGQGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propanediol utilization protein PduA
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica serovar typhimurium
molecule tags Structural protein
total genus 18
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rbuA00
3NGKA 4AXJA 3CIMA 4OX6A 4OX7A 4P7TA 4DDFA 2A1BA 3MPYA 4PPDA 3IA0A 4RBTA 4RBVA 4RBUA 3VCDA 3SSQA 2A10A 4QIEA 2G13A 4P2SA 3MPWA 4QIGA 5L38A 3I6PA 2EWHA 3DNCA 3CGIA 3SSRA 3I96A 4AXIA 3BN4A 4OLOA 4LIWA 4P7VA 2A18A 4OX8A 3H8YA 3PACA 5DJBA 3NWGA 3SSSA 3DN9A 4OLPA 4QIVA 3N79A 4QIFA
chains in the Genus database with same CATH superfamily
2PFFB 2XS7A 3CCWA 4L72B 3OLBA 2R7WA 1HHTP 2B8QA 3C15A 1VDHA 3A8JA 5J2NA 1QE1B 2QEXS 2C2KB 2EBGA 2H5JB 1NNDA 4EFAC 2IIHA 1Y5NB 3CXCR 3QZ8A 3I9V9 2DH7A 1SKWA 4KGVB 2VHGA 3EVWA 1X5TA 1NZ8A 3F73A 2W7AA 1GNKA 1SC1B 1SVDA 5IT4A 1TKXB 2FZCB 3HHLD 4QIVA 4WYLA 4P10A 3IWNC 1R8BA 2M7SA 4ZCKA 3CJ5A 4F26A 4HHHA 2MY7A 2PA3A 4G1PA 2YPYA 3W5XA 4ECRA 2I9SA 1TMJA 2RRNA 4ZOSA 2CG8A 1WDTA 5KFEA 4LF1A 2LQ9A 3NGRA 1U1NA 2BQ3A 3T5LA 4KHPJ 2BE2B 1TQLA 1KSPA 2YXLA 4A8YA 3BREA 3L95X 4K0KJ 1PJ5A 4F25A 4PG4A 4FNIA 4FF3A 4B17A 2E5LF 2LECA 5C7PA 2MPUA 3MEGB 3AJDA 1VLOA 3GJRB 1X4GA 2XULA 3TUZC 3MPVA 4FVCA 1N32F 3MR5A 3N01A 3C19A 2VC0A 4YN3B 1RKJA 1IKYB 3CDBA 2R7OA 3LO3A 2L9WA 2K7JA 3PX0A 3FCVA 2XEXA 6AT1B 4LVOP 2OEKA 4DU7A 4A8KA 3WHIA 2JJ4D 3EXYA 1Y11A 5KFMA 4I2QA 2CA9A 5DDRC 1N54B 4X4SA 2F65A 1VRQC 1FJGJ 2VUGA 2HHSA 2E7WA 5CCLA 3TZZA 3NEKA 1T9TA 3N0VA 1V9OA 1UVKA 4K4VA 5CAAA 3EGNA 4O44A 5B09A 4QU6A 2DHGA 1R43A 5J2PB 4NXNF 1DY3A 5HBMA 5L9XA 2E5IA 1NAQA 3L7UA 4UOHA 3LP1A 1SJRA 4PG8A 4NLYA 2X1AA 3UDLA 1FDAA 5KFVA 2NR0A 3RRKA 1V5VA 3ITHA 2UZAA 1TVRA 4NCGA 1DQ9A 3BGLA 5I3UA 2HK2A 1S49A 2A10A 2NXJA 1FKPA 3I6PA 4JI8J 3QRPA 3Q8QB 3AAWB 2CG4A 3ZZYA 4NLPA 2RE1A 4Y2AA 1IBMF 4EO6A 1KVJA 2GO9A 3R7SB 3SCKE 2F5GA 1FWKA 2ZNZA 1I6JA 3DLEA 3L4BC 4LF7F 2OPRA 2HBZB 5JJBA 4J9RA 1J5OA 2JC0A 3HMJG 4FYDA 2OMLA 2ZHBA 2W9BA 1OPZA 4ERDA 2DO4A 1X4HA 1KVKA 4RUBA 4L74A 5CCMA 2ALYB 3MMAA 2I8EA 3IAM9 4WFYA 2XZWA 2ACMA 5C2CA 2EG2A 2B9YA 2JL9A 1XR7A 4Z2XA 1PYOB 1QDUB 3TA2A 5DETA 2MJUA 1UEKA 3OW2R 3H4BA 1WJ9A 1WEZA 5D3GB 4C3MA 1SKSA 3E01A 2ZJPQ 3SFGA 1H74A 1Y9OA 3DHWC 1PBAA 4DR6J 3DRYA 3ISNC 1M5KC 2BM1A 3MFIA 5A76A 2DEIA 2CJXB 3GPAA 4ILRA 4ETZA 1IN0A 3BYRA 2XGPA 3D9BA 4AL6A 3IBFB 2YKOA 2IC3B 1KN6A 3C14A 3BO3A 3K8VA 4DQPA 2GVZA 4GMKA 3H98A 3MI7X 1TKZB 4ED4A 2AQ4A 3K59A 4G1IA 4ZLNA 1NRKA 2HHHJ 2ILZA 2FZKB 3A13A 2OHDA 3DGVA 1N5YA 4M94A 3LF0A 5A2QU 4PPZA 1RT3A 4URQU 2RB7A 5F3ZA 4F3OA 2MSTA 1SB6A 4U7UD 4M95A 4LFBF 4USWA 4WIQA 1WC5A 3IWXA 2QRRA 1S1UB 4PWDA 4J9QA 3HHLB 4QZVB 2PO4A 4MYUA 4C8ZA 1G2EA 4Q2MA 1REVA 1FFWB 1VQMS 2UU9J 2VG5A 1WACA 2FHOB 4LIRA 1E6VB 5C42B 3GP9A 3HFKA 2ZOGA 4LQ3A 2HLTA 4Y3CA 1T03B 4XTTA 2MXYA 1RACB 4E98A 4LSZB 3PFOA 5EN1A 2BKPA 2DVIA 3CCJS 2KM8C 4NLTA 4JI6J 3IRXB 2AZ1A 1BQNB 2FDNA 2FJBB 2C3UA 3FCHA 1YQHA 2YKPA 2LKZA 5L8RC 1WKJA 3QLHA 4D3GA 1HQEB 1VQ5S 4DV6F 2XQCA 2MQ8A 1RK8A 2LLZA 3M2UB 2R7UA 4WZMA 1WC3A 1UW9A 3TO8A 2W2OP 5H9EJ 1FF2A 3C16A 2CJKA 4GRSA 1M0SA 2LDYA 3D0HE 1K44A 4UUXA 1YZ6A 3UFCX 1RABB 4LSLA 4NA1A 2KXNB 2RU9A 4C4WA 4KH0B 2MKKA 1F2GA 2LXIA 3FZ2A 1WF2A 1D0EA 1OYDA 2B4UA 4JYAF 2D9OA 1KLMA 3FKBA 3NG8A 2VU5A 2HFUA 4OQJA 5KFZA 3MM9B 5KFOA 3HPOA 5E3RA 3R5GA 4MAKA 1BQXA 1TL7A 4O23A 5HO4A 2AP6A 2CJAA 2OPSA 3HI9A 1FKOB 2OFHX 4QIWD 4WYWA 1HNIB 5D0HA 4OX9J 1RGVA 3RB0A 3GB0A 1VBKA 2VG6A 2HQDA 2HHPA 1RHKB 3NMRA 2RILA 2P9EA 1G3OA 4RW7B 4OX6A 1N0VC 3DOKB 3FMWA 3BGFA 2ZBIA 2CWKA 5LSOA 2QG9B 1TUVA 2BACA 2V4RA 4J9PA 4ZHRA 2LYVA 3MD3A 5HN0A 3KG4A 1WC1A 4G3IA 3J7A1 4ZVPB 3X1LB 2KFZA 4CO0A 1QAIA 2NYHA 3PKMA 2IDLA 2XMUA 1H2TZ 3JYTA 2DR9A 1HBNA 3ZFVA 1OSDA 1VK3A 5HI7A 2XLKA 3CDEA 2CQGA 5KG0A 2VJVA 5IQQA 3FSYA 5D4NA 3EXCX 2YWGA 4UOFA 4DV3J 3UWTA 5IOLA 1RA7A 1Q0NA 3CDUA 4OZ0A 3NCQA 1N0UA 4ALZA 4KKOB 5BYQA 2QLWA 1B0TA 2MKJA 2NZCA 2QL5B 1SL0A 2MLXA 4F0KA 1VLYA 4DQQA 1N5TA 1VQ7S 3AXMA 5FDLB 2H9ZA 2HMIB 1R8HA 4USMA 1PG5B 1FJ7A 4NZ7A 2AEFA 2UV8G 2UP1A 3K5PA 1MMLA 3ZZOA 2RSQA 3CMQA 4FNHA 2CQ2A 1TKTB 2B5JA 2Y1IA 5KOWA 2GJIA 3QO9B 4PQAA 5L1LA 4MMOA 3AHPA 3I5BA 3AD9C 3ZC4A 2ZVIA 3D28A 2YKMB 1FE4A 3P4UB 4I0WA 2IAJB 4TN2A 3ZZUA 3ZNJ1 3SCJE 5K14A 4FXVA 3DU5A 4WKRA 1RI7A 2ZH3A 3EE3A 3RJMB 4X84A 3GV5B 2LXFA 4R8UA 4ID5B 5HMYA 4X4OA 1APSA 3RG6A 1IBKJ 3ILLA 2OO4A 1U26A 4DSIA 3K5NA 3OTCA 3W65A 1TK5A 5C24A 4B3RF 1U4BA 5LT5A 1DTQB 2F8EX 1RZMA 4DBQA 2E1RA 4OZNA 4QQBA 2YQ0A 1U2RA 1KP6A 4DI6A 1WEXA 2V94A 1VQ4S 2CPZA 4ZN3A 2DR7A 1JWWA 5AJ3J 3TARA 3OLAA 1Y10A 3B6BA 2RJZA 4IG3A 3DRRA 3PHEA 2BANB 1YBTA 5IWAF 1FJCA 3ZXWA 3SQGA 3ZZRA 2L48A 2EWHA 4ID8A 1B64A 2AGOA 4OJGA 3PO5A 4F2SA 1JX4A 1TTHB 3NS7B 2W9AA 4USJC 3AJ1A 4ECZA 3G82A 3HVWA 4X65F 1SH2A 2JRSA 1FNXH 3RW6A 1C0UB 1L5UA 3BKFA 4ZJLA 2DRAA 1F3VA 3MOJB 1I5OB 2VQEJ 3BN4A 2DNKA 2QSFA 1YRXA 3LAMA 1U8SA 2QMUB 1HPZB 4HEA9 5HLFB 3CJKA 3MEKA 1GX6A 3O8WA 2U2FA 4PR6A 1RTDA 1IM6A 3HM9A 1SV5B 5CD4A 3W8PA 3EZ5A 3TRGA 1OY9A 3BQ1A 1N52B 4CM2A 2E7XA 4KPYA 1PJ6A 4ANEA 1I94F 5ETSA 2F3JA 2A6OA 4B08A 3JAMU 1N5SA 1KD1T 2DNHA 1LOUA 1MMDA 2DGXA 5F0UA 4G65A 3TANA 1TMMA 2LXUA 4NYOA 4B9LA 1FK9A 5HQ8A 4F04B 2MKSA 3W9IA 3VAGA 5KG5A 3FK4A 1Y7PA 3T41A 3NS6A 3BKUA 5CYMA 4OIXA 2XYPB 2UVUA 3DOMB 5DZ7A 5KFFA 1VRTB 2HFVA 2HWIA 1LQ9A 1FDBA 4NRUA 2K1RA 1NK4A 4M1KA 2Y0BB 3CCES 3UN2A 1IKWA 3CCQS 4DR2F 3PYGA 7FDRA 2G9OA 1IWGA 1Q7YT 2EVZA 1AFJA 2DEJA 3OL6A 1SIWB 3CD7A 1IKVA 1WI6A 1VBYA 4RW6B 1S7IA 1CLFA 4YHHJ 1S99A 1V5IB 4I6YA 1U48A 3ENVA 1U09A 5ITHA 2LEBA 1VIOA 2QGFB 3DN9A 2CQHA 5F9NA 1F5BA 3NBPB 3JQJA 2CNNB 4HACA 1S6PA 4CYUB 1PBUA 1A0OB 1EQ0A 5M2PA 2YPZA 2C3OA 4DFMA 2K7KA 3DHXA 2ZH2A 4TLRA 3JQKA 2MQOA 2VFRA 2A2CA 2IYGA 4DR3F 2H3EB 2C1EB 4H4MA 1P27B 3K17A 3FRYA 2DR8A 4LF8J 1R8CA 4NXMF 4W92B 1YWXA 2FHMA 2KHCA 5GAEI 3G6ES 2OSQA 2PEHA 1UP1A 3DRSA 3R97A 2OPQB 2XMJA 3KUGA 2HPUA 4YB6A 2C2MB 2LEAA 1RAEB 3UNYA 4U8YA 4DPYA 3H5UA 2YNFA 3W63A 2UVWA 3TVYA 4YQWA 4OYAA 3BYPA 2AJQA 3MGJA 2GW8A 2RDJA 3TUIC 1DLOA 1S1TB 4N76A 2J0QD 3FJ2A 1FT8A 2POKA 3F44A 2OELA 3DGPA 1HMVB 1NK5A 1S7HA 1RWVB 4FP9A 3TW0A 2QL9B 2HZAA 1X5OA 5KG6A 4FBUA 4JI1J 4IOBA 2QLFB 3S01A 4RW4B 1R0AA 2BJDA 3PW4A 2H51B 4IDKA 4AQYJ 5LXYA 1HNVA 3G4SS 1CJVB 1HI1A 4TKTA 2R2SA 1BQMB 2ZUAA 3GTYX 2ZC3A 2CPIA 4F0HA 1RXOB 3PEHA 4U7CA 3P96A 3MDFA 2D3O1 1LWXA 2QIFA 4DDFA 4ES2A 2KB2A 2G0JA 2P2CB 4IG0A 3G8SA 3GFZA 2YX7A 4HL9A 3IN5A 4JV1A 3IGNA 1HBOA 1NLKL 3W2WB 4LMZA 3IS9A 3PRBA 1RTHB 3A4TA 3D3BJ 1AFIA 2RF2B 1F9EB 1X4DA 4FYXB 1S6QA 4K8RA 3PRDA 3NWRA 2CFXA 5L1KA 4C11B 2JC1A 4DV5J 2E5JA 3QIPB 4KO0A 3GCWP 1OYEA 1C0TB 1JLEA 4TQRA 3QIDA 5HL7Q 4PQUB 4KFBB 1HWUA 3MAAA 4O4RA 3QYYA 4ILLA 2C3PA 1MW7A 1ZM9A 4OMFG 1H7XA 5DDOC 2FHJA 3T1AA 3ONQA 5K8MA 3M2RB 3JS9A 4DV2J 3D6FB 3VGVA 3O2IA 4DV1F 3BSNA 1M5SA 2R7RA 1T3NA 4XO0A 2IMOA 3SBMA 3PYDA 3MMJA 1CBKA 1JXEA 3MUTP 2HFNA 2NUHA 1TU0B 2PMHA 1XJWB 1NB2A 4WFNQ 4DUYJ 1S1WA 5CABA 4X4PA 2VJUA 3K8WA 1PO6A 2GC8A 1IVZA 3F41A 3IA0A 2XLJA 3GLJA 1LWEA 3GE9A 3I82A 1U49A 3BSCA 2V8GA 3KLFA 1S0OA 1SC6A 1VISA 1S9GA 3HKWA 2ZDPA 5BR8F 4RKUC 2JH3A 1RCOB 2HWHA 2HQGA 4UOGA 2W2PP 3BM7A 4PKDB 1RAAB 4JV5J 4DJBA 1OQ6A 2I5JA 2EFVA 1QM9A 2B4VA 2HNYA 4I64A 3ZTPA 3DLKB 3V6DB 4JI2F 4PYAA 4RBUA 2EPIA 4JI4F 3EGZA 4ZITA 4P2FA 1UFWA 2HVZA 1PYSB 5K8PA 4ZVQB 2KYXA 2CQ3A 3R6GB 5ADZA 3V81A 1U24A 4I68A 2MJNA 1SJ3P 5F8LA 2JX2A 1TKXA 3C15B 3TX0A 1YBUA 5J2NB 3C6TB 3D1QA 3O44A 4BC7A 3MM7B 4PXDA 1YGYA 4M5GA 3OFFA 2M8HA 2R7XA 1X9SA 4Q8FA 4XPCA 4FYWB 1OSCA 1T3OA 4LF6F 4Q2LA 2GA7A 2UUBF 4ZP7A 4FF4A 3CSKA 3NNCA 1GEHA 2V4JA 4NLUA 1TKDA 5KT2A 4ECVA 3T6JA 2E29A 2YNHB 1TAUA 4UY85 2VDIA 4CO1A 3PCOB 3HVTA 3PRVA 4IRDA 1NUEA 5AE2A 3MM8A 4ICLA 3TZXA 5CZVA 1ZM3A 3CC4S 2NUUG 2JLEA 3FUYA 4X66F 5HQLA 1IBLJ 5IM0B 1UAWA 2M5YA 2J7KA 1LKZA 1UETA 1F0XA 1B3TA 2F63A 5LMUJ 2LA4A 4Z7CA 4NZ0A 1RWOB 6FDRA 1RT5B 2UUCF 2YQ3A 1F60B 2AF6A 1S97A 2LU1A 4J9SA 2BJ8A 2R3VA 1RTJB 3B4DA 4NE9C 2XTJP 5FIIA 5HAOA 2HAIA 3DI6A 1YJVA 3PW5A 3KDNA 4OHVA 3CT9A 5J2PA 4LFCJ 1WG4A 1EJ7L 4C0HA 4PCQA 1ZTTA 4I2QB 4HH0A 4LQ9A 4RWXA 1F9HA 3VAKA 2V0NA 3OD2A 3TA1A 3THTA 2GS8A 4OLOA 3KNGA 2FY8A 3NWGA 3I56S 1T8EA 2FJWA 3IM8A 4O44B 2Z4PA 3WIUA 4LBHA 5C2GA 2EEYA 3H42A 4UQTA 3HP6A 5HBMB 3VVTA 4CH7A 3LP1B 5KG2A 1D3WA 1ZBTA 4QYRA 4DPUA 3P45B 3ITHB 1TVRB 4DSLA 4NCGB 3WZ0A 3C3LA 2WRMA 3M1VA 4M5NA 1LFPA 3QGPA 5CHCB 2M88A 1FKPB 1PC4A 5DG9A 4C2MA 4WU2A 4DSEA 3T19A 1EIYB 2WB4A 4DV7J 1WOPA 2MQNA 3VVUA 3QMQA 1A7GE 4IR1A 1VS3A 1WI8A 3O1LA 3DLEB 4F4KA 3FNNA 2OPRB 5A0YB 2FLPA 4ZS6A 4DLEA 2LCWA 2IM3A 4I7FA 1ZAWA 5LL6d 1TZ0A 5EX3A 1J5OB 3GONA 1HQUA 4KHPF 5ETKA 1NK9A 4L76A 5D3GA 3DDKA 2W9BB 4KBIA 3DXBA 5A8WA 1T9YA 2AEJA 3OXLA 3KJNB 3HJVA 4DG1A 3LALA 3CEDA 2PD1A 3N9UC 3PW0A 2QJ3A 3MMAB 1D9DA 4U7UK 2ADCA 4WF9Q 5H1SV 1RTIA 1NO8A 1WC0A 2JVRA 3E01B 2AX1A 2DNZA 3D4JA 3MCNA 2VH7A 2KYZA 9RUBA 5A6PA 5CZXA 4ES1A 3GR1A 4CLZA 3CIMA 3G86A 1L3VA 2E5HA 1N8RT 2KKHA 2Q1LA 1UVMA 4H4KC 4DR5F 3TP2A 1FJGF 2W4CA 3LP0A 3SEOA 3FVYA 5FLXU 2DIUA 3MEEA 1U6FA 3PW7A 1S9EA 1NDPA 3TVZA 3C14B 4DFKA 1S6OA 3GIMA 4CNZA 2C2NA 4KV8A 3GIJA 1YJRA 2WAQD 2GVZB 3TVKA 2DR5A 2PN6A 3CD5A 4IFVA 3RRGA 2YNIA 2FVSA 2H5IB 3E51A 5B0EA 3K5LA 4J9KA 4OZ2A 2ZD1A 1VJWA 3EJMA 3QFWA 1AXQA 5C42A 4P73A 2DHAA 3R2CJ 1JJCB 3DRPA 2DH9A 2K2PA 2EG1A 4K4XA 3BQ2A 2HQ3A 4WP8A 1XNRJ 4DMZA 4J9OA 5MAOA 4UQGA 4JI8F 2CVIA 2H4WB 2V34A 1NDCA 2MLYA 2CQCA 5J2QA 1KQSR 1PKUA 1HQEA 1S6UA 4J91A 2ZOFA 1OY8A 3FZBA 4OYBA 4ZP8A 2HFOA 3M2UA 3DC2A 2ZH4A 2RIJA 1K9MT 4ZPCA 2ZBCA 2ZZMA 4OJHA 4F67A 1HARA 1FTCA 1N48A 3CTRA 1RWNB 2HRUA 2XNRA 4ED2A 4LVNP 3M7VA 1RLDA 4K50A 3QLHB 2XZTB 3Q8PB 1HBUA 1DBDA 1NXIA 2AMCB 2E9RX 5FJ4A 1KQKA 3J80Y 4X4RA 2DH8A 5LSLA 1NDLA 3C16B 4A8FA 2CPDA 1B4SA 3DM2B 2FVRA 3AA9A 4LSLB 1KS2A 2ZBQA 1FD2A 4DX5A 1NSKL 4JI7J 2UXDJ 2B4PA 1U45A 3G71S 3D5MA 4QWDA 4DR6F 5T41A 3UR3C 2P9CA 3M8WA 2AYEA 4QJVA 1TL7B 2D1CA 2ZZNA 2OPSB 3AB2B 1NMEB 2KHDA 1HW8A 1X4CA 2OFGX 4FS1A 5D15A 3DOKA 3CC2S 1YTYA 2QO3A 3HVRA 1AZSB 1U7LA 2DGOA 4RL1A 4DL6A 4XK8C 4OYPA 1FD8A 2PI4A 2XS2A 2R7VA 5KFXA 2YKQA 2KJVA 5KFTA 3W5YA 3HHNB 2HHWA 2VG6B 3BSAA 1EZZB 1GXLA 1UZHA 1JMTA 4NASA 3BO4A 4B3SJ 5KT3A 1IUJA 4B3OA 3BDEA 1RBOB 1XBWA 3T1HJ 1KDNA 4DUTA 1Y0HA 2RHQB 1R6YA 4Q5VA 3JQMA 4NEZA 3EM1A 3JTOA 4LF4J 3MMBA 4ZHRB 1A9NB 2KO1A 1VCTA 4DPXA 3JSMA 2D7SA 1Q4RA 2CAJA 5T14A 2RT3A 2F4VF 2FYXA 4KKOA 3JYTB 4CO3A 1HBNB 1TK0A 5F9LA 1F5CA 2H65B 3IM9A 2IY5B 1YK9A 4EMDA 4CLLA 1VHIA 3DNCA 4JI6F 2NSBA 2HMIA 1SI9A 3R7BB 4Y6IA 4ZLPA 1Z2ZA 1TL5A 2B9WA 3HT3A 2ZH5A 2DY1A 1LXJA 4B3TJ 2WONA 1S1XB 3D68A 4GKJJ 2DNGA 3BEGB 2BW7A 4GVBA 4BC9A 4K4SA 4DL0C 4RUCA 2UUTA 5HVHA 2Y1RI 2OGUA 4L73A 4IRCA 2QL7B 1FDDA 4YEAA 4QR0A 2B5JB 2G1DA 4X62F 4DSFA 3BDPA 2H1YA 1N36J 3ILOA 5K14B 1GFWB 3HDSA 4MJKA 3MECA 4DUZJ 4JOUA 3BGOP 5B0AA 4R8UB 2AEMA 2DNQA 2W7PA 1YJ7A 4UUWA 3LGMA 2Y0SD 4YS2A 1HQ2A 1FRMA 1QUVA 2KXFA 3V5RA 1CJKA 1U1RA 1SJQA 2BANA 4HTJA 1Q8LA 5CYJA 4HTIA 1MSWD 3Q24A 2KZMA 1UJ6A 1K8AT 4B9NA 4WTYA 3CB4A 2EI5A 4PPDA 5D4PA 3GYNA 1YRUA 4DQSA 2HHVA 3ENAA 3OTBA 1TL1A 3U1MA 2N4CA 2DRBA 1CPZA 3IP0A 3DRRB 4QOTA 1T02A 1U1LA 2LP4A 5AXMA 5D78A 3W5ZA 1C0UA 3SQGB 4HLBA 2W7OA 3K5MA 1HKAA 2LQJA 3OHAA 2XC9A 4C3KA 1WNEA 1TR0A 1ZZFA 3IXQA 1BWVA 3DYAA 4DV3F 4IUFA 1IXKA 1ZYQA 2MDAA 4FPIA 2VPYB 3VZHA 3G82B 3NAHA 5B0CA 5IT9U 4AXIA 2B6AA 3NNAA 5HLFA 1H6KX 1QAYA 2QYGA 5F8HA 4JI3J 3D6TB 1RAFB 4DV0J 2OAUA 2RUGA 1UL3A 2CDQA 2CIMA 2Q66A 2H54B 1WG5A 2QV6A 2EK1A 2V8DA 4K59A 1MU2A 5DZ6A 4JI0F 3CJKB 2M2BA 1FHTA 2XMTA 5KFDA 4LR7A 3CCUS 3TAPA 3MTJA 1UVLA 2BA9A 1RTDB 2ZM6F 2R2RA 3SMZA 2K3IA 2BRKA 4KAIA 2YNGA 4RPFA 3R3TA 1FA0A 3KMQA 2A2DA 4B3MF 4KJIA 1Y5IB 4O3OA 3I0SA 5GADU 3ZZZA 2R9LA 2N82B 2ZWPA 4KY3A 1PIEA 4CLSA 3D0IE 1HI8A 1FK9B 2Z2MA 4EI2A 4H4OA 1FESA 2XY6A 2RQCA 3G6XA 2AX0A 3RYLA 4DXLA 4KR0B 2FZGB 5CYMB 1Q78A 1DTTB 5A8KB 2CPFA 1G4CA 4RW6A 2GZOA 4KGKA 5EWEA 2CJQA 2D9PA 4J90A 5LXRA 4Z7YA 1YJUA 4DU8A 2K1RB 1DQAA 1FKAF 2GQCA 3D3CJ 3GR0A 4CI0B 4M5DA 4IH5A 1VQOS 2CUYA 1IKWB 4J37A 1HBMA 4LRDA 1DQ8A 4ANCA 3A1YG 1IKVB 2HBRB 4OZJA 3X3UA 2HFZA 2ZBRA 2YH1A 2C42A 5IS2A 4K7QA 2A0FB 3QNWB 3FFIB 5J2MB 3K2YA 4HACB 1S6PB 2ZZTA 1RAGB 4BHQA 2JDJA 1IKXA 2RDIA 4NLSA 2VQEF 1WTFA 5K5MA 2CQ0A 4U67Q 3VQSA 3OTDA 4IH7A 4RO0A 2ZWOA 4WXOA 3LP2A 2HNDA 2W9CA 4QBUA 3I0RA 4ELVA 1KHWA 2HHXA 4H4MB 1T0TV 4U9RA 4EEYA 1RE1B 1OJ4A 5U47A 2XGQA 1J5EF 1T11A 4GKKJ 4WK3A 3DRSB 2MMYA 4C0OC 1S48A 2Z58B 2Y8WA 2IVYA 3CJ8A 3TAMA 3VR1A 2DBBA 2E9TA 2YNFB 3ILIA 2Z30B 4LF7J 1RA6A 2L9DA 1VJQA 2D74B 1YZ7A 3KHLA 4K4UA 4K2XA 2MKIA 1DLOB 2WSEC 1JJHA 2O5DA 3CIZA 2R8GA 3MPUB 3DGPB 1KKHA 2HQCA 2PE8A 2R42A 2ROPA 2CYYA 3OTEA 3KK3B 2NCKL 4ZPTR 5GMEA 3C46A 3AB4B 3KJFB 2DB1A 1VR6A 5LMNJ 2YWEA 3VGTA 3ISND 4L6V3 4YR3A 4C8OA 1FRXA 4HKQA 4KHMA 1VQ8S 2YY3A 4RU2A 4A8SA 2JOQA 4NLRA 1XC9A 2HGMA 2V9KA 4IG0B 4U6PA 3MR6A 3BBBA 4A4JA 4YHHF 4DZ6A 2Y8YA 4NLGA 1OS5A 4RR5A 1SQFA 1MMNA 1HBOB 2Y1JA 3IS9B 1C0TA 4WXWA 4LJMA 1UFKA 1HYSA 2R2TA 5BXIA 3Q2TC 2BOAA 2Q6BA 1XNQF 2RQKA 1IR0A 4A47A 5GADI 1S6QB 4QIEA 1RAJA 2RD5C 3CJTA 4K4TA 2BYCA 1JLCA 3U02A 2OD4A 2MZTA 2LU2A 4KO0B 3SSSA 4OLPA 2GGPA 3QFHA 1WG1A 4LFBJ 4Q43A 3MAAB 4ER8A 1RHRB 3RBXA 5HROA 2LA6A 2WSFC 3NKYA 3UQSA 4TU7A 2VPWB 3CMAS 4AE5A 4MKBA 2KL8A 1BXNA 2B4OA 1QD1A 3NP5A 4Z37A 1FEEA 2V5HG 1XTZA 3TEHB 2XMVA 3SQOP 2WVBA 1LV5A 3HF5A 1CVJA 2E1MC 3POTB 2LQ8A 1CC7A 1P9YA 3JSYA 3JXOA 4IYQA 3UD5A 3FGVA 2M4MA 1EETA 3NY0A 1WELA 4F36A 2SXLA 1AUDA 4ZPVR 4PABA 1RWMB 2V69A 4JI5J 1H0HB 4OI1A 5IV3A 4DR1J 3CO9A 4QWCA 3ISZA 1HD0A 2RMLA 2DJWA 4N5SA 1XMOF 4DV6J 4QW9A 4JI1F 1U1OA 1S9GB 1RTZA 3QWPA 1NK8A 3RUBL 1W26A 5C25A 1WF0A 1TFYA 3AH6A 4LBIA 1PAUB 2KTQA 4GO7X 4QYZJ 2I5JB 5A2QY 2QA1A 5K8NA 2HNYB 2D41A 3EDQB 3C6TA 3TJAA 2GFFA 3M6UA 3PZPA 1YIJS 3MM7A 5CYQB 2JZ5A 1CS4B 4WWSA 1VBXA 2GO8A 3M8RA 1YHQS 1X60A 2HNZA 3V81B 2FGOA 5CA5A 2F8MA 5HMWA 2AWZA 4I2PB 5ETQA 5KFHA 5KFNA 4ZPBA 2W4PA 1X0FA 2YNHA 3N79A 2DGQA 2YTCA 4PXEA 4M5KA 3OUYA 4USUA 1HHSA 3PXGa 2LQBA 4DQRA 4DV5F 2EC2A 3OJSA 2JEIA 4ZVUB 2DITA 4TY8A 5DJBA 2QLXA 4PWWA 2P8IA 2RQ4A 3K7RA 4NA2A 5IM0A 1G1XA 4FKYA 3H25A 2UVVA 4OI3A 1L3UA 2V4JB 2DIVA 3RB6A 3SCIE 4ZCMA 1LW0A 1SJ1A 5B7WA 2FHKA 2F9DA 2WTFA 4ED3A 2R7SA 3HVTB 3MM8B 4ICLB 2CPYA 1RT5A 1B0VA 2FJVA 2I0XA 2BJ7A 2ZVSA 5JUMA 1RTJA 2XO6A 4UT4A 1OPIA 3Q8YA 2HIQA 4EYIB 1VHFA 5DRKA 4ZPDA 5DLFA 2EFOA 3R7NB 4KE5A 3THPA 5L9NA 4YY3F 1LK7A 1CULA 2R4FA 4DUYF 1S12A 4FDFA 1WOOA 2WVCA 2ZDOA 2KU7A 4NLQA 2V63A 4BWMA 4ZLLA 4HI1A 3E8OA 3P49B 3Q89A 1UVNA 5IZHA 4ZN1A 2CKWA 2RRBA 5AXKA 2R8KA 5J1PA 3DI6B 4LR9A 2HS4A 4JV5F 3MEDA 2KG0A 4IOAQ 1O51A 4X4TA 4H4KA 2HHTA 1HWJA 1U1MA 5BYRA 3LH2S 1R0CB 3PVXA 1VBZA 1JLBA 1XWLA 1MG7A 1RWPB 1N34F 3KK1A 1W2BR 1CSJA 5KG4A 4Y28C 3PJWA 2J9EA 4CH0S 4IRKA 4HYKA 4CWBA 2QZ8A 4Y2CA 1X31C 8AT1B 2RUSA 2HGNA 2J9CA 2KDOA 1H73A 2W25A 5B08A 2DXEA 1EKRA 2K8GA 2N3OA 5F3TA 1G6BA 2ROEA 2WOMA 4ANDA 3T5KA 4DLGA 2QMXA 2FJDB 4AT1B 1RISA 3NCPA 1CJTA 1KEKA 3KG1A 1WHYA 1RWKB 1AA1B 2GIFA 5A0YA 4IO1A 3H8YA 3M1VB 3M30B 4J9LA 2X3GA 1S72S 3GMGA 4DQIA 2WW8A 4QWEA 1CC8A 4OYZA 2MQLA 4EWTA 2JWNA 4YR0A 5EWFA 3VAJA 3DRXA 4FPRA 1V3RA 1QSYA 3G9CA 3T9NA 2JFDA 3GU0A 5A6WA 3H2UB 4K2JA 3E2EA 2HKEA 2KM8B 2KT3A 3Q2SC 2Z2ZA 1UVIA 3UD4P 4I7FB 4X4QA 3UO0A 3HFZB 1X7VA 2BZ2A 5K9FA 1RADB 1HQUB 4O3RA 1SC4B 3GJSB 1GTHA 1KC8T 1FO1A 4LREA 1RYSA 5H9FK 2KH9A 2UXBF 5A8WB 4DG1B 4EGLA 3T1YJ 1O6XA 2AU0A 5F0WA 2UXCF 2BRLA 1FTRA 4OYWA 4C8YA 1B70B 1X5SA 3J81j 1RTIB 4ZCLA 1L3KA 1HNXJ 1RAIB 4PG6A 4DL4A 1H3DA 4EO8A 3HULA 3ELHA 4LFCF 1RAHB 1NSAA 2IRYA 1RP5A 1ZPWX 1LFWA 3LP0B 4C6AA 2CRLA 1NU4A 2NPIA 1BWEA 3MEEB 3JSRA 3W61A 1S9EB 2GIRA 2JLGA 1VQLS 3KNAA 3L7PA 3LTOA 3WX4A 3LGNA 3R27A 4DX7A 4KV8B 3MR7A 4TNOA 2PA8D 3P5BP 4IFVB 1JQGA 2YNIB 4L75A 4F8RA 2GMHA 2KRBA 4RX6A 2ZD1B 4EZ9A 3M6WA 1SJ4P 1ZM4A 1SQGA 2FQQB 4DL2A 2KN4A 1S77D 2R2UA 5D0EA 2M0GB 1U8WA 3DRPB 2CDRB 2ABYA 4WCEQ 3KJVA 3U7JA 1UKUA 3P8BB 3DLBA 4DV7F 3H2LA 3W66A 2DISA 5J2QB 3H59A 4LBPA 3S1TA 3PW2A 1QTMA 2BOPA 3CPWR 2FVQA 3H5SA 4XDCA 4EBCA 4S0MA 2CQBA 1SJFA 4ELUA 3T5JA 3PJXA 1HWKA 3T3FA 4USIA 1NHUA 2QMWA 1KOHA 2BE7D 2EFNA 3DM2A 3W60A 1X4BA 1XEZA 2AJ2A 2BV3A 3IBWA 5I42A 3KLIA 3SSQA 3TYTA 2GJFA 2GNKA 3QT5A 1URRA 3I96A 4YUDA 1HBUB 3HSGA 2J0SD 3V6HA 4XPEA 4PXBA 2CZ9A 2ACYA 3BF4A 2E7VA 3CJ2A 4X64F 2NLWA 1YBAA 2V68A 4CO5A 4F7VA 5KFRA 4YB7A 4WP3A 2JHEA 1JLAA 2HZVA 5CQGA 5IT0A 4RU9A 3VGSA 1AZSA 1S76D 3O3LA 2NXUA 2VKRA 3CCTA 3I5CA 3JAMY 2MGZA 4BCAA 3ZTQA 1R27B 2QT7A 3N28A 2VDHA 2V67A 2VFVA 2PMWA 3M9OB 4NX9A 4WIIA 2CPJA 4QW8A 2DNNA 1QTNB 4BBYA 3HZGA 3MCMA 4CP5A 2F7VA 2J7UA 1D1UA 4CTAA 3BV8A 1U6BA 2BX6A 4UZBA 2RH3A 3L09A 3CCMS 4Q8EA 3LW5C 4X2BA 2IYIA 2VB6A 3H40A 2LMIA 2QLBB 5HQMA 1Q53A 5EGYA 2EC0A 3C2PA 4NOHA 1S79A 4B3OB 2OI2A 1TK8A 3Q8UA 1RQ0A 2VPZB 3EZOA 1UZDA 4LRFA 3HFVA 4O3QA 1YJTA 2MLZA 5JXSA 2JVOA 4FZVA 3MMBB 4HH1A 4NLWA 2FUG9 4PUOB 3W9HA 3JSMB 3QT7A 3GSIA 3KYLA 1S1XA 1K47A 3UW1A 5THWA 4A8MP 1SPBP 3S6EA 2JEJA 3K57A 3I32A 1NBEB 3KUEA 1S1VA 1M1HA 2ZBPA 1IQZA 4YDXA 1Z2LA 1MN7A 3LUYA 2JEGA 4MIWA 3SV3A 3RW7A 4R5PB 4PZVA 3TNVA 2AKWB 2WONB 4GVLA 4Q7AA 1Q8KA 3N5BA 2KT5A 5KFIA 1J2VA 4OX7A 1K73T 4KGZB 4EBEA 3MCSA 5F8MA 4TLQA 4GVBB 1Q1KA 2OMOA 4DR7F 4P2SA 4BDPA 2FPHX 3W7BA 2UV8A 4DV4J 4ZIVA 3FDSA 3FBEA 4JI7F 3UDEA 2HFSA 4ZPWR 2B9EA 4WZQA 2DKOB 4ZVGA 2NPFA 1M5VC 1TFWA 3B8HA 1WWHA 1IBCB 2HVHA 1KONA 3QATA 1LWCA 4ECTA 4OJ1A 1WSVA 2W2QP 3J7YU 5GAGU 5JVGQ 3MECB 1Y00A 1S0MA 2HSEB 1DHMA 2QC3A 3TQ1A 2BJEA 2ZHAA 4WFBQ 1HNWF 1R89A 2G4BA 3RR7A 2IPOB 1NEEA 3NGUA 4EYHB 1QY7A 1FNOA 4ZDNA 4TXSA 1ZA1B 1KVIA 4A8QA 3IGVA 3GIKA 1CJKB 4DV1J 3E3XA 3KDOA 1VC0A 1QAXA 1CJUA 2E5GA 4Y2IA 4TQSA 3T1HF 2XHCA 3DDNA 4OHWA 1RBAA 3CF5Q 4RW8B 1T7PA 4CLWA 4LF4F 1YSJA 2B43A 5KFYA 2ADBA 5T7LB 1TL1B 3OHBA 3OSPA 3IAS9 3BBCA 3KFWX 3M32A 2EFGA 4I1TA 1I1GA 2CVEA 1H7WA 2DGSA 2IDEA 1NCLA 3CJRA 5BR8J 1WHXA 2V6AA 2A3JA 3VZIA 2O67A 2WHOA 3TJ9A 4UOCA 3Q0AA 1LWFA 4ZCIA 4M8LA 1T9XA 5KFUA 3JTPA 3OR2B 3DYAB 4UF4A 2J7WA 3GCXP 3EYZA 4NMLA 1RAOA 4P74A 2IBOA 4N47A 4JI2J 4GKJF 4QCLA 4A8OA 3R8YA 1GAOA 1IR1A 1TUGB 1FFGB 2B6AB 3SZ2A 2M3DA 1QLNA 3M9MB 1GXUA 2M70A 1HD1A 1PC5A 1SH0A 2VBXA 2XLIA 2VFSA 4C8NA 1ZA2B 4MKAA 1X4EA 4I6WA 2ZUGA 3Q8VA 4ZJQA 2XS5A 1UJ4A 1SKUB 2XB2D 1NK6A 1KNZA 4OJ3A 2XYGB 1MU2B 5B0BA 2FD2A 4BS2A 3M8PA 2QYCA 4FBTA 1YI2S 4DUZF 3M8QA 3D54A 1X9WA 4QU7A 3W8GA 3G2XA 2YKAA 2UUBJ 2OPPA 3KHRA 2EXUA 3AY0A 3HHKA 2WSCC 1CG2A 4HT5A 2IJNA 2YNGB 4ZP9A 5KFWA 4CLKA 1DTTA 5A8KA 3MR2A 4HHUA 3WC0A 3I0SB 4X66J 1RT1A 4ECQA 3HCXA 2NXCA 2RKIA 2B7BB 2MY8A 3PX4A 1U1PA 3J7ZT 2G13A 1XR5A 2IA0A 4LFAF 4ED5A 2WB1D 2FJXA 1BGXT 1EP4B 4H4OB 4DSKA 5A8RA 4A8XA 4J9MA 2FJAB 3PR4A 2MZSA 2XG8A 5GMDA 2UUCJ 1F9FA 5IC6B 2FGCA 2HYIB 2WVFA 2Z8QA 1SUQA 5D4LA 1HW9A 7FD1A 4Q45A 3FFIA 5J2MA 1CQMA 4M5DB 3RZAA 4OZ1A 2CZVC 3NGSA 3GV7B 1EX8A 4KGXB 1HBMB 4M5HA 3J7YI 1RB0A 5HATA 5B0GA 2HS0A 4QR1A 2VONA 2ZH1A 5KG7A 3V6KA 1BC6A 2IVFB 4B9VA 3TUPA 4QIFA 5SUHA 3FBFA 2GVDB 4DCPB 4RWWA 3OT9A 2G0IA 4ZVHA 4JI3F 3MR3A 3IR5B 3W64A 4A48A 2BXJA 4JP8A 5KT7A 3JSBA 4WFXA 4CLPA 3H0PA 2RS8A 3S8SA 1IKXB 3L3CA 1S59A 2XYHB 4B9MA 1RBLA 5KAKA 2XY7A 1N33J 1GX5A 1D9AA 1VMBA 3OL8A 1U25A 2Q79A 3BSOA 3LP2B 2HNDB 2BJ9A 2W9CB 3R5AA 4TY9A 3I0RB 3DMJA 4NEYA 5ETMA 4WP9A 1VGYA 3KXDA 2CWXA 4FKXA 3CWJA 3IRWP 1FFSB 1M5PC 3D0GE 1REGX 2FVPA 4RUHA 2E66A 3TI0A 3NGTA 5C5JA 2JEFA 2HLUA 3VHQA 2ZFHA 4UZCA 3TAMB 5H9FJ 5JMNA 1SBRA 2RU3A 1X5PA 5CXTA 1VRUB 2EK6A 3KK3A 3GFHA 5HANA 5F8JA 3DLGA 4ENOA 1ICEB 2VICA 2OJ3A 3QJLA 1U02A 2HBQB 2CNOB 2DRDA 1SIZA 2IRXA 1QSSA 4DCOB 2CZ4A 2DGTA 5LJ3Y 3PEJA 4H54A 3GIRA 3IR6B 2IFXA 2HAFA 3PO4A 5E3PA 2B0GA 3N6LA 5L46A 1BUXA 1KFSA 4KH1B 2LQ5A 2DO0A 2BJ3A 4WE1A 4K4ZA 2OSRA 5DS7A 2FIUA 1WKLA 5ETPA 2F8HA 2KZZA 4RNHA 4HT7A 4CIOA 1I3OB 2VL1A 4DR5J 4LRAA 3BH6B 1KWMA 2K3KA 3KLVA 4MKYA 4K4WA 3MM5A 3V4IB 3FC9A 3U1NA 1HYSB 3OVAA 3Q8SB 3PKYA 1S4FA 1SH3A 3J81U 8RUCA 1UVJA 3D1HA 2Z2LA 1Q95G 3CD0A 2DNOA 1R6VA 2DNRA 1RHUB 1NK7A 4WFZA 1JLCB 3RR8A 4YR2A 2YKNA 3IMQJ 3POTA 5SZTA 4D3HA 3I4PA 2GGPB 1WSRA 4E0DA 1P8GA 2VQFJ 4TU9A 4NI2A 2C28A 3PR5B 2XM3A 4TVAB 1IM4A 4GKKF 2C2OB 2GQQA 5HROB 1VC6A 1JJ2R 3KUHA 3KWMA 3W9JA 2B9XA 4DR4F 2X51A 4RLEA 2V8VA 3ICLA 3PNIA 1UTAA 2WW4A 2NQPA 4OV6A 4DWIA 2N7YA 2XMKA 2A18A 3QPIA 2QFJA 3HK2A 2EFQA 4P52A 2HWTA 3A3NB 1EETB 5HP1B 1RWUA 1HR0J 1MNEA 5HK4A 4Y2MA 1IWAA 5FLXY 3DLLQ 1Q82T 3UI3A 2YVSA 5DLGA 3AODA 2FLLA 2EKNA 1GT8A 3OPKA 4ED1A 5CYQA 1UA1A 2ZOMA 1CS4A 3MWBA 5E41A 3TAQA 1JLGA 3UVJA 5C25B 2GJ2A 2GV1A 5LMNF 1LW2A 2XMMA 2ZH9A 5DQIA 3HX9A 4I2PA 3EZUA 3P3DA 5E7OB 1OMSA 2OEMA 2OTJS 3CCZA 4CQ1A 3OXGA 1PYTA 1KOOA 1RJJA 3DCAA 2AT1B 3CVKA 3OR1A 2UVRA 4NLXA 2FC8A 3R6LB 3W1YC 3C8YA 3D6MB 1UEUA 3MTKA 3MD1A 4YB1P 4OHZA 2HNZB 3KOAA 5E2QA 1TELA 5J1NA 2KG1A 2N7CA 4U8VA 2W4DA 4M5IA 4PG5A 3TZWA 3UCUP 1S57A 3PM9A 2LFVA 1VIXA 4DCJB 3OUYB 1QAJA 1URNA 3B4MA 4A46A 2G0CA 2BE9B 4ED6A 3L9ZA 4TY8B 3SI8A 3GFXA 4KRWA 3CUNA 2W2MP 3PIPQ 1YKWA 1RKIA 3KLHA 1H2VZ 3DLHA 2ZJQQ 3AQPA 3B54A 1LW0B 3Q86A 1JLQA 1RU2A 3A3PB 2B51A 3I5AA 4KB7A 1RHJB 3RB3A 2KVQE 4YMEA 4NMXA 2HURA 1Y3JA 2F4VJ 3H7HB 3WIVA 1FRIA 1UMJA 3OFEA 2DNPA 3NNHA 1JK9B 3OTOF 1CULB 1ELOA 1LK5A 2JLFA 4LF5J 1YRTA 4JI5F 4FYVB 1HLWA 3PY8A 4DR1F 3M9NB 5B0FA 4UTGA 4N8NA 4FF2A 1DAXA 3SDEA 2L9NA 5LJ5Y 2BVZA 2J6SA 3MFHA 4IO9Q 1AW0A 2VOOA 1RCXB 1W25A 2QFIA 2L3MA 2W2NP 3I9ZA 2G1HA 5D6GA 2MQMA 5AT1B 4HDGA 1SCJB 5EUHA 3KLGA 4V1Ak 3MEDB 5HJYA 3MURP 2YX1A 2DHHA 4CO4A 3UE2A 3QJJA 4WU3A 3KK2A 4W98A 1FEHA 2DPJA 2M8DB 1U0SA 1RT4A 4L3NA 4X62J 1JLBB 2W8KA 3UD3P 3V4MA 3KK1B 5GVQA 4P7TA 2XCPA 3QJPA 4ZVFA 1GK8A 1NKBA 3M30A 2C3MA 1N6QB 1M5OC 3QWUA 4QR2A 3MM6A 3M2VA 4ZLJA 2WOMB 4ZK7M 3W2VA 1L3TA 4C3LA 1KR4A 1CJTB 2WCXA 1ZETA 4AUKA 2MKHA 3HHLC 2YWWA 2MSSA 3HHDA 1RWXB 3MPWA 1R7IA 3MMCA 4DX6A 5ETOA 3CCRS 1AROP 2JNJA 2GHPA 1RSCA 2Q6CA 3A8KA 4K0KF 3HSDA 1VQSA 2ZE2A 1DRZA 1X0PA 1UWAA 3EGWB 3IBCB 2RDDA 4GC6A 3KLEA 5M2UA 4QIGA 3QBCA 4NL5A 1VQKS 2UUAJ 1BY9A 3MOZA 1FXRA 4OYOA 1R0BG 2VODA 3RAQA 1JLFB 3VQTA 3OV7A 1DJ0A 1KTVA 2JSXA 2Y9HA 3R9LA 1GMWA 1Z1ZA 3GG1A 3H5XA 1OY6A 4DZDA 3CCSS 3OFGA 5CD4H 3C66A 2P6TA 5FD1A 1RT6A 3CCLS 1TP7A 1W7WA 3K89A 3LWLA 2C3YA 1OWXA 3IC1A 2GAHC 4N8OA 3ILJA 3RBEA 4W90B 3NL0A 3FEZA 4M5LA 5ETVA 1EB0A 1UJ5A 1FERA 2APOA 3HHEA 3OBIA 2XSJA 2J5AA 3ET6A 1WHWA 2CQIA 3BB5A 2XZDB 4IQMA 1UWBB 5F8IA 4JI0J 2I6WA 4I4BA 1N5VA 4KGMA 3MXHP 4QPXA 2KFNA 1FE0A 1HNZJ 4F4YA 1XR6A 3O6QA 1EARA 2CNLB 2ZM6J 4F3MA 2O3DA 2KRRA 3LPYA 4ZA1A 4F4WA 3NRBA 3K5OA 4B3MJ 5HJXA 2GMLA 5I3PA 2XCAA 2OP5A 5E3CA 3QSIA 3KJVB 3BPSP 3HSJA 5IT9Y 1C1BA 3G96A 2XI2A 5IQ6A 3LQVA 1JKHA 3FEXB 4Q0BA 4F3QA 5DGBA 1XMBA 4O4GB 5GAEU 1YJNS 1UPPA 4LF9J 4DL3A 1WD6A 3AFGA 3GQCA 5I3QA 2V4QA 2K06A 3ULHA 4C0BA 4OZ5A 3DOLA 2FTRA 4K5SA 3FRZA 2J6UA 3EPIA 2V50A 4NYZA 5I42B 3KLIB 2NSCA 1WTBA 1X4FA 3T1YF 2I1RA 2MYFA 4J7CA 3GJTB 3V6JA 3B78A 5DDQC 2R7QA 4QYZK 1WF1A 4LT6A 4DEZA 2G2OA 1WC6A 4OFZA 3M8ZA 2HK3A 1HNXF 2OTLS 2VBZA 1JLAB 2GX8A 3NLCA 5HVGA 4DS4A 4A8WA 1TL4A 4WK1A 1TV6A 1V6HA 3IO1A 2MGZB 1J27A 2ZJRQ 5KT6A 2HHHF 3VAIA 4DPTA 3S7RA 4F0MA 2PC6A 2E1CA 2C22A 1Q7LB 4LRCA 4N77A 4CTAB 3MAHA 3IR7B 1F5AA 1ZS6A 2PMZD 1DURA 4KPCA 1J5EJ 4BLGA 1U6ZA 4PUOA 1T05A 1Q81T 3ZTRA 2AV5A 2C2EA 3NGDA 3NS5A 2UU9F 3W62A 2W1BA 3N4WA 5MLCV 5KFPA 2DD8S 4OI2A 5KFSA 3VAFA 3JTNA 2Q43A 1YITS 2XMWA 5DGAA 2J8AA 4DN0A 1X4AA 1S5ZA 3NCRA 1K1QA 3NOCA 2MKYA 4RW9A 2FC9A 2D3OR 4KQZA 3QGIA 2ZKTA 4R5PA 2MHNA 4WPAA 4CZCA 2R8IA 3D7SB 2O66A 4V19X 1ZTWA 1BE4A 3LPEA 1XK8A 4ZMMA 4RBVA 1F3FA 4X4NA 1S1VB 2DHSA 4C8KA 4JBCA 2IM0A 2VPXB 2DHXA 5KFLA 3IG1B 1VQNS 5ETTA 2DR6A 2HVDA 2CQ4A 1Y4ZB 1X8DA 2KJWA 2W01A 1SXLA 1RT2A 4FXDA 2MHEA 2ATLA 2ZC4A 3BGRA 4USKA 3DLJA 3WQPA 3CJSA 1E6YA 4OX9F 2B3TB 5G0RA 2U1AA 3KTQA 4EZ6A 4V19J 2F4FA 3CGIA 1RT7A 3D66A 4FF1A 3H20A 5DG7A 1XNQJ 2F1FA 1LWCB 5IXUA 5EDWA 3QQCD 4IQXA 1FX4A 2AW0A 2GMJA 1I51B 1XMQJ 3GWCA 1NM2A 2HS3A 4RW8A 2XBPA 2MZJA 1V3SA 3CNQP 5J1EB 3MUMP 5T7LA 2DTJA 4LSNA 1C1CA 2MZRA 3PDNA 3N6MA 2QX0A 2NYIA 1VQ9S 1CJUB 3MPYA 1U0HA 3N6NA 3RU0A 3I55S 2VC1A 3FSXA 4OYMA 4OI6A 2VG7A 4ILMA 2MZ1A 1EQMA 4CH1A 3Q23A 1HIYA 3OR2A 5E0OA 2ROGA 3CULA 3M32B 2Z57B 4P6QA 4OZLA 4Y34A 2B56A 1XMOJ 2L41A 1YG0A 4B02A 5IV4A 1LNQA 1FWLA 4P72A 2DT9A 3D1OA 4YFUA 3ENWA 4WTOB 2IRUA 2D3UA 1NDKA 4YP3A 3BGUA 1LWFB 4U95A 3M4XA 2D3ZA 2KT2A 1HI0P 4ES3A 1NJWA 3GYGA 2RRAA 2Q3PA 4OI4A 4Q44A 4IFYA 4OYXA 4KYZA 3CO0P 3UDVA 2DCLA 4PG7A 1LXNA 1ULRA 4OZ3A 4DV4F 7AT1B 6FD1A 4DFJA 3M05A 1D8YA 1IBKF 2WVEA 1HFEL 2FHJD 5KFGA 5EHHA 8ATCB 2FVCA 3AOCA 2CQPA 2A1BA 4I6AA 3BH7B 2CPHA 3IFEA 5KOXA 3M8PB 2BEFA 3M8QB 4KIAA 4TYBA 5DG8A 1T9UA 3BJYA 4USVA 2OPPB 3C6UA 4NA3A 3UCGA 1KLNA 3VV2B 3T6BA 3ZZPA 5KG3A 2MQPA 1EP4A 2F9JA 5AJ3F 1Q79A 1NPPA 1H98A 4LIWA 4P7VA 2E5LJ 2DY9A 4RNNA 2XWYA 5DO2A 2HQIA 2PI5A 1M5HA 4ZVSB 4JV2A 3PG9A 1VC5A 1RT1B 3EUNA 4CM0A 2RKIB 4KT0C 1N32J 1QVGR 1P6TA 4RNMA 5BYSA 1MWYA 3SV4A 4YY3J 1MROB 2HQFA 2Z0GA 2G2YA 3EVOA 3EICA 5A8RB 3TX8A 1TL3B 2CNKB 5KG1A 1ZPVA 2ILYA 4CLYA 4G1QB 1GMVA 1R8AA 4MFBA 1SKRA 1S10A 4OX8A 1YDLA 3O5TB 2GVDA 4R0EA 4ZVTB 4IR9A 1SUQB 2YWFA 3KG0A 3BR8A 3VCDA 1T9WA 1FNMA 5KFKA 2YBVA 4N41A 4EU0A 3TJ8A 2E9ZA 5K8OA 1QE1A 1KTQA 4NXNJ 4B9SA 4DOZA 1VK8A 2PEBA 1V3ZA 1N34J 3US5A 2QN6B 4OI0A 1C2PA 3BS9A 3PACA 4B9UA 2IM2A 4P71A 3DDIA 2COLA 1NJZA 4C97A 2J9DA 1CQNA 4CO2A 4USHA 5HSPA 1NKEA 2BMBA 2CJ9A 2RAQA 1IBMJ 4J9VA 2C2DA 3QSYB 4QWAA 3T9ZA 2CJBA 3KJQB 4CNYA 2J8SA 5D77A 1Q8IA 1OO0B 3MPDA 1VRUA 1U1KA 3DMJB 3FBCA 4ZVEA 3CD6S 4JUZA 3SSRA 1M1GA 4OV1A 2WZ1A 5AXNA 2Z2YB 3ZTOA 1SC3B 4M5MA 2PT0A 3RTVA 3GIIA 2BE2A 1UCNA 1QJHA 1HA1A 4O0IA 2QA2A 1VQ6S 4FVMA 3FQKA 3LANA 2VV5A 4MK7A 2BKOA 4E8UA 5D0RA 2ASYA 3QRQA 3MEGA 3JB9k 4NCAA 3HO1A 1GH8A 2E1PA 3DLGB 4UY8T 1PJ7A 5L38A 1Z4UA 2RQMA 3MCOA 4F2RA 3CE8A 1IKYA 1FRLA 1Y5LB 1XIQA 2VIHA 5L1IA 1QVFR 2VA3A 2UXBJ 5ETNA 3UCZP 3CDAA 2IJRA 2UXCJ 3THVA 3AA8A 1PILA 4ATNA 4M63A 3G8QA 1SQEA 4YB5A 4P9SA 1HWLA 1BHNA 5KFJA 1LEOA 3V4IA 3BR9A 2LVWA 4XAKA 1NJIT 3P6YC 4C7QA 2ZITA 4WE1B 3OXFA 2XO7A 3ENQA 4QPTA 3PYEA 2CPXA 2P6SA 2ZH6A 3DXSX 2BQUA 1F2HA 2BBEA 1JNRB 1FJEB 4DF8A 1YVFA 3HKZD 2IVMA 4NLOA 3F0NA 3QT8A 1YX2A 2H4YB 4R25A 3MM5B 4LF8F 2YX4A 1KBRA 1JIHA 5F41A 2RVJA 3FCWA 4ED8A 4P75A 4CRJA 4J9UE 4LF2A 2HVEA 3NXZA 4ED0A 1N33F 1RHMB 3FBBA 3CC7S 3TZYA 1VQPS 2YKNB 1FI4A 3QZ7A 1CEZA 4OHXA 5I3UB 3FEYB 3BO2A 3I31A 1WHVA 2X1BA 4NI2B 2BR0A 1M90T 2AJ1A 2N4DA 5HP1A 1H72C 2EBEA 4CCHA 3QGGA 2WVDA 4IH6A 3LA0A 4C8LA 2CQ1A 3TR5A 1AYEA 2XMAA 2YWHA 2J0WA 4ZVOB 3ADAC 3NGKA 2OUGA 1AT1B 1T9VA 1O8BA 1U47A 5E5NA 2RS2A 4AQYF 2XY5A 1NB7A 3RRHA 1GXTA 2AZ3A 4DS5A 1L3SA 1GMWD 1B99A 2R8JA 2X3DA 4MKVA 1WDDA 4AYBD 3ZZ0A 4JYAJ 1FVQA 4M5JA 4DPWA 3ZTSA 4X64J 1JLGB 3UVJB 3V2UC 2HIYA 4HHJA 1D09B 1BLUA 1NPRA 1LW2B 3PJ9A 1T95A 4ECUA 4MIBA 1KFDA 4ZJOA 2VF3A 4Y65A 2IC3A 3EPGA 2X7IA 2KVIA 4NRTA 4K4YA 1EAYC 5DM7Q 3P5TL 1N4LA 3TQEA 3UNGC 4RZRA 1BD6A 1TKZA 2RNEA 3OR1B 2DNLA 3A8IA 4AFFA 2VA2A 4GC7A 3MZIA 4X4UA 2JFKA 3A3OB 9ATCB 5D0GA 3QT6A 2MEWA 1VYAA 4LR8A 2GHWA 3HD2A 1S1UA 3MF5A 3HHLA 4IOCQ 3HVAA 3LAKA 3G6YA 2IBKA 2DNYA 4DV2F 5G4DA 1SL1A 4TYAA 4ZKAA 2AYGA 2YQ1A 1B7FA 1FCAA 5DM6Q 1E6VA 1N5YB 4F4AA 1WKKA 1RT3B 3D6HB 1T03A 2ZEJA 4N56A 2VQFF 2BKNA 2VFUA 4NLDA 3KLHB 2AJ4A 2YWKA 2G2ZA 2V2QA 1F1BB 1Q86T 1FXDA 2Y1LB 1NHVA 1ZAVA 3IRXA 4PWDB 1JLQB 1BQNA 2R7TA 3HSZA 2NREA 4C98A 2XNQA 1REVB 3K58A 2ATCB 2OD6A 3PFEA 4NZ6A 2VG5B 4W4MA 5K20B 2QTWA 4Y00A 3A8EA 1H38A 3T5HA 4KC5A 1TAQA 1AB8A 3CCVS 5LSRA 1RYRA 5L39A 1WC4A 1HR0F 1UA0A 3D67A 1FXLA 3BPDA 1H2UX 3SDEB 4OHYA 3FMBA 3WBZA 3MM9A 2LEPA 2A6MA 3AD8C 3VAHA 2HZCA 3AD7C 4CLUA 3IWLA 4TU8A 1P1TA 3TWZA 2I2YA 4DR7J 3KLGB 3SFUA 1FKOA 2ASJA 2OH2A 5CH7B 1N6QA 1HWIA 1HNIA 1EKSA 3RAXA 2NS1B 3KK2B 4KTQA 2Z56B 2UUWA 2XI3A 1U1QA 1RT4B 1QSLA 1KLMB 1T94A 1P1LA 2CJYB 1ACMB 2DYAA 2OKQA 1N56A 1GMUA 3ETMA 2O1PA 1JB0C 4B3RJ 4RW7A 1PAEX 3MHYA 3DFEA 4DFPA 2MQQA 3ETOA 3GFYA 3GZ7A 4P2XA 3VF0B 2ASLA 1R31A 3MM6B 2PSZA 1JJ4A 3M2VB 1HNWJ 3GJQB 4WJBA 3W2VB 2IJFA 3DKDA 2GCFA 4J9NA 2DNMA 1KHVA 4NLVA 1K0VA 2J0XA 4RNFA 3CJ0A 2MTLA 1IBLF 1UFLA 3MMCB 5IWAJ 1JLFA 4F4XA 4O3NA 2VOPA 3RB4A 1XERA 1PSDA 5LMUF 1IJEB 3G6VA 4O3SA 1P9QC 4F50A 4RBTA 1WORA 5I4MA 1S0VA 4CLFA 3M8SA 1RLCL 3OL7A 5F8GA 2ZE2B 3OJUA 2ZKUA 2BJ1A 3LOUA 1B7YB 3KLEB 2GAGC 4EBDA 4BWJA 2C2RA 2F40A 1DARA 5F8NA 3QGHA 4X65J 4ED7A 5M2RA 3AJ2A 2M52A 2V2VA 3D2WA 2HW3A 1HL6A 5FDLA 4LF5F 1G7CB 1QUPA 3FSIA 5ETLA 1Q8BA 3GILA 3M8YA 5LOQA 2E1AA 3CJ4A 2V8PA 4WKYA 1TKTA 2DK2A 3HLUA 1RT6B 4MIAA 5KTQA 4DL5A 5L1JA 3QO9A 5HMXA 4MH8A 1UWBA 3Q22A 3EGVA 2LDIA 4PRFA 2YKMA 4ZIWA 3OVSA 2IAJA 3R5BA 2FJEB 2W8LA 1D8ZA 3HXMA 1ZAXA 2BUNA 2NZ4A 2B8PA 3ZO7A 2P5VA 3RGIA 4ID5A 2J6TA 2L08A 1FWPA 2XSJB 2MKCA 3ET6B 1MWZA 4C48A 1IJFB 2XSFA 2KXHA 4ECYA 4RUAA 5D8HB 2IM1A 4RJVA 2QA4G 2VD3A 1I94J 1AUSL 5DQHA 5KFAA 1DTQA 4CT9A 4KSEB 3OQ2A 4Y2KA 2HRTA 4L3KA 4FYYB 1RHQB 2V8HA 3R5DA 2FY1A 2FB0A 4O4GA 2HVIA 2QLJB 3H90A 5KT4A 1YJWS 3AXKA 3B82A 5C24B 1RWWB 5AXLA 3WX8A 2J76E 2VBWA 5GMKa 5DDPC 5KFBA 5DQGA 4EUVA 4I67A 1UEVA 1PGZA 4XIUA 2I38A 5KT5A 1U2FA 2XWXA 5D4OA 2DGUA 3OFHA 1C1BB 2CXEA 1DZ5A 4DSJA 2BABA 4DN9A 3CJ3A 1JKHB 4ZP6A 1NJXA 4LFAJ 4Q0BB 4DR2J 2X1GA 2V2KA 4PYDA 4IG3B 1Q16B 2PDAA 3KHGA 2UUAF 1KQGB 4ITSA 4AXJA 3R5JB 2NXNA 1MWQA 4CT8A 4CDIA 2VASA 4DL7A 1VI7A 4ZPAA 5KFQA 3G8TA 3RAMA 2DPIA 3DOLB 1UW4A 4WBFA 4YDDB 4C8MA 3ZZTA 3ZNUA 1FX2A 1U2CA 4URSA 3U27A 1S9FA 4FN5A 3KKFA 4OYIA 1X9MA 1HPZA 2H48B 1ZZNA 1YJ9S 4NPOA 1MLAA 3R1HA 3SIPB 3GYXB 4DHVA 2ZH7A 2AYBA 3WDOA 4DR3J 3CMES 4K5RA 1MN9A 4I69A 4P2MA 3AOBA 5RUBA 2VZ9A 2FLOA 3U1LA 4NXMJ 1WEYA 1TV6B 1SV5A 3AOAA 2BW2A 1VOMA 3J80U 4I56A 5GAHU 2ALZA 3PV8A 2DGWA 3A12A 2DXDA 3TA0A 3CJQA 1DFDA 4MTPA 2IMWP 2CPEA 3N5FA 4X4VA 3QAUA 1JXLA 2HBYB 1OIAA 4MK8A 5BJRA 1W2IA 1XNRF 4AD6A 2MB0B 2AIRB 5ETRA 1VQYA 4NWBA 1XQIA 3H5YA 1HNZF 4PAAA 1NK0A 4Y0FA 4ECWA 1T05B 5EX0A 2PGCA 5E3QA 1NJYA 2NXEA 5IC4B 4EK2A 3M6VA 4ECSA 5JVHQ 4O0NA 1FVSA 2P9GA 1RU1A 1Y3KA 5AE1A 4FS2A 3DOMA 3BZQA 1HHQA 1S4EA 4GO5X 1B0PA 1N5QA 1NPKA 3TEGA 1VRTA 3SYZA 3CDWA 2B7CB 1TUWA 3SXLA 3UN3A 1O5JA 3NOGA 3PX6A 3IG1A 4WFAQ 4B9TA 1R3NA 2V2ZA 4ETXA 3EMTA 4RW9B 2WK4A 5KFCA 2CADA 4CLTA 2D69A 4ZVRB 3MUVP 2EW9A 4LF9F 1YLXA 4G6VB 4F02A 2WBRA 2GQ2A 2HEKA 3GSDA 3GG0A 4UW2A 1PCAA 1EHWA 4JV0A 4XDDA 4IKAA 1D9FA 2CQDA 3NBPA 3QAEA 2DGVA 4QWBA 4CYUA 3BQ0A 3UDCA 1SL2A 5IFMA 2UXDF 5LM7E 3UPFA 2AJ0A 2BQRA 4F4ZA 3AT1B 3M6XA 3KMSA 5H9EK 1RT2B 3OVBA 4PXCA 3BGRB 3I4HX 2OLWA 1UPMB 2OIHA 3I87A 2KI2A 2YH0A 2ZHOA 1GTEA 2ZH8A 1E6YB 3R5CA 3LGHA 1A6LA 5G0RB 4LUBA 2R8HA 3EWGA 3PIOQ 1RT7B 4DPOA 5J1EA 2OPQA 2MZQA 3TUJC 2N3LA 4B3SF 1C4AA 5HMZA 4RNOA 2PIIA 1NSPA 4HDHA 4HI2A 2HRYA 3AQOA 2DXFA 2AYMA 2EKYA 3W3SA 3HJFA 1FDNA 1S1TA 1O0PA 2HHUA 3PTWA 1KQFB 4LSNB 3LWMA 4DR4J 4JB8B 2QE5A 1C1CB 1HMVA 1K1SA 3GV8B 1VFJA 1NH8A 1K0TA 3F56A 2ERRA 1GQEA 1U0HB 5B0DA 4RW4A 1NZAA 3J7AN 2OEJA 4J5OA 2VG7B 2W24A 2O01C 2RHSB 1CJVA 2Y3YA 1BQMA 1NH7A 2VBYA 1ZM2A 3VAMA 4B3TF 2J9DE 2V9WA 2WBMA 4JI4J 2H5EA 3PHTA 3VWSA 1Q5VA 4ECXA 1ROFA 3R1LA 3J81Y 3VALA 1R0AB 5E3AA 4IDKB 3RBZA 2XHWA 3SCLE 3W2WA 1HNVB 3FQLA 3UR0A 5GAHI 1RTHA 3EX7B 2VKZG 4HVZA 4MK9A 4E2FB 1C4CA 2KFYA 2RF2A 1IR2A 4C9DA 4AL7A 1RUSA 3BN7A 3EVMA 1N36F 4YOEA 4IFYB 3H4DA 2X1FA 4OL8A 2C2ZB 4PEOA 1ZOTA 1JXVA 2AJFE 4C11A 2QSWA 3QIPA 2ZNYA 1Q5YA 4LF6J 3OL9A 4U96A 4PQUA 3HT0A 4KFBA 1FRKA 4HR2A 3CW2C 1JNZB 1NKCA 3K0JA 2E44A 3EDRB 2FLNA 3M2RA 3BBFA 1S0NA 2AD9A 3BKTA 4PWUA 4MT1A 3J7Z5 1NHKL 5E33A 3H2VE 1F6TA 3HZEA 1XMQF 3G87A 3TOQA 4NCBA 3KHHA 2IA6A 1FRJA 1JLEB 4KHRA 4LRBA 2IHR1 3C6UB 3QRRA 3VTIA 1WUUA 2VFTA 4ELTA 1MROA 5EWGA 2GIQA 4FXWA 1R8PA 1KRPA 2HHQA 2GHVC 4N7TA 1M1KT 3R2DJ 1TL3A 4G1QA 1XN9A 3NAIA 2HG4A 3Q8RB 4MYTA 2AHOB 3OSNA 2AGQA 3PYFA 4USTA 3MAQA 2AGPA 2M9KA 3VGUA 2HGLA 2BM0A 2PFDA 3WC2A 1FRHA 1IQTA 4O3PA 3OTOJ 1RDRA 5HVFA 3Q83A 1S1WB 2QA4S 3RBDA 1WOSA 2EFPA 3UN5A 1OQ3A 4R0JA 5GAGI 3NMAA 3DLKA 3V6DA 1LWEB 1BMQB 4URGA 3KLFB 1ITPA 4MFBB 3HD1A 4DF4A 2DCUB 1NSQA 3DU6A 4AL5A 2ASDA 4DV0F 1N88A 2BDPA 3L7OA 4DX8H 4NYPA 1ZH5A 5AE3A
chains in the Genus database with same CATH topology
2NXUA 2FLPA 2PFFB 2XS7A 2VKRA 3CCWA 3MPYA 3N6NA 4ZS6A 3CCTA 3I5CA 3RU0A 2LCWA 4L72B 3JAMY 2IM3A 2MGZA 3OLBA 3I55S 2R7WA 4BCAA 4I7FA 1HHTP 1ZAWA 2VC1A 5J2NA 5LL6d 1QE1B 1TZ0A 2QEXS 3FSXA 5EX3A 2EBGA 1R27B 4OI6A 1J5OB 1NNDA 2QT7A 2VG7A 4ILMA 4EFAC 1HQUA 2MZ1A 3N28A 4KHPF 1NK9A 2VFVA 5D3GA 3M9OB 3DDKA 4NX9A 2W9BB 1Y5NB 4WIIA 3CXCR 4KBIA 2CPJA 4QW8A 3QZ8A 3I9V9 2DNNA 2DH7A 3DXBA 4CH1A 5A8WA 3Q23A 4BBYA 3OR2A 1SKWA 3OXLA 5E0OA 2ROGA 3HZGA 4DG1A 3LALA 3CEDA 3CULA 3M32B 2PD1A 3N9UC 3PW0A 2F7VA 2J7UA 3MMAB 4P6QA 1D1UA 4OZLA 1X5TA 4Y34A 4CTAA 2B56A 2L41A 1D9DA 4U7UK 1YG0A 1U6BA 3F73A 2W7AA 1GNKA 4B02A 2ADCA 4WF9Q 5H1SV 5IT4A 1TKXB 3HHLD 4QIVA 2RH3A 3L09A 3CCMS 1RTIA 4WYLA 4Q8EA 1NO8A 2DT9A 3D1OA 4YFUA 3LW5C 4X2BA 3IWNC 2IYIA 1R8BA 2VB6A 3ENWA 3H40A 2IRUA 2M7SA 2D3UA 3CJ5A 4ZCKA 2LMIA 4F26A 4YP3A 2JVRA 3E01B 1Q53A 3BGUA 2AX1A 2MY7A 1LWFB 2PA3A 5EGYA 2DNZA 2EC0A 3C2PA 4G1PA 3M4XA 2VH7A 4ECRA 2KYZA 4NOHA 1S79A 4B3OB 2D3ZA 2I9SA 2KT2A 5A6PA 2RRNA 5CZXA 4ES1A 4ZOSA 1TK8A 3GR1A 1HI0P 4ES3A 3CIMA 1RQ0A 5KFEA 3G86A 1NJWA 2VPZB 1L3VA 2E5HA 1N8RT 2KKHA 2Q1LA 2RRAA 2LQ9A 4O3QA 1YJTA 1U1NA 2BQ3A 2Q3PA 5JXSA 1UVMA 2JVOA 4H4KC 3T5LA 4FZVA 4OI4A 4Q44A 2BE2B 4IFYA 3MMBB 4DR5F 4HH1A 1TQLA 3TP2A 1FJGF 4NLWA 1KSPA 4A8YA 2W4CA 2FUG9 3BREA 3L95X 3LP0A 4PUOB 3SEOA 3FVYA 2DCLA 3JSMB 4PG7A 2DIUA 3MEEA 4F25A 1U6FA 3KYLA 1LXNA 3PW7A 4PG4A 1S9EA 4FNIA 1ULRA 4FF3A 4DV4F 4B17A 2E5LF 2LECA 3TVZA 1S1XA 2MPUA 3MEGB 3UW1A 4DFKA 6FD1A 1S6OA 3GIMA 4CNZA 3M05A 4DFJA 4KV8A 5THWA 4A8MP 3GIJA 3S6EA 1YJRA 2WAQD 3TVKA 1D8YA 2DR5A 1X4GA 2PN6A 2XULA 1IBKF 3TUZC 1HFEL 3CD5A 4IFVA 3RRGA 2FHJD 2YNIA 3MPVA 5KFGA 2FVSA 5EHHA 4FVCA 1N32F 2JEJA 3E51A 3K57A 5B0EA 2FVCA 3MR5A 3K5LA 4J9KA 3N01A 3I32A 2ZD1A 1S1VA 1VJWA 2VC0A 2CQPA 1RKJA 1IKYB 3CDBA 2R7OA 1IQZA 3LO3A 1AXQA 4YDXA 2A1BA 4I6AA 1Z2LA 5C42A 2L9WA 2CPHA 2K7JA 3IFEA 2DHAA 3LUYA 3PX0A 5KOXA 2XEXA 3M8PB 2JEGA 4MIWA 4LVOP 3DRPA 3SV3A 2DH9A 3M8QB 3RW7A 2K2PA 4A8KA 2EG1A 4K4XA 3BQ2A 4KIAA 4R5PB 2HQ3A 4TYBA 3TNVA 2JJ4D 2WONB 3EXYA 5DG8A 4Q7AA 4DMZA 4J9OA 3BJYA 3N5BA 2KT5A 5MAOA 4UQGA 2OPPB 5KFMA 5KFIA 4JI8F 3C6UA 4I2QA 1J2VA 2CVIA 4NA3A 4OX7A 3UCGA 5DDRC 1N54B 1K73T 1KLNA 4EBEA 4X4SA 3MCSA 5F8MA 4TLQA 2VUGA 3T6BA 1Q1KA 3ZZPA 5KG3A 2OMOA 4DR7F 4P2SA 2MQPA 1EP4A 2F9JA 4BDPA 2HHSA 2CQCA 5AJ3F 2E7WA 2FPHX 1Q79A 5CCLA 5J2QA 1KQSR 3N0VA 3W7BA 1H98A 2UV8A 1HQEA 1S6UA 2ZOFA 4LIWA 4P7VA 1V9OA 1UVKA 4K4VA 3EGNA 3FZBA 4O44A 3FDSA 4ZP8A 2HFOA 4RNNA 2XWYA 3M2UA 5DO2A 4JI7F 2HQIA 2PI5A 1M5HA 4ZPWR 4JV2A 3DC2A 5B09A 1VC5A 4QU6A 2ZH4A 2RIJA 1K9MT 1RT1B 4ZPCA 2DHGA 1R43A 3EUNA 2RKIB 2ZBCA 5J2PB 2ZZMA 4WZQA 4NXNF 4OJHA 4ZVGA 4KT0C 2NPFA 1M5VC 1TFWA 3B8HA 5HBMA 1WWHA 5L9XA 1QVGR 2E5IA 1NAQA 2HVHA 1P6TA 4F67A 3LP1A 1HARA 4RNMA 1FTCA 1N48A 1SJRA 1KONA 5BYSA 1LWCA 1MWYA 4ECTA 3CTRA 3SV4A 4PG8A 4OJ1A 2HRUA 1MROB 4NLYA 2X1AA 2XNRA 3UDLA 3J7YU 4ED2A 1FDAA 5KFVA 5GAGU 4LVNP 3RRKA 2Z0GA 2NR0A 5JVGQ 3ITHA 2UZAA 1TVRA 4NCGA 5A8RB 4K50A 3MECB 1Y00A 3QLHB 1DQ9A 3BGLA 5I3UA 3Q8PB 1S0MA 1S49A 3TX8A 2A10A 1HBUA 1DBDA 1DHMA 3TQ1A 1TL3B 2BJEA 2ZHAA 5KG1A 1FKPA 1ZPVA 2ILYA 3I6PA 4G1QB 2E9RX 4WFBQ 1HNWF 1R8AA 4MFBA 5FJ4A 1SKRA 1R89A 2G4BA 1KQKA 1S10A 4OX8A 3Q8QB 3RR7A 3O5TB 4R0EA 3AAWB 2CG4A 3J80Y 1NEEA 4NLPA 2RE1A 4Y2AA 3ZZYA 4EYHB 1IBMF 4X4RA 2DH8A 4EO6A 5LSLA 1KVJA 4IR9A 1QY7A 2GO9A 1FNOA 1SUQB 4ZDNA 4A8FA 2CPDA 2YWFA 3KG0A 3BR8A 4TXSA 3SCKE 3VCDA 1KVIA 2ZNZA 3DM2B 4A8QA 2FVRA 3IGVA 3AA9A 1FNMA 3DLEA 1I6JA 5KFKA 3GIKA 4LSLB 1KS2A 4LF7F 2OPRA 4N41A 1FD2A 4EU0A 3E3XA 1VC0A 1QAXA 5JJBA 2B4PA 2E5GA 4Y2IA 1U45A 3G71S 2E9ZA 4TQSA 3T1HF 5K8OA 3D5MA 4QWDA 3DDNA 4DR6F 4OHWA 5T41A 3CF5Q 1QE1A 1KTQA 4RW8B 4J9RA 4B9SA 4DOZA 1J5OA 3UR3C 2JC0A 1T7PA 2P9CA 1VK8A 3HMJG 4FYDA 1V3ZA 2AYEA 3US5A 2OMLA 4LF4F 1YSJA 4OI0A 1C2PA 2ZHBA 4QJVA 2W9BA 1OPZA 2B43A 2D1CA 2ZZNA 2OPSB 4ERDA 2DO4A 5KFYA 3AB2B 2ADBA 2KHDA 1X4HA 3BS9A 1HW8A 1TL1B 3PACA 5T7LB 3OHBA 3OSPA 4B9UA 2IM2A 1X4CA 2OFGX 4FS1A 3IAS9 3DOKA 3CC2S 3KFWX 5CCMA 1YTYA 2QO3A 2COLA 3M32A 2EFGA 4I1TA 3HVRA 1NJZA 1I1GA 1U7LA 3MMAA 4C97A 2I8EA 2DGOA 2CVEA 2J9DA 1CQNA 4CO2A 3IAM9 4USHA 4DL6A 4WFYA 2XZWA 4XK8C 1H7WA 2DGSA 1FD8A 2EG2A 2PI4A 2XS2A 2R7VA 2B9YA 2JL9A 5KFXA 2YKQA 1XR7A 2KJVA 5KFTA 1NKEA 3HHNB 2HHWA 2CJ9A 4Z2XA 1WHXA 2VG6B 2A3JA 3BSAA 2C2DA 4QWAA 3VZIA 2O67A 2WHOA 3T9ZA 1GXLA 3TA2A 5DETA 2CJBA 1JMTA 2MJUA 3OW2R 3H4BA 4CNYA 1WEZA 5D77A 5D3GB 4C3MA 1Q8IA 4UOCA 3E01A 1OO0B 1SKSA 3Q0AA 2ZJPQ 1VRUA 3BO4A 1LWFA 3SFGA 1U1KA 4ZCIA 3DMJB 4M8LA 4ZVEA 1Y9OA 5KFUA 3JTPA 3OR2B 3CD6S 3DYAB 2J7WA 5KT3A 4JUZA 1IUJA 4B3OA 3EYZA 3SSRA 3DHWC 3BDEA 1XBWA 4NMLA 4OV1A 5AXNA 1Y0HA 2IBOA 4N47A 3DRYA 3ISNC 1R6YA 4Q5VA 4GKJF 4QCLA 4A8OA 2PT0A 1GAOA 1M5KC 3RTVA 2BM1A 3MFIA 2B6AB 3SZ2A 3GIIA 2BE2A 2M3DA 3JTOA 3MMBA 4ZHRB 1A9NB 2KO1A 4ILRA 1QLNA 4ETZA 1IN0A 1QJHA 3M9MB 1HA1A 4O0IA 1GXUA 2QA2A 2M70A 4FVMA 1VQ6S 1HD1A 3FQKA 2XGPA 1PC5A 1SH0A 3JSMA 3LANA 2VBXA 2VV5A 2D7SA 4MK7A 2XLIA 2VFSA 4E8UA 1Q4RA 4C8NA 4AL6A 5T14A 2RT3A 2YKOA 4MKAA 2ASYA 2IC3B 2F4VF 1X4EA 3MEGA 4I6WA 1KN6A 3JB9k 4KKOA 2ZUGA 3BO3A 3JYTB 3K8VA 4CO3A 2XS5A 4DQPA 4NCAA 1HBNB 3HO1A 1GH8A 1TK0A 5F9LA 3DLGB 1F5CA 1UJ4A 4UY8T 4GMKA 3H98A 3MI7X 2XB2D 1NK6A 1TKZB 5L38A 1KNZA 2AQ4A 1Z4UA 2RQMA 3K59A 4F2RA 3DNCA 4G1IA 4JI6F 2NSBA 3CE8A 4OJ3A 2HMIA 1NRKA 1SI9A 2ILZA 1IKYA 1MU2B 1Z2ZA 1TL5A 4Y6IA 4ZLPA 5B0BA 1FRLA 1Y5LB 1N5YA 2FD2A 4M94A 3LF0A 5L1IA 4PPZA 1RT3A 4URQU 1QVFR 4BS2A 3M8PA 2RB7A 2VA3A 5F3ZA 4F3OA 2QYCA 3UCZP 2B9WA 4FBTA 1YI2S 3HT3A 3M8QA 4DUZF 2MSTA 3CDAA 1SB6A 2ZH5A 4M95A 1LXJA 3D54A 4LFBF 2WONA 1X9WA 4QU7A 3THVA 1S1XB 2YKAA 2OPPA 3KHRA 2DNGA 3IWXA 2QRRA 3BEGB 3AA8A 1PILA 3AY0A 4ATNA 1S1UB 3HHKA 4PWDA 4M63A 4J9QA 2WSCC 3HHLB 4QZVB 1CG2A 2PO4A 4MYUA 4C8ZA 1G2EA 3G8QA 1SQEA 4BC9A 4HT5A 2IJNA 2YNGB 4Q2MA 4YB5A 1HWLA 1REVA 4ZP9A 4K4SA 4DL0C 4RUCA 5KFWA 5KFJA 3V4IA 3BR9A 2LVWA 2UUTA 4XAKA 1VQMS 2Y1RI 1NJIT 2VG5A 3P6YC 1WACA 2FHOB 4LIRA 1E6VB 4C7QA 5C42B 2ZITA 1DTTA 3HFKA 5A8KA 4IRCA 4WE1B 2ZOGA 3MR2A 3OXFA 4LQ3A 2HLTA 2XO7A 3ENQA 1FDDA 4Y3CA 4QPTA 3WC0A 3I0SB 1T03B 2MXYA 4YEAA 4E98A 1RT1A 4QR0A 2B5JB 2G1DA 4X62F 4ECQA 2RKIA 4DSFA 2B7BB 2MY8A 2CPXA 3BDPA 2P6SA 3PFOA 2ZH6A 3DXSX 2BQUA 3PX4A 5EN1A 2DVIA 3CCJS 2KM8C 2BBEA 1U1PA 4NLTA 1JNRB 1FJEB 3J7ZT 2G13A 4DF8A 1XR5A 1YVFA 3IRXB 2IA0A 3HKZD 4LFAF 4ED5A 2WB1D 1BQNB 2IVMA 2FJXA 2FDNA 2FJBB 1BGXT 4NLOA 5K14B 2C3UA 3HDSA 4MJKA 3FCHA 1EP4B 1YQHA 4H4OB 2YKPA 4DSKA 5A8RA 2LKZA 5L8RC 3MECA 4A8XA 3QLHA 4J9MA 4R25A 3MM5B 4JOUA 4D3GA 4LF8F 2FJAB 1HQEB 1VQ5S 2YX4A 3PR4A 2MZSA 4DV6F 2XG8A 5B0AA 1JIHA 1RK8A 5F41A 4R8UB 2LLZA 3M2UB 2RVJA 1F9FA 2R7UA 2DNQA 2W7PA 4WZMA 4ED8A 2FGCA 4UUWA 3TO8A 3LGMA 2HYIB 2Y0SD 2Z8QA 5H9EJ 1FF2A 1SUQA 2CJKA 4ED0A 5D4LA 1HW9A 1N33F 7FD1A 1M0SA 2LDYA 4Q45A 3D0HE 4UUXA 4DLEA 1FRMA 3FFIA 5J2MA 3CC7S 1QUVA 1CQMA 2KXFA 3V5RA 4M5DB 3RZAA 3UFCX 4OZ1A 1U1RA 2CZVC 4LSLA 4NA1A 1VQPS 2YKNB 2KXNB 3QZ7A 2RU9A 1SJQA 3GV7B 1CEZA 2BANA 4HTJA 4C4WA 1Q8LA 5CYJA 1HBMB 2MKKA 1F2GA 2LXIA 3FZ2A 4HTIA 1WF2A 3J7YI 3Q24A 4OHXA 1D0EA 5I3UB 1MSWD 2B4UA 3FEYB 5B0GA 3I31A 1WHVA 2HS0A 4QR1A 2D9OA 2X1BA 3BO2A 1KLMA 2BR0A 4JYAF 3NG8A 2VONA 1UJ6A 2ZH1A 5KG7A 3V6KA 1BC6A 1K8AT 2IVFB 4OQJA 5KFZA 4B9VA 1M90T 2AJ1A 4B9NA 2N4DA 3MM9B 5KFOA 3HPOA 5E3RA 4QIFA 5SUHA 5HP1A 2EBEA 4WTYA 4CCHA 3CB4A 3QGGA 2EI5A 4MAKA 4PPDA 4IH6A 5D4PA 1BQXA 4O23A 5HO4A 4RWWA 2AP6A 3GYNA 2CJAA 4C8LA 1YRUA 2OPSA 4DQSA 2HHVA 2CQ1A 4ZVHA 3HI9A 3OTBA 4JI3F 1TL1A 3U1MA 1FKOB 2N4CA 3TR5A 2OFHX 3IR5B 3MR3A 2DRBA 4QIWD 4A48A 2YWHA 1CPZA 2BXJA 5KT7A 2J0WA 3JSBA 4WYWA 3DRRB 4WFXA 1HNIB 2RS8A 4QOTA 3S8SA 1IKXB 1T02A 3NGKA 3L3CA 1U1LA 1RGVA 5AXMA 3RB0A 1O8BA 5D78A 1U47A 5E5NA 3GB0A 1C0UA 4B9MA 2VG6A 2RS2A 4AQYF 2XY5A 5KAKA 1NB7A 2XY7A 3SQGB 4HLBA 2W7OA 3K5MA 1GX5A 1D9AA 3RRHA 2LQJA 1VMBA 2HHPA 3OHAA 3OL8A 1U25A 1GXTA 2XC9A 3NMRA 2RILA 4DS5A 2Q79A 3BSOA 3LP2B 2HNDB 2P9EA 2W9CB 4C3KA 1G3OA 3R5AA 1WNEA 4TY9A 3I0RB 1L3SA 1TR0A 3DMJA 4RW7B 4OX6A 1ZZFA 3IXQA 2R8JA 3DYAA 1N0VC 4DV3F 1VGYA 3DOKB 3FMWA 4IUFA 1IXKA 4AYBD 1ZYQA 3ZZ0A 2MDAA 3BGFA 3CWJA 2ZBIA 2VPYB 3VZHA 1FVQA 3NAHA 5B0CA 3IRWP 4AXIA 5LSOA 1M5PC 3D0GE 2FVPA 4RUHA 1TUVA 2B6AA 2E66A 3TI0A 2BACA 2V4RA 4J9PA 4ZHRA 3NNAA 5C5JA 5HLFA 1JLGB 2LYVA 3MD3A 5HN0A 1H6KX 2JEFA 1QAYA 3V2UC 5F8HA 4HHJA 2HLUA 3KG4A 1BLUA 1LW2B 1T95A 4ECUA 2ZFHA 4MIBA 4G3IA