4RBVA

Pdua k26a s40gsg mutant, from salmonella enterica serovar typhimurium lt2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
QEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGGSGGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propanediol utilization protein PduA
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica serovar typhimurium
molecule tags Structural protein
total genus 20
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rbvA00
3N79A 3CIMA 4OLPA 4AXJA 2EWHA 3VCDA 5L38A 3DN9A 4OLOA 3SSRA 3DNCA 4LIWA 3BN4A 3SSQA 4RBUA 4QIFA 3MPWA 3NGKA 4OX7A 3IA0A 2A10A 3I6PA 4OX8A 3PACA 4QIVA 3H8YA 5DJBA 3NWGA 2A18A 4PPDA 3CGIA 3I96A 4P2SA 4RBVA 4DDFA 4OX6A 4RBTA 4P7VA 3MPYA 2G13A 4QIGA 4AXIA 3SSSA 4P7TA 2A1BA 4QIEA
chains in the Genus database with same CATH superfamily
4MIWA 3UVJB 3UCUP 3KLVA 1JLCB 2LQ8A 1Y00A 2LQ5A 4I69A 2DNPA 2GJ2A 1CSJA 4UOCA 2OPRA 3QNWB 3O44A 2HHXA 2E9RX 2RB7A 1VCTA 1UWAA 2JC0A 4X4RA 1HYSA 1H2UX 4FKYA 2MKKA 1NK5A 3MPYA 4M5LA 1HKAA 2MPUA 3VALA 2LDYA 5SUHA 5DDRC 2B4VA 3UPFA 2K1RB 3SYZA 3IGNA 5C24A 3V4IB 5DDPC 3H59A 1SC1B 3QT6A 2MYFA 4ZDNA 2ZOGA 5C5JA 2A2DA 2ZM6F 4UOFA 1RTHB 2HBZB 4C0BA 1RAJA 4N8NA 4CT8A 2QLXA 1HBUA 3BSCA 3MD3A 4DLGA 3NCPA 4JV1A 4X84A 4NRTA 3OTCA 3OJSA 3T1HF 4GC7A 5KFHA 4NEZA 2BR0A 2R2UA 1TQLA 4NXNJ 3FZ2A 2KYXA 2DNRA 1IKWA 1WOSA 1HNZJ 5IT9U 3NBPA 4C6AA 1VRTA 1WF0A 3AB2B 1JLEA 2H9ZA 3EZOA 3T1AA 4OZ1A 1SUQA 3CW2C 4A8KA 4ELTA 5JXSA 4OHZA 1QSYA 3SEOA 3G71S 2WVFA 1H72C 2IBKA 1N6QA 5EX0A 3EJMA 2VQFF 4Q5VA 1S0MA 5KFWA 2QX0A 1AT1B 3CMES 1N5YA 4ELUA 5JUMA 4DQQA 2BW2A 1CULA 3RB0A 4LQ3A 1KTQA 7FD1A 1L5UA 3LGMA 1YHQS 2CWKA 1WF2A 2OHDA 3CNQP 5ETKA 5KFSA 1GEHA 1JJ2R 5D4LA 1ZM9A 4ZVTB 4FF4A 4F25A 3CCLS 2B51A 2K06A 1RB0A 4CRJA 5F0WA 2ZKTA 4J9LA 1NJIT 2ZZMA 1VJQA 2EFNA 1HI0P 1U02A 2AJ0A 1IBCB 4DV7F 1TL1A 4JI7F 2G4BA 5KFUA 4LF4J 2DNLA 3EWGA 4NMXA 4FDFA 1QY7A 3RTVA 2YNHB 4A8YA 5E3QA 2HQCA 3IR6B 1T9YA 4WU2A 4X4OA 4F4AA 1FFWB 1N56A 3HHNB 3QATA 2IDEA 3K8WA 5HJYA 3BH7B 5CYQA 4XO0A 4KT0C 5F8LA 3HVWA 3DMJB 4LF9F 3S1TA 3BQ2A 4FVCA 4KHRA 1N4LA 2JJ4D 3LAMA 3N9UC 4LBPA 1V5VA 2WRMA 2IVYA 3PW4A 1X60A 3POTA 3D2WA 2KVIA 1DTQB 2ZVIA 5B08A 4DWIA 1VK3A 3AJ2A 1TFYA 3AQPA 5H9EK 1BGXT 1JX4A 3G9CA 2FDNA 3W62A 1LW2A 1XMQF 5ETNA 3DRYA 5KG0A 3QAUA 2C3PA 1Q86T 2G2YA 1SI9A 1EB0A 1NHUA 4MK8A 3TO8A 1WKLA 1X4CA 5RUBA 3KOAA 4USWA 4HDHA 3N0VA 4ZVEA 1UFWA 4ECYA 2VASA 2KI2A 4F2RA 1ZM3A 5G0RB 1KRPA 1K9MT 4RW8A 2OIHA 3EM1A 2QMUB 1WDDA 3G2XA 4C2MA 3CD5A 3R1LA 4DR7F 4RX6A 2B5JA 1YSJA 3Q22A 1RT4B 3M32A 1UP1A 1NKEA 3HZEA 3W2VA 5L1LA 3G8SA 2K3IA 3QIPB 4FF1A 3DCAA 4B3OB 2IM0A 2OI2A 3OL8A 2EFGA 4AUKA 3HHLC 3D3BJ 1VC0A 8RUCA 2YKAA 1BQNB 4YUDA 2CJYB 4CO3A 2QA4G 2PDAA 3NWGA 1RT7A 1TL5A 4IRKA 1N34F 1ZA2B 3BGLA 5IWAF 1NPPA 3U7JA 1VQYA 1WSRA 2DGQA 1U26A 3DNCA 1HMVB 1KVJA 4DV4F 4TVAB 2DJWA 1U45A 1K0TA 2DEIA 5DZ6A 3TWZA 2Y0SD 3CJQA 2Q3PA 2HFOA 1RT5A 1RT3B 2YKOA 1F3FA 2GVZA 2ZJQQ 4CWBA 4C8LA 4IG3B 3IS9A 5HVHA 1S9FA 4DX8H 1MROA 3A3NB 3GZ7A 2CQBA 2VHGA 3D54A 5D0HA 2HHSA 3HFKA 2D3O1 1RHQB 1P6TA 4G1IA 4O4GB 1F1BB 3TW0A 1TZ0A 3SCKE 1J5OB 2F9DA 3BYRA 3KHLA 1S1TB 4FVMA 3TAMA 1WTBA 3FNNA 3C3LA 1ICEB 4Q8EA 3CD0A 2C2EA 3O6QA 2VKZG 2OFGX 3LP1B 3HULA 2W9CB 5B09A 2XC9A 4QIWD 4ZMMA 2IAJB 4CLZA 1MMNA 1HBOA 2HFSA 4J9KA 2WSCC 3SQOP 5L1IA 4B3MJ 2B4OA 4ECRA 3BR8A 2ASDA 2JEJA 3UWTA 3JSYA 1G2EA 1BC6A 1BQMB 4B9UA 1S6PA 3T5HA 3NY0A 3DU5A 1L3UA 1IBKJ 1UJ4A 3IWLA 4DFPA 4OZ3A 3EXYA 3K7RA 3W5YA 3BBCA 1M1GA 2H5JB 2G13A 1UVMA 2P9EA 3K5LA 3TVKA 1HHTP 3E8OA 2XLJA 2VG5B 2QV6A 3T5LA 3ZZOA 2DNMA 1TVRA 2V69A 4M5JA 3ITHB 2KH9A 4MTPA 3PVXA 5GAGI 4LRDA 4GC6A 4V19X 1FWLA 1XERA 4UZCA 3TP2A 1YWXA 2HSEB 4YDXA 2HK3A 3HJFA 1VQMS 1UEUA 4ZIVA 1T9WA 1S0NA 4CLWA 4C3LA 1ZM4A 5LL6d 1J27A 3CB4A 2DNOA 1CQMA 4A8SA 3A3PB 2GHPA 4OX9F 1LNQA 3R5CA 4KYZA 3UDCA 1S1XA 2ZE2B 5I42A 5LJ3Y 2J7WA 1VQSA 3C46A 3MAQA 2J76E 1RKJA 1UFKA 2W2MP 4OX8A 3VAFA 1VQ4S 3FCWA 3M8PA 5J2QB 4C98A 1PJ5A 2F1FA 2C28A 4OYBA 5F8HA 2DNHA 4C7QA 2WAQD 1JLGB 3RU0A 5F0UA 1D9DA 1HWIA 2W2NP 1FEEA 2CXEA 2WK4A 3FK4A 2FY1A 3VCDA 1FT8A 1DQAA 1S59A 1WHYA 1UETA 5DZ7A 2YKPA 4AE5A 2K2PA 4W98A 2KZZA 4Z2XA 3M2UB 1HR0F 4WJBA 3OT9A 3R5BA 2YBVA 5KG3A 2UU9F 4PZVA 5HANA 4ENOA 5AXLA 8ATCB 3PHTA 3V2UC 1RABB 1P9YA 3DLJA 3JAMU 2EC2A 4ID8A 1SH3A 2RDDA 4B3TF 4I64A 2VJVA 1VIOA 1VC5A 2A10A 2WVBA 2NPFA 4F50A 2XB2D 3QT5A 1ZTTA 4X66J 3R7SB 1U1NA 1RTJA 2ZH1A 3HSZA 3W5XA 4CT9A 3QAEA 1S57A 4WFYA 1RTZA 5AE3A 4PG5A 4A8FA 2UUCF 4OHXA 2DPIA 1HWUA 1NB2A 5ETQA 3T1YF 2AGQA 2UXCF 5A8WA 3BBBA 2YKMA 1Q8IA 3FQKA 4MKVA 1NJWA 4K59A 2CZ9A 1XK8A 3GSIA 4RW4A 2HRTA 4JV5J 3JQMA 4DF8A 2E7XA 2AYMA 1R27B 4DS5A 3AT1B 5BYQA 3MR5A 4ATNA 1VR6A 2E1MC 3VAHA 1F5CA 1RAFB 2RSQA 3P8BB 1S7HA 2JX2A 4RNNA 4ECUA 5KTQA 5F3TA 5EHHA 2WONB 3SFGA 1U1OA 1IWGA 3HSDA 3X1LB 3AA9A 4HI1A 3BEGB 1JJ4A 2I1RA 3R9LA 1LXJA 1O8BA 4B9LA 3GPAA 1XQIA 2O1PA 4DCOB 1XEZA 2UV8A 4Q0BB 3RAXA 3B6BA 1PYTA 3MMCB 5KFYA 4RBVA 3AD7C 3W61A 3LWMA 4CM0A 4KH0B 2ZH9A 3Q23A 1TMJA 2FJXA 4XDCA 4DL2A 1ZZFA 2EKYA 4RW6B 1X4GA 1RAOA 5EWGA 4L73A 3QO9A 4ZOSA 3NNHA 1X4DA 4MT1A 1YZ6A 4KGZB 1UW9A 2RF2A 4RO0A 1I1GA 4IYQA 4NCGA 3OFHA 1UKUA 3A8JA 3EVOA 1LFWA 2B9YA 4JI8J 3L09A 4CI0B 5ETLA 4ZCKA 4NXMJ 5HJXA 4YHHJ 1K1SA 4ED6A 1ZZNA 4LVOP 2AGPA 2EKNA 1ZA1B 4IFVA 4N41A 4MK7A 2QYGA 2GIRA 1QUVA 1NJYA 4WFBQ 4J37A 1RYSA 3B54A 4LFCF 4P2FA 4JI2F 4KKOA 2ZVSA 4KPYA 4I7FA 2R2TA 3P96A 4JI0J 4JI4J 4U7UD 4RU9A 3SDEA 4OI3A 2KFYA 3IFEA 3CJ2A 3IA0A 3GR1A 3LA0A 3HVTB 2DGUA 5AJ3J 5ETRA 3Q83A 5KFIA 4V1Ak 3LPYA 3W8PA 3MEGA 1GAOA 1FRMA 3O3LA 2P6TA 4AL5A 3FRZA 1F6TA 2HQFA 3CD6S 3SCIE 3KK2A 2K7JA 3JYTB 3RGIA 4PAAA 1U6FA 1QVFR 4DR2J 5ADZA 1H7XA 1NSPA 4ZCLA 3P4UB 4DG1A 2B43A 3PJWA 3OXLA 4DS4A 3CDUA 5D4NA 4IR9A 2IM1A 3MTKA 4XAKA 2GQQA 2VONA 1RAEB 2B4PA 2ZUGA 4RNOA 2AGOA 4LREA 3CO9A 3TVZA 2BABA 4LFAF 3R6GB 3DOMA 1V6HA 1OYEA 3ICLA 4EU0A 3IMQJ 5F8NA 4OYZA 2XWYA 1Z2ZA 3OHBA 2YNIB 3Q8RB 5B0DA 3GQCA 3HK2A 3HCXA 2FJAB 4DV5J 2KB2A 4ZVHA 4AXJA 3MXHP 2EWHA 3LPEA 3MM5B 4I6AA 3BSAA 2AEJA 4KO0B 3DI6B 2ZHOA 4L75A 5K14A 3UCGA 3CC2S 4DR3F 3GILA 2PGCA 1N0UA 1FDBA 1TKTA 4X4SA 4O3QA 4ZHRB 5EGYA 3FBBA 3EMTA 3IRXB 1FKOB 4F04B 4DV3J 1M1HA 2I8EA 3RR8A 4AD6A 1IWAA 4NLWA 3UVJA 1SJQA 2F63A 2A3JA 1JLCA 4K0KF 1TL7B 2V8DA 2Y1RI 1R89A 3KUHA 2KHCA 1S6QB 3CWJA 4ZVFA 5KFLA 3R8YA 1U0SA 1NCLA 2AF6A 1PYOB 3H98A 1YI2S 2CJBA 1NDKA 2K1RA 1TELA 4RW9B 3DGPB 3V4IA 1FERA 2QLBB 1OPZA 1O6XA 1HD0A 4B9VA 2QJ3A 3C19A 4ZN1A 4ER8A 3N01A 1RTHA 2XMMA 2CPDA 1KVIA 3WC2A 1T9VA 2YX7A 1VQ9S 1V3ZA 2DNQA 1X0PA 1FEHA 4PG7A 3EGWB 4R8UB 4USVA 4PRFA 4EFAC 2DHHA 3CDBA 5BXIA 1Q16B 1FJCA 1Y5IB 1UCNA 3EVWA 2KU7A 2XSFA 5D4PA 2FJEB 3KWMA 1FNOA 5LJ5Y 3MM6B 4DPUA 1UEVA 4JI6F 3NCRA 5IT9Y 1B70B 4TY9A 3HKWA 3SQGA 5HN0A 2OEJA 3FEXB 4A48A 1KQSR 3ILIA 2ZC3A 4OHYA 3MR3A 4O0NA 3JTPA 1TU0B 1G1XA 4LSNB 4YB7A 1SIWB 4C0OC 2OMLA 3UR3C 3AQOA 3E3XA 4WP9A 1FJGF 4DMZA 3A1YG 1GX6A 2RRAA 1NLKL 1NH7A 4TXSA 5IT0A 4WTOB 2BM0A 3HHLB 4ZVUB 1WOPA 2ADCA 1S4FA 2VG6B 3J81U 1NDCA 2XS2A 3B4DA 3THVA 2CA9A 2RD5C 4OZJA 4QJVA 5ETTA 3LUYA 3DU6A 3NLCA 5G4DA 1LFPA 2XO6A 2ROGA 1RHMB 3HHLD 3OVAA 2YNHA 3NGSA 3LTOA 1VC6A 4NLUA 1JXEA 2F8EX 2EPIA 4RUAA 2AEFA 4WTYA 2ILYA 2ZHAA 4ES2A 2GO9A 4RPFA 3BR9A 2OELA 4GKJF 5HAOA 3NL0A 2MLYA 2MZTA 3DMJA 1MWZA 3DRSB 4E2FB 2ATCB 4QW8A 5KFMA 1S97A 3OFGA 5KT7A 3KLFB 3MZIA 4UUXA 3PYGA 1DTQA 4U6PA 1WACA 4NLQA 4CH1A 4EBDA 2Z2ZA 2UV8G 1JJHA 2DHXA 2CAJA 1WELA 2OFHX 5CABA 3BYPA 4LFBF 3AODA 2KO1A 4CLYA 5THWA 3PDNA 2JFDA 2RUSA 5A6WA 2BQUA 4ED7A 1RBAA 3EVMA 4ECVA 4ED0A 1IN0A 4RUCA 2QT7A 1WSVA 2B7CB 1RWKB 3KMSA 2IJFA 5G0RA 1M90T 4USMA 5A0YB 2JC1A 3ENQA 4HKQA 5HQLA 4P9SA 1S1WB 4ZPTR 2DEJA 4KGVB 1RT4A 2BRLA 2HLTA 3HD1A 2YQ0A 3SV4A 1RDRA 1SJRA 2OTLS 2E9TA 4JI3J 2GQCA 3OQ2A 3QIPA 5D8HB 2R4FA 2P6SA 4DCPB 4H4KA 3GYGA 2J6TA 4JI5J 5KT5A 4B3OA 1FE4A 2LVWA 4IOAQ 3W1YC 3UN3A 1EX8A 2V4QA 3MMBB 1YBAA 1BQNA 2CQPA 1VK8A 1HFEL 1X5TA 1PBAA 2VOOA 4L6V3 3MDFA 1GTEA 2KRBA 1HWKA 1V3SA 3M9NB 4A47A 1HMVA 2XBPA 1X0FA 1YLXA 2COLA 5FD1A 2FVCA 4M5NA 1P9QC 1U1MA 1KONA 2M4MA 5T14A 3RRGA 1RT3A 1QD1A 2IRXA 1YJVA 4XDDA 1XMOJ 1K44A 5LMUF 3NOGA 2ASLA 4IG3A 3D1QA 4J9OA 1RHJB 1R3NA 1FRKA 2A1BA 2AT1B 1IJEB 3J80U 2XO7A 1A6LA 1X5PA 1GNKA 4O4GA 3EGNA 4URQU 3HDSA 2OGUA 4C4WA 1Q7YT 1J5OA 2CZ4A 1S1TA 2JEFA 3W60A 4P52A 4JYAF 1SQEA 1PGZA 4K2XA 4DL7A 1HIYA 3LP1A 1HNWF 3OJUA 2VPYB 2W9CA 2JNJA 2C3MA 3KFWX 3LAKA 2W2OP 5M2PA 2IAJA 5J2NB 3K59A 2HHUA 1VI7A 4Z37A 4W92B 4OHVA 3DLBA 2IYIA 4HH1A 4BLGA 4F4XA 1AZSB 4X65J 2L48A 4P2SA 4OYIA 1BQMA 1QLNA 2RH3A 2FLLA 1VIXA 1YJNS 4HDGA 3W66A 2XCAA 2N4DA 4TU8A 4FYWB 4AYBD 2M8HA 3M8ZA 4HLBA 3C8YA 2KG0A 1D0EA 2M2BA 5GVQA 2J0XA 2DHSA 1U1RA 4JV0A 4I2QB 5K20B 4NLPA 2UUAJ 4YR0A 2WVCA 2JH3A 2M88A 2MEWA 4DL3A 4FP9A 4ZK7M 4N77A 2VG5A 3ETOA 1U24A 2B4UA 2D9OA 3ITHA 2J9CA 3DM2B 2HIQA 4Y2AA 3VGSA 4WXWA 1OS5A 1VJWA 4OI0A 5L1KA 4L3KA 1RAIB 1D09B 2W2PP 4ZVRB 3E01B 5E3PA 2GMHA 4IQMA 1Q1KA 2DRBA 1CS4B 2ZNZA 1H73A 3AAWB 1N32F 1MMDA 2F3JA 4QZVB 4GKKF 3IBWA 2OUGA 1HBNB 1JLFB 3O8WA 2R7OA 3UDLA 4PCQA 3BB5A 2ZE2A 2R8HA 5AE1A 2VPXB 3AXKA 2L3MA 5E7OB 4EMDA 3NNAA 3CCRS 2V4RA 1T0TV 1TKZB 5J2QA 2D3UA 5BR8F 3HD2A 1X31C 2HPUA 1ZM2A 2OPSB 2JSXA 1FXRA 1SJ1A 1JLGA 1GH8A 2RQKA 2O3DA 3KJVB 1KR4A 3QT8A 3CJTA 5IQQA 4QWAA 1TTHB 1EARA 3WZ0A 1YRXA 5IV4A 3D67A 2CJQA 3PRDA 3PR5B 2JFKA 3W3SA 1IUJA 3J7YI 2M7SA 3WIVA 3ADAC 4CIOA 4DR5J 4KR0B 1H3DA 2HWIA 3M2UA 4B08A 4NXNF 3RB4A 4KRWA 2IRUA 2YWFA 1FFGB 4Q8FA 1RT6B 3L7OA 3OTOJ 2XMUA 2NYIA 4PG8A 3GV5B 3R5AA 5KG7A 2O66A 4PQUB 3QWPA 4PQAA 2PIIA 3MTJA 1YVFA 2BZ2A 2JL9A 1TUWA 2H48B 4PUOB 1GT8A 3M8QB 2UXBF 1GXUA 5CH7B 5D0EA 2W2QP 4DV2F 1MSWD 4U7CA 3JAMY 1KOHA 2VL1A 1W26A 2J9DA 2CVEA 1IM6A 3VAKA 4B9TA 3PHEA 4WIQA 1DHMA 1FVSA 4DJBA 3UO0A 5A2QU 3M7VA 1OIAA 5KFQA 4HHUA 1U8WA 3NGUA 5JVGQ 4CO0A 2MB0B 3T9ZA 1JJCB 3CO0P 1D9FA 5KFJA 2I0XA 1BE4A 3D9BA 1VQ5S 1NKCA 2E66A 5D0GA 1URRA 2N3OA 1K8AT 4U95A 4UOGA 1GXTA 5EWFA 4I4BA 3NMAA 2PEBA 5HATA 3RB6A 5LT5A 3VTIA 2HWHA 3DFEA 3I9V9 3A4TA 4KFBB 4DQPA 2QLJB 4OLOA 3UQSA 2IJNA 2C2DA 2OEKA 1HI8A 4OI6A 2ILZA 2WONA 4I1TA 4NZ7A 2D1CA 4CQ1A 4C9DA 3QGPA 1ROFA 3KK1B 1HNXF 1NU4A 2AYGA 1KHVA 2FJBB 4Y0FA 4EYHB 3HVAA 4I67A 5D6GA 4Q0BA 4YB6A 2V68A 3MMCA 2J0SD 2DBBA 4A8QA 2KZMA 1X5OA 1OMSA 2Y1LB 2IHR1 4F7VA 4P72A 1TUGB 1FRHA 4E0DA 2FQQB 4NMLA 1U6BA 3CF5Q 4RW6A 3RAQA 4Y6IA 2QE5A 3RR7A 3LO3A 5K9FA 1RCOB 4WP8A 4DEZA 1LWEA 3Q8YA 4NA2A 5LMNJ 2W25A 5HMZA 1Y0HA 2WSFC 5K5MA 1ULRA 3N6LA 3UN5A 1KKHA 4EUVA 4R25A 3FVYA 2J8SA 3CCSS 2CWXA 4V19J 4QYZJ 2XMTA 1J5EF 1M5PC 1W7WA 4LF2A 2DNYA 2U2FA 2MSTA 1RLDA 1ACMB 2DPJA 2UVUA 2QN6B 2PN6A 2ZUAA 5CCMA 2YPZA 2DR6A 1R8BA 4DSEA 4UY8T 1S48A 4YDDB 4RUHA 3HMJG 5F9NA 3D6HB 2W4PA 1RACB 1FNMA 4B3SJ 1C0UB 3D6TB 3LANA 2J6UA 5LSLA 1RUSA 2AP6A 1E6YB 2DXEA 4DZ6A 2VDIA 1JLQB 1PIEA 3UFCX 5MLCV 5D78A 3TA2A 3BDPA 5CZVA 3HVTA 3G96A 3ILLA 1S49A 5M2RA 2OJ3A 5GAHU 1RZMA 2QLFB 1N5QA 1MW7A 1UW4A 3KJNB 4LSLB 4GRSA 3P3DA 3G6XA 2MGZA 5B0FA 3JS9A 1TK5A 1WF1A 2R7XA 1Y3JA 4TQSA 1WI8A 4UY85 2Z30B 1D3WA 3W9IA 2IM3A 3PO4A 3N5BA 1CEZA 3JYTA 3QYYA 5KG5A 3PM9A 1RBLA 4LMZA 1G6BA 1FDDA 1WEYA 3K58A 4WK1A 3S7RA 2E7WA 2G2ZA 3KMQA 5F8MA 3PEJA 2GA7A 2ZH5A 4TKTA 2MQPA 1U2CA 2QZ8A 2XI2A 3MD1A 3WIUA 4ZVGA 5I3PA 3H0PA 3MFIA 2AKWB 2UZAA 2AZ1A 4IH6A 2CG8A 3W64A 3GV8B 1Q5VA 2DH7A 3M1VB 2CQ1A 3CJ3A 1N5TA 1Q95G 2HK2A 1YG0A 2CVIA 2YNIA 2VC0A 1MG7A 3FMWA 4IG0B 3G6YA 1QAJA 3I31A 1VQLS 2HLUA 1A7GE 1NK4A 2VZ9A 1LK7A 1P8GA 2HHVA 4DU8A 1WJ9A 1VQPS 1D9AA 4NI2B 3NGDA 1Q8BA 3Q24A 3VZHA 3MM5A 2MY7A 2CADA 2RE1A 3ENVA 4KO0A 3FGVA 1SQGA 3DI6A 2NR0A 5M2UA 1FF2A 3QT7A 2RJZA 2P2CB 2W9AA 4O23A 2BV3A 1RE1B 1FESA 1S1VB 2QA4S 4G3IA 3T1HJ 4ZHRA 4AQYF 3JTNA 3Q2SC 2GMLA 3IRXA 1N36J 1CLFA 1FKOA 3MCSA 4ZPVR 3RW6A 3AJDA 1IBLJ 4Y65A 9RUBA 4CO4A 2CJ9A 2G0CA 1UPPA 1YJRA 1TL7A 3TR5A 1KWMA 3EPIA 1SBRA 1S6QA 4B9MA 2R42A 4F0KA 4AL7A 1WI6A 3IR7B 3MHYA 4ZPAA 4QPTA 1FI4A 3K5PA 4TN2A 2E29A 2AJ1A 4KBIA 4RW9A 3DGPA 3OD2A 4ECWA 4DV6F 1U48A 2NXNA 1EKSA 3TVYA 3HF5A 2RRBA 4KH1B 5A6PA 3TUZC 3M8PB 4HYKA 1KC8T 4PYAA 5DQGA 3Q8UA 2HZAA 4CTAB 1RHKB 1AUDA 2Z0GA 2BACA 4R8UA 3MCOA 1HHSA 2ZH7A 2CNNB 1U49A 2QYCA 4URGA 1FD2A 2LU1A 2BJ9A 1AUSL 1UJ6A 2BE7D 2K7KA 1YKWA 4U96A 2ZDOA 3NEKA 4FPIA 2J0WA 3MM6A 1DQ9A 3CCJS 1YX2A 2DGVA 1YIJS 4OJ3A 3D7SB 3FMBA 4DV7J 4JI7J 3GG1A 1IKXB 2OD6A 2IRYA 2HRUA 3GU0A 4ZPCA 2NXEA 2HHHF 4MH8A 2G0JA 2RT3A 3Q8VA 3FRYA 4LSNA 1O5JA 3M2VB 2FJDB 2BKOA 3RYLA 4ZP9A 1Q81T 2VICA 2MLXA 1MMLA 2MKYA 2I38A 1RU1A 1BXNA 4LF9J 4NEYA 3NG8A 3CJ8A 3HHLA 1ZYQA 4MIAA 2VG6A 2F40A 3GG0A 3PIOQ 5K8PA 3ZTQA 4U7UK 1OSCA 5C42B 1DLOB 3H20A 3ET6B 4CDIA 5HI7A 2X3DA 2ALYB 2FVPA 1SJ4P 1XMQJ 3T19A 1SKSA 2RKIB 4RNHA 2E1CA 4QCLA 2YH0A 1UVLA 4KGKA 3MPVA 2UUBF 2HYIB 3T5JA 3NXZA 4NLVA 2PEHA 1RT1B 1NSKL 3QSIA 4Q44A 3ZNUA 2GAGC 2HS4A 3M05A 2VC1A 3I9ZA 2HIYA 2BA9A 3M8YA 3T6BA 2NPIA 4DR7J 2DH8A 4FF3A 4DV0F 3D28A 3CCES 1VQ6S 1W2BR 2RILA 2FZCB 4NRUA 2CNKB 1NXIA 3DRSA 1YBUA 4OJHA 3KLFA 2HZCA 1FRLA 4BHQA 3OLAA 4YOEA 4WFNQ 1T03B 2HKEA 3CJSA 4TU7A 5KFAA 3BQ0A 4WE1A 2CJKA 1YZ7A 1R31A 1MLAA 3JTOA 3QRRA 1TP7A 2EEYA 2YX1A 1WNEA 3DOLB 4LF6F 1FE0A 2LQ9A 4ECZA 1VBXA 2A0FB 4CO1A 1N34J 5IWAJ 2PSZA 1PSDA 4DLEA 2B56A 1YTYA 3W7BA 4DPOA 4ZCMA 4ECTA 1V5IB 1F9EB 4W4MA 3AHPA 4OI4A 5A0YA 4DV4J 3R6LB 1JK9B 2BJ3A 3W5ZA 1S1WA 4DSLA 2XWXA 1DQ8A 4AXIA 6AT1B 2XGQA 2DIVA 3UNGC 1BHNA 2HFNA 5DLGA 4M5KA 4JV2A 2H3EB 4MIBA 4PR6A 4TY8B 3UR0A 5E0OA 2B9WA 4K5SA 1LEOA 4J9RA 5ETOA 1IKYB 3D66A 3I5AA 3MMBA 3UD3P 4NLGA 5U47A 4J9UE 4J9PA 5DO2A 1HNIB 4K7QA 2DNKA 2VBWA 2XYHB 1YRUA 2ZC4A 5HMYA 1RTIB 4P75A 3Q89A 6FD1A 4U67Q 3MR6A 2ABYA 2B9XA 1JXLA 5HBMB 2KG1A 4FYYB 3OPKA 2C3UA 2DNNA 3OFEA 1RHRB 4JI0F 1ZH5A 1RADB 3CXCR 1BLUA 3TZYA 3PJ9A 1ZAXA 3SMZA 3EYZA 2A18A 2OP5A 2CFXA 2D69A 2KRRA 2RIJA 2QTWA 3I5CA 2Q6BA 5AE2A 1KD1T 4O3NA 3M8SA 3VHQA 3MEEB 1W2IA 3TJ9A 1JIHA 2QLWA 2ZBQA 3DYAB 3H25A 3FEYB 4DR2F 5DGAA 1S76D 3H2LA 1KN6A 5J2NA 3LP0B 2AD9A 1FFSB 4F8RA 3M8RA 2UP1A 1UVIA 2ADBA 2BANB 1AZSA 4WFXA 1K1QA 5KAKA 4KC5A 4Q2LA 3EXCX 2K3KA 3GYXB 5A8RB 2YKQA 2KKHA 4OX9J 5L9NA 1SIZA 1R43A 4KAIA 4QW9A 2WB4A 3LW5C 4I2QA 2GAHC 2EFOA 2YWEA 4N5SA 1ZPVA 1HLWA 4PKDB 4FXVA 2ZJPQ 5DG7A 1WOOA 5FIIA 3QRQA 3HT0A 1NUEA 2UVRA 3DM2A 1T9UA 1U1QA 5HO4A 1MU2B 4ZVQB 1RTDB 3OR1B 1RCXB 5GAGU 3A8EA 3E01A 2VPZB 3BN7A 5DG9A 2RDJA 1C4CA 4K4WA 2OMOA 1CS4A 2PC6A 5H9FJ 3H90A 2GS8A 2Z56B 2LA4A 3V6HA 1HR0J 1C1CB 2DGTA 1EIYB 1HQ2A 3I4PA 2GCFA 1HBNA 3JSRA 1JLFA 3VGTA 2UU9J 2XLKA 2E5HA 3GTYX 5E5NA 3ZZYA 2J9EA 4QIGA 1OY9A 1XJWB 4B3TJ 2IC3B 2MQLA 1TKZA 4G1PA 2UXDF 5KFGA 3RBXA 2LFVA 2OPSA 1W25A 3VAIA 2KM8C 1FRJA 1F0XA 2XSJB 4J91A 5HVGA 3I55S 2IMWP 2SXLA 3KJVA 3Q8QB 2C2MB 1I3OB 2UUCJ 3SQGB 3EGZA 4NWBA 3T1YJ 1NBEB 2UXCJ 1G4CA 1FVQA 4KGMA 3CMQA 1LWCB 2AJ2A 4FPRA 3JQJA 3TZWA 4P7TA 4DOZA 4U9RA 3PKYA 4DR1J 2MJNA 1XIQA 2NS1B 1YJUA 1RT6A 4MKAA 1LWFB 4EBEA 4F4ZA 4ED4A 1JXVA 2AU0A 2MTLA 5IC4B 4PQUA 2Q1LA 3I0SB 5MAOA 2V2KA 2P9CA 4PUOA 3M8QA 5IM0B 5IOLA 1SL0A 3SXLA 1IR0A 3KG0A 2EG1A 5IXUA 3G82B 4KV8B 3FKBA 1U1KA 4NLDA 2RU9A 3U1NA 4RL1A 2YWKA 2Y1JA 3V6JA 5A2QY 1YDLA 4JBCA 2B0GA 4H4OA 1N5SA 1CC7A 4MKBA 1Y5LB 2MKSA 1X8DA 1QSSA 1PC5A 3G4SS 2V50A 3FDSA 2R8GA 2ZH3A 2KFZA 3TARA 4KFBA 1VBYA 2Y9HA 1B64A 4F4YA 4G65A 1S99A 1T05B 1NSQA 4M5DB 2UUWA 2Z2LA 3CT9A 2L9WA 4CLPA 2VODA 1IR1A 4YQWA 2PI4A 2H5EA 3VAMA 1AA1B 1VOMA 2FZGB 4HI2A 3KHHA 3KK1A 1UAWA 3B78A 2XY5A 4JI1F 1DJ0A 1LOUA 4P2XA 1JLAB 5CYMB 2WOMB 5A8KB 2KHDA 4I6WA 9ATCB 3V4MA 4RBUA 4LFCJ 1PCAA 4JI2J 2HFZA 2ZBRA 5KFKA 2MHEA 1SPBP 3TZZA 1NB7A 2KVQE 3NS6A 5JVHQ 1TK8A 5BYSA 3EZUA 3IWXA 2WSEC 5J2PB 4MYTA 1RT2B 1JLBB 2N7CA 2QFIA 2D9PA 2Y8WA 1YK9A 2KXFA 4WYLA 2ZWPA 3R7BB 4NLOA 3DKDA 1Z4UA 4A8OA 3DHWC 2D3OR 3V6DB 3GJSB 2LEAA 1SJFA 4URSA 2DKOB 4PXDA 4Y2CA 2RQMA 2EFVA 1U0HB 1YQHA 4A8MP 1C0UA 3SIPB 3NS5A 2UUTA 4CO5A 5CXTA 2AYBA 2L41A 1E6YA 4USUA 2MQNA 2CQ4A 4HACB 2I9SA 1JLQA 3PW0A 3GJTB 3G6ES 1U47A 2O67A 4HEA9 1I51B 4MK9A 3FUYA 3NGTA 4OYOA 4LSLA 1DAXA 1EQ0A 2ZHBA 4K4TA 4RLEA 1N33J 5L46A 3RRKA 1Q0NA 3ETMA 3DRRB 4OHWA 3CVKA 1FKAF 1NDLA 3H7HB 4GVLA 1U1PA 3K2YA 2W7PA 2IY5B 3ZZZA 4DR3J 1APSA 4AT1B 2GGPB 2KFNA 2HQGA 2JZ5A 3IP0A 5J1PA 5DQIA 2XY6A 4ILLA 1VFJA 4RNMA 1G3OA 3GIJA 2FVRA 3M8WA 3WDOA 3I82A 2YWWA 3M1VA 1NK0A 1U8SA 3IRWP 3H5XA 2CNLB 4QWDA 3FFIA 1MN7A 2XMAA 4ALZA 3FBCA 1B4SA 2WW4A 4HTJA 4CNYA 4DDFA 4IG0A 2W7AA 3BGFA 5FLXU 2YVSA 3ENWA 3FZBA 1KLNA 2YXLA 3I32A 4UQGA 4NI2A 3R97A 4OYMA 4H4KC 1LXNA 3PX6A 2HQIA 5B0EA 3UCZP 4KY3A 3JXOA 1NEEA 3H4DA 4O3PA 1EHWA 4FXDA 1ZOTA 3TQ1A 4FBUA 1S1VA 1RWUA 5CYJA 2JWNA 4CLKA 1JWWA 5KG2A 1FDAA 1Q79A 4O3OA 4N56A 2CPJA 2APOA 2EW9A 3TAQA 1RWVB 1NZ8A 2DGXA 4ID5B 2XZWA 2XCPA 5F8IA 3CGIA 4DCJB 4USHA 1REVB 3HM9A 3GIKA 2POKA 4L3NA 4DUZF 3U1LA 4OX7A 3EDRB 3I0RB 3QIDA 4B3RJ 2GIFA 1FTCA 3MUTP 3NRBA 1AFJA 3DDNA 2OPQB 2ZOMA 2LEBA 1KP6A 1N54B 3NS7B 4WFZA 2MJUA 4ZLNA 4CTAA 1FJGJ 4CH0S 2ACMA 3LP2B 4Q43A 1T02A 2DB1A 5FDLB 2DD8S 2HNDB 1S4EA 1B7FA 1VDHA 4USTA 3NGRA 4M5IA 3EZ5A 3NMRA 2V2QA 2HNZB 2E7VA 4CYUB 1WC3A 3C2PA 5DGBA 4WZMA 5KT4A 1H38A 4ELVA 2H51B 3R3TA 4FS1A 2WVEA 3PYFA 4XPCA 1IKXA 4X64F 4OFZA 2AEMA 2QIFA 5AXMA 4IQXA 3VR1A 3C16A 5DQHA 2VG7B 4O3SA 1R8PA 2I2YA 1VQKS 1IKVB 1C2PA 3M2VA 1VBZA 2HQ3A 3FCVA 4GKJJ 2GQ2A 2VV5A 2HVEA 1FD8A 4DR5F 3DLGB 3CE8A 5E41A 3VF0B 3MUMP 5C2CA 1SH0A 2V67A 4K8RA 2CQIA 2GZOA 3KJFB 5C42A 1ZS6A 4HL9A 2XS5A 1DLOA 3ET6A 2OLWA 1H7WA 1B0PA 5B7WA 4M1KA 4DN0A 1F60B 5F8GA 4LFBJ 2W4CA 2AQ4A 2RKIA 4K4SA 2G0IA 1SC3B 2DITA 5DDQC 2BX6A 2LEPA 4CLLA 1X9MA 1RT1A 2UVWA 2CPHA 4OJGA 1NRKA 2HWTA 4CP5A 3MMJA 2BRKA 4B17A 3CPWR 2R8JA 2EFPA 2M3DA 4RR5A 1RXOB 2E5LF 1KVKA 2BJ8A 3CCWA 1BQXA 3RUBL 3L3CA 3L7PA 4GO5X 3CULA 4KHMA 4C48A 2RUGA 3N79A 4QR2A 1RWWB 1PYSB 2XGPA 2CPEA 4FYDA 1Q53A 3N5FA 3QGHA 1T03A 1S0OA 2HURA 3BGUA 4EYIB 1NAQA 3ZXWA 4U8VA 1LWEB 3Q86A 4M8LA 1S79A 1Q5YA 4WIIA 4ZLPA 2MMYA 3DOLA 2ZDPA 1XBWA 5HQMA 4OV6A 2YNFB 1KOOA 3BPSP 3E2EA 4HVZA 2DY1A 4DSFA 1NH8A 1M5HA 2CQHA 2B3TB 5DS7A 4P74A 3NNCA 1LKZA 1VMBA 3OUYB 4DV1F 2HZVA 2XMKA 2KYZA 4MFBB 3K89A 2Y3YA 2AX0A 3ILJA 1BWVA 4ED8A 4YB5A 2KN4A 2PA3A 4DUYF 5LMUJ 3TA1A 2XG8A 4P2MA 4OQJA 4KQZA 4LF7F 3JSBA 4TY8A 2MKIA 2Y8YA 5T7LB 2RAQA 2HVIA 2QSWA 3UI3A 3H4BA 3MECB 1IKYA 3TUIC 2BEFA 1EJ7L 4C11B 2GHVC 2NXJA 2ASJA 3N4WA 3C6TB 1RQ0A 2W8KA 1HNIA 2MGZB 4C8MA 4KHPF 1HNWJ 1RTIA 2GC8A 1I94F 1XC9A 2GHWA 3ZZ0A 1CVJA 3TUPA 2JLEA 4KE5A 2W24A 5HBMA 1DBDA 4HT5A 3QSYB 1H74A 3OV7A 4YMEA 4XIUA 1QVGR 2D74B 1SKWA 3KG1A 3OL7A 4WWSA 1S5ZA 4TYBA 2A6OA 4DUTA 4WU3A 1IXKA 4LQ9A 2KM8B 1NK7A 4QR1A 2XY7A 4F26A 3MR7A 3RJMB 3SSQA 2H5IB 2HFUA 2M9KA 1BUXA 1SC4B 3SBMA 1RHUB 1K73T 4C3MA 5CHCB 3TJ8A 1J2VA 3HSJA 4DQSA 2R8KA 1VRUB 3UD4P 2N3LA 3MEEA 4LR8A 4OIXA 4EI2A 1VHIA 3DYAA 1SH2A 2CDQA 1JNRB 3MURP 3HKZD 4Q2MA 3FCHA 3MEDB 2XHWA 4P10A 1RYRA 1Z1ZA 3LP0A 2V5HG 3LQVA 3EUNA 2Y1IA 4MJKA 1N32J 4ZP7A 2Z58B 3D1OA 4C0HA 3IAM9 4EK2A 4GKKJ 2BANA 2MQMA 2EI5A 2PD1A 3DRPB 2O01C 3C66A 5A8RA 1CQNA 3B82A 2PMHA 2H54B 3M9OB 5C7PA 3MM7B 1KNZA 1RAHB 3PZPA 5DJBA 5L1JA 2W8LA 1X9WA 2BUNA 3WQPA 2QSFA 3F0NA 3KDOA 3R7NB 5BR8J 1FTRA 1SKUB 2HGNA 3PR4A 2CG4A 2ASYA 4QU6A 8AT1B 2CQDA 1SC6A 3RZAA 4NZ0A 3M6WA 3V6KA 4FF2A 1HHQA 2BM1A 1X4BA 1S6UA 1NM2A 4K5RA 1URNA 3GFXA 3X3UA 3W2WB 1MU2A 3QZ8A 3A3OB 1RTDA 3OR1A 3CCQS 4ED3A 1TV6B 4LVNP 1T7PA 1CJTB 2PT0A 1UFLA 4C3KA 1M5OC 3G8QA 3OR2B 3OHAA 3M6VA 1C1CA 1N36F 3KJQB 2IA0A 2E5GA 2BYCA 3G6VA 1IBLF 4C8KA 1PBUA 4J9NA 2ZITA 3NGKA 1NHVA 5LXRA 3AXMA 1YRTA 1XWLA 2V0NA 4ETZA 2JVRA 2KDOA 1WEXA 4I2PB 3TUJC 4QR0A 4DSKA 3WX4A 2UXBJ 1TAUA 2IC3A 3M30B 4LSZB 4DV2J 3P6YC 4BCAA 4QU7A 4YY3F 2EXUA 1M5SA 4UW2A 2XEXA 2XSJA 1N48A 3KDNA 4K4YA 2VFRA 2VA2A 3FC9A 3K5MA 5J2MB 1U25A 1O0PA 2WBMA 3QLHB 5L39A 5D77A 2WTFA 1LWCA 3ONQA 1NK9A 3M2RB 3J7YU 1DURA 4M5HA 4Y28C 3PRBA 2ZH6A 4USIA 2W01A 1LWFA 4OI1A 3MM8B 2MZQA 2X1BA 3UD5A 3L4BC 5E33A 3I4HX 1KQFB 3I0SA 3AY0A 2NZ4A 4N76A 3HJVA 5IM0A 3D0HE 2X1FA 2C2RA 3NOCA 3ZZPA 2R3VA 2DYAA 4NLYA 1SL1A 3G82A 1HNXJ 5K8OA 4KV8A 1WC0A 2BOAA 2N4CA 1FKPB 4NCBA 2MHNA 1VBKA 5E3AA 2XZDB 2KTQA 4LF8F 2OTJS 3D6MB 3Q0AA 1R7IA 3D5MA 3CJ4A 1DZ5A 1JNZB 1RWXB 3MFHA 4PWUA 3HP6A 3V81B 4ECQA 2MQQA 2MSSA 4LF5F 3ZZTA 1EP4B 2N82B 2F7VA 1ZBTA 2FLPA 1UMJA 3ZO7A 4UZBA 2NCKL 2XMVA 3GR0A 2FJWA 1S6OA 5T41A 1QAYA 4DR4F 2WZ1A 3NAIA 1T05A 4YN3B 4M5DA 1QAIA 2B9EA 2BE2B 1T8EA 4A8WA 2VOPA 4C97A 4NLRA 1NJXA 4ICLB 1J5EJ 4PXEA 4JP8A 3R27A 3IGVA 3QJLA 2PO4A 1FWPA 3MCMA 1NSAA 4WE1B 1JLAA 4G1QB 5CYMA 2B6AB 4N7TA 2WOMA 5A8KA 2V4JB 1FWKA 1Y9OA 2CPXA 1R6YA 1FO1A 2AJFE 4LJMA 2ATLA 3IG1B 4NCAA 2PFFB 4HR2A 2CPIA 1N0VC 3I96A 7FDRA 2A6MA 3RBZA 4ZITA 2BJEA 4O44B 3RRHA 3FJ2A 2HVHA 5KFZA 3JSMB 2AIRB 1H2VZ 3FEZA 5J2PA 1RT2A 2FGCA 1JLBA 1T94A 3F56A 2C3OA 5D4OA 1MNEA 2MKHA 4LT6A 4FXWA 2R9LA 1V3RA 3MI7X 4PEOA 5KOXA 1FNXH 2V8VA 4RW7B 4UUWA 3UE2A 4EBCA 2FTRA 3TOQA 3BO4A 1Y10A 4CZCA 3V6DA 1R8AA 2ZBPA 2CJXB 1M5KC 1BY9A 3WHIA 5K8NA 2GJIA 3TEHB 2GO8A 1U0HA 3KLIB 3ZTRA 2HGLA 4ANEA 2CQGA 2BQ3A 3QFWA 5KG6A 3THTA 4HT7A 3K5OA 2J9DE 5DLFA 4HACA 5IZHA 1FJEB 4CNZA 2KJWA 1K47A 5DETA 2OEMA 2ZBIA 4F02A 5D15A 3G87A 1HBMB 3L9ZA 2VUGA 1KS2A 2DCUB 2F4VF 2HRYA 4NA3A 1FXLA 2XNRA 2G1HA 2F4FA 3GLJA 1XNRF 1KTVA 2HBQB 4GO7X 3DRRA 2DISA 2ZNYA 1F5AA 1QAXA 2FVQA 3VVUA 4E98A 4EZ9A 1KLMB 3LOUA 5GMDA 1EQMA 4R5PB 2E9ZA 3J7ZT 2FHMA 3PCOB 2GGPA 1CJKB 4F2SA 3QBCA 4A4JA 4DPWA 2OSRA 4AQYJ 3BREA 1UWBB 2IMOA 2JRSA 4DBQA 3MAAB 1RWMB 1L3VA 1M5VC 1FHTA 4Y3CA 3GMGA 1RA7A 5KFEA 1SXLA 4OYWA 1F5BA 1WTFA 3KHGA 4J9MA 1IR2A 3HT3A 2DXFA 2HAFA 1G7CB 4DR6J 1NPKA 5GADU 3OW2R 3DLHA 4USKA 1EETB 1V9OA 2FYXA 1ZAWA 3W63A 2QMWA 3EGVA 4ES1A 2ZKUA 3J7Z5 4DV6J 5IT4A 1IBMF 3W9HA 4NL5A 5FLXY 3IN5A 3OLBA 3D0IE 4WBFA 4KIAA 4AL6A 4NE9C 1S9EB 5J1NA 4QOTA 4C8YA 4UOHA 5H9EJ 4YR3A 2HFVA 3THPA 2FHJD 5KG1A 3KLGB 5KFFA 2KXNB 2W4DA 3QGIA 5HSPA 2EK6A 1FCAA 2ZEJA 4X62F 2BXJA 1SVDA 4PXBA 4QYZK 3TQEA 4UQTA 3C14B 4CH7A 2J7KA 4ID5A 1LQ9A 1TUVA 2AJ4A 3IM8A 3R1HA 2HAIA 5EN1A 2P5VA 4IFYB 1RGVA 1GMUA 1REVA 4Y2IA 3W9JA 1RWOB 4BWMA 4ANDA 2OPPB 3GYNA 3EICA 3TJAA 1QJHA 2GVDB 2F9JA 4DQRA 1C0TB 3I0RA 2FC8A 2HHHJ 2ZD1B 4OX6A 3PX4A 4OZ0A 2DR5A 2QGFB 1N5VA 2OPQA 1OY8A 1HQUB 2IFXA 4DX7A 1VGYA 4X4PA 3M4XA 5GAEU 3Q8SB 2DRDA 1FA0A 3WBZA 5I3UB 2V9WA 3LP2A 2GV1A 5FDLA 5L9XA 2HNDA 3DN9A 3QZ7A 2WHOA 1WC4A 2QG9B 2YY3A 1VQ7S 1U2FA 3T9NA 2HNZA 4CYUA 1WKJA 2XM3A 1S72S 4EGLA 5JMNA 5F9LA 1HNZF 3BGRB 3T41A 5GMEA 4D3GA 1CJVB 3KYLA 2VFSA 3CDWA 1WUUA 4P71A 4ZN3A 3DGVA 1QE1B 1S1UB 2LXUA 3KG4A 4WFAQ 3HXMA 3G8TA 2FVSA 4QPXA 2UUBJ 3CSKA 1R6VA 2VG7A 3GJRB 3QGGA 2ZZNA 1IKVA 2E1RA 1UVNA 4OMFG 3QJPA 2GJFA 2H1YA 2F8MA 2HGMA 4CLFA 1WHVA 3LH2S 2U1AA 3DLGA 4DV0J 2RHSB 3P5BP 1M1KT 4DR1F 3ZC4A 5I4MA 2L08A 3BSNA 1GMWD 4KB7A 3C6UB 4OL8A 3L95X 3JQKA 3HSGA 1RU2A 5KFDA 4H4OB 1BWEA 1DTTB 3VZIA 4OV1A 4WZQA 1H98A 1T9XA 3GFHA 4P73A 4D3HA 2DVIA 3EE3A 1TR0A 3PW2A 4J9QA 1S10A 1IM4A 3TX0A 5E2QA 2HBRB 1YJTA 4IRCA 4LF6J 1FJ7A 3CC4S 3HVRA 2FHKA 1TKDA 3HPOA 2KXHA 2QMXA 2C22A 3IAS9 2CQ2A 1GFWB 4LF4F 3VQSA 2Z2MA 1B7YB 2LDIA 5EWEA 4DI6A 4Y2KA 1NO8A 2YWGA 2R7SA 1UEKA 2BVZA 3KLHB 2IDLA 2L9DA 2C3YA 3AOBA 2EFQA 4B02A 3HLUA 3A8KA 4RWWA 2IYGA 3PFOA 1FX4A 3A13A 2R7QA 4J5OA 1WDTA 2MZSA 2F5GA 2NSCA 4TQRA 1XNQJ 1N88A 1FRXA 2BBEA 2R2SA 5LM7E 2XLIA 2Z57B 3QWUA 4ZJOA 1F3VA 2JVOA 1IVZA 3MOZA 3BPDA 2LKZA 1QM9A 1CC8A 2YNGB 2ROPA 3RBEA 2I6WA 4H4MB 2J0QD 4EWTA 4P6QA 2YNFA 4R0JA 3AD8C 3P45B 3H8YA 1EZZB 4PPDA 1UPMB 4L76A 3OTDA 1VHFA 3UDEA 4ITSA 1MWYA 2QL7B 4LR7A 1PG5B 2D41A 1X4HA 2AJQA 3AOCA 4DL6A 2LXFA 4LIWA 3OXFA 4YR2A 2HMIB 1S77D 1TL3B 3MOJB 3HHEA 3OUYA 4MFBA 2Z4PA 2VU5A 3JB9k 4WP3A 4K4VA 5KFVA 5HLFB 1VLOA 4LBIA 4WK3A 2YPYA 2XMJA 4I68A 3IR5B 3PTWA 2M0GB 3NCQA 4QYRA 3VAJA 1B99A 5T7LA 2JLGA 2GW8A 1Y11A 4ED1A 1WG4A 3MECA 4CLUA 1A0OB 4WF9Q 2WVDA 4C11A 5CD4H 1R0AB 5CA5A 3C6TA 2ZH4A 4UF4A 2PMZD 3CC7S 4OZLA 2P9GA 4ZPDA 3MAHA 1HQEB 4EO8A 4ZJQA 3KNGA 2VDHA 2NLWA 1RA6A 2AV5A 1Q8LA 1YBTA 1U2RA 3HHDA 4X4VA 4ANCA 4C8ZA 2VQEJ 5K8MA 3PV8A 2M5YA 2BKPA 3ZTSA 3CJKB 3UW1A 5C2GA 3CCMS 2F65A 5HP1B 3TYTA 1Q4RA 2EG2A 4BC9A 1N33F 2BMBA 5C25B 3BO3A 1JQGA 2FY8A 3A8IA 1HARA 2VA3A 1VRUA 4ILRA 2EC0A 1D8ZA 1SV5B 1WC6A 3FFIB 5B0BA 2DNGA 3SSRA 1F9FA 5GADI 2PMWA 2MLZA 3MEDA 2V8GA 2HW3A 3BKFA 4DX6A 2KL8A 2YKNB 1AXQA 5A76A 3OTEA 4DL5A 2YTCA 3T6JA 3SZ2A 2ZM6J 1KFSA 4OI2A 3LGNA 3C15A 2Q79A 2C42A 2FIUA 2EBGA 2DGOA 4O0IA 2V2ZA 3DRPA 1ZETA 1TKXB 3KTQA 1HPZB 2XQCA 3MGJA 2HHQA 3PX0A 2DCLA 2FC9A 3H5YA 3DDKA 4B3MF 3MM7A 1VQ8S 3VVTA 1I5OB 1Y7PA 1C1BB 1T95A 1WD6A 4PYDA 4DSIA 4F4KA 2UXDJ 2RMLA 5DDOC 2J7UA 2DO0A 4QIFA 1IBKF 3LF0A 4NPOA 2RS8A 2E1AA 1GK8A 2YWHA 4WYWA 1RWNB 3VGUA 1L3SA 1RLCL 2M8DB 5EX3A 3W2WA 3MR2A 4LRFA 3W8GA 2HNYB 4TNOA 2NUHA 1TV6A 4JB8B 1T11A 3M6XA 4GVBB 1CJTA 2CRLA 3OR2A 3P5TL 1Y5NB 3HZGA 4CLTA 5GAEI 2VQFJ 2IBOA 3SSSA 2XNQA 5KFBA 2DXDA 1WC1A 1AB8A 1XR6A 4F36A 1PKUA 1HW9A 4IO1A 5ETSA 5ETVA 3D4JA 3F41A 4IUFA 1LWXA 4I2PA 4PWWA 1RBOB 1GTHA 3M30A 2C2NA 3K0JA 2AYEA 2QO3A 3BV8A 2F8HA 1PJ7A 3GIIA 2MKJA 3ISNC 4B3RF 1F9HA 2DO4A 2G1DA 3TNVA 4DL4A 1SCJB 5HMWA 3PO5A 2XULA 5J2MA 3CD7A 3RAMA 3MWBA 3QLHA 4WXOA 2CYYA 3DXSX 3NWRA 4ZVPB 3M2RA 4FN5A 1S9GB 3C16B 5L38A 2DTJA 1REGX 3J7AN 2JEGA 1N8RT 4DN9A 1SL2A 2NSBA 3PYEA 4KJIA 3MM8A 1X4EA 1JKHB 2WW8A 1UVJA 1H0HB 2A2CA 3KLEB 1D8YA 2MKCA 4M5GA 3LGHA 3DOKB 4PG4A 2WB1D 1DARA 4I6YA 3MMAB 4DFJA 4JUZA 4F3MA 4NLXA 4K4ZA 1EAYC 2RS2A 1OQ3A 2VB6A 2DT9A 1L3TA 3AH6A 2J6SA 4NZ6A 4A46A 3KK3B 1FKPA 4ZP6A 4JI1J 2RVJA 3BF4A 4QIVA 2H4YB 5KFRA 4C8NA 4X66F 4X4QA 1Y3KA 1Q78A 3OVBA 3F73A 4FYVB 3AOAA 4UT4A 3V81A 1C4AA 1R8CA 2CZVC 3MCNA 1EP4A 7AT1B 3J81j 2HHPA 2NXCA 1HWLA 1HL6A 4Y00A 2Z8QA 2G9OA 2MDAA 4JV5F 3PXGa 4WKYA 2ZWOA 2JHEA 3AB4B 2BE2A 3OSNA 2ROEA 1E6VB 2W9BB 3BGOP 2RNEA 2I5JB 3TEGA 4ICLA 4K50A 4DU7A 1NNDA 4USJC 3US5A 2XI3A 4C8OA 5H9FK 4Q45A 2XMWA 1VQOS 4G1QA 2B6AA 2CIMA 3D6FB 5F8JA 2V4JA 2BW7A 4FKXA 1NPRA 1VLYA 3VV2B 3I6PA 3IG1A 4LRBA 2ZOFA 4O44A 4QIEA 1PAEX 1B3TA 2H4WB 3JSMA 3S01A 4DF4A 5B0AA 4PWDB 1KQKA 3SCJE 1VYAA 4ZIWA 2IIHA 1S0VA 5CCLA 4B9NA 4RW7A 2LYVA 1YJ7A 2C1EB 2FJVA 4IDKB 2R7RA 2OO4A 1LW0B 2CPFA 3MM9B 4JI8F 2CNOB 2HVDA 4NXMF 2QL9B 2OSQA 4YHHF 3V5RA 3DLKB 3UDVA 1D1UA 1R8HA 4LBHA 2XTJP 4RUBA 3KLIA 5HROB 4X2BA 4BWJA 3MPDA 4E8UA 5ETPA 5IS2A 4KTQA 1P1LA 6FDRA 3DXBA 1QDUB 1S12A 2HHTA 3NKYA 4M94A 5D3GB 4CM2A 3PFEA 3IBFB 2OKQA 5HMXA 2OAUA 2E44A 4ES3A 4GMKA 3DHXA 1Q7LB 1UVKA 1HBMA 4JI4F 4KGXB 4WKRA 3IO1A 1XMBA 4FBTA 1HNVB 3MEKA 3CIZA 5AJ3F 1UZHA 2J8AA 4YEAA 4NA1A 4KPCA 1KLMA 4F3OA 1CJUB 2RQ4A 2V8PA 3DLEB 4R5PA 2BJDA 1PAUB 3E51A 4PG6A 1CJKA 2EVZA 2DY9A 2AX1A 1SQFA 1L3KA 3K8VA 3OVSA 4YFUA 1B0TA 1UJ5A 4IO9Q 2R8IA 3SCLE 2MXYA 1UWBA 1OPIA 2LP4A 2FUG9 3MAAA 1FX2A 2EK1A 1BMQB 2JEIA 2ERRA 2DHAA 4KSEB 2P8IA 2N7YA 3DLLQ 2C2OB 2MZJA 1FK9B 3MPWA 2BOPA 1F2GA 2YH1A 4NYPA 1HA1A 2M70A 2X1AA 5DG8A 1VS3A 4NLSA 5J1EB 5FJ4A 1EETA 1P1TA 3U02A 2FHJA 4DUZJ 4YP3A 1OWXA 2OPRB 1YGYA 2AW0A 3IXQA 4LIRA 3ZTPA 5EDWA 2V2VA 3CCTA 4FYXB 1HYSB 2R2RA 2D7SA 4P7VA 2B8PA 1KBRA 4FNHA 4DV5F 1S9EA 3GWCA 1DFDA 1GXLA 5C24B 2QC3A 3N28A 1AFIA 1UA1A 4IH7A 3KLGA 3HI9A 3TX8A 2XHCA 3KNAA 4NLTA 4N8OA 1HBUB 3GSDA 2V63A 4QQBA 1OSDA 5KT6A 5IV3A 1AW0A 3AD9C 3PKMA 4DPYA 1AYEA 3C14A 3CCUS 3ZZRA 4F0HA 2V8HA 3TI0A 2NREA 4IFYA 4DV3F 3QPIA 4J9SA 4CCHA 2ZZTA 4ZPBA 1IKWB 1OYDA 2D3ZA 3O1LA 4WPAA 2FLNA 3NBPB 2OPPA 2RU3A 1VRTB 2HBYB 1IJFB 2GVDA 4PABA 1JLEB 4LUBA 2LU2A 1C0TA 2BJ1A 4X64J 4DX5A 1WC5A 2PFDA 4CLSA 3FBEA 2ZD1A 4JOUA 1SUQB 1OY6A 1RSCA 3CJ5A 1HQUA 4EZ6A 4IRDA 4Z7YA 5I3QA 5EUHA 5SZTA 4IH5A 1TFWA 1PO6A 4Y34A 5I3UA 1N6QB 1FXDA 2XYPB 5KFOA 2C2ZB 2E5IA 2IVMA 4YB1P 1N5YB 2NZCA 4O3RA 3TA0A 1CULB 2EBEA 5HQ8A 2VFUA 4ZA1A 1NHKL 2NQPA 4TYAA 1PILA 1FRIA 3PJXA 2W7OA 1X4FA 3CJRA 1NK8A 2VFVA 2FPHX 3BGRA 1CJVA 2Q66A 1QE1A 1S1UA 3ELHA 3AJ1A 4IKAA 1X7VA 4H54A 1QSLA 4M5MA 4CO2A 1RISA 3CMAS 3OL6A 3U27A 4OYXA 1SB6A 2OH2A 1TL1B 1GMWA 2GMJA 4XPEA 1T3OA 2X1GA 3GCXP 4UTGA 3K5NA 2VFTA 3FSXA 4LRCA 5D0RA 2Y0BB 2E5LJ 1SJ3P 2X7IA 1WKKA 2K8GA 2KT2A 4RBTA 3ZFVA 2DHGA 4DXLA 5GMKa 1ZAVA 5CQGA 3C6UA 5CYQB 1PJ6A 1DTTA 5LXYA 3CTRA 3QMQA 1CPZA 2CUYA 3HFZB 3POTB 4ZPWR 1A9NB 1I6JA 3OSPA 2QRRA 5CD4A 5H1SV 2B8QA 2MZ1A 5HVFA 5AXNA 4QWBA 1LW2B 3CDEA 3GFZA 3R5JB 4I56A 2NUUG 1T3NA 3R5GA 1SKRA 2PI5A 1RK8A 3BKUA 4DV1J 4FS2A 5F3ZA 1HWJA 3KLHA 1Q8KA 2VF3A 3PYDA 2LECA 5L8RC 4MYUA 4RW8B 3ZTOA 4DUYJ 2DGWA 4OJ1A 1KSPA 4MKYA 4LF7J 2CQCA 1ZPWX 1B0VA 2B5JB 1X4AA 4W90B 2CJAA 4IR1A 2GNKA 3NP5A 1RKIA 3DC2A 2L9NA 1GMVA 3H2UB 4Z7CA 3M32B 3BJYA 3L7UA 4TU9A 3KUGA 3MPUB 3W2VB 2YNGA 4ZJLA 1UZDA 3CJ0A 4L72B 2Q43A 2CQ3A 3O2IA 1NK6A 3KHRA 4H4MA 2KT3A 3KXDA 3ULHA 1U4BA 3FSYA 1UTAA 4ZVOB 4KHPJ 3GV7B 4LR9A 1QUPA 4ETXA 3VWSA 1I94J 4J7CA 4DL0C 3CEDA 2WBRA 1TL4A 2HMIA 1TL3A 1NKBA 1RT7B 3LALA 3PEHA 2ALZA 3HO1A 1KFDA 2HEKA 5HLFA 3P49B 1RJJA 1Z2LA 3N6NA 3BSOA 2IPOB 4ZKAA 4ECSA 4O4RA 3GIMA 2VIHA 2JDJA 3BS9A 2VH7A 2E1PA 1RAAB 4EEYA 5LOQA 2NYHA 1RT5B 3ENAA 3ZZUA 5KFTA 2GVZB 4ECXA 4Q7AA 4LFAJ 3IS9B 1YJWS 4K4XA 1MROB 4JI3F 3A12A 3GP9A 1R0AA 4R0EA 4JI5F 4XTTA 3PG9A 3H42A 3F44A 5B0CA 3BM7A 1HQEA 3TAMB 3W65A 4TLRA 4X4TA 4NASA 1TMMA 3WC0A 2MQ8A 3N6MA 4F0MA 2RDIA 1QTNB 1S7IA 3R2CJ 2V6AA 4DFMA 2WCXA 1KQGB 3VGVA 1HBOB 2RHQB 2XZTB 3PNIA 5KG4A 2ZH2A 3CJKA 4BS2A 4ZCIA 3G86A 4MAKA 5ETMA 5HP1A 4A8XA 1VRQC 1XMOF 1S6PB 5C25A 4QWCA 1M0SA 4K4UA 3Q2TC 4K0KJ 1SV5A 5ITHA 1UL3A 3TRGA 1DY3A 2QA2A 3M6UA 2IA6A 1KDNA 1QTMA 3PACA 3ISND 2V9KA 1RI7A 4BDPA 1IQTA 1NZAA 2CPZA 2DIUA 3QRPA 1HW8A 3CCZA 1NMEB 2YX4A 3I5BA 2YKNA 1TVRB 4BC7A 1GX5A 4N47A 3FSIA 3CUNA 2DRAA 4HHHA 2HS3A 4OZ5A 2YQ3A 1U09A 3OTBA 4YS2A 3QQCD 2FZKB 1TKXA 1HPZA 1H2TZ 3BBFA 2V34A 4G6VB 3QFHA 3H40A 1XR5A 2KJVA 3TANA 4FNIA 2HG4A 4X4NA 1BD6A 5KFPA 4X65F 5HK4A 1ZTWA 4DR6F 2FLOA 1C1BA 4U8YA 1XR7A 2HQDA 3CIMA 3OFFA 3HHKA 1WWHA 3BQ1A 1S1XB 4OZNA 5I42B 4NYOA 4DSJA 4YY3J 1XTZA 4RZRA 4JI6J 4NX9A 4WCEQ 2UUAF 2FB0A 2NXUA 3PIPQ 2HNYA 3PW5A 3EX7B 3MUVP 1NDPA 5KOWA 3LWLA 4GVBA 2O5DA 4OZ2A 2X3GA 2DK2A 1OQ6A 2LXIA 2ACYA 2C2KB 3D0GE 1ELOA 2MY8A 1JMTA 2QFJA 4DQIA 4M63A 4HH0A 1N52B 3R2DJ 2J5AA 1U6ZA 1ITPA 3GONA 2XS7A 1KEKA 3OL9A 3GIRA 4RKUC 2ZJRQ 1CBKA 2IVFB 1WORA 4DZDA 4PXCA 4PPZA 3D1HA 5JJBA 1RP5A 1YITS 3NAHA 3VAGA 2XYGB 1YJ9S 3I87A 1U1LA 4AFFA 1WG1A 2GFFA 2V94A 3TZXA 3CCVS 2VBYA 3OBIA 3T5KA 4LRAA 4LF8J 2GIQA 1RTJB 3ILOA 1MWQA 4ZS6A 5DM6Q 1S9GA 2DH9A 3OXGA 1R0CB 1KHWA 4LF5J 5A8WB 1VISA 2YKMB 3BKTA 4ZLJA 4RU2A 3H2VE 1JKHA 4EO6A 4RW4B 2Q6CA 2B7BB 2BQRA 3S8SA 3KLEA 4DR4J 4RJVA 3KKFA 2LMIA 3RBDA 2W1BA 2MZRA 5AXKA 2DR9A 3J81Y 3DOKA 2BDPA 3MMAA 3OTOF 5CAAA 2G2OA 4LF1A 4F67A 2CPYA 3H5UA 3Q8PB 4ED2A 1JB0C 3KK3A 3ZNJ1 3I56S 2ZH8A 1Y4ZB 2PE8A 2AWZA 1HI1A 3BDEA 4NYZA 1F2HA 2BE9B 1H6KX 2M52A 4K2JA 2BJ7A 4XK8C 5E3CA 2Z2YB 1U7LA 3S6EA 3BO2A 5DM7Q 3AA8A 4TLQA 5IQ6A 1FDNA 2AMCB 5KFXA 3ISZA 3RB3A 3QJJA 3DDIA 3HX9A 2UVVA 4BBYA 3IWNC 3QO9B 3SFUA 2CDRB 1RWPB 2JOQA 1E6VA 2W9BA 4DPTA 3H5SA 1T9TA 2I5JA 2AHOB 3AFGA 4OLPA 2OD4A 2RF2B 4F3QA 1Q82T 2DR8A 4NCGB 3IBCB 1IQZA 2QEXS 1X5SA 3GJQB 5LSOA 5E3RA 3GCWP 1WHXA 3RW7A 4MMOA 5DRKA 1EKRA 4DHVA 2YQ1A 1TAQA 3M9MB 3K57A 5LSRA 2BKNA 3HFVA 4IFVB 4ZVSB 1LK5A 2LQJA 5KT2A 3MF5A 3UN2A 1R0BG 2RQCA 1AROP 3KUEA 2R7WA 1OJ4A 1MN9A 3O5TB 4RWXA 4L74A 3D3CJ 3U1MA 1WHWA 2VBXA 3BN4A 3PW7A 3DRXA 3PY8A 5KFCA 3B8HA 3EDQB 2DGSA 2FHOB 4KKOB 2LLZA 4PWDA 2VPWB 3FBFA 2H65B 1XNQF 4I7FB 4J9VA 4I0WA 2E5JA 2F4VJ 3SDEB 2QA1A 4S0MA 5LMNF 1XNRJ 1P27B 1DRZA 5GAHI 3IC1A 1TK0A 1PC4A 2ZBCA 4IDKA 4HTIA 1LW0A 4ED5A 3R5DA 3MM9A 2QL5B 2CKWA 3MEGB 4Y2MA 4M95A 4OYPA 2VBZA 2JLFA 3BH6B 3BZQA 5F41A 3DLKA 4ZLLA 2GX8A 2LCWA 4RNFA 3KK2B 3EPGA 4JYAJ 2FGOA 1HD1A 5HROA 3GB0A 4FZVA 4IOBA 2IJRA 3UNYA 2R7TA 3GFYA 5D3GA 3VQTA 2KT5A 4DG1B 4B3SF 2PA8D 4QBUA 3GE9A 3RG6A 1K0VA 4DFKA 2VKRA 4F4WA 1RAGB 1WG5A 4ZP8A 3TAPA 2X51A 4NOHA 3DOMB 1HNVA 1VQNS 2VJUA 3J80Y 1X9SA 3SV3A 1UA0A 5KFNA 5KT3A 2RRNA 1O51A 2CQ0A 3D68A 4HHJA 5HL7Q 1IBMJ 2LQBA 4QWEA 4DPXA 4J90A 1CJUA 4OYAA 2FD2A 2ZFHA 1XN9A 2HVZA 3DLEA 4ERDA 3CDAA 2DR7A 5CZXA 1WEZA 5AT1B 1CG2A 3WX8A 2LA6A 2HS0A 2VQEF 4B9SA 5K14B 1LV5A 3PRVA 2VD3A 2DNZA 5IFMA 4X62J 5BJRA 5IC6B 4X4UA 3B4MA 1TKTB 5BYRA 2MQOA 3J7A1 3K17A 2IM2A 2HHWA 4ILMA 1FK9A 2R7UA 1OO0B 2AZ3A 4IOCQ 1GQEA 3C15B 1NJZA 5B0GA 2R7VA 3FQLA 3IM9A 3T3FA 5J1EA 3SI8A
chains in the Genus database with same CATH topology
4MIWA 2DGOA 4FP9A 4O0IA 4DL3A 3DRPA 4ZK7M 1ZETA 3UCUP 4FXDA 1TKXB 3KTQA 3KLVA 1HPZB 4N77A 3MGJA 1JLCB 2VG5A 2HHQA 1ZOTA 3ETOA 3PX0A 1Y00A 2LQ5A 4I69A 3TQ1A 4FBUA 1U24A 2DNPA 1S1VA 2GJ2A 2B4UA 2DCLA 1CSJA 4UOCA 2D9OA 2FC9A 2OPRA 3ITHA 3O44A 2HHXA 2E9RX 2RB7A 2J9CA 3DM2B 2JC0A 4X4RA 2HIQA 3DDKA 3H5YA 4B3MF 1HYSA 1H2UX 1RWUA 3MM7A 4Y2AA 1VQ8S 5CYJA 2JWNA 4WXWA 2MKKA 1OS5A 1Y7PA 3MPYA 1NK5A 1VJWA 1C1BB 1T95A 1JWWA 4OI0A 1WD6A 2MPUA 3VALA 5KG2A 5L1KA 2LDYA 4DSIA 1FDAA 4F4KA 1Q79A 5SUHA 4O3OA 2RMLA 5DDRC 4N56A 2CPJA 2APOA 2B4VA 2EW9A 2J7UA 3E01B 3UPFA 5DDOC 5E3PA 2K1RB 3TAQA 3SYZA 2GMHA 2DO0A 4IQMA 3IGNA 2DGXA 5C24A 4QIFA 1Q1KA 3V4IB 1IBKF 2DRBA 3LF0A 5DDPC 2ZNZA 3AAWB 3H59A 4ID5B 1N32F 2XZWA 1MMDA 4NPOA 2RS8A 2XCPA 2E1AA 5F8IA 2F3JA 3CGIA 2MYFA 2YWHA 4WYWA 4ZDNA 4USHA 2ZOGA 1L3SA 5C5JA 2A2DA 2ZM6F 4QZVB 2M8DB 4GKKF 1REVB 1RTHB 5EX3A 4C0BA 3W2WA 3MR2A 1RAJA 4N8NA 3HM9A 3IBWA 2QLXA 4CT8A 1HBUA 3BSCA 1HBNB 2HNYB 1JLFB 3MD3A 4TNOA 3O8WA 3GIKA 2POKA 2R7OA 4DLGA 2NUHA 3NCPA 1TV6A 3UDLA 4JV1A 4L3NA 4PCQA 4X84A 4NRTA 4DUZF 3U1LA 3OTCA 4OX7A 3OJSA 3M6XA 3BB5A 3T1HF 3I0RB 4GC7A 2ZE2A 3QIDA 2R8HA 5AE1A 5KFHA 2BR0A 2VPXB 2CRLA 3OR2A 3P5TL 1Y5NB 3HZGA 2R2UA 1TQLA 1FTCA 5GAEI 3MUTP 3NRBA 1AFJA 3FZ2A 2IBOA 2L3MA 3DDNA 3SSSA 5E7OB 3NNAA 2OPQB 2XNQA 3CCRS 2KYXA 2ZOMA 2V4RA 2LEBA 2DNRA 1N54B 1IKWA 1TKZB 5KFBA 5J2QA 1XR6A 2D3UA 5BR8F 3NBPA 1VRTA 2MJUA 1WF0A 3AB2B 4WFZA 2HPUA 1ZM2A 2OPSB 1JLEA 4CTAA 2H9ZA 1HW9A 2JSXA 4IO1A 1FXRA 1SJ1A 4CH0S 1JLGA 3LP2B 1GH8A 2RQKA 4Q43A 1T02A 2DB1A 2O3DA 5FDLB 3F41A 4IUFA 2DD8S 3KJVB 1KR4A 4I2PA 5IQQA 2HNDB 3T1AA 4QWAA 4OZ1A 1SUQA 4A8KA 4ELTA 1GTHA 1B7FA 3M30A 3WZ0A 1YRXA 2CJQA 3PRDA 5JXSA 4OHZA 3PR5B 3K0JA 1QSYA 3SEOA 3G71S 2JFKA 3W3SA 2AYEA 1IUJA 3J7YI 2QO3A 2M7SA 3EZ5A 2F8HA 2IBKA 1N6QA 3GIIA 4CIOA 3NMRA 2MKJA 3ISNC 5EX0A 4B3RF 2HNZB 2DO4A 4KR0B 2G1DA 1H3DA 2HWIA 3M2UA 3TNVA 4B08A 2VQFF 4DL4A 3RB4A 4NXNF 4Q5VA 3C2PA 4KRWA 5HMWA 5DGBA 2XULA 1S0MA 3PO5A 4WZMA 5KFWA 2IRUA 5KT4A 2YWFA 3CMES 1N5YA 4Q8FA 5J2MA 3CD7A 1RT6B 4ELUA 1H38A 5JUMA 3L7OA 3RAMA 4DQQA 2BW2A 4ELVA 2XMUA 3RB0A 3MWBA 1KTQA 2NYIA 3QLHA 4WXOA 4PG8A 4LQ3A 3R3TA 2CYYA 3GV5B 3R5AA 7FD1A 4FS1A 3DXSX 4XPCA 5KG7A 1IKXA 4X64F 1L5UA 3LGMA 4OFZA 2O66A 4PQUB 2QIFA 3QWPA 4PQAA 1YHQS 3M2RA 4FN5A 1S9GB 5AXMA 1WF2A 2PIIA 4IQXA 3VR1A 3MTJA 5L38A 2DTJA 5KFSA 1JJ2R 5D4LA 1YVFA 2BZ2A 2JL9A 4PUOB 5DQHA 2JEGA 1GT8A 2VG7B 3M8QB 4O3SA 2UXBF 1N8RT 1ZM9A 1GXUA 1R8PA 4DN9A 4FF4A 5CH7B 1SL2A 4F25A 2I2YA 2NSBA 3CCLS 1VQKS 1IKVB 1C2PA 4KJIA 2B51A 3M2VA 1VBZA 4DV2F 1MSWD 2HQ3A 4U7CA 3JAMY 1KOHA 3MM8A 2VL1A 1X4EA 1JKHB 2GQ2A 5F0WA 2WW8A 2ZKTA 1UVJA 4J9LA 1NJIT 2ZZMA 2J9DA 1H0HB 2A2CA 2CVEA 2VV5A 3KLEB 1FD8A 2EFNA 4DR5F 3DLGB 1D8YA 3VAKA 4B9TA 2MKCA 3CE8A 3PHEA 1HI0P 1DHMA 1FVSA 4DJBA 5E41A 2AJ0A 3VF0B 3DOKB 4PG4A 2WB1D 1OIAA 1DARA 4I6YA 3MUMP 4DV7F 1TL1A 3MMAB 4JI7F 2G4BA 5KFQA 5KFUA 2DNLA 4DFJA 1SH0A 4JUZA 5JVGQ 2CQIA 4F3MA 4NLXA 1QY7A 4CO0A 3RTVA 4K4ZA 2YNHB 2RS2A 1OQ3A 2MB0B 3T9ZA 2VB6A 4A8YA 2DT9A 5E3QA 5C42A 1D9FA 4HL9A 5KFJA 2I0XA 2XS5A 1DLOA 1L3TA 3IR6B 1VQ5S 1NKCA 2E66A 3AH6A 1URRA 2J6SA 4NZ6A 2N3OA 1K8AT 2OLWA 4A46A 4WU2A 3KK3B 1GXTA 1H7WA 1B0PA 5B7WA 1FKPA 5EWFA 4X4OA 4ZP6A 4I4BA 2RVJA 4M1KA 4DN0A 3NMAA 3BF4A 1F60B 4QIVA 5F8GA 5KFRA 4C8NA 3RB6A 1N56A 4X66F 2W4CA 5LT5A 2AQ4A 3HHNB 3VTIA 2RKIA 2HWHA 3DFEA 4K4SA 3I9V9 4X4QA 4KFBB 3K8WA 1Y3KA 2DITA 1Q78A 5CYQA 5DDQC 4XO0A 4DQPA 4OLOA 3UQSA 3OVBA 3F73A 2IJNA 4KT0C 2C2DA 2LEPA 5F8LA 3HVWA 3DMJB 4LF9F 1HI8A 3S1TA 4OI6A 3BQ2A 4FVCA 4KHRA 1X9MA 1N4LA 2ILZA 2JJ4D 1RT1A 2WONA 3LAMA 1C4AA 3N9UC 4I1TA 1R8CA 2CPHA 2CZVC 4NZ7A 3V81A 4OJGA 2D1CA 1NRKA 2WRMA 2IVYA 1EP4A 4CQ1A 3PW4A 2HWTA 3D2WA 3POTA 2KVIA 1DTQB 4C9DA 3MMJA 3QGPA 2HHPA 2BRKA 1HWLA 5B08A 1HL6A 4DWIA 4B17A 4Y00A 1ROFA 3KK1B 3CPWR 1VK3A 2Z8QA 1HNXF 2R8JA 3AJ2A 1NU4A 2G9OA 2AYGA 1KHVA 2FJBB 4Y0FA 1TFYA 2MDAA 4JV5F 2EFPA 3AQPA 3PXGa 4EYHB 1BGXT 2M3DA 1JX4A 4WKYA 3HVAA 2JHEA 3AB4B 4I67A 2E5LF 5D6GA 3G9CA 2BE2A 2FDNA 3CCWA 2ROEA 3OSNA 1E6VB 1BQXA 1LW2A 3L3CA 3L7PA 4YB6A 4GO5X 4Q0BA 3MMCA 2W9BB 3CULA 4KHMA 1XMQF 2J0SD 2DBBA 4A8QA 2RNEA 2I5JB 2KZMA 2RUGA 3DRYA 4ICLA 4K50A 3N79A 4QR2A 5KG0A 1X5OA 2C3PA 3QAUA 2IHR1 1Q86T 1FRHA 1SI9A 1NHUA 4MK8A 3TO8A 2XGPA 2CPEA 4E0DA 1Q53A 3N5FA 4NMLA 4FYDA 1NNDA 4USJC 3QGHA 1U6BA 1X4CA 3KOAA 1T03A 3CF5Q 3US5A 1S0OA 4RW6A 3RAQA 3BGUA 3N0VA 4HDHA 4Y6IA 2QE5A 2XI3A 4ZVEA 4C8OA 3RR7A 4EYIB 3LO3A 1UFWA 1NAQA 4ECYA 2VASA 4Q45A 2XMWA 5K9FA 2KI2A 1VQOS 4F2RA 1LWEB 4G1QA 1ZM3A 4M8LA 5G0RB 4DEZA 1KRPA 2B6AA 1LWEA 2CIMA 1K9MT 5F8JA 1S79A 4NA2A 4RW8A 2V4JA 4WIIA 2OIHA 2W25A 5HMZA 4ZLPA 2MMYA 3DOLA 2ZDPA 1VLYA 1XBWA 4C2MA 3CD5A 1Y0HA 2WSFC 5K5MA 2YNFB 3R1LA 4DR7F 1ULRA 3I6PA 4RX6A 3N6LA 1KOOA 2B5JA 3IG1A 1YSJA 3E2EA 4EUVA 4R25A 4HVZA 3Q22A 4DSFA 3FVYA 1RT4B 1NH8A 2ZOFA 3CCSS 4O44A 4QIEA 3M32A 1M5HA 2CQHA 4V19J 4QYZJ 1UP1A 2XMTA 1NKEA 3HZEA 1J5EF 3W2VA 1M5PC 5L1LA 2B3TB 3G8SA 5DS7A 3JSMA 2DNYA 3S01A 3NNCA 4DF4A 2K3IA 2U2FA 3QIPB 2MSTA 5B0AA 1LKZA 1VMBA 3OUYB 2DPJA 4FF1A 3DCAA 2UVUA 2PN6A 4DV1F 2XMKA 4PWDB 2KYZA 4MFBB 1KQKA 4B3OB 5CCMA 3SCJE 1R8BA 4DSEA 4UY8T 2AX0A 2IM0A 1S48A 4YDDB 3OL8A 2EFGA 4RUHA 3HMJG 4AUKA 4ED8A 5F9NA 3HHLC 2W4PA 1VC0A 1S0VA 4YB5A 2KN4A 2PA3A 5CCLA 4DUYF 4B9NA 3TA1A 2YKAA 1BQNB 4RW7A 1FNMA 2LYVA 4YUDA 2XG8A 4CO3A 2QA4G 2PDAA 1C0UB 4OQJA 2FJVA 4KQZA 3NWGA 1RT7A 4IDKB 4LF7F 3JSBA 2R7RA 3LANA 4TY8A 2MKIA 2J6UA 1TL5A 4IRKA 2OO4A 1LW0B 2CPFA 5LSLA 1N34F 3MM9B 3BGLA 5T7LB 2AP6A 4JI8F 5IWAF 1E6YB 2HVIA 2QSWA 4NXMF 3UI3A 2OSQA 3U7JA 3H4BA 1JLQB 1VQYA 4YHHF 3MECB 2DGQA 1IKYA 1U26A 3DNCA 1HMVB 3TUIC 3DLKB 3UFCX 3V5RA 1D1UA 1KVJA 5MLCV 4C11B 1R8HA 5D78A 4DV4F 2GHVC 2DJWA 3TA2A 1U45A 3BDPA 5CZVA 2ASJA 3N4WA 1K0TA 3KLIA 5HROB 3HVTA 3G96A 5M2RA 1S49A 4X2BA 4BWJA 2OJ3A 5GAHU 3C6TB 1RQ0A 4E8UA 1N5QA 2W8KA 5IS2A 1MW7A 1HNIA 2MGZB 1UW4A 4LSLB 2Y0SD 1P1LA 6FDRA 4KTQA 4C8MA 2Q3PA 2HFOA 3P3DA 3G6XA 4KHPF 2MGZA 3DXBA 1RT5A 2HHTA 1RT3B 2YKOA 3NKYA 4M94A 1RTIA 5B0FA 2GC8A 5D3GB 1I94F 1TK5A 1XC9A 1WF1A 3PFEA 2ZJQQ 1Y3JA 2R7XA 2GHWA 4TQSA 1WI8A 4UY85 2OKQA 3ZZ0A 5HMXA 1CVJA 4C8LA 4IG3B 3IS9A 1D3WA 2OAUA 1S9FA 2JLEA 4DX8H 2IM3A 3PO4A 1MROA 2W24A 4KE5A 5HBMA 2E44A 4ES3A 3GZ7A 4GMKA 1DBDA 2CQBA 3D54A 4HT5A 3N5BA 1CEZA 3JYTA 3QYYA 5KG5A 3DHXA 1Q7LB 3OV7A 3PM9A 2HHSA 4YMEA 3HFKA 1UVKA 4XIUA 1QVGR 4LMZA 1HBMA 4JI4F 2D74B 1G6BA 1SKWA 4WKRA 3KG1A 1FDDA 1P6TA 1WEYA 3IO1A 4G1IA 4O4GB 3TW0A 4WK1A 3K58A 3OL7A 3S7RA 2E7WA 3KMQA 1XMBA 1TZ0A 3SCKE 1J5OB 2F9DA 3KHLA 1S1TB 4FVMA 4FBTA 1HNVB 3TAMA 3MEKA 4TYBA 1WTBA 5F8MA 3PEJA 2GA7A 2ZH5A 3FNNA 3C3LA 4TKTA 2MQPA 4Q8EA 4WU3A 1IXKA 3CIZA 3CD0A 4LQ9A 2KM8B 1NK7A 2C2EA 3O6QA 2QZ8A 2XI2A 5AJ3F 4QR1A 2VKZG 3MD1A 2J8AA 4YEAA 2XY7A 4ZVGA 4F26A 2OFGX 3LP1B 4NA1A 5I3PA 3SSQA 1KLMA 3MFIA 2M9KA 2W9CB 4F3OA 2RQ4A 2UZAA 5B09A 2XC9A 4IH6A 1K73T 3DLEB 4QIWD 4R5PA 3GV8B 4C3MA 4ZMMA 5CHCB 2DH7A 2IAJB 1J2VA 2BJDA 3E51A 4DQSA 2R8KA 1VRUB 1MMNA 3UD4P 3M1VB 1HBOA 4PG6A 2CQ1A 2N3LA 3MEEA 2EVZA 4OIXA 3CJ3A 2AX1A 4J9KA 1N5TA 2WSCC 1L3KA 3DYAA 1SH2A 3K8VA 4YFUA 2CDQA 3OVSA 1B0TA 1JNRB 3MURP 3HKZD 1UJ5A 5L1IA 4IO9Q 1YG0A 2R8IA 2CVIA 3SCLE 2MXYA 1UWBA 2B4OA 4Q2MA 3FCHA 1OPIA 2XHWA 3MEDB 2FUG9 2YNIA 4ECRA 2VC0A 3BR8A 2EK1A 2ASDA 2JEJA 3UWTA 3FMWA 3JSYA 4IG0B 1G2EA 1BC6A 1BQMB 3G6YA 3I31A 1QAJA 1S6PA 4B9UA 1VQLS 1RYRA 2JEIA 2HLUA 1A7GE 1NK4A 2ERRA 2DHAA 2VZ9A 4KSEB 1Z1ZA 1LK7A 1P8GA 2N7YA 3T5HA 2HHVA 3LP0A 2V5HG 3LQVA 3DU5A 1VQPS 3EUNA 1D9AA 2Y1IA 1L3UA 3DLLQ 1UJ4A 3NGDA 3IWLA 4MJKA 1Q8BA 2MZJA 3Q24A 1FK9B 4ZP7A 3VZHA 3MM5A 4DFPA 2MY7A 3D1OA 3MPWA 2BOPA 2RE1A 1F2GA 3EXYA 2YH1A 3ENVA 4KO0A 3FGVA 4NYPA 3DI6A 1HA1A 4C0HA 2NR0A 2M70A 3IAM9 3K7RA 5M2UA 1FF2A 2X1AA 5DG8A 2BANA 1VS3A 2RJZA 4NLSA 2G13A 2MQMA 5J1EB 2W9AA 4O23A 1UVMA 5FJ4A 1EETA 2EI5A 2P9EA 1P1TA 2PD1A 3TVKA 3K5LA 1HHTP 3DRPB 3E8OA 2O01C 2XLJA 2VG5B 2QV6A 3C66A 2BV3A 3U02A 5A8RA 3T5LA 2FHJA 3ZZOA 1CQNA 3B82A 2DNMA 1FESA 1S1VB 1TVRA 1OWXA 4YP3A 2QA4S 4G3IA 2OPRB 3ITHB 4ZHRA 1YGYA 2AW0A 3IXQA 4LIRA 4AQYF 5EDWA 2PMHA 3JTNA 3Q2SC 2KH9A 3CCTA 1HYSB 3M9OB 2GMLA 3MM7B 1KNZA 2R2RA 3PZPA 4MTPA 3IRXA 5DJBA 1CLFA 1FKOA 3MCSA 5L1JA 3PVXA 4ZPVR 5GAGI 2D7SA 4GC6A 4P7VA 4V19X 3RW6A 2W8LA 1X9WA 1XERA 2BUNA 4FNHA 2QSFA 3TP2A 1S9EA 4DV5F 1YWXA 1FTRA 4Y65A 4CO4A 3GWCA 2HGNA 1DFDA 4YDXA 2CJ9A 3PR4A 2CG4A 1GXLA