4RBVA

Pdua k26a s40gsg mutant, from salmonella enterica serovar typhimurium lt2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
QEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGGSGGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica serovar typhimurium
molecule tags Structural protein
molecule keywords Propanediol utilization protein PduA
total genus 20
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rbvA00
2A10A 4OLOA 3VCDA 4QIFA 4DDFA 4QIVA 3DNCA 4P7TA 4AXJA 4OX7A 4OX6A 4P2SA 3I96A 4AXIA 2A18A 3IA0A 3PACA 3SSQA 2G13A 3CIMA 5L38A 4P7VA 4PPDA 4LIWA 5DJBA 3H8YA 3N79A 2EWHA 4RBTA 4OX8A 3CGIA 3SSSA 3MPWA 4QIEA 3NGKA 4RBVA 3MPYA 4QIGA 4OLPA 3DN9A 4RBUA 3SSRA 3NWGA 2A1BA 3I6PA 3BN4A
chains in the Genus database with same CATH superfamily
3TVZA 3QZ8A 4I68A 1IKWA 1TL3A 2L08A 2P8IA 3SCJE 3Q8QB 2KG0A 2VPXB 5KT5A 4MYTA 3RUBL 2R2RA 2ZJPQ 3UNYA 4CLKA 2LXFA 5HMYA 2J0QD 3PRVA 4IQXA 4N76A 4O3SA 3GP9A 1UL3A 1NJIT 1TQLA 5L8RC 4PYAA 1KTVA 4YY3F 4KC5A 2LQBA 2XMUA 1WI6A 4KGXB 4FPIA 4HACB 4I67A 1DLOA 1NK8A 3MOJB 2YPZA 2Y3YA 4ZA1A 2B7CB 3UN2A 3WDOA 4C3LA 4HVZA 2BRLA 5ADZA 4NEZA 4Q2MA 2ZWOA 2DO0A 2XYGB 2HFSA 2OLWA 2RIJA 1QAXA 3S1TA 1PJ6A 9RUBA 3DMJB 1U7LA 1R0AA 1GH8A 2V5HG 2APOA 4DCPB 3GJRB 2V63A 4DL5A 2M88A 4ZP7A 3OJSA 4M5GA 2OAUA 4M1KA 3KK1B 1S9FA 4LF7J 5D4LA 2EVZA 2RDIA 2F1FA 3QO9A 4IKAA 4A8KA 3TYTA 5A8WA 5FD1A 4X62J 3TAQA 1O6XA 5HP1B 2DR5A 1R8BA 1UFLA 3DRPB 4NZ0A 4QZVB 3JTPA 3VVTA 3QPIA 5B0BA 4ZPTR 2DXEA 2ZBCA 2NZ4A 1GXLA 3N9UC 1OO0B 3MM9B 2DH8A 2B9XA 4N77A 2MZTA 4C0HA 4USMA 2C2MB 4O0IA 2YNGB 1MLAA 4TKTA 2Y8WA 2VG6A 2BM0A 1CSJA 3BYPA 3GWCA 4DF4A 1YJ9S 3HHNB 2B51A 1KRPA 1YK9A 2OELA 3H90A 3HDSA 2UUBF 2CQ2A 3QT7A 4X65F 3BH6B 1SV5B 5B0EA 4K2JA 1CJUB 5GAEI 1XR6A 2H5IB 2Y0SD 2RHSB 4DQPA 1HMVA 1RCXB 3QAUA 2A3JA 3M32B 2AF6A 4C48A 3E8OA 1NHKL 2ILZA 1SJ1A 2LQJA 2XULA 4ZVGA 4B9LA 2HSEB 1NU4A 3BSAA 1EP4B 4URSA 4UZBA 1NK9A 2QZ8A 3O1LA 2B9EA 3W2VA 2AYGA 4IRCA 4TXSA 1Y7PA 4JP8A 2CJYB 2DB1A 4NE9C 5RUBA 4K50A 3VAMA 1LWXA 3AQPA 4DL3A 2MEWA 1S1TA 2R2UA 1L3SA 3PW7A 1S6UA 3M9NB 2O01C 3G2XA 4WU2A 4JI6F 5F9LA 3PO4A 1RHJB 3HFZB 4X64F 2MY7A 2CPHA 2FTRA 4ZN1A 2MMYA 3I56S 1OSDA 3PRDA 2W2QP 4LFAJ 3W1YC 4J90A 3PO5A 4C8ZA 4GKKJ 3ISNC 4OHZA 4KGKA 4Y2KA 1UPMB 2MKYA 1SXLA 2BQRA 5L1JA 2WBMA 4RBTA 4U6PA 1JLQA 5CHCB 1KEKA 4MT1A 3PW2A 3NGRA 1GX6A 4JI5J 1T8EA 1QTNB 5A0YB 1L3UA 3SV4A 1EKSA 2R4FA 1K1SA 2ZKTA 3K5OA 4F0KA 4GKKF 5KFKA 5GMEA 4FYWB 5L1KA 1JXLA 3K0JA 2R8GA 3GG0A 4IYQA 3BGUA 4DI6A 5GMKa 1WC4A 3D6HB 4UOCA 5KFMA 2R8IA 4EZ6A 2KM8B 3G82A 1P27B 1W2BR 3CDEA 1V5IB 4TU9A 5L38A 2FHJD 2ZH2A 1CJUA 2RU9A 3PFEA 3J7A1 3LGMA 4I6YA 4OZ3A 5HK4A 1DQ9A 1ZAVA 3MMCA 4QWBA 3HFVA 3MR2A 3OSPA 3NAIA 4OI4A 3LUYA 2FJXA 1XNRJ 1HNWJ 1TK0A 2OEJA 5E3AA 2RU3A 4K2XA 3V81A 5IT9Y 4KT0C 5LMUJ 3LGNA 3MF5A 2KKHA 3MM7A 4Y34A 1KNZA 4PQUA 3RJMB 4K4ZA 3M9OB 4EBCA 1G2EA 5DDOC 2XI2A 2ZH9A 1HD1A 3HM9A 3NEKA 1KSPA 4USWA 3J80U 2CVEA 3DYAA 4QIFA 1K8AT 2HPUA 3ENWA 4F3OA 2M8HA 4ETXA 4Y00A 3GCWP 1QE1A 3MCSA 4QYRA 3AA8A 4NLVA 4DEZA 2UZAA 2M3DA 5FLXU 3SFGA 1NDPA 1NJZA 4NYZA 4USTA 1YBTA 1KQSR 2XEXA 4S0MA 5HLFB 4TNOA 4OYAA 3W5XA 3DDIA 1E6VB 3UFCX 4B9TA 3M8YA 3POTA 2VG7A 4ED1A 3OXLA 5E33A 1Y9OA 4FYDA 5LSLA 5H9EJ 2BJ3A 5EDWA 3HKZD 5J1EA 3IWLA 3TI0A 3SQGB 1JWWA 1FCAA 3J7ZT 2HVEA 3CD7A 2ZVSA 4BWMA 2HFNA 4JI8F 5EHHA 3PIPQ 1VQKS 2NREA 1VQNS 1RADB 2LCWA 3HSDA 3ILOA 5ETRA 1XBWA 4J9LA 2EI5A 4IH6A 1GQEA 3D28A 4HDHA 2MHEA 2FGOA 2GVZB 1S0OA 1B99A 2BOAA 3QIPA 4P9SA 3MAAB 4IH5A 1JLCB 3ZZTA 4DCJB 3GV7B 5H1SV 3NS5A 1FRHA 2MXYA 1N36F 1N33J 1SKWA 1IBLF 1RACB 2YQ3A 1X4HA 2QL7B 3QMQA 2DGUA 4RU9A 4ZP9A 2B5JA 2R2SA 1C4CA 1RU2A 2MQLA 3CO9A 4L6V3 3H4BA 2CFXA 4MKVA 4CH0S 4UOFA 4DS4A 3TZZA 2BQUA 1SQEA 3QIPB 3R1LA 2YKOA 4FBUA 2G2ZA 1HI1A 3CDUA 4C8NA 1JK9B 4IFVB 4RZRA 3NGUA 1RWVB 3HK2A 2VG6B 4PXDA 4KHMA 2CPXA 3TO8A 1U0HA 2ZKUA 4GVLA 3LP0B 2EK1A 3I5BA 2KG1A 1NKEA 3KOAA 5T14A 3MUTP 5DDRC 3DN9A 2EW9A 4URQU 1N32F 1LOUA 4KHPJ 1BQMB 1SJ3P 1Y3KA 3I6PA 3BQ2A 1FTRA 4LVOP 2VICA 2HS0A 4DSIA 1Y11A 3D54A 3KLHA 2JLGA 4ES3A 4DFKA 3BGOP 1T05B 3ZZPA 3MM8A 3PM9A 3T1YJ 2DGTA 3B54A 3GJSB 4HDGA 3KWMA 5K20B 1X5OA 4Q8EA 1ZTTA 1OY6A 4J9NA 4I1TA 4TVAB 2NXEA 2R8JA 3TP2A 1HBUB 3ENQA 3DGPB 3MHYA 4NZ7A 9ATCB 3MXHP 1FNMA 1KR4A 2IPOB 5C2GA 4DCOB 1RTDA 5BYSA 3MEGB 2DNNA 3AOBA 4RO0A 5M2UA 3FFIB 3VAKA 1EETB 2HFUA 4DR4F 1FESA 3FEXB 1WG4A 2W9CB 2OH2A 1WORA 4NLTA 4BC9A 1RZMA 2CQ4A 3DC2A 3OD2A 3KLFB 5ETNA 4WZQA 2BZ2A 3JSMB 3CT9A 4HR2A 1WSVA 3F44A 3BO4A 1NKCA 5M2RA 1CBKA 2C2ZB 2ZDOA 3NWGA 1IR2A 1GNKA 4ZPAA 4A8XA 2XWYA 4DR7F 2LA6A 4RUCA 2CWXA 1JNZB 3FFIA 1PYSB 2IM2A 4OV1A 1IM4A 1RT7B 4IG3B 3HSZA 4LJMA 3J7Z5 1T03A 2NXJA 1RU1A 4O4GA 2D3OR 4MTPA 2YY3A 3GONA 3MMAA 2FPHX 1HMVB 4K8RA 2ZH1A 3FCWA 4PXBA 3THPA 3TUZC 2MJUA 4PWDB 1ZM9A 3IFEA 3TRGA 4LF5F 1NDLA 2HK3A 2E66A 2XHCA 2OPPB 3CJTA 4TYBA 3TX0A 3RRGA 3K5LA 1S77D 2IJFA 1FD8A 2Z58B 5D3GB 1GX5A 2WSFC 2MGZB 2CQBA 1LNQA 2XGPA 1UJ4A 2QMUB 3OT9A 3P4UB 5CABA 1FVSA 3A8IA 3T3FA 4CO5A 1IKWB 1TL3B 2IMOA 3EM1A 4WU3A 5IQ6A 3TAPA 4DG1A 1U1OA 1KKHA 5LSOA 2JJ4D 4M5LA 5AE2A 3BZQA 2HAIA 5KFOA 1U1PA 2AJ4A 2QSWA 4QIVA 2NR0A 2HG4A 2HQFA 5HMXA 2GNKA 4PXEA 2EFGA 4DL7A 4ZVHA 4DUYF 4F4ZA 3CSKA 4OYMA 1B0VA 2AWZA 2J9DA 2O1PA 5F0UA 3SSQA 4WP9A 2DH7A 3NBPA 4YS2A 4ED5A 4LIWA 3TX8A 3L09A 1WEZA 3CNQP 5L1LA 3MUMP 1U6ZA 2BYCA 1GK8A 2V4JA 3KJFB 4C0OC 3M6VA 4LF4F 4NI2A 2QLWA 3OBIA 5D6GA 1UVLA 2CQCA 3ETOA 1LXJA 4B3SF 1RTIB 2LQ8A 3CWJA 4H4MA 5LOQA 1U6FA 5K9FA 1K1QA 4LBIA 4JI4J 3FJ2A 1JLEA 3CJ8A 2QJ3A 4IFYB 1FTCA 4NRTA 1NB2A 3ITHB 3RRKA 4P72A 1PGZA 1HYSA 3BV8A 4CLPA 4X4QA 3DOKA 3TUPA 1PIEA 3ZNUA 1UZDA 4A4JA 3VHQA 2RNEA 1YQHA 1OY9A 2HKEA 4OJ3A 5EWGA 1RTIA 3ILLA 4QWAA 3ZTOA 1HR0J 2HK2A 5KFYA 5KFBA 4P52A 2QA4S 3M8RA 4RU2A 4B9NA 1SJQA 1F6TA 1VQ9S 1EZZB 3DYAB 4ZVOB 1WACA 2IJRA 4OYWA 1AFIA 2PO4A 5F41A 2UVRA 1RWXB 3MEEA 3MECB 5B7WA 2XYPB 2DNKA 2RH3A 4X2BA 4Q2LA 1IBMF 5LMNJ 3GYXB 3IG1A 1SB6A 4XO0A 3U1LA 1XMQJ 2N4CA 2N3OA 2LYVA 4NLGA 2JDJA 4MMOA 4Z2XA 5KFUA 4USUA 4DQRA 4C8KA 1V3RA 4OYPA 2B6AB 3SQGA 1CC7A 3GU0A 1S49A 3KG0A 1X0FA 2X51A 3HI9A 4IG0B 4XTTA 1NH7A 1F0XA 1NJYA 2KJWA 4LF2A 2NYHA 2OGUA 2QE5A 3B4MA 3LO3A 4NMXA 3ENVA 4OHVA 4P7VA 3T5HA 1R6YA 2ZH4A 2VFSA 1YZ6A 4DFJA 4PPZA 3AA9A 3EPIA 3SFUA 1TL1B 2Q1LA 5J1PA 5IT9U 2E1AA 3MPDA 1R3NA 1URRA 1C4AA 3JTNA 3RZAA 3CDWA 3GIKA 1J5OB 4LRCA 2J0WA 4RW6B 3H4DA 2QX0A 3D4JA 1CS4A 2AZ3A 1B3TA 2HVIA 3DOKB 2PFFB 1P6TA 2W7AA 5HMZA 4F26A 1OJ4A 2DKOB 4N8NA 1HI0P 5E0OA 2OPQB 2GIQA 5KTQA 4QWEA 1QSSA 1WSRA 2FGCA 2OSQA 2CWKA 2RF2B 5I4MA 3EZOA 4DPOA 4HHHA 3UW1A 3T6JA 1EJ7L 1FE4A 2W2NP 1T9TA 2V50A 2HNZB 2WZ1A 3HX9A 1RT5A 2YPYA 3DRYA 3UN3A 4F50A 1EAYC 1AZSA 5SUHA 1YDLA 1GXUA 1X4GA 4ZCLA 1F9EB 4ZIWA 3W66A 4QR1A 1FDBA 2V2QA 2R3VA 1FK9A 1UEUA 3QGGA 2B4VA 1OYEA 2QLJB 1D9AA 3A4TA 1UFKA 1M5HA 2VF3A 2C2OB 4KKOB 4E2FB 4R25A 1Q8LA 2M70A 5EWFA 1PSDA 4L76A 1U2FA 5DS7A 3ZTSA 3OVBA 2JC1A 2ZE2B 3M6UA 4ECXA 1KTQA 2U1AA 2BW7A 5IC6B 5BR8F 1N54B 4ED2A 4U8YA 1WWHA 3HSGA 4WE1B 3UCGA 2I9SA 4WK1A 1HW9A 2JLEA 2BA9A 2WW8A 4C3KA 4E8UA 2R8HA 3CCMS 1VHFA 2XLIA 1JXVA 1C0TA 2HZAA 5A6PA 1QAYA 2UXDF 1Y5IB 2E9ZA 3MI7X 2XWXA 3M2UB 4DG1B 1NK0A 4JV1A 1YGYA 3PKYA 4ECYA 4OI0A 1AYEA 1R0AB 4LMZA 1NPPA 2KT5A 2POKA 2X1BA 5MLCV 5J2NA 3IWNC 1RHRB 4KE5A 2HGMA 2HZCA 1YJ7A 4IOAQ 2JSXA 1U1RA 2B56A 1WI8A 1YKWA 4DV4F 2F5GA 1H3DA 3VALA 1HNWF 3JQMA 1B7YB 1Y10A 3C16A 4PRFA 5IV3A 2I38A 1FWKA 2OMOA 2WVFA 3JSYA 4O4GB 3LTOA 2ADCA 4G1IA 3BBCA 3MMAB 3R5BA 2VBXA 4NASA 4TLRA 5E2QA 3K5MA 5CZXA 4DV3F 2M8DB 1AFJA 2I8EA 2E1RA 2N4DA 3OVSA 5CYMA 4JI7F 2E9RX 3BKUA 1SC3B 1ZA1B 2R8KA 3NGTA 2Z2ZA 2A10A 4IOCQ 3DOMB 4G1QA 5LJ3Y 1CULB 3QSIA 1JKHA 4H4MB 1UVJA 2YVSA 1YWXA 4OJGA 2XMKA 3H5UA 3Q0AA 3NL0A 1FA0A 2ZH3A 2N7CA 2V8HA 2R7UA 3I9ZA 4GVBA 3KHRA 1HYSB 1SCJB 1F5BA 3G8QA 4FPRA 2VC1A 2K8GA 2GQQA 1S57A 2DNLA 1CVJA 1U0SA 4M5MA 4ZLJA 3W9JA 1VQSA 3C2PA 3KNAA 3QRPA 1LXNA 2PC6A 2E9TA 2VFVA 3TQ1A 1T94A 2I5JB 4F3QA 5M2PA 1RWOB 4Y6IA 3RRHA 4DR7J 1IKVB 2ZFHA 5KFVA 2ZITA 3N6MA 3PR5B 2FHOB 2I2YA 5CAAA 5KFDA 2ZHOA 2MKCA 2A2DA 4IDKA 3MR6A 1L3TA 3GCXP 3EPGA 4ED6A 1M5KC 1XQIA 2OI2A 3GR0A 2QFJA 2EC0A 1WKJA 3DLEB 5SZTA 3H5XA 3M8QA 3GFYA 1IBCB 2AEMA 5HVHA 3BR8A 3EWGA 4JV2A 1PO6A 1MMNA 2IC3B 1N56A 3FBBA 1JLFB 5CCMA 1CPZA 2UUTA 4K5RA 5K8OA 1YRUA 3HO1A 4LRBA 2W9CA 3LP2A 3KHGA 2C42A 3EZUA 5F9NA 1GXTA 3J7YI 1EB0A 1RT2B 4CLFA 1UVMA 3TANA 3WX4A 1FEEA 4ZPCA 1S97A 2XNRA 1IWGA 1ZBTA 2IRXA 5B0AA 2I6WA 3OW2R 3M4XA 1D1UA 2ATLA 2J9DE 5LXRA 5H9FJ 2JHEA 3R9LA 3V5RA 1NH8A 3G82B 1I94J 3CUNA 3BBFA 1HWIA 1VISA 3A1YG 3R8YA 4ECSA 4OLPA 3OFGA 1EKRA 3X3UA 3SSRA 1RT2A 3CB4A 2HIYA 3NXZA 1YIJS 2DR9A 2EPIA 4BS2A 2CJQA 2DR6A 4PKDB 4DN9A 1DBDA 1D0EA 3N4WA 3ZZUA 5KFRA 1VQOS 3CJKB 4DMZA 4CRJA 3CDAA 3UD4P 3QGHA 3PV8A 1YZ7A 2D7SA 3O5TB 4DX5A 5CYQA 4ERDA 3QO9B 2VPZB 3I5CA 4I6AA 1U02A 3WX8A 5ETSA 2AW0A 1IKYB 3I0RB 2HVZA 3HPOA 4TY8B 1X5SA 4QOTA 2OSRA 3FKBA 1TTHB 2DGSA 2F63A 1T02A 5HSPA 1LFPA 2RSQA 1KVKA 2MKJA 2HYIB 4BLGA 1R8PA 1SIZA 1HR0F 2C3PA 1GMVA 4MYUA 3DNCA 1ZA2B 1FKPB 1UFWA 1T7PA 3T5KA 4WBFA 4A48A 1WC3A 3PZPA 3HJVA 4DR3J 1X4DA 2DHHA 1FE0A 2LLZA 4KAIA 1LWCA 3OR1B 4X4OA 3D68A 2ZZNA 1XNQF 4RWWA 1N34J 4Y2CA 2ASYA 4MFBB 2GJIA 2VIHA 1GMWA 2L48A 2G2OA 1S1XB 2VG5B 4NMLA 2DEJA 1IXKA 2J6UA 1HBUA 3P45B 2L3MA 1RHKB 4F25A 1Z4UA 4NPOA 1Q0NA 3OHAA 4K4YA 1B4SA 1X4FA 2JH3A 4JYAJ 4AFFA 3BGRA 4R5PB 2YWWA 3UDCA 4L73A 3PTWA 2FD2A 2I0XA 3BGFA 4USHA 3KLEB 1QTMA 2JVRA 4HEA9 1XC9A 1TZ0A 1MN7A 1M0SA 1RKIA 1S4FA 1YITS 1NPKA 1T9UA 1WKLA 3IBCB 2DHGA 1UA1A 4G3IA 5B09A 1CG2A 1JLQB 2D1CA 2ASLA 5AE3A 3OL6A 2QLBB 1P1LA 2OHDA 3D6FB 4RJVA 4IO9Q 2A0FB 2JRSA 4K5SA 1WHYA 2GJ2A 2IYGA 4P2XA 2MJNA 3Q23A 1SC1B 4EI2A 5FLXY 1I51B 4I0WA 4TU8A 3CCQS 3BO3A 4OZ5A 1T9WA 2V67A 3M9MB 4YB1P 2GO8A 1FFSB 1X4AA 3KHLA 1TUVA 3TNVA 1J27A 4MKAA 4LR7A 2V4QA 4C6AA 5D0EA 1HLWA 1XIQA 2XB2D 2R7XA 2E7VA 1KFSA 2NYIA 4JI5F 2DGOA 1NHUA 1TV6B 5LL6d 2MZQA 1VRTB 2RB7A 1HPZB 3KUEA 1KLMA 3QATA 5AXMA 2IHR1 4KO0A 3VQSA 1WEYA 4EU0A 4OHXA 1VLYA 1VQ6S 3SCLE 2BACA 1FEHA 2DNYA 2DO4A 4J9RA 3TEHB 3QSYB 1FERA 1IQTA 1R6VA 5DQIA 2LP4A 1X5TA 2R7WA 4NXMF 2O66A 1J5OA 3M30A 4EYIB 4AQYJ 2ALZA 1RT3B 2F4FA 3HT3A 4LFCJ 4DR4J 3A8KA 3LWMA 3BB5A 2HURA 2HS3A 5AT1B 2VJUA 3P5TL 4Q7AA 1F5CA 3RAQA 4EO8A 1IJFB 4FXVA 4NLXA 2RDJA 3K17A 2U2FA 4NCAA 1G7CB 1RE1B 3HCXA 3KLGA 2DNMA 2VQEJ 1ICEB 4IRKA 2MHNA 1QSLA 4I2QB 2V4JB 4G1PA 4DV5J 1TKTB 4HYKA 5H9FK 2A1BA 3IS9A 3M8PA 3D66A 3FMBA 2MQQA 3V6JA 2UXCJ 1R8CA 1ROFA 4PYDA 2L9NA 3NGSA 4J91A 3VGVA 1KHVA 4ILLA 3M32A 4DPYA 4EUVA 1PBUA 2EBEA 2HEKA 3A3PB 5J2QA 2BOPA 3GSDA 3RBZA 2LA4A 3M8PB 2W8KA 3OLAA 2W9AA 2E1CA 3Q8UA 5FDLB 4WF9Q 3CJKA 5KG1A 1WOSA 1WUUA 2V0NA 1X9MA 1KLMB 2OP5A 4NZ6A 4O44B 2KT2A 3AODA 3DCAA 1KLNA 3AT1B 4LSZB 3MFIA 2J5AA 3CE8A 4X4VA 1HBMB 1S5ZA 4Z7CA 2G1HA 4RUBA 2D74B 2HIQA 3MEDA 1SUQB 2VQFJ 1VBXA 3RB4A 2ROGA 1RAFB 5CQGA 2LU2A 2MZ1A 5DLFA 1HHTP 3PW0A 2ZH8A 2XMVA 3OLBA 4A8MP 4X4NA 5HBMB 3QGPA 2IBOA 4ECTA 2PN6A 2ZEJA 3M6WA 4CNZA 3GZ7A 4OI2A 4DV7F 2FJDB 2FHKA 3FMWA 1NPRA 3MEDB 4OQJA 3W9HA 4ECVA 4JI8J 3OV7A 2DH9A 3HD2A 3PEHA 4X66J 1KQGB 1IKXA 1FKAF 2IRYA 1K44A 1FWPA 2DGVA 5C24A 4ZIVA 1LQ9A 1H38A 3R5AA 5D4PA 2NZCA 3LA0A 3OUYA 1TFWA 2W4CA 2VL1A 2BKOA 2WK4A 4KH0B 4OI3A 4HH0A 2GS8A 2KVIA 5K14A 5KFCA 4Z7YA 4IR1A 3MEGA 1F2GA 2BJ1A 4CI0B 2GZOA 2OEMA 1OQ3A 1T95A 2PFDA 2XNQA 3CXCR 2AV5A 3MM6A 3RB3A 3DLHA 1O0PA 2D3ZA 3A8JA 3OTOF 4F2SA 1VQPS 2K1RA 3FBFA 2Z2LA 3V4IB 4ANDA 3MEEB 4RR5A 4ER8A 4RNFA 3QNWB 4ECUA 3JSMA 2K2PA 1SL2A 4EFAC 2DGXA 3JQJA 1YJNS 3ADAC 4DJBA 4FF1A 1BWEA 4RNOA 2VH7A 4NA3A 2YWHA 5KG6A 2VKZG 5LMUF 1T3NA 1HIYA 2QFIA 4UUXA 4TQRA 4HH1A 2LQ9A 4ZCIA 1U4BA 3V4IA 1S1WB 1Y5LB 3OTCA 3SDEB 2YNIA 3CGIA 4ZDNA 2LXUA 2AJ0A 1WTFA 2BANA 2XZWA 4CQ1A 4IG0A 3GMGA 2KFYA 2Q79A 3IWXA 3LQVA 5K8NA 1X9WA 3CW2C 2IC3A 4CNYA 1HNVA 2KO1A 3HT0A 1PILA 3NNCA 2GFFA 4NYOA 3OHBA 2PSZA 2I1RA 3WBZA 4WE1A 2HQGA 8RUCA 4ES2A 1X0PA 1LW2A 3Q8YA 5HJXA 2BANB 4OHWA 1VQYA 3S7RA 1U45A 2F4VF 3W60A 1QDUB 4RNHA 4B08A 1S6OA 4QYZK 2KL8A 2NS1B 3GIMA 2MKIA 2CQIA 2CZ4A 2G0CA 3NOCA 4FBTA 5J2NB 5IFMA 5GADU 2DD8S 1V5VA 4WPAA 4DR5F 1SIWB 4A8QA 5HROA 1F9FA 4ED0A 2QEXS 1M5PC 3I32A 5A8WB 4ETZA 5D4NA 2YKNB 2JFDA 2CJAA 1BLUA 2YX4A 5AXNA 4LRFA 3ZC4A 2W01A 4NLPA 1HQEA 3LW5C 1N36J 1IBKJ 1N33F 2D69A 4JI3F 2Z57B 3P49B 4I2QA 3AB2B 3TZWA 1ZM3A 4NLOA 2WRMA 1JLGB 2F65A 1UETA 1YBUA 1AT1B 1ZM4A 4W4MA 1SV5A 2ZZTA 2UUAF 2HHUA 1S12A 3IRXB 2IM3A 4L3NA 5T7LB 5KFQA 2BR0A 3ITHA 3Q8RB 4NXMJ 1GMWD 4YB7A 2ZOGA 2RE1A 5CD4A 1VQ4S 4RW4B 2C2KB 1PC5A 1FKOB 2AZ1A 3L95X 1NHVA 5BYQA 1EHWA 2HVHA 3UI3A 3MPWA 3FEZA 2MZRA 1I5OB 1HWUA 3TARA 2RVJA 4J37A 2H5EA 4GC6A 4ICLA 3KK2A 4JV0A 3J81j 1N5VA 3AOAA 4H4OA 1VOMA 1RISA 1AA1B 4HI1A 2X3GA 4PXCA 1EQMA 4O3OA 4Q5VA 2VU5A 3D2WA 4JI4F 4K4XA 2KHDA 5CCLA 4H4KC 2EFOA 1OIAA 5ETVA 3X1LB 2QC3A 1FDDA 4ZPVR 1HHSA 1S9GA 4C8LA 2LVWA 1IWAA 3VF0B 3ZO7A 2ZM6J 3SYZA 2ZDPA 1Q16B 1NJWA 4RW7B 3DLEA 2VOPA 1RWNB 2YWKA 3H42A 2R7QA 1Q78A 2MDAA 3OL9A 1VGYA 2E5IA 3DGVA 2O5DA 2B8QA 4DSEA 2XY6A 5BXIA 3IS9B 2MQNA 5CXTA 1WKKA 5F8MA 4J9OA 2B3TB 2HFZA 4R5PA 1TP7A 4ELVA 2HHHJ 4ILRA 5B0DA 1DQ8A 4YDXA 1MN9A 5JUMA 1OS5A 3V6KA 4YDDB 4XPEA 2GAGC 1FXLA 5BJRA 2DHSA 4DZDA 5DGBA 4U96A 2XS7A 3EICA 4R8UB 1PBAA 5KFNA 3POTB 1RP5A 2D3UA 2Z4PA 4JBCA 4EMDA 1F5AA 3RBDA 3MWBA 1NM2A 3TJ8A 1J2VA 1T9VA 3R5GA 5IT4A 2HGLA 2YKMA 1IKVA 3IR5B 2N3LA 4P74A 1CS4B 1Q5VA 1HNXF 1IVZA 4OYZA 4DQIA 1Y00A 2E1PA 1VS3A 5E5NA 3AH6A 1ZYQA 3HHEA 1FKOA 4ED7A 1WTBA 3HVTA 2K1RB 1N32J 4M95A 2V8VA 3MAHA 1RT1B 2KTQA 3BSNA 2A2CA 2HFOA 2HNDB 4NOHA 3BSOA 4HT5A 3KK2B 3I0SB 2UUCF 3OL8A 4WXWA 2BMBA 2CQ3A 2DXDA 4ZVPB 4YP3A 3D3CJ 3MZIA 4ZCMA 1G3OA 4WFYA 1ZPVA 2PT0A 5HVFA 4LF6J 2MLXA 1VJWA 2ZBRA 4KHRA 3NNHA 3I0RA 2DT9A 4Y2AA 2HNDA 3JTOA 4DUYJ 2DRAA 2G4BA 5JXSA 3DRRB 2LQ5A 3B8HA 1K9MT 2XO7A 1X31C 1U2RA 4FYYB 2CG4A 4NI2B 3D1OA 3K59A 2BE2B 2FUG9 1REGX 2KHCA 2UV8A 3JYTA 2YX1A 5THWA 4CYUA 5E3RA 1T9YA 3M2RA 3BDEA 3PACA 4C4WA 1NRKA 3R7NB 2ROEA 3G9CA 1REVA 4TN2A 1N5TA 4KGMA 4NLDA 2FZKB 1DTQA 3CDBA 3B82A 1OQ6A 2GMLA 4ZVUB 3ZZ0A 4DLEA 1TL4A 1S6QA 2ZBPA 6FDRA 5ETMA 1FHTA 1YX2A 3H0PA 2D41A 4G65A 4J9UE 3R5JB 4TLQA 4KSEB 1RAIB 3H2LA 4OX9F 4Y2IA 4F67A 3V6HA 2PEBA 4RNMA 4AL5A 2YKMB 1VDHA 2HQCA 4IR9A 1WEXA 1Q53A 4QQBA 4PG5A 2WHOA 4LUBA 1V3ZA 1TFYA 4ZP8A 2FZCB 3L7OA 4DN0A 3IP0A 3KHHA 2AJ2A 5D0HA 3SI8A 2Q43A 1SJ4P 2GGPB 1WDTA 3DLGA 3VV2B 2DNGA 2V69A 3IR6B 4CLTA 3BYRA 1U1KA 2FYXA 5DDQC 4OX9J 5DM7Q 2ZBIA 2ZWPA 3AXMA 4FYXB 1NLKL 2WVEA 4JI0F 2RQKA 4NLRA 5GAEU 3G71S 4LF8F 1N4LA 3QJJA 1XJWB 4GKJF 2BJ7A 1UEKA 3HLUA 2CAJA 3LPYA 1LV5A 1M5OC 5KFWA 1HQUA 1NK5A 3DLGB 1LWFB 4ID5B 1RJJA 1RB0A 3MM5B 1FRJA 3ET6A 2WTFA 2OKQA 3GG1A 4M63A 4FZVA 4B3OA 1YHQS 4PUOB 1BD6A 4DV7J 4DUTA 1W7WA 3C6UB 3DKDA 3M8ZA 1F60B 2BX6A 2GQCA 1VIOA 4YY3J 4LRAA 3CCTA 5C42A 3VGTA 1BUXA 1KONA 1L3KA 2NSCA 4OLOA 4EK2A 5KOXA 1W26A 1UW9A 3T1YF 1N0UA 1JLBA 3MPUB 3MAQA 2PMHA 2F40A 4UW2A 2VQFF 3HHDA 1EETA 3VZHA 4GC7A 2JEJA 1Q95G 4AL6A 4DL0C 5F8GA 3QGIA 4OYOA 4QPXA 2YWEA 3KLEA 3VAFA 2AQ4A 3IAM9 1TK8A 1GFWB 1HQEB 3CCZA 5IXUA 3M8QB 1FJGF 2EFNA 2VFTA 3PRBA 3G8SA 1HNZJ 2ZC3A 1YRTA 1KQKA 1YJWS 4N47A 2PMWA 3U7JA 3IO1A 4CLYA 2DHAA 3BSCA 1BE4A 4LFBJ 2KT3A 1QD1A 2GA7A 2AU0A 4C11A 3UPFA 1IUJA 3MDFA 3CMAS 2F4VJ 2E5HA 5KG5A 3EDQB 5E3CA 4PG8A 5DZ7A 3KLGB 2UV8G 3IM9A 4B02A 1B0PA 4ZK7M 4PWDA 1CLFA 4U67Q 5IQQA 3EUNA 3GV5B 4UZCA 1P1TA 2EBGA 2R9LA 1BGXT 3GFZA 5ETPA 2V2ZA 4WWSA 4YUDA 1VBKA 2KRRA 4F2RA 4ATNA 2O3DA 5KFPA 1JLCA 1JLEB 1U24A 3BGLA 4IFYA 4LSLB 3U27A 1WOPA 3V4MA 2XM3A 3M05A 1C2PA 3BH7B 2DBBA 3T5JA 4KY3A 2QSFA 1TAUA 3MOZA 4A8WA 2HHVA 3MD3A 2IVFB 1NDKA 4ZN3A 3M8WA 2BKPA 3OL7A 4YOEA 5FDLA 3HF5A 1JLBB 4Q44A 4MAKA 3LOUA 1N48A 1DRZA 1YSJA 1LW2B 4J9SA 5CYQB 1UVIA 2BRKA 1XMBA 1N0VC 4DSKA 4ZVFA 2RMLA 4D3HA 5KG2A 5E41A 2B43A 4LRDA 2D9OA 2XMJA 4PZVA 3OTOJ 1XN9A 1N6QB 3QWPA 5MAOA 1QVFR 3C16B 1BQMA 4OYXA 2E5JA 2E1MC 3R2DJ 4JUZA 1R0BG 1KOOA 1PYOB 4HTIA 5HL7Q 2ADBA 3ISZA 4ECQA 1JJ2R 5J2MA 1VBZA 1U8WA 1Q5YA 1TKTA 3EDRB 3LF0A 5IC4B 4CTAB 4JI2J 5IOLA 2H1YA 2DRDA 1DARA 2KU7A 1JB0C 5F0WA 2ILYA 4CWBA 1WC5A 2F8MA 1RT4B 1VRUA 3M6XA 2QYCA 3R97A 1S10A 2BV3A 3TZXA 3FBCA 2NUUG 5DDPC 3TVYA 4QIGA 2FJVA 3DOLA 4WK3A 2VONA 3KLIA 3HFKA 2GHPA 1VK8A 3WIUA 1HBNA 4K4WA 1VLOA 1VMBA 4QR0A 1U48A 2XMWA 4JI1J 3PW4A 1MWYA 4OL8A 1ZM2A 3MTKA 4FNIA 1RUSA 3G6YA 4DR5J 2G2YA 3Q89A 4WKYA 2UXBJ 4BCAA 4AT1B 4DR1F 3DRXA 4EZ9A 3T9ZA 1VQ5S 2A6OA 1A9NB 2VA3A 1O8BA 2QRRA 1RT7A 5GVQA 4OZJA 5KFZA 1X5PA 3FBEA 1X9SA 2RKIA 1VQMS 1KC8T 3UDVA 4IUFA 1FNOA 3AJ1A 1NDCA 4FS1A 1QJHA 3BN7A 1AXQA 2MY8A 2UXDJ 5GMDA 2GJFA 1K73T 4KH1B 1FDNA 2YNHA 1OWXA 1FDAA 3I9V9 2BE2A 3SMZA 1SQGA 1YI2S 3C3LA 2ZZMA 2EKYA 3G6VA 3GFXA 3GPAA 1UWBA 4KGZB 1S9GB 4OI6A 4CZCA 4ED8A 2AD9A 1T0TV 5I3QA 4LR9A 3EYZA 1FK9B 4DR3F 1NSPA 3TEGA 1ZAXA 4PEOA 2YNFA 3DM2A 1C0UA 2CPYA 3TJ9A 4CLLA 4J9VA 2AJFE 2OPRA 1YJRA 3K5PA 5HAOA 5F8LA 3G96A 2ZE2A 3K2YA 2HQDA 5CH7B 5K8MA 3HHLA 4NLYA 1NZAA 3LPEA 1A0OB 3QFHA 1PAUB 4AE5A 5H9EK 2UVVA 4ZMMA 1TL7A 2V8PA 2VDHA 2W4PA 1TVRB 1TKXB 2OTLS 3DLBA 3ETMA 3RGIA 3TA0A 2B8PA 3UQSA 3KK1A 1D8ZA 3GJQB 2VC0A 3HVWA 1RWUA 2XZTB 3KLIB 3C6TB 3RW6A 1RA7A 1RHUB 3DFEA 5L9XA 2CPIA 2F8EX 4Y3CA 2QTWA 3QRRA 2BE7D 4KR0B 4DHVA 4NLUA 4URGA 3GE9A 2Q6BA 3DLKA 2DEIA 4M5HA 3VCDA 2FY8A 5A8RB 3Q8PB 2B5JB 1TUWA 2KFZA 3LANA 2IM0A 4QCLA 2XC9A 2V8DA 2NXCA 3N6LA 4DOZA 3O3LA 3UNGC 3WC0A 2BQ3A 4WFNQ 1IN0A 1Z2ZA 2DGWA 2GX8A 2PA3A 3CIMA 3PYEA 2DIVA 4DV2J 3IC1A 4IQMA 3MR7A 1S99A 1UPPA 4FF2A 1Y3JA 3W5ZA 1FO1A 3BKFA 1TL5A 3GJTB 3PHTA 4CH1A 1HFEL 5F8IA 2MQ8A 1G1XA 4HT7A 2WONA 3SDEA 4DR2F 4OX8A 2PD1A 2ACYA 3VWSA 3KJVB 4ZJOA 2DNPA 3HSJA 3R27A 1N34F 5KFJA 2HW3A 2HFVA 2LMIA 2C3OA 2OPRB 2DTJA 5KFXA 3PX0A 3IGVA 3Q8VA 2RQCA 1FFGB 1R31A 1P9YA 1WOOA 3TAMA 4OYIA 1S72S 3AD8C 4ALZA 1HBOA 4CO1A 3D67A 5E3PA 4X4SA 3IG1B 1LK5A 2CPDA 2CZ9A 3DXBA 1GAOA 2M5YA 3JSRA 3O8WA 2CG8A 3UE2A 4EO6A 2AGOA 2JL9A 4OZ0A 2CNNB 1S6QB 2JEGA 2ABYA 4W90B 4UQGA 2X3DA 2DITA 1W25A 5A8KB 3OVAA 3GIJA 2UUCJ 1D8YA 5LJ5Y 1H98A 1S76D 1KFDA 1VFJA 2XHWA 1C1CA 1T11A 3GIRA 1H6KX 5JVGQ 1JLFA 2EXUA 4M5IA 1FJGJ 3EGNA 1CULA 1DHMA 5A6WA 2FVQA 1D09B 2OD6A 2M2BA 2P6TA 4O3QA 1HWKA 3TJAA 3W64A 3MR5A 1CJTA 2ZNYA 4DPTA 3D6TB 3EZ5A 3G86A 5KFAA 2CDQA 1HNXJ 3FQKA 2QA2A 4N41A 1RAAB 1FXDA 3H98A 1RTZA 2AYBA 5AXKA 4R8UA 2OPPA 2AJQA 4P2SA 3HVRA 2FLNA 3WZ0A 3CCES 4L72B 2BJEA 1HNIB 1S48A 3HZEA 3AOCA 1T3OA 3MAAA 2RQ4A 5LT5A 1M1KT 2IVMA 2JNJA 4LQ9A 4RW8B 1HPZA 1YJUA 5CZVA 2XG8A 3ZZZA 4E98A 4DL4A 1BC6A 1FD2A 1JJCB 3EVWA 4WIIA 1XWLA 2HMIA 5J1NA 3VAHA 1RTJA 2MZSA 4U8VA 2DNZA 3NG8A 4J5OA 4DXLA 4X65J 4JI0J 1TKZA 5C25B 4GKJJ 4JI3J 1WJ9A 3OTEA 4OV6A 4UOHA 4O3RA 3QT8A 4IFVA 4PR6A 1E6VA 3U1MA 4CDIA 5B08A 3VGUA 2Q66A 2EFQA 4QR2A 2DRBA 5IZHA 3FSIA 1S0VA 3LP2B 3ZTQA 2E44A 5ETOA 2XYHB 1JLAB 3O44A 3IMQJ 3IR7B 4IH7A 4WJBA 4F0HA 3MMJA 1NJXA 1KBRA 3DDKA 2VD3A 1H0HB 4A46A 3MM8B 3V6DB 3P96A 3EE3A 2P9EA 3NAHA 3FDSA 5KT4A 1RI7A 3CJQA 4TY9A 4UOGA 3NNAA 3QLHB 3MEKA 1TKXA 3CULA 4NA2A 2AGPA 4LF9F 1RAOA 1KN6A 4DQQA 1HHQA 2GHWA 2V94A 3GYGA 4RBUA 2HHQA 2V8GA 1ZPWX 4MIWA 3T9NA 4Q0BA 1SKSA 3K5NA 4F8RA 2HHSA 1RT1A 3L3CA 1L5UA 2EFPA 3TUIC 2WOMA 3HKWA 2BE9B 5U47A 2J9EA 5A76A 1SH2A 3KK3B 1FRLA 3RTVA 4WCEQ 1XK8A 1RTHA 3HHLD 4GO5X 3Q83A 4AXIA 4RNNA 2HVDA 2M9KA 3IM8A 2RRBA 5HANA 1LWEA 2HHPA 3MECA 3I4PA 2ZC4A 4KRWA 1RBLA 3BQ1A 1HARA 1BXNA 1FX4A 2IA0A 2PA8D 2Y1IA 2EEYA 2FB0A 1U8SA 3D5MA 3THTA 4PG4A 4F04B 2J6TA 3G6ES 2OFHX 2OFGX 5L1IA 3H2UB 1H7XA 2DY9A 2KB2A 3MUVP 5HBMA 5DG7A 4Z37A 2R2TA 1SI9A 2RD5C 5D3GA 3V2UC 1KOHA 5KFTA 2KM8C 5GAHU 4HACA 3BPDA 3TOQA 2CPJA 3ZZOA 4DX8H 1WC6A 5KFHA 3C46A 2UXCF 4X4RA 5J2PB 1HL6A 3HP6A 1OYDA 4MH8A 2P6SA 4KV8A 2W7PA 2J6SA 4ZP6A 2NXNA 2DR7A 4CO0A 4V19J 5D78A 3QFWA 2W4DA 3R1HA 2ZOFA 1HBOB 4XAKA 2IA6A 2CNLB 3P5BP 2HQIA 3RW7A 3CMES 4B3MJ 1AW0A 1RK8A 1DFDA 3W3SA 1U26A 4I7FB 1AB8A 2OO4A 3TUJC 3PDNA 3ZTRA 4UY85 1WG5A 2R42A 4DPWA 2XMAA 1DZ5A 4J9PA 2GW8A 1SH0A 2PDAA 2CQHA 5IT0A 3T5LA 4KHPF 1NSKL 3GR1A 1ULRA 1F1BB 4F02A 4FYVB 4RLEA 2KXNB 2FIUA 3JSBA 1S7IA 4KBIA 2BEFA 3PY8A 3ZFVA 1RHMB 3SCKE 5HQMA 2CZVC 3M1VA 3W8PA 1UP1A 5KFFA 2W7OA 5KFGA 5DRKA 2FQQB 2JLFA 1VBYA 1S0MA 2MLZA 2ZUAA 3R7SB 4FDFA 4AUKA 3HHLC 3M2VA 2W2PP 3NP5A 4WYLA 5LXYA 2YNHB 5IWAJ 4ZJQA 1CQMA 2CQ0A 3DU5A 3FVYA 3CJ3A 3K89A 4DZ6A 2DPJA 2VV5A 4FXWA 1KS2A 4PWUA 1Q8BA 3EJMA 3CJ4A 2N82B 1R8AA 1HNIA 2W9BA 4NXNJ 4JB8B 2L9WA 3AFGA 4WFXA 3CJ2A 4IO1A 1UZHA 3I82A 3PYFA 3R5CA 5BYRA 2H48B 5D0RA 2BKNA 3CC2S 4ZVSB 2UUAJ 3PCOB 1P9QC 2RUGA 1DTTA 1RHQB 1Y5NB 5EGYA 2E5LJ 4B3TF 4ZKAA 4K4VA 3NCQA 3W61A 4D3GA 1S1VB 2LEPA 1NK7A 1TVRA 4NLWA 4RPFA 2GQ2A 2YKPA 4DV4J 3BBBA 2ASDA 2GAHC 5GAGI 3UVJB 2C2DA 4YMEA 1C1CB 1WF2A 3D9BA 3WIVA 1NCLA 2QLXA 1I6JA 4UF4A 2XSFA 1FKPA 2VPWB 2QL9B 3DDNA 1U6BA 3KUHA 1N6QA 5IS2A 1UMJA 4LT6A 1I1GA 1LFWA 2V2KA 4NCBA 1RXOB 2FLOA 2V4RA 2UU9F 2CKWA 3RB6A 2AEJA 1S59A 2D9PA 2RS8A 3IGNA 1A7GE 3KMQA 1RT6B 3PIOQ 4ZLPA 3MGJA 2RRAA 4TU7A 1KVIA 2PGCA 1WHXA 4QWDA 2ROPA 3CCVS 5HP1A 4NLQA 3OJUA 3M1VB 4ZHRB 3NMRA 3D0HE 1MWZA 3A3OB 1DTQB 2V9KA 4RW8A 3CPWR 5KG3A 1JJ4A 1R89A 3K57A 4CLZA 2Q6CA 3BGRB 4ZPWR 4I2PA 1BQNB 1HI8A 1S9EB 5KG0A 2FLLA 3B78A 5KFLA 4R0EA 2ZH5A 5ETKA 3UO0A 1ZTWA 2B4OA 2J9CA 2C3YA 4I69A 4PQUB 2I5JA 1SBRA 3KK3A 5DGAA 3PKMA 1ZOTA 2J7KA 5K14B 3DI6A 1YTYA 2AEFA 4USIA 4CM2A 1NBEB 3PJWA 5IM0A 1XEZA 2GMJA 3FC9A 4MIAA 5D15A 3KG4A 1VR6A 3PX4A 2C2EA 1AZSB 2QA1A 4MK9A 2DY1A 1S9EA 3PEJA 1FJEB 3W8GA 2H65B 3GLJA 1IBKF 4K4TA 2VUGA 1MW7A 1YG0A 2DISA 4YR2A 4OIXA 1WF1A 3I4HX 2HHHF 1SQFA 4CTAA 4DSLA 2B9WA 4O3NA 1FI4A 3IBFB 1QLNA 1NNDA 1S79A 2DYAA 2CQDA 2WCXA 3FRYA 3NBPB 1SH3A 3ONQA 2LEAA 5LM7E 2J76E 1UKUA 3QYYA 5C5JA 2R7OA 4C9DA 4RW9B 3CD5A 2G0JA 2KXFA 4C0BA 1Q7YT 3PJ9A 4DUZJ 2ZBQA 2WBRA 2GIFA 1VHIA 3MPVA 3DRSB 2P5VA 4B3SJ 3BO2A 1P8GA 3FUYA 3PXGa 4DX6A 2RQMA 1TL7B 2FVRA 2ALYB 3UN5A 2XQCA 3DGPA 1RCOB 5HVGA 1RT3A 5B0CA 1F2HA 4ZVEA 2XS2A 1NAQA 2WSEC 4RWXA 5F3ZA 4YR3A 3FZ2A 2J8SA 3MM6B 5DLGA 2NCKL 3A8EA 5KT7A 2BXJA 2HS4A 4I2PB 1UW4A 4WIQA 3Q2SC 3VR1A 4QWCA 2MKKA 4ILMA 2BM1A 1Q7LB 2QIFA 5EWEA 3H25A 2MSTA 2DIUA 2FZGB 1MMDA 2JOQA 1FRIA 2IYIA 1S6PA 4NX9A 4R0JA 4P7TA 3L9ZA 4USVA 5C2CA 3J7YU 4YHHF 1D9FA 4B3MF 3N0VA 4KIAA 5I3UB 4GRSA 1WHWA 4OX6A 5I3PA 2RDDA 1U0HB 4USJC 1VYAA 2HMIB 2P2CB 5A8RA 4DL2A 4TQSA 5EN1A 2JC0A 2FY1A 4LBHA 1Q1KA 3D1HA 3KNGA 1TMJA 1SC4B 3N6NA 1QAIA 1YJTA 2OPSA 3UD3P 3AAWB 1HNZF 3CCRS 2J7UA 2UUBJ 1IR1A 3I55S 5HMWA 3W5YA 2BVZA 4NL5A 5ITHA 3PNIA 4BC7A 2H51B 1XMQF 1NK4A 3MCNA 1TKDA 1OPZA 2GC8A 3WQPA 5IV4A 1AROP 2W9BB 4LSLA 4U9RA 1VC5A 1XR5A 2XS5A 2WONB 2IFXA 5DO2A 4DLGA 4K7QA 3DU6A 4CP5A 2UU9J 2FVSA 2CYYA 4QBUA 3CVKA 3OXGA 1R43A 2FJAB 4CLUA 7AT1B 7FD1A 3NCPA 4QPTA 2YWFA 1SVDA 3TAMB 4KPCA 3H20A 3RAXA 4K0KJ 5J1EB 4DSFA 3CCSS 3HMJG 4DF8A 3F41A 3FZBA 3KTQA 4DFMA 5CYMB 4JV5J 2IDLA 4ANCA 1RAEB 2GMHA 4P71A 4LSNA 3OPKA 3QQCD 1MNEA 3DLKB 3MURP 2UUWA 2VB6A 3UR0A 1M1HA 4Q0BB 3O2IA 1UCNA 3MMBA 4PQAA 4UUWA 4QIEA 2ZNZA 2W8LA 2H4WB 3R3TA 4CO3A 5KOWA 3RBEA 1S6PB 2NXUA 3NLCA 4RBVA 2ERRA 4C2MA 3CJ5A 3CC4S 1NSQA 1R8HA 2OMLA 4LF9J 2K3KA 3VGSA 1MSWD 5KFEA 5DQGA 2HHWA 3I31A 1V3SA 3BF4A 3M8SA 1YJVA 1Q82T 3R5DA 2VPYB 3AHPA 4C97A 4YQWA 4WFZA 1G4CA 1FJ7A 5IWAF 4B3RF 2A18A 1U1LA 4B9UA 2YH0A 3DHXA 5E7OB 2ZM6F 1QVGR 2K3IA 1GT8A 2XZDB 1U09A 3F0NA 4DPUA 1S7HA 5KAKA 1DQAA 1I94F 1QAJA 2ZHBA 2Y1JA 1F3VA 4DR6J 1S4EA 1ZAWA 2HRYA 3EVMA 4OHYA 1VRTA 4YN3B 3P3DA 1RWWB 2UVUA 4F4KA 3NMAA 1DURA 3NS7B 4OI1A 2J0SD 3NKYA 2ZUGA 2UP1A 3ILJA 2SXLA 3M2UA 4M8LA 2EG1A 3TVKA 2A6MA 2CPZA 2H9ZA 3OQ2A 2E5LF 1K0VA 1RTJB 4LQ3A 2ZH7A 3Q24A 1RYRA 2CNOB 2BABA 3CJSA 4A8OA 4DPXA 4U7UK 3UWTA 1U1MA 3P8BB 4FXDA 1RT6A 2FHMA 2ZH6A 3VQTA 4CO2A 4O23A 3KLVA 2LECA 3T1HJ 1PYTA 5A0YA 2M52A 4GMKA 3GV8B 5CYJA 3AQOA 1JMTA 3OR2B 3TQEA 2M4MA 2OIHA 5L46A 2QYGA 3EX7B 2IY5B 3GYNA 1DAXA 3UDLA 3C8YA 4V19X 1BQNA 2BJ8A 3I5AA 2H3EB 2IVYA 4CYUB 1UVNA 2NSBA 3TA2A 1EIYB 3JAMU 4ZVQB 1TL1A 1FVQA 1KDNA 2W2OP 5D0GA 3Q86A 2CPFA 4LF7F 2VBWA 2B9YA 5DG8A 4ZVRB 5D8HB 3DHWC 3DI6B 4HHUA 2XLJA 4XDDA 4P2FA 3E01A 1QUPA 4LR8A 5LSRA 4HTJA 2KYXA 3CTRA 2LEBA 2YKNA 2LDIA 1QY7A 1B64A 3NY0A 3VAIA 1RKJA 2HWTA 2YWGA 2YXLA 5C24B 3KFWX 3V81B 1FF2A 4ENOA 4ED3A 2MGZA 1CJKA 2KYZA 4PG7A 2WOMB 3N28A 4J7CA 4DV1J 3KDNA 2AIRB 1XTZA 3HVAA 2C2RA 2EK6A 4ELTA 1X4BA 2KZMA 2E7WA 4F4WA 4OZ1A 5AXLA 2K7KA 2XMMA 1RT5B 4Q43A 1U1NA 2OJ3A 3S6EA 3DXSX 2F9DA 4BDPA 2ATCB 1F9HA 3IRXA 3S8SA 1VRQC 1MG7A 2KN4A 4A8SA 3K8VA 2QV6A 4M5DB 4X84A 2XGQA 2YH1A 2V2VA 2P9CA 4DV1F 2DPIA 4K0KF 3ZZYA 2GHVC 2ACMA 2WVDA 3V6DA 3CEDA 4FVMA 4F36A 3LAMA 3VZIA 2P9GA 2CPEA 3RR7A 5EX0A 4JOUA 1REVB 4U7UD 2XCPA 4E0DA 2AKWB 4PAAA 3KJVA 3TA1A 3CF5Q 4AQYF 1LK7A 3PW5A 4LFCF 1CJVA 2CJBA 2J8AA 3BJYA 1D9DA 3KLHB 3KYLA 2E29A 5A2QU 2NQPA 1EARA 1RBOB 4I6WA 3SXLA 2FC9A 3KJNB 3UR3C 2FDNA 1RYSA 2XMTA 4X62F 3KUGA 5GAHI 2ZJRQ 1J5EF 2ZOMA 4GO7X 4O4RA 1Y4ZB 2FJBB 4DBQA 1S1TB 4X64J 1ACMB 1RTHB 4UT4A 2JEIA 2HNZA 3UDEA 3RU0A 1M1GA 1TELA 2F9JA 2HRTA 3OFEA 2AMCB 3SBMA 2VBZA 1NO8A 1URNA 2JZ5A 5KG7A 1SC6A 4WP3A 3ULHA 4DR1J 2RKIB 2VQEF 4YHHJ 2PI5A 2HWIA 1FRKA 1XMOJ 1NZ8A 2HGNA 3H2VE 3T1HF 1BWVA 2B0GA 4P10A 4FF4A 2DCUB 4B3TJ 2GVDB 3DOMA 4G1QB 3G4SS 2Q3PA 4KFBB 1JKHB 3FEYB 5DG9A 4HL9A 1UA0A 2YNIB 4LF8J 1TAQA 4PPDA 4KO0B 1FWLA 4M5DA 3TWZA 1U49A 4B9SA 2NPIA 1C0TB 1H2TZ 2VFUA 3M2VB 3U1NA 3KG1A 4BBYA 4ZLNA 4KV8B 1N5SA 2CNKB 2C3MA 4FKXA 2DHXA 2EFVA 3HHLB 4N56A 1LKZA 2VASA 4PWWA 4UTGA 2D3O1 4DUZF 4NEYA 1HWLA 2EKNA 1H2UX 2Z56B 1RTDB 1FRMA 4IOBA 1RAHB 2B7BB 2KJVA 2PIIA 2RHQB 3FGVA 3GFHA 4LIRA 2GO9A 4YEAA 3VAJA 4MKYA 1LW0B 2HQ3A 4X4UA 1TKZB 3MMBB 3OTBA 5ETTA 2VHGA 4J9QA 1M5VC 3PJXA 1WG1A 3BQ0A 3DRRA 3LGHA 2G13A 2IBKA 2MB0B 4LF1A 1Y0HA 3THVA 1KWMA 5DQHA 2RJZA 4C98A 1UJ5A 5F8HA 1WNEA 2W2MP 3U02A 2PI4A 1Q8IA 2MLYA 3HZGA 4P73A 3LWLA 4J9MA 4F4YA 1NSAA 2XBPA 4CH7A 1JLAA 2Z30B 2C1EB 4P75A 1KD1T 2R7VA 5T41A 1FXRA 4OZLA 3OR2A 6AT1B 3UCZP 1CQNA 3B4DA 4DFPA 4YB6A 1Q8KA 2GV1A 5GADI 1R7IA 1BMQB 1WHVA 2VZ9A 3LP1B 3QJLA 3VVUA 5HI7A 3OUYB 3US5A 2CUYA 1GMUA 2FC8A 3D3BJ 4KFBA 4DU8A 1JIHA 3QIDA 5GAGU 2AX0A 1CEZA 5G0RA 8AT1B 5K5MA 3KKFA 2DNRA 5DETA 3HXMA 4DV2F 4F7VA 2M0GB 1H2VZ 2B4UA 4RW4A 4FS2A 2MZJA 4WXOA 3A3NB 4I56A 3LP1A 2KH9A 4JI6J 3J81Y 2QG9B 5G4DA 2AYEA 2LDYA 3L7UA 1O5JA 2XY7A 5BR8J 4B17A 4B3RJ 4F0MA 1TV6A 1A6LA 5DJBA 5E3QA 1CJKB 4ZVTB 4MK8A 3R2CJ 3GILA 4ZPDA 3UD5A 5JMNA 2X7IA 3PHEA 1SKRA 5HO4A 1AUSL 1BHNA 1BQXA 1JNRB 3QWUA 1NEEA 3ENAA 3T41A 2YBVA 1OY8A 2RRNA 3I0SA 4M5JA 3PYDA 2XCAA 3NRBA 1CC8A 4ZJLA 3QT6A 4FVCA 4L74A 4NA1A 4DL6A 4I4BA 2AT1B 2G0IA 3C66A 4JI1F 2VDIA 3LAKA 2ZD1A 3DLLQ 5F8JA 4WFAQ 3K8WA 4JI2F 2BUNA 3PX6A 2CA9A 1YBAA 3ISND 1HD0A 2EC2A 3D7SB 4MIBA 4N8OA 1D3WA 1RLDA 4DR2J 1VC6A 2C22A 4DSJA 2BJDA 3NWRA 3RAMA 2CQ1A 3N79A 1HW8A 4B9MA 1WC1A 2E5GA 1UJ6A 3EGWB 1PJ5A 3AJ2A 4WFBQ 3HJFA 1RWMB 2G1DA 3BM7A 2OTJS 3FSXA 3O6QA 1RABB 1MROA 2MKHA 3FRZA 2KVQE 3C15A 2WAQD 1S1XA 2VG5A 3KXDA 5DZ6A 4ZCKA 4QW8A 3S01A 3W7BA 2DNHA 3M7VA 3A13A 4IRDA 3DLJA 2AHOB 3MMCB 5JJBA 2ZHAA 5IM0B 1N5QA 5J2QB 1PKUA 2WVCA 1UAWA 1K47A 2XTJP 3J81U 4K4UA 1DY3A 2AJ1A 5C25A 3MFHA 2Z2MA 2RF2A 4A47A 3NS6A 3A12A 4JI7J 1RA6A 3HULA 2C28A 1VQ8S 2VJVA 1UTAA 4NYPA 3CCUS 5C7PA 1UVKA 2X1GA 2RUSA 2WB1D 5KT6A 2GVDA 3PFOA 4IDKB 4N7TA 2FLPA 4FF3A 2R7TA 4LFBF 4EBDA 3ZXWA 1RQ0A 3CC7S 1DJ0A 5D4OA 1QE1B 4JV5F 2HBZB 2KXHA 4RW9A 3WHIA 4NCGB 2AYMA 4KKOA 2IIHA 2UVWA 4WTYA 1TU0B 4W98A 3TZYA 2FJWA 1IJEB 1FX2A 2WW4A 2BBEA 3JXOA 4XDCA 1U47A 5HQLA 1RAJA 1KP6A 5F3TA 3ET6B 1YLXA 4MJKA 4ECWA 2Y1RI 2MKSA 3FCVA 4DU7A 3I87A 1TMMA 3C6TA 3F73A 1IQZA 1PAEX 3GQCA 4CT8A 3IXQA 2H4YB 1N5YA 1UWAA 2JFKA 2IAJA 5D77A 1S1VA 2OPQA 4ECRA 3PVXA 4RW7A 3CO0P 1HKAA 2UXBF 5J2MB 3UVJA 3K7RA 1PJ7A 3IAS9 1N8RT 2N7YA 4HLBA 2LXIA 1RAGB 1VJQA 1MWQA 4KGVB 1VK3A 4DWIA 4ITSA 2LFVA 1Q86T 3DRPA 5B0FA 2HHTA 1N5YB 4PABA 5I42B 5LMNF 4Y28C 4EGLA 5L9NA 2CRLA 3FCHA 2PMZD 2DXFA 3BKTA 1PG5B 3CCJS 2Y9HA 2Y0BB 2F8HA 2V6AA 3NGDA 3SCIE 2MQOA 5A2QY 2AP6A 3LP0A 1FRXA 1IKYA 3EMTA 2CIMA 2Z0GA 5G0RB 5L39A 4OJHA 4XK8C 3BEGB 3OFFA 4ELUA 4NCGA 1FJCA 2BDPA 2QLFB 4DQSA 1OSCA 1N88A 4QYZJ 1HNVB 4WZMA 2WSCC 2X1FA 4K59A 1ITPA 5FIIA 1ZZFA 1EX8A 3H5YA 4RL1A 4WP8A 5ETLA 3ZTPA 2CJXB 4CIOA 3QJPA 3QZ7A 2L41A 3CD0A 1M5SA 1RBAA 4FNHA 2K7JA 4U95A 1RDRA 1CJVB 4CLWA 4NXNF 1U25A 2QL5B 4EEYA 1VI7A 2J7WA 3HHKA 1G6BA 4QIWD 3IN5A 1IR0A 3FQLA 4YFUA 3W65A 3J80Y 3C19A 4WYWA 2RT3A 3KLFA 2YNFB 2DNOA 2XI3A 3DM2B 2V68A 2AX1A 2CJ9A 3C14B 3QAEA 4CT9A 1IBMJ 4CO4A 4LBPA 1OPIA 4RUHA 1XR7A 2Y1LB 1CJTB 1NUEA 3LH2S 8ATCB 3SSSA 1APSA 3SIPB 2DR8A 3W62A 4L3KA 4Y2MA 2VOOA 1TK5A 1NXIA 1K0TA 2W24A 3VTIA 5HQ8A 3FK4A 4EWTA 3F56A 4XPCA 4QU6A 3C14A 2DVIA 1KVJA 3N5BA 6FD1A 2XY5A 3JAMY 1H74A 4USKA 1OMSA 4CM0A 1SL0A 4Y0FA 2HNYA 3W9IA 4CCHA 2JEFA 1X4CA 1QM9A 5AE1A 4RW6A 1QUVA 2CXEA 3AJDA 1YRXA 4O44A 1SPBP 2CADA 2FVPA 5KT2A 1H73A 4U7CA 1HA1A 2HZVA 1HBNB 3CMQA 3EGZA 4LF6F 2GVZA 1MU2B 3D0GE 3R7BB 1B7FA 5FJ4A 2HAFA 2BW2A 3CJ0A 5HJYA 4M94A 2Z8QA 5KG4A 3E2EA 2F3JA 4KJIA 4A8FA 4NRUA 1V6HA 1JQGA 2K06A 4KYZA 3NGKA 4P6QA 3VAGA 2C3UA 3JYTB 4H54A 4DV5F 1M90T 3RR8A 1AUDA 1C1BA 1LW0A 3KDOA 2W25A 3MD1A 1NK6A 4HHJA 4Q45A 2YX7A 3T6BA 4NWBA 2HRUA 4DV3J 1NMEB 3BN4A 4HI2A 4KPYA 2OPSB 2HBRB 5AJ3F 2KFNA 3J7AN 3M30B 2XSJA 4M5NA 4PUOA 2QA4G 3ZNJ1 3AXKA 3BDPA 2HLUA 1JX4A 3I96A 1L3VA 4B9VA 1LEOA 1MROB 2DK2A 2KDOA 1X60A 3QLHA 4ZITA 3RB0A 4M5KA 2YQ1A 4Q8FA 2MPUA 3B6BA 2MQPA 1XMOF 4XIUA 3LALA 3SQOP 1E6YA 1C0UB 3E01B 3GSIA 3JS9A 5KFSA 3DOLB 2O67A 4F4AA 4PG6A 3FNNA 2QMXA 3GIIA 2ASJA 2ZJQQ 3E51A 2GGPA 1T9XA 3IRWP 1FFWB 4C8YA 3PYGA 2IJNA 3AY0A 4OZNA 4Y65A 5A8KA 4LREA 2PEHA 2AGQA 4N5SA 1EQ0A 2CDRB 2RS2A 2COLA 4W92B 2VBYA 1TUGB 3QRQA 2PE8A 3W63A 4RUAA 2YKQA 3MR3A 3SZ2A 1LWEB 1WF0A 3BS9A 3DMJA 1RGVA 3H5SA 3MTJA 4ZS6A 3ZZRA 5KT3A 4TY8A 2GIRA 3OFHA 3MM5A 3G87A 4DV6F 5KFIA 1TR0A 1X7VA 1ZZNA 3T1AA 4B3OB 1ELOA 3OSNA 2KRBA 2WVBA 2QT7A 1JJHA 1VC0A 5CD4H 2RILA 1X8DA 3BPSP 4MKBA 1RWKB 1WD6A 3RG6A 1X4EA 5C42B 4HKQA 1C1BB 4OMFG 1UWBB 4X4TA 3RBXA 1U1QA 1O51A 5JVHQ 3N01A 2E7XA 4ANEA 2CVIA 2B6AA 3MM9A 2VODA 3IBWA 3MPYA 2WB4A 1Q79A 1LWCB 2YKAA 2FVCA 3OR1A 4ES1A 1T05A 1JXEA 1S0NA 2XLKA 2HBYB 1PCAA 4AL7A 4MFBA 3Q8SB 2IAJB 3M2RB 4NLSA 3MM7B 4QW9A 1XNRF 4ICLB 3W2WA 4H4OB 1LWFA 4ID5A 4C8OA 2OEKA 2V34A 1NB7A 2IM1A 3QT5A 3FSYA 2W1BA 4I7FA 1GTEA 3AB4B 3D1QA 3GB0A 1VQ7S 4FN5A 4DV0J 2HWHA 3W2VB 1GTHA 5HN0A 3ICLA 3AD9C 4ECZA 3L7PA 2H5JB 3EGVA 5I42A 5EX3A 3Q2TC 3C15B 2IDEA 2C2NA 3OXFA 4J9KA 2JX2A 3H8YA 2DCLA 4LFAF 2EWHA 4O3PA 5HLFA 5B0GA 2CQPA 3QBCA 3D6MB 4OFZA 4AYBD 1JLGA 1H7WA 4LVNP 4F3MA 4IG3A 1XNQJ 2J0XA 4DV0F 3JQKA 1RT4A 1VRUB 1U2CA 2H54B 4FP9A 4I64A 1KQFB 4X4PA 2R7RA 3P6YC 2YQ0A 4UQTA 1B0TA 5T7LA 1IBLJ 2BJ9A 4G6VB 5EUHA 4F4XA 4DDFA 3R6LB 2YNGA 4AXJA 4OX7A 1SL1A 4RX6A 3CCWA 4LF4J 1Q4RA 2DNQA 2RAQA 4ID8A 3SV3A 2IRUA 1FNXH 3Q22A 3JB9k 2FJEB 2M7SA 1MMLA 1RSCA 3WC2A 4O0NA 1HQUB 2HNYB 2FHJA 3HD1A 2EG2A 4C8MA 1B70B 5CA5A 3KMSA 2R7SA 2G9OA 4PCQA 1QSYA 1RWPB 1ZS6A 3GTYX 3NOGA 1EP4A 4RKUC 3C6UA 1DTTB 1RLCL 3KJQB 3TR5A 3HVTB 3RYLA 4C7QA 4WTOB 2ZVIA 1XERA 3BREA 1ZETA 3CD6S 4V1Ak 1S1UA 3L4BC 1HWJA 4FKYA 3W2WB 1SJFA 2Z2YB 2VKRA 3BR9A 3UCUP 1WC0A 2DGQA 2X1AA 5K8PA 2VA2A 3E3XA 2L9DA 4KB7A 3D0IE 4LSNB 4DV6J 1R0CB 4EYHB 4LF5J 1HBMA 3MCMA 4UY8T 4OZ2A 5F8NA 2CQGA 1N52B 1IM6A 2Y8YA 1S1UB 1F3FA 2MYFA 2OD4A 3T19A 3EXYA 2KI2A 1UEVA 5J2PA 2XSJB 5HROB 1PC4A 1WELA 1HQ2A 4EBEA 2JWNA 3EVOA 4KQZA 3N5FA 4BHQA 2GCFA 2CJKA 3AD7C 1I3OB 2YTCA 4C11B 4ZHRA 4X66F 2JVOA 3G6XA 3CIZA 1Z1ZA 1NKBA 3H59A 3OTDA 4K4SA 2QMWA 2MTLA 1VCTA 2LKZA 1SKUB 4QJVA 4ZOSA 1E6YB 4GVBB 4TYAA 3MCOA 5ETQA 3SEOA 1WDDA 4CLSA 1IKXB 4ED4A 3PR4A 1BY9A 2QGFB 1W2IA 1YVFA 3ELHA 3DRSA 3TW0A 2VG7B 2V9WA 2OUGA 1MU2A 2MSSA 4L75A 3PG9A 3K58A 2XO6A 3CCLS 1H72C 4ZPBA 4P2MA 1SJRA 5DM6Q 2DJWA 2KZZA 3H7HB 4KTQA 2MQMA 3ILIA 5AJ3J 2NUHA 2HBQB 1GEHA 3IA0A 4MK7A 2IMWP 4WKRA 4DX7A 2B4PA 4H4KA 2QO3A 1T03B 4JYAF 4YR0A 4DS5A 3NCRA 1R27B 1VIXA 4OJ1A 4OYBA 1SUQA 4BWJA 1Z2LA 4AD6A 2HLTA 1J5EJ 4YB5A 7FDRA 1Q81T 3CJRA 2LU1A 4C3MA 5I3UA 1ZH5A 4DR6F 3G8TA 5HATA 2QN6B 2NPFA 2F7VA 3EXCX 1KHWA 2ZD1B 1VQLS 1V9OA 4ZLLA 3H40A 4QU7A 2HHXA 2NLWA 2VFRA 1S1WA 1DLOB 4A8YA 1FT8A 3R6GB
chains in the Genus database with same CATH topology
3TVZA 3QZ8A 4I68A 1IKWA 1TL3A 2L08A 3SCJE 3Q8QB 2KG0A 2VPXB 5KT5A 4MYTA 2R2RA 4DR5F 2ZJPQ 4N76A 4O3SA 2LXFA 5HMYA 2J0QD 4IQXA 1UL3A 1NJIT 1TQLA 5L8RC 1KTVA 4YY3F 4KC5A 2LQBA 2XMUA 1WI6A 4I67A 1DLOA 1NK8A 3MOJB 4C3LA 4ZA1A 2B7CB 3WDOA 4HVZA 2BRLA 5ADZA 4Q2MA 2DO0A 3S1TA 2OLWA 2RIJA 1QAXA 3DMJB 1U7LA 1R0AA 1GH8A 2V5HG 2APOA 4DL5A 2M88A 4ZP7A 3OJSA 2OAUA 4M1KA 3KK1B 1S9FA 5D4LA 2EVZA 2RDIA 2F1FA 3QO9A 4IKAA 4A8KA 3TYTA 5A8WA 5FD1A 3TAQA 5HP1B 2DR5A 1R8BA 1UFLA 3DRPB 4NZ0A 4QZVB 3JTPA 5B0BA 3QPIA 4ZPTR 2ZBCA 2NZ4A 1GXLA 3N9UC 1OO0B 3MM9B 2DH8A 2B9XA 4N77A 2MZTA 4C0HA 4O0IA 2YNGB 4TKTA 2VG6A 2BM0A 1CSJA 3GWCA 4DF4A 1YJ9S 3HHNB 2B51A 1KRPA 3HDSA 2UUBF 2CQ2A 4X65F 1SV5B 5B0EA 5GAEI 1XR6A 2Y0SD 4DQPA 1HMVA 3QAUA 2A3JA 3M32B 2AF6A 3E8OA 2ILZA 1SJ1A 2LQJA 2XULA 4ZVGA 4B9LA 3BSAA 1NU4A 1EP4B 4URSA 1NK9A 2QZ8A 3O1LA 3W2VA 2AYGA 4IRCA 4TXSA 1Y7PA 2DB1A 4K50A 3VAMA 3AQPA 4DL3A 1S1TA 2R2UA 1L3SA 3PW7A 1S6UA 3M9NB 2O01C 4WU2A 4JI6F 5F9LA 3PO4A 4X64F 2MY7A 2CPHA 2FTRA 3I56S 2MMYA 4NCBA 1OSDA 3PRDA 4C8ZA 3PO5A 3ISNC 4OHZA 4KGKA 4Y2KA 2BQRA 1SXLA 5L1JA 2WBMA 4RBTA 4U6PA 1JLQA 5CHCB 1KEKA 3PW2A 1GX6A 1T8EA 5A0YB 1L3UA 3SV4A 2R4FA 1K1SA 2ZKTA 3K5OA 4GKKF 5KFKA 1JXLA 5L1KA 3K0JA 2R8GA 3GG0A 4IYQA 3BGUA 5GMKa 2ZZMA 2R8IA 4EZ6A 4UOCA 5KFMA 2KM8B 1P27B 1W2BR 3CDEA 4TU9A 5L38A 2FHJD 2ZH2A 2RU9A 3PFEA 3J7A1 3LGMA 4I6YA 1DQ9A 1ZAVA 3MMCA 4QWBA 3MR2A 3OSPA 2FJXA 3NAIA 4OI4A 3LUYA 1TK0A 5E3AA 2RU3A 4K2XA 3V81A 5IT9Y 4KT0C 3LGNA 3MF5A 2KKHA 3MM7A 4Y34A 4PQUA 4K4ZA 3M9OB 4EBCA 1G2EA 5DDOC 2XI2A 2ZH9A 1HD1A 3HM9A 1KSPA 2CVEA 3DYAA 4QIFA 1K8AT 2HPUA 3ENWA 4F3OA 2M8HA 4ETXA 4Y00A 1QE1A 3MCSA 4QYRA 3AA8A 4NLVA 4DEZA 2UZAA 2M3DA 1NJZA 3SFGA 1KQSR 4NYZA 2XEXA 5HLFB 4TNOA 4B9TA 1E6VB 3UFCX 3POTA 2VG7A 4ED1A 3OXLA 5E33A 1Y9OA 5LSLA 5H9EJ 5EDWA 3HKZD 5J1EA 3IWLA 3TI0A 3SQGB 1JWWA 1FCAA 3J7ZT 3CD7A 2ZVSA 4BWMA 2HFNA 4JI8F 5EHHA 3PIPQ 1VQKS 2NREA 1VQNS 2LCWA 4J9LA 1XBWA 2EI5A 4IH6A 1GQEA 3D28A 4HDHA 2MHEA 2FGOA 1S0OA 3QIPA 4IH5A 1JLCB 3ZZTA 3GV7B 5H1SV 3NS5A 1FRHA 2MXYA 1N36F 1SKWA 1IBLF 2YQ3A 1X4HA 3QMQA 2DGUA 4RU9A 4ZP9A 2B5JA 2R2SA 1C4CA 2MQLA 3CO9A 4L6V3 3H4BA 4HYKA 2CFXA 4CH0S 2BQUA 4DS4A 1SQEA 3QIPB 3R1LA 2YKOA 3CDUA 1HI1A 4C8NA 1JK9B 4IFVB 4RZRA 3HK2A 2VG6B 4PXDA 4KHMA 2CPXA 3TO8A 1NKEA 2ZKUA 3LP0B 2EK1A 3I5BA 2KG1A 3KOAA 5T14A 3MUTP 5DDRC 3DN9A 2EW9A 4URQU 1N32F 1LOUA 1BQMB 1SJ3P 1Y3KA 3I6PA 3BQ2A 1FTRA 4LVOP 2HS0A 4DSIA 3D54A 3KLHA 2JLGA 4DFKA 4ES3A 1T05B 3ZZPA 3MM8A 3PM9A 2DGTA 4HDGA 3KWMA 1X5OA 4Q8EA 1ZTTA 4J9NA 4I1TA 2R8JA 3TP2A 1HBUB 3ENQA 3MHYA 4NZ7A 3MXHP 1FNMA 1KR4A 1RTDA 5BYSA 3MEGB 2DNNA 5M2UA 3FFIB 3VAKA 1EETB 4DR4F 1FESA 3FEXB 1WG4A 2W9CB 2OH2A 4NLTA 4BC9A 2CQ4A 3DC2A 3KLFB 4WZQA 2BZ2A 3JSMB 3CT9A 1NKCA 3F44A 3BO4A 5M2RA 2ZDOA 3NWGA 1GNKA 4ZPAA 4DR7F 4A8XA 2XWYA 2LA6A 4RUCA 3FFIA 1JNZB 2IM2A 4OV1A 1IM4A 1RT7B 4IG3B 4LJMA 3J7Z5 1T03A 4O4GA 2D3OR 4MTPA 2YY3A 3MMAA 2FPHX 1HMVB 2ZH1A 4PXBA 3THPA 3TUZC 2MJUA 4PWDB 1ZM9A 3IFEA 3TRGA 4LF5F 2E66A 2OPPB 4TYBA 3RRGA 3K5LA 1S77D 2IJFA 1FD8A 5D3GB 1GX5A 2WSFC 2MGZB 2CQBA 2XGPA 1UJ4A 1FVSA 3T3FA 4CO5A 1IKWB 1TL3B 2IMOA 4WU3A 5IQ6A 3TAPA 4DG1A 1U1OA 5LSOA 2JJ4D 5AE2A 3BZQA 2HAIA 5KFOA 1U1PA 2AJ4A 2QSWA 4QIVA 2NR0A 2HG4A 5HMXA 2GNKA 4PXEA 2EFGA 4ZVHA 4DUYF 4F4ZA 3CSKA 1B0VA 2AWZA 2J9DA 2O1PA 5F0UA 3SSQA 2DH7A 3NBPA 4ED5A 4LIWA 3TX8A 3L09A 1WEZA 5L1LA 3MUMP 1U6ZA 2BYCA 2V4JA 4C0OC 4LF4F 1UVLA 3M6VA 2QLWA 3OBIA 5D6GA 2CQCA 3ETOA 1LXJA 4B3SF 1RTIB 3CWJA 4H4MA 1U6FA 5K9FA 1K1QA 3FJ2A 1JLEA 4IFYB 1FTCA 4NRTA 3ITHB 3RRKA 1PGZA 1HYSA 4X4QA 3DOKA 4A4JA 2RNEA 1YQHA 4OJ3A 5EWGA 1RTIA 4QWAA 5KFYA 5KFBA 2QA4S 3M8RA 4RU2A 4B9NA 1SJQA 1VQ9S 3DYAB 1WACA 1AFIA 2PO4A 5F41A 2UVRA 3MEEA 5B7WA 3MECB 2DNKA 2RH3A 4X2BA 4Q2LA 1IBMF 3GYXB 3IG1A 1SB6A 4XO0A 3U1LA 2N4CA 2N3OA 2LYVA 4NLGA 2JDJA 4MMOA 4Z2XA 5KFUA 4DQRA 4C8KA 1V3RA 2B6AB 3SQGA 1CC7A 1X0FA 1S49A 3KG0A 2X51A 3HI9A 4IG0B 1NH7A 1F0XA 1NJYA 2KJWA 1NK6A 2XLKA 2QE5A 3B4MA 3LO3A 3T5HA 3ENVA 4OHVA 4P7VA 1R6YA 2VFSA 4DFJA 4PPZA 3AA9A 3EPIA 3SFUA 1TL1B 2Q1LA 5J1PA 2E1AA 1R3NA 1URRA 1C4AA 3JTNA 3RZAA 3CDWA 3GIKA 1J5OB 2J0WA 4RW6B 3H4DA 2PFFB 2HVIA 3DOKB 1P6TA 2W7AA 5HMZA 4F26A 1HI0P 4N8NA 5E0OA 2OPQB 2GIQA 5KTQA 4QWEA 1QSSA 2RF2B 2FGCA 2OSQA 5I4MA 4DPOA 3UW1A 3T6JA 1FE4A 2HNZB 3HX9A 1RT5A 3DRYA 4F50A 5SUHA 1GXUA 1X4GA 4ZCLA 4LFBF 4QR1A 1FDBA 3QGGA 1FK9A 1UEUA 2B4VA 1D9AA 1M5HA 4KKOB 4R25A 1Q8LA 2M70A 5EWFA 1PSDA 5DS7A 1U2FA 3OVBA 2JC1A 2ZE2B 3M6UA 4ECXA 1KTQA 2U1AA 5BR8F 1N54B 4ED2A 1WWHA 4WE1B 3UCGA 2I9SA 4WK1A 1HW9A 2JLEA 2BA9A 2WW8A 4C3KA 4E8UA 2R8HA 3CCMS 1VHFA 2XLIA 2UXDF 1C0TA 5A6PA 1QAYA 1Y5IB 2E9ZA 3MI7X 2XWXA 3M2UB 4DG1B 1NK0A 4JV1A 1YGYA 3PKYA 4ECYA 4OI0A 4LMZA 1R0AB 2KT5A 5MLCV 2POKA 2X1BA 5J2NA 3IWNC 4KE5A 2HGMA 2HZCA 4IOAQ 2JSXA 1U1RA 2B56A 1WI8A 4DV4F 1H3DA 3VALA 1HNWF 4PRFA 2I38A 2OMOA 4O4GB 3JSYA 2ADCA 4G1IA 3K5MA 3MMAB 3R5BA 2VBXA 4TLRA 2M8DB 5E2QA 4DV3F 5CZXA 1AFJA 2I8EA 2E1RA 2N4DA 3OVSA 5CYMA 4JI7F 2E9RX 2R8KA 2A10A 4IOCQ 4G1QA 5LJ3Y 1JKHA 4H4MB 1UVJA 2YVSA 1YWXA 4OJGA 2XMKA 3H5UA 3Q0AA 3NL0A 1FA0A 2ZH3A 2N7CA 2V8HA 2R7UA 3I9ZA 3KHRA 1HYSB 1F5BA 3G8QA 4FPRA 2VC1A 2K8GA 2GQQA 2DNLA 1CVJA 1VQSA 3C2PA 3KNAA 1LXNA 2PC6A 2E9TA 2VFVA 3TQ1A 1T94A 2I5JB 4F3QA 5M2PA 4Y6IA 1IKVB 2ZFHA 5KFVA 2ZITA 3N6MA 3PR5B 2FHOB 2I2YA 5KFDA 2ZHOA 2MKCA 2A2DA 4IDKA 3MR6A 1L3TA 3EPGA 4ED6A 1M5KC 3GR0A 2QFJA 2EC0A 3DLEB 5SZTA 3H5XA 3M8QA 3GFYA 3BR8A 4JV2A 1PO6A 1MMNA 2IC3B 1N56A 1JLFB 5CCMA 1CPZA 2UUTA 4K5RA 5K8OA 1YRUA 3HO1A 2W9CA 3LP2A 3KHGA 2C42A 3EZUA 5F9NA 1GXTA 3J7YI 1RT2B 1UVMA 3TANA 3WX4A 1FEEA 4ZPCA 1S97A 2XNRA 1ZBTA 2IRXA 5B0AA 3OW2R 1D1UA 3M4XA 2ATLA 2J9DE 5LXRA 5H9FJ 2JHEA 3V5RA 1NH8A 3CUNA 1HWIA 3A1YG 4ECSA 4OLPA 3OFGA 3X3UA 3SSRA 1RT2A 3CB4A 1YIJS 2DR9A 2EPIA 4BS2A 2CJQA 4PKDB 4DN9A 1DBDA 1D0EA 3N4WA 3ZZUA 5KFRA 1VQOS 3CJKB 4DMZA 3CDAA 3UD4P 3QGHA 3PV8A 2D7SA 3O5TB 5CYQA 4ERDA 3QO9B 2VPZB 3I5CA 4I6AA 2AW0A 1IKYB 3I0RB 2HVZA 3HPOA 4TY8B 1X5SA 4QOTA 2OSRA 2DGSA 1T02A 1LFPA 2RSQA 2MKJA 2HYIB 1HR0F 1R8PA 1SIZA 2C3PA 4MYUA 3DNCA 1FKPB 1UFWA 1T7PA 3T5KA 4A48A 3PZPA 1X4DA 1FE0A 2LLZA 4KAIA 1LWCA 3OR1B 4X4OA 2ZZNA 1XNQF 4RWWA 4Y2CA 2ASYA 4MFBB 2GJIA 2L48A 1S1XB 2VG5B 4NMLA 1IXKA 2J6UA 1HBUA 2L3MA 4F25A 1Z4UA 4NPOA 3OHAA 4K4YA 1X4FA 2JH3A 4AFFA 3BGRA 4R5PB 3UDCA 2FD2A 2I0XA 3BGFA 4USHA 3KLEB 1QTMA 2JVRA 4HEA9 1XC9A 1TZ0A 1M0SA 1RKIA 1S4FA 1YITS 4G3IA 2DHGA 1UA1A 5B09A 1CG2A 1JLQB 2D1CA 2ASLA 5AE3A 3OL6A 1P1LA 4IO9Q 2JRSA 4K5SA 1WHYA 2GJ2A 2IYGA 3Q23A 2MJNA 1KC8T 5FLXY 4TU8A 3BO3A 4I0WA 3CCQS 4OZ5A 3M9MB 4YB1P 2GO8A 1X4AA 3KHLA 1TUVA 3TNVA 4MKAA 2V4QA 2XB2D 2R7XA 1KFSA 2NYIA 4JI5F 2DGOA 1NHUA 1TV6B 5LL6d 2MZQA 1VRTB 2RB7A 1HPZB 3VQSA 1KLMA 5AXMA 4DL7A 2IHR1 4KO0A 4EU0A 1WEYA 4OHXA 1VLYA 1VQ6S 3SCLE 2BACA 1FEHA 2DNYA 2DO4A 4J9RA 1IQTA 1FERA 5DQIA 1X5TA 2R7WA 4NXMF 2O66A 1J5OA 3M30A 4EYIB 2ALZA 1RT3B 3HT3A 3LWMA 3BB5A 2HS3A 3P5TL 4Q7AA 1F5CA 3RAQA 4EO8A 1IJFB 4FXVA 4NLXA 2RDJA 2U2FA 4NCAA 1G7CB 3KLGA 2DNMA 4IRKA 2MHNA 1QSLA 4I2QB 2V4JB 4G1PA 1TKTB 2A1BA 3IS9A 3M8PA 3FMBA 2MQQA 3V6JA 1R8CA 1ROFA 2L9NA 1KHVA 4ILLA 3M32A 4EUVA 2EBEA 5J2QA 2BOPA 3GSDA 2LA4A 3M8PB 2W8KA 3OLAA 2W9AA 2E1CA 5FDLB 4WF9Q 3CJKA 5KG1A 2V0NA 1X9MA 1KLMB 2OP5A 4NZ6A 4O44B 2KT2A 3DCAA 1KLNA 3MFIA 2J5AA 3CE8A 4X4VA 1HBMB 2D74B 2HIQA 3MEDA 1SUQB 1VBXA 3RB4A 2ROGA 5CQGA 2LU2A 2MZ1A 5DLFA 1HHTP 3PW0A 2ZH8A 2XMVA 3OLBA 4A8MP 4X4NA 5HBMB 3QGPA 2IBOA 4ECTA 2PN6A 4CNZA 3M6WA 3GZ7A 4OI2A 4DV7F 2FJDB 2FHKA 3FMWA 3MEDB 4OQJA 4ECVA 3OV7A 2DH9A 3PEHA 1KQGB 1IKXA 1FKAF 2IRYA 2DGVA 5C24A 1H38A 1LQ9A 3R5AA 5D4PA 3OUYA 1TFWA 2W4CA 2VL1A 2WK4A 4OI3A 4HH0A 2KVIA 5K14A 5KFCA 4IR1A 3MEGA 1F2GA 4CI0B 3CXCR 3RB3A 4FBUA 1OQ3A 1T95A 2XNQA 3DLHA 2AV5A 3MM6A 1KNZA 1O0PA 2D3ZA 3OTOF 4F2SA 1VQPS 2K1RA 2Z2LA 3V4IB 3MEEB 4RNFA 4ECUA 3JSMA 2K2PA 1SL2A 4EFAC 2DGXA 1YJNS 4DJBA 4FF1A 1BWEA 4RNOA 2VH7A 4NA3A 2YWHA 5KG6A 2VKZG 5LMUF 1T3NA 4TQRA 4UUXA 4HH1A 2LQ9A 4ZCIA 1U4BA 3V4IA 1S1WB 1Y5LB 3OTCA 3SDEB 3CGIA 2YNIA 4ZDNA 2LXUA 2AJ0A 1WTFA 2BANA 2XZWA 4CQ1A 4IG0A 3GMGA 2Q79A 3IWXA 3LQVA 5K8NA 1X9WA 2IC3A 4CNYA 1HNVA 2KO1A 1PILA 3NNCA 2GFFA 4NYOA 3OHBA 2PSZA 2I1RA 3WBZA 4WE1A 4ES2A 1X0PA 1LW2A 2BANB 4OHWA 1VQYA 3S7RA 1U45A 2F4VF 4B08A 4RNHA 1S6OA 2NS1B 3GIMA 2MKIA 2CQIA 2CZ4A 2G0CA 4FBTA 5J2NB 5IFMA 5GADU 2DD8S 1SIWB 4A8QA 5HROA 1F9FA 4ED0A 2QEXS 1M5PC