4RBVA

Pdua k26a s40gsg mutant, from salmonella enterica serovar typhimurium lt2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
QEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGGSGGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica serovar typhimurium
molecule tags Structural protein
molecule keywords Propanediol utilization protein PduA
total genus 20
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rbvA00
3N79A 4QIEA 4RBVA 4OX8A 4QIGA 3SSQA 4P2SA 3I96A 3PACA 2A18A 3MPWA 5DJBA 4OX7A 4PPDA 3SSSA 4QIVA 3H8YA 5L38A 4QIFA 3NWGA 3BN4A 3IA0A 2G13A 3DN9A 3CIMA 4OLOA 3VCDA 4RBUA 4LIWA 3MPYA 4DDFA 3CGIA 4OLPA 3SSRA 4RBTA 2A1BA 3NGKA 3I6PA 4P7VA 4AXJA 4OX6A 3DNCA 2EWHA 4AXIA 2A10A 4P7TA
chains in the Genus database with same CATH superfamily
1R0CB 3CJ4A 4NYZA 3IM8A 2HMIB 4HHHA 3R5DA 3M9OB 3GV7B 1D8ZA 3EICA 2ASLA 3QRQA 1DQ8A 2MKCA 1S10A 1YLXA 2YQ3A 4IUFA 1LFPA 1SPBP 1T9TA 2Z4PA 2CZ4A 2UXCJ 3C15B 1T9YA 2KXNB 3PIOQ 3OTCA 1UW4A 2D3OR 1PO6A 4ZVSB 4F50A 2ZH4A 2AJQA 1M5OC 2NR0A 5AXLA 3KK2A 4GO7X 3K5OA 2DXDA 2I5JA 2DO4A 5AT1B 1C0TB 4Z37A 5DLGA 5CYMB 2L08A 3JXOA 5FLXY 4WFZA 2W01A 3MEEA 1N5TA 3BGRA 3Q22A 2XS5A 4PXEA 2WTFA 1LWFB 1T95A 1C0TA 2MLYA 3M2RB 3PRVA 2UXBF 3EXYA 2GIRA 1VFJA 2OPSB 4ZHRB 1FKOA 2HS0A 4F2SA 1JKHB 1HMVB 2G1HA 3TANA 3WIUA 1RYSA 4KPYA 2RU3A 5B0BA 3LP1B 4NLQA 1RA7A 5L1KA 1AXQA 2UUCJ 2PI5A 2J0XA 3SCLE 2EFVA 1B7YB 1IKYA 3KDOA 4ZVGA 1NRKA 3BM7A 3EWGA 3T6JA 2YX4A 4ECVA 3S1TA 2MEWA 5KFZA 2V63A 2F4VF 4JYAF 1Y10A 4ZN1A 3LAKA 1LWCB 2HPUA 3A3NB 1FFSB 4ANCA 2ZH3A 2DH9A 3BSOA 5C25B 3OPKA 3WQPA 4DV7J 4A8QA 2MZTA 1IKXA 3CWJA 2XMJA 5HO4A 4YB7A 5F9NA 2M0GB 4OYWA 2BQRA 3ISND 4FN5A 1WF0A 5DDRC 1TUWA 3MI7X 3FUYA 2A2DA 1TUVA 2JHEA 3KLIA 5HVFA 1N5SA 2QA1A 3J80U 2GFFA 1W2BR 4ED1A 1YJRA 1U26A 1AA1B 5EWEA 1U1LA 2Q79A 1JB0C 3QZ8A 2C3MA 1S1XB 4X4RA 1TR0A 2JZ5A 1TV6A 1UP1A 1UFLA 1H7XA 2Y9HA 2R7SA 5L38A 4PKDB 2OJ3A 2ZZTA 3A8IA 2EC2A 3H25A 1T3NA 1CULA 2BE2B 3D5MA 4J7CA 3BGUA 2ZM6F 4DDFA 4BDPA 3OL8A 3EPGA 1B0PA 2M3DA 4JI7F 3G6XA 2MJNA 2EFGA 2RJZA 1RWOB 1VRUA 5KTQA 1PJ6A 2FJXA 3MR6A 5HROA 4X62J 1V3ZA 4TU8A 3I9ZA 1XK8A 1AROP 5T7LA 3O3LA 4A4JA 3MFIA 4ECZA 2C2ZB 4WIQA 1AZSB 2LQJA 1SH0A 5IV4A 1Y3KA 4MYUA 3CJ8A 4J9PA 2PIIA 2C3UA 2H1YA 2CAJA 2DJWA 4H4KA 3T5LA 3H42A 2IC3A 4ANDA 2KFNA 3HF5A 3AODA 3BKTA 1M5KC 1S1VB 1S57A 2MQNA 1MMNA 1S6UA 3PNIA 2XMAA 4JV5J 1Y5NB 4C0HA 2HVIA 2BR0A 2MHNA 1UFKA 3R97A 2GVZB 3QFHA 4C0BA 4KHPF 5C2CA 3RGIA 1AFIA 2QFIA 3A4TA 1X4GA 4UW2A 3K5LA 2ROPA 1X0FA 3I87A 3HPOA 1YZ7A 2R8HA 1B64A 3HVRA 3PR4A 1OS5A 4NA2A 2HK3A 1LXJA 4CLLA 2UVRA 1X5SA 3OTDA 4DU7A 4OI4A 2R2RA 3ENQA 1FRXA 2CADA 3IP0A 2NZ4A 1ZM2A 4ED7A 2QIFA 4R0EA 9RUBA 2OKQA 2PI4A 1UJ4A 3A1YG 3OLBA 3VZHA 5L46A 4WFAQ 4NYPA 1JJ4A 3BO3A 4GKJJ 3KK1B 4GKKJ 1FJGF 4NLWA 4RL1A 1S0OA 4PG8A 2W2MP 2RKIA 4DV7F 1U4BA 1KLMA 4KSEB 3DYAA 5KFDA 2M70A 3EVMA 4RW8B 1RAOA 4HACB 4U8YA 1HD1A 1ZETA 3DGVA 1N8RT 2C28A 4J9QA 3HZGA 2VZ9A 2EWHA 2UZAA 4HLBA 3LP2A 2CIMA 4M5DA 2HRUA 3NY0A 1BLUA 4K5SA 4J5OA 1AT1B 5LSOA 2E7WA 4TY8A 4AE5A 1XNQF 4DEZA 4YDDB 2E9TA 4JI8F 3WX4A 4QOTA 4C6AA 4W98A 5KG6A 4QJVA 1N34F 3CMAS 2ZEJA 2BJEA 3MAAB 3TEGA 1S9EB 4IG0A 1XQIA 3Q23A 4DSFA 1NCLA 5J1EB 2OPQA 2YNFB 1HWKA 3AD9C 4KY3A 2Z8QA 4UUWA 4WFBQ 1P1LA 2XYPB 5G4DA 5ETLA 5KFLA 2FB0A 3DHXA 4LF5F 3CT9A 4ZCKA 3FEXB 1Q0NA 1IKWB 1C0UB 4P2XA 4A8XA 1S4EA 2NXJA 2AJ4A 4U95A 3SFGA 3GSIA 5KFNA 1FE0A 2CPIA 2OHDA 4OHWA 3KLHB 5L1IA 2V8PA 3ZTSA 5B7WA 3Q8SB 5A6PA 3NMAA 4AL6A 2JFDA 2MLZA 5B0EA 3SXLA 3ZXWA 2CQCA 2ROGA 3BS9A 1FEHA 3QT7A 5M2UA 4JI4J 1I1GA 4DV0J 2CG4A 4PCQA 1Y00A 1I5OB 4RUCA 1HBUB 3SV4A 4I56A 4FXVA 3JTOA 4OZ2A 4EO6A 2DR6A 1UA0A 2FJAB 4WFXA 3NWGA 4I2PA 3AY0A 2RAQA 2QX0A 2P2CB 2WZ1A 3BGLA 2DNKA 2QMWA 4ELUA 1REVB 3FQKA 1WTBA 3HM9A 2HQ3A 3RW7A 1FHTA 1CPZA 2XMWA 1MWYA 2VHGA 3CCRS 4R8UB 3G6YA 1U1KA 2LA4A 2FVCA 2G9OA 3N6MA 3AXKA 1K0VA 2WVBA 4IO1A 3CJTA 5IC4B 3W60A 2V4RA 1HR0F 1UL3A 2A10A 2J6UA 2DD8S 4CO0A 2BXJA 1S9GB 3O2IA 2GVDA 2IA0A 4ZS6A 1KSPA 1UW9A 3MR7A 1TFYA 4DN9A 1MU2B 4A47A 1T05B 5E3QA 4I67A 1RP5A 2ZFHA 1GMWD 2CJBA 1NLKL 2DBBA 2FZGB 4CRJA 1L5UA 4ERDA 2OEMA 2WBRA 4C8ZA 4F25A 3ZZYA 3DLGB 4HHJA 2V0NA 3HJFA 1LOUA 1JKHA 1WSVA 3TVYA 2KKHA 3NKYA 4AQYF 4DQIA 1JLEA 3MECA 3HT0A 2OP5A 2UUAF 1RT2B 2VPWB 5E3AA 4UUXA 2E1CA 1F1BB 4NZ7A 2IDLA 5BR8F 1S49A 1I94J 1IKVB 1GMUA 1OSCA 4CLZA 2M9KA 4TY8B 1SJ1A 3GB0A 1J27A 4IG3B 1RWWB 3JSYA 2LKZA 7FDRA 5K8NA 1ACMB 2IMWP 3V6HA 2ZWOA 4ECSA 3KLGB 4CI0B 5AJ3J 4LSNB 2PC6A 3QAEA 4WWSA 2KVQE 2ROEA 1N6QB 2DNGA 4USWA 4C2MA 4LF4J 4JV0A 2IM0A 3ILIA 1MU2A 2R9LA 3P5TL 1I94F 4RUHA 3KUHA 3N28A 1LK7A 3NEKA 1N32J 1YJWS 2YNGA 3HHKA 1PYSB 1EARA 1NK8A 5I42A 1W7WA 3OUYA 4OYMA 2AWZA 3CC2S 3CF5Q 1LWEB 4I6AA 1TFWA 3LGNA 3POTA 3MM9B 3CD7A 4J37A 3PKYA 2XCPA 2ZOFA 3L7UA 3GE9A 4F0HA 3BBFA 2ZBCA 3CCUS 4K2XA 4K2JA 1SI9A 1S7HA 1TL5A 3BZQA 3CDUA 3L7OA 5A0YA 2KFZA 2E5HA 1R6YA 1SUQA 2IVYA 3DU6A 4WKRA 1RAEB 1FXDA 3QO9A 2GX8A 3DFEA 4ED6A 1Y0HA 2C22A 4IR9A 4JV2A 3NP5A 4Y28C 2EXUA 4F2RA 1EETB 3H5XA 1X4HA 1VBKA 4DCPB 2GQ2A 1L3UA 1A6LA 1TL1A 2QE5A 5L8RC 2L41A 2W24A 2FVSA 4B9LA 2Z2ZA 4RX6A 3MOJB 1QE1A 5FDLA 1JXLA 2IFXA 2K3IA 2RNEA 2VG7B 1XMQF 1RBLA 2WSCC 3MCSA 3M1VA 2HIQA 5JUMA 4NLVA 4LF5J 3NL0A 3DXSX 4UQGA 2CVIA 3LGHA 4X66F 3H5YA 3EVWA 5KG0A 4JUZA 4QPTA 4NMLA 3IN5A 4C7QA 4Y2MA 2KN4A 3DHWC 3CSKA 2FHMA 1GX5A 2LU2A 3IR6B 3LO3A 3CCMS 1U45A 1T03B 1KVIA 4CLYA 4OHYA 1C1BA 1SH3A 2XYGB 3CEDA 3EZUA 3QT6A 4LJMA 3I0SB 4CZCA 3D6FB 4NEYA 3H90A 4WFNQ 4YUDA 2CNKB 2XGPA 1RB0A 2W9BA 3RB3A 2ZOMA 1N36F 4Q45A 2BOPA 2ZKTA 1PJ5A 3Q8PB 2HHHF 1BQNB 4LBIA 4QIFA 1RWVB 4ZPAA 2V2VA 4M5JA 5ETKA 2D3O1 5D78A 2Q66A 3DLKB 3FCHA 3N6NA 1CEZA 2MYFA 4Z2XA 3NWRA 2OFGX 2WW8A 3D1OA 1TMJA 2FY1A 3F73A 4N41A 1S7IA 2FZCB 1WC1A 2AJ1A 4ECYA 1HNVB 3O5TB 1PAUB 1VQ7S 3EPIA 4QWCA 1FDAA 5F3TA 4J9SA 3KTQA 3I6PA 3WDOA 1X31C 5KT6A 4IRCA 4P71A 3ZNJ1 5HVHA 2QA4S 2BJ3A 5IS2A 3NBPA 2R7VA 1YJUA 4JI6J 2B51A 1BQMA 3E01B 1C1BB 2DHSA 1FKOB 2QT7A 1Q5YA 3I0RA 1M0SA 3IO1A 4CT8A 1VQ8S 3MM7A 1LWCA 5D0HA 2OELA 2JC1A 4PQUB 2ASDA 2PN6A 3T5KA 5AE2A 1EB0A 4P9SA 4S0MA 2H4YB 3FFIB 3FEZA 2CWXA 3RB4A 4Y65A 3Q8VA 2BBEA 4HI1A 5EHHA 3Q8UA 3HT3A 4ZJQA 1NJXA 4ILLA 3GFYA 4NLOA 4USVA 3SEOA 3DGPB 4ES1A 1ELOA 4NLXA 3J81j 1RZMA 2V34A 4IDKA 3ZZTA 4F3MA 1H3DA 2H4WB 3ZTPA 2MQLA 1R0BG 4DBQA 4ECRA 2BQUA 4B3SJ 2B0GA 1SC6A 3G96A 4U96A 4Q8EA 1LWEA 2XSJB 3DDNA 4DV6F 1XMOF 3HSZA 4YB5A 1HIYA 2N7YA 4OI6A 4PAAA 3WHIA 4LBHA 2DEJA 4DUYJ 2W7OA 1SL0A 2WAQD 2YKMB 2AYBA 4ICLA 5I4MA 2M4MA 2EG1A 5A2QU 2ZHBA 2EFNA 3H8YA 4MFBB 1FK9A 4MK8A 5KG4A 5RUBA 4X65J 2Z2LA 1NKCA 3M2VA 2NXNA 4WKYA 3R1HA 1VRQC 3H20A 3KFWX 3SV3A 2XC9A 4J9NA 1SH2A 2DHGA 2WOMB 1RADB 2CPJA 1S59A 4NCGB 1S9FA 4TVAB 4RBTA 2ZH6A 1SV5B 4XK8C 1FKAF 1TL7B 9ATCB 1F60B 1EQMA 5KFQA 4P2FA 2R7RA 3FK4A 1B7FA 1JJCB 1SV5A 4BHQA 4X62F 3CCQS 1S97A 4NCAA 1F0XA 3FSYA 5DGBA 1B0TA 1VQSA 1Y9OA 1YBAA 2KVIA 3R5GA 3UDCA 2ZHOA 2ZD1A 1F5CA 1UPMB 2HEKA 2LQBA 5C7PA 4DQQA 4LFAJ 3PX6A 4WTYA 5HVGA 2NS1B 1X5OA 1YVFA 1XIQA 2P9EA 7AT1B 4GC7A 4OI2A 3WZ0A 2NQPA 3MEGB 3ETOA 2EG2A 4DUZF 1RAIB 2R7UA 2BEFA 1YKWA 3JTNA 1RT3A 4YP3A 1XR5A 4OZ5A 3AA8A 3MM5A 1FRMA 1S9GA 2PT0A 4O3PA 3B78A 5KFSA 2XLIA 1T94A 2ZJRQ 1TKZA 3GONA 4EBCA 3RR7A 1UJ5A 4K4SA 3PO4A 4I68A 3GPAA 3DLKA 2NSCA 3CDEA 3H2UB 1H6KX 4ZPWR 3V4IA 2XEXA 4HTJA 1YJ9S 3IBFB 1U0HA 1S1WA 2FHKA 3HX9A 4FYYB 2XZTB 3D0GE 2J8AA 3CVKA 4J9VA 4OZ1A 4C8KA 3G9CA 4GKKF 1K44A 2WCXA 1LW0A 2GHWA 2H5JB 3L4BC 1GMWA 2ACMA 4KGXB 4QIEA 5GMEA 3ZTOA 4IQMA 4GMKA 4QW8A 4X4QA 2AX0A 5CZVA 5HMYA 1XC9A 1DQ9A 1D9FA 2KDOA 2V8HA 2DR5A 2F9DA 1UJ6A 3HZEA 3CJQA 1RE1B 2QLBB 2RRNA 3IXQA 4QW9A 4DL3A 3JAMY 4OX9J 5IV3A 3D9BA 1FXLA 3CXCR 5SUHA 1CJKB 5B0CA 5CYMA 3M6VA 4QBUA 3DOMA 1XMBA 1WC5A 3JYTA 2RDDA 4LFCF 3E01A 4MYTA 2DPIA 2KG1A 3H98A 4ZJLA 3SSRA 1XBWA 3OXGA 1RTJA 4IFYB 4F04B 3QGIA 2FJWA 1FA0A 5AE1A 1Q1KA 1FDBA 1U0HB 1U24A 4W4MA 3W63A 4FDFA 2V2QA 4EU0A 4PPZA 4F0KA 2ZUAA 2GA7A 1MW7A 1FRHA 2YKMA 3H4BA 4DV2F 3K2YA 2AX1A 2OLWA 2B8QA 3VF0B 1BD6A 3UQSA 2R8KA 2NLWA 3IBWA 4HVZA 4K4UA 2W4PA 4YY3J 3KK1A 4RUAA 5B0AA 2HSEB 4KH0B 4X65F 1U2RA 2P9GA 3ZFVA 3D1HA 3I4HX 5A0YB 1PC4A 2G4BA 5LXYA 5GAEU 2GGPB 2QL9B 4PUOB 2HKEA 4TNOA 5C25A 2ASJA 1F5AA 3MCMA 1U48A 3DOKB 3ILOA 1VBXA 1RSCA 1EETA 4B9NA 3GP9A 4DL7A 1RA6A 3NNAA 2D7SA 3M2UB 2R2TA 3J7A1 5M2RA 1X8DA 3GV5B 3MM8A 3GTYX 5EUHA 1XMQJ 3HP6A 1RT4A 2EFOA 1H38A 5LSLA 1RISA 4X4VA 3FKBA 3FBCA 1IN0A 3PDNA 3IRXA 2MKSA 3KKFA 3QT8A 3UNYA 2O67A 2COLA 3M2RA 4RU9A 3OV7A 4DV4J 2HBYB 2SXLA 4CLTA 4LQ9A 3ZNUA 4DV3J 1RHMB 5J2NB 4CT9A 1DARA 4QWAA 5HK4A 2HHTA 1TL4A 4KKOA 3BQ1A 1FK9B 1MSWD 2Y1JA 3AA9A 5GAGI 3J7YI 2Z58B 3BEGB 1WUUA 5KT7A 2E44A 1HBNA 4KFBB 4LT6A 2GVDB 4C8MA 3UN5A 5DZ7A 2ZJPQ 1ZM4A 4DPTA 3MR5A 3H4DA 2KRRA 4IH5A 1QAYA 4DR2F 3QWUA 4TXSA 4DJBA 2HG4A 2CPEA 5IWAJ 4TYBA 2RSQA 3GIJA 5AJ3F 2QGFB 3BQ0A 1S1UA 3M7VA 2EBEA 1FDDA 4O3NA 2VUGA 4OHZA 2QN6B 1FWPA 1HWLA 2F63A 1GXUA 3D6TB 1E6YA 3HCXA 1JLBA 2HQCA 3BSCA 4ED8A 1N32F 4DL5A 2HQGA 1H0HB 4X4TA 3FVYA 3G6VA 3VAMA 4ZCLA 1SL2A 3UCZP 3QRPA 1NDPA 1YDLA 5EX3A 4DV5J 5DJBA 5CCMA 3RBEA 2Q1LA 2LQ8A 2RRAA 3IG1A 2I2YA 1ITPA 3AB4B 3OR2A 2OD6A 1C4CA 4R8UA 4BBYA 2IPOB 3QIDA 1S79A 2OGUA 1N6QA 3SDEA 1NM2A 2ZH2A 3I5AA 4WP9A 1AFJA 4NI2B 4DSEA 4CM0A 1BE4A 1HBOA 1HQUB 3TZWA 5HL7Q 5BYRA 4F4AA 1WI8A 3HFZB 2CPDA 1IQTA 3OFHA 4ITSA 4Y6IA 2E5LJ 3D1QA 1Q78A 3DI6A 4OYZA 2VPYB 1L3TA 1N33J 2DNYA 2R7WA 1WKLA 1IQZA 5ETOA 4ZOSA 1FVSA 1YBUA 4MKVA 2MKKA 1WG1A 2M5YA 5F0UA 1P27B 2Z2MA 1RT7A 1FJEB 1JXVA 2XI3A 2CQIA 2QLJB 4DL6A 2AYEA 5DQIA 1X60A 2HAIA 2BV3A 1RT7B 2FHOB 3ITHA 3DRRA 1X9MA 3WC2A 3NCQA 4KR0B 2HFSA 4XAKA 1G6BA 2DIVA 2VASA 3MM9A 4YN3B 3JSMA 1HBUA 5JXSA 3S7RA 1QJHA 2OSQA 3NAIA 1SXLA 4NLTA 4BWMA 1G2EA 1AB8A 4TQSA 3HHNB 1RU1A 2LXFA 3OHBA 2EC0A 1T9UA 4G1QA 4DU8A 2BKOA 4PWWA 2WW4A 2BJ8A 2G0JA 5KFVA 4B08A 2GJFA 4GO5X 4A8OA 1TVRA 4ZKAA 3RRGA 3JS9A 3C6UA 1WKJA 3OTEA 3TOQA 4CO4A 4USKA 1REVA 4USMA 3Q0AA 2EKYA 4UY8T 4JI2J 2W8LA 3J7Z5 4F4ZA 3PM9A 4RKUC 4BS2A 2GC8A 3KG4A 1XTZA 2KT5A 3MPDA 5F8JA 2V2ZA 8AT1B 1ZA2B 4JI4F 3PKMA 1VQYA 3LP0B 2Z57B 1GXTA 1IJEB 4YMEA 3K5MA 4RW6B 2IAJB 3BPDA 2VFRA 3R8YA 3WIVA 4I1TA 1YITS 5E5NA 1VIXA 2YNHA 1T11A 4DSIA 1VI7A 3KNAA 3GLJA 3RU0A 1N0UA 2MMYA 3DMJB 1N52B 3M8QB 3QSIA 4ZCIA 3QYYA 5D0RA 1X5PA 5F41A 3DLGA 4WK3A 1Y11A 4R5PB 4UY85 5KT5A 1HYSB 3GG1A 2QL5B 3GR1A 4B3TF 1RT5B 1URNA 3O8WA 3CMQA 2PFFB 2MZSA 2RF2A 2VKZG 4H4MB 1B0VA 6FDRA 1CSJA 5KFJA 1S1WB 5DO2A 3KMSA 3QSYB 1X9SA 4C11A 2BRKA 2POKA 4DR7F 2JEGA 1Z4UA 2DO0A 4YB1P 3VWSA 1UMJA 2CPHA 2OEKA 3OL9A 1IBKJ 4OX7A 4LF7F 2MLXA 2MB0B 2WBMA 1QUVA 1HW8A 3ENAA 3HHLA 3QT5A 4Y2CA 3VALA 1DRZA 4IG0B 3OQ2A 3DN9A 2I5JB 2VU5A 2VOOA 4GKJF 2CFXA 2YWKA 4OYBA 2Y1RI 4P6QA 3LF0A 2VA3A 1O51A 2VFUA 3KJVA 4ILRA 1RI7A 2DISA 3IR5B 5DRKA 3UFCX 4B3SF 1J2VA 2FLNA 3N6LA 3OTBA 3X1LB 1WG5A 1JIHA 4MJKA 3CCJS 1O8BA 1SJFA 3TZXA 3NCRA 1NAQA 3RYLA 3CO0P 1S5ZA 3QRRA 3OL7A 3L9ZA 1FD8A 4NL5A 3PG9A 1H72C 2KYZA 2GZOA 1KQKA 2HVDA 1PCAA 2YNIA 2M8HA 3UN3A 4FPIA 4RNFA 4G6VB 2ZBQA 4WZMA 3T5HA 1RABB 2HFUA 4OYAA 3UWTA 4A48A 3EYZA 2DHXA 3BB5A 2ZH9A 3RAQA 4OL8A 2JDJA 5LMNF 4DF4A 4CLKA 1ZPWX 5J2PB 4P10A 2F4VJ 1KHWA 1SC1B 3Q86A 3PYEA 4N76A 4CO2A 3UD4P 2EBGA 3HLUA 1IBCB 2KXHA 2V5HG 1I6JA 4M63A 4DX8H 1NSPA 5HJXA 4YOEA 2Y1LB 1PG5B 4NE9C 2LEPA 4C0OC 2VDIA 4EBEA 3AJ1A 4FBUA 4J9MA 2UVUA 4PQUA 1ZAVA 2HWIA 1OO0B 1S9EA 1SIWB 4UTGA 5A2QY 2JWNA 1TL3A 4EFAC 1VRTB 3FBEA 2FJVA 2HHUA 3LH2S 3UDVA 2CQBA 2CNLB 3MEKA 3HD1A 3QATA 2B5JB 3T1HJ 1ZAXA 1G7CB 3LAMA 3R7SB 3V6DB 1EKSA 4V19X 5F8NA 5DZ6A 4LF8J 2MPUA 4K5RA 1QDUB 1TUGB 3NGDA 1RTDA 4O44B 1WF1A 1NK5A 2HBRB 2B56A 5H9FK 1JLFB 2DITA 3PEJA 3V5RA 5GADI 4K50A 2RD5C 2CJYB 2HWTA 5T7LB 5J2QA 2XGQA 3J7AN 4UZCA 4J90A 1DHMA 4P7VA 3MUVP 5ETRA 1MWQA 2DCLA 4AXIA 1S1TA 3UD5A 2BQ3A 4X4SA 2KHCA 4K59A 2F8HA 2HZAA 4KHMA 3RW6A 2PO4A 3KK2B 2KG0A 1TL3B 4IOAQ 1WOPA 2LU1A 3MDFA 3BH7B 4O23A 1QE1B 5FDLB 2KYXA 1X4AA 3FCVA 3NGTA 4M94A 1UVJA 1FCAA 2K3KA 3PV8A 2XLKA 4KHRA 1Q86T 4CM2A 3DRYA 1OMSA 5K20B 2ALZA 2ATCB 2HS4A 1FESA 1F5BA 3N4WA 3X3UA 4KAIA 3HSDA 1HMVA 1VK3A 4NLYA 4P52A 2ZBRA 3A3PB 3NCPA 4PG7A 5LXRA 5FLXU 3CCSS 3PO5A 3KHRA 1C2PA 3IC1A 4MMOA 2BE9B 4B3RF 3GG0A 3D54A 3I4PA 1H73A 4L3NA 3TX8A 1WKKA 2E1RA 3UNGC 1WEZA 4USHA 1HLWA 4WYWA 3RR8A 1R89A 2YKNA 3QGPA 4PYAA 4KJIA 1UEKA 3ZC4A 3CDBA 3P6YC 2VG5A 4WYLA 2LP4A 4C3KA 3OR1B 4JYAJ 2J8SA 1E6VA 4H4OA 4IFVB 4RW8A 4B17A 3THVA 4QCLA 1PBUA 1OYDA 1Q8LA 4KRWA 3TP2A 2AU0A 2HQIA 2I9SA 1S6OA 2IYIA 3N9UC 5JVGQ 1IBKF 2NREA 4LF7J 2MDAA 2VONA 2IM3A 3UPFA 4R25A 3FZ2A 1N5VA 3KDNA 2HBQB 3R5CA 3BSNA 2CRLA 2DGTA 2WHOA 5BYSA 4YR0A 2HHXA 2VG7A 1Q4RA 3AH6A 3THPA 4DR5F 1S48A 2BRLA 2QMUB 1QAJA 2W2QP 2JEIA 1N88A 3NBPB 3UDEA 2VQEF 5LMUJ 5C5JA 1SKSA 4Q8FA 2I0XA 1EKRA 2PMWA 1V5IB 1UTAA 2VKRA 3MCOA 3PHTA 1RTIB 4BCAA 2XY6A 3SI8A 1C1CB 3G86A 3MEDA 3N79A 3T19A 5K8PA 3TJ8A 2XM3A 3C2PA 3N5FA 1U6FA 3THTA 4JI5J 4MH8A 2XCAA 4YQWA 1EQ0A 1RTDB 1T3OA 5HSPA 1XNRJ 2VG6A 3GJRB 1X0PA 2UU9J 3KJNB 1JK9B 1PSDA 4TLQA 5HROB 2FJDB 1KFSA 2R7XA 5ADZA 2F7VA 3T5JA 4TY9A 2CJXB 2KJVA 2RB7A 1DLOA 1IUJA 1JNZB 2HHQA 3FC9A 4L72B 4NEZA 3M9MB 2VF3A 1MROA 5HAOA 4OYPA 3U1NA 1R0AA 4ID5B 1UEVA 3DM2A 4RWXA 3LP0A 2HLTA 2IJRA 2V8DA 1T0TV 3MM5B 3W5YA 1GAOA 3W64A 2L9DA 4URQU 4ZP9A 4TU7A 2DPJA 3A3OB 3HSJA 2LECA 1FNXH 1AUDA 2YKPA 1OWXA 3U7JA 4Q43A 1TKXA 4RW9A 4IQXA 1FTCA 4F7VA 4Q0BA 1HPZA 3AD8C 2JLFA 2ATLA 1SC4B 3GCXP 2PFDA 4LR7A 4QIWD 2XMKA 1HBMB 2OPRA 2QFJA 3K17A 1HYSA 1A7GE 3PJXA 3MD1A 4OZ3A 1NSQA 1T7PA 4Q0BB 1LWXA 2K7JA 5KFUA 4ZMMA 4YDXA 1DQAA 3G87A 4JP8A 1V9OA 1UZDA 1H98A 2F9JA 1RAGB 2ACYA 2IHR1 4KGZB 1WHVA 1NZ8A 4GRSA 5JJBA 4DR2J 4DG1B 3V4IB 3DOKA 4DPYA 4ZIWA 3W5ZA 2F8MA 2IAJA 1KHVA 2RT3A 1V5VA 5D4OA 3PW7A 3IGNA 4LF2A 3IS9A 1R0AB 3MPYA 1P9QC 1KLMB 1K0TA 1XJWB 1CJUB 2P6TA 1GT8A 1S12A 1QTNB 2CQ1A 4A46A 4ELVA 2B9WA 1YGYA 4RNOA 1GH8A 4UF4A 3K89A 3H40A 5IFMA 2DNHA 4LRDA 1YIJS 4N8NA 2VB6A 4CIOA 4FF2A 3W2VA 5DDQC 4JI1J 2VFTA 1Q82T 1RWKB 2IRUA 2F5GA 1CC7A 3HKZD 3OR2B 4AL7A 3PX4A 3JSRA 2F1FA 2FDNA 2H9ZA 1M1HA 5C24A 4O3OA 4EBDA 3FNNA 1XERA 5CH7B 1NPRA 1X4CA 3CJKB 1VLYA 5HANA 3C3LA 1OPIA 1CJVA 3SQGB 4NOHA 2YNIB 3L09A 1W26A 4NLPA 1F9FA 5KFYA 4LFBF 3QBCA 2CQDA 4OLOA 4MIAA 1PYOB 5GMDA 1M5HA 3CCLS 1UA1A 8ATCB 1Y4ZB 4RW4A 4K4YA 5KFAA 2OEJA 2W4CA 4TKTA 2DEIA 3SMZA 3V81B 4CH0S 5BYQA 3OVAA 4DL4A 1TV6B 3MEDB 4AD6A 4EEYA 2E9RX 2OPQB 2VPZB 4OX9F 4GVBA 4ZPTR 1NK0A 2VV5A 2OTLS 2J9CA 1VCTA 3UI3A 1IWAA 4X2BA 2YPYA 1G4CA 3PW5A 3MUTP 8RUCA 1WC4A 2A6OA 2HNYA 2OPPB 5J2PA 1CS4A 2FUG9 4ZP8A 5A8RA 3RZAA 5C24B 1APSA 6FD1A 2YH1A 5DETA 1VDHA 1VQNS 3D6MB 2OUGA 2UXCF 1RT1A 2CZ9A 4UOGA 3DM2B 4USTA 4JI0F 4Y00A 3SDEB 3GV8B 1B4SA 4NA1A 2MKJA 4JB8B 2CPFA 4RO0A 2VJUA 3BSAA 1NK7A 1D1UA 3PTWA 3VHQA 1S72S 2AZ1A 2NSBA 5F8MA 4EZ6A 1ROFA 4FBTA 3IMQJ 3D67A 2GQQA 4M5GA 2ZKUA 2W9AA 1EIYB 1HI0P 3MURP 2W7AA 3QMQA 1TKTB 2KO1A 4ZPCA 2DGOA 2JX2A 3I5CA 4ZP7A 1U1NA 1VC6A 1U6BA 2XZWA 2KZZA 1LQ9A 2XSFA 2GW8A 3M8SA 5K5MA 2CDRB 2JLGA 1F3FA 1S1UB 1YHQS 1UVLA 1T9XA 3HHLD 2Y8YA 2KT3A 1IBMJ 4B9VA 5D6GA 3BPSP 2E5IA 2BACA 3IRWP 1BUXA 4D3HA 1L3KA 5GAEI 5HLFA 2Y8WA 1UKUA 1HL6A 2X1GA 3DC2A 4ECXA 1FE4A 4OJHA 3EVOA 1NH8A 2GV1A 1VGYA 2WONA 2YNGB 3BR9A 3IA0A 4I6WA 4QWDA 2BANA 1GEHA 1XR7A 3SCIE 3K5NA 1NDCA 3RTVA 1RT6B 2RQ4A 3MMAA 1T05A 2HVEA 4WCEQ 4M5LA 1NB7A 2V9WA 2IM1A 3LA0A 2MZQA 1GFWB 2V50A 3AOBA 4KHPJ 3C6TB 1U1MA 5HATA 3EGZA 3O44A 3M8QA 3H2LA 1RACB 4OZLA 1S1TB 1CC8A 1HQUA 3CJ3A 2LQ9A 3MMBA 1RGVA 2AYGA 2RS2A 2F4FA 2DB1A 2AEFA 3GYNA 2XULA 2R7QA 3DLLQ 2C2KB 2WK4A 5KFKA 1DURA 1FRKA 2DH7A 2YWWA 4FZVA 4C97A 3LWLA 3OHAA 2ZC4A 1IM4A 3FBFA 4WP3A 2CJ9A 2Q3PA 2NYIA 2WVFA 5J2MA 2HZVA 2KXFA 4ZCMA 1WG4A 2FC8A 3UE2A 2UP1A 2D69A 2UVWA 2CKWA 5CYQB 5L9XA 1FJGJ 1KVJA 1RWMB 5KFFA 3BQ2A 1CULB 2BE2A 3UD3P 2GGPA 4DR4J 4DX7A 2W2OP 1VBZA 1KR4A 4WU3A 3M8PB 1UAWA 1NSKL 5HMWA 2NXCA 3MM6A 3CCZA 2MJUA 5I42B 3Q24A 4ZP6A 4Q5VA 5DQGA 1UETA 5T14A 3MGJA 1SJRA 5M2PA 4ECTA 1M5VC 4F8RA 1S6QA 5IWAF 1HW9A 2HFOA 2NCKL 3EGWB 3M32A 3PRBA 4F4WA 5DS7A 3BREA 1K73T 4MKBA 1RBAA 2CPXA 2H48B 3D3BJ 2R8GA 4PZVA 3BF4A 4K4VA 4M5HA 2MHEA 3PIPQ 1LKZA 1MN9A 2ASYA 2JVOA 2VBZA 3ILLA 1TAQA 4ZVUB 1RAAB 1OQ6A 2BMBA 2Z0GA 2OIHA 4L73A 3C46A 1DJ0A 3L7PA 1DTQA 1UCNA 1SB6A 3CIMA 3NNCA 4WF9Q 3VCDA 2HURA 4ETXA 2DNPA 1GTHA 2V8VA 5DQHA 5KT3A 1RT3B 4YFUA 1X4BA 4C8LA 1RU2A 5EWFA 2HFZA 4K0KF 1K47A 3EDRB 1KS2A 3BN7A 1YJTA 2CJAA 2KT2A 1WEYA 3KWMA 4K4ZA 3TA2A 4HEA9 1NH7A 4O3SA 2IRYA 1FRIA 1OSDA 3TJ9A 3UR0A 1IJFB 3QQCD 2GHPA 2HFVA 4L75A 1ZTTA 2FLLA 2KTQA 1ZM9A 4ZJOA 1CBKA 2WSFC 2GNKA 2OPSA 5H9EK 2DNNA 1RLDA 3EM1A 4E8UA 5E33A 1KBRA 1SBRA 2J5AA 2UXDF 5J1PA 4A8MP 1JNRB 5F8GA 2BJ7A 3I96A 2R4FA 3IGVA 2WB4A 3R3TA 5J1NA 1Q16B 2V67A 2E66A 2VODA 1EP4A 1BMQB 1HHSA 2RE1A 4FF3A 4B3TJ 2KJWA 3U02A 4Q7AA 1WTFA 2FTRA 1WC0A 4LR8A 3EJMA 4IH6A 2DH8A 3T41A 3D7SB 2D3ZA 1NO8A 5CABA 1VLOA 3TJAA 4WE1A 1NK4A 1VJWA 1HWIA 5K8OA 1EZZB 2K2PA 1PKUA 4ETZA 3SBMA 4NLGA 3GIRA 1AUSL 4DV5F 5MAOA 2GQCA 3W5XA 5KFXA 1U1RA 3I31A 1RWXB 3FRZA 2O1PA 1H2VZ 1Y7PA 4K7QA 3PEHA 2F65A 1LXNA 2VBXA 4LVOP 2K8GA 4PXCA 3BGRB 3HHDA 4QQBA 2NPFA 4OJ1A 4QYZK 2QYGA 3K8WA 5F8IA 5ETVA 4JI2F 1ZZFA 1K9MT 3D6HB 1F9HA 2QSWA 3PFEA 2XO6A 1VC5A 1QY7A 2HIYA 2BDPA 4U67Q 5HP1B 2GMHA 2B6AA 4JI1F 2E5JA 3E2EA 1BY9A 2EEYA 1BQMB 2WB1D 1JLAA 3I0RB 2IYGA 4M5MA 3V4MA 3VV2B 2GIQA 2LFVA 2UUTA 3OXFA 3ZZUA 2ABYA 1CJTB 1HNIB 4OZ0A 4JI3F 4P2MA 2B7BB 2JL9A 1O5JA 2B4PA 1WNEA 1FKPB 2G2ZA 2ZJQQ 4A8YA 2W9CB 1OIAA 1S99A 3US5A 3CJKA 2HZCA 4HDHA 4QWEA 2UUCF 2HVHA 3G6ES 4PG5A 1Q7YT 1RCXB 3JYTB 3VAIA 1J5OA 1HNZJ 5HQLA 4PRFA 3HD2A 4DOZA 1DTQB 3DU5A 5ETTA 1U1OA 5HBMA 4FXWA 4B3OB 2HW3A 3ZTRA 3IWNC 1WHWA 2PEHA 2UV8A 3EMTA 1VBYA 1R8CA 1SUQB 2ZBIA 1Q79A 1KEKA 3VAHA 4DS5A 4ZDNA 1FX4A 2F40A 2DIUA 2QLWA 2D9PA 5B09A 2MZJA 4IOBA 1NXIA 3CE8A 3W8GA 2M7SA 4DV0F 2I38A 1QM9A 4OYXA 4Q2LA 4DQRA 1YSJA 5K9FA 2ILZA 2ZVSA 1N34J 4DFKA 1SCJB 3BGOP 2YKOA 2VC0A 5DG9A 4DR4F 2RS8A 3BBCA 1XNRF 1FKPA 2HHVA 4OX6A 2MQQA 1FD2A 3R5JB 1FX2A 1U8SA 3HULA 4PEOA 3ETMA 4KC5A 1BC6A 2WOMA 3O6QA 1WDTA 3KLEB 1RHRB 1HFEL 1ZAWA 2B8PA 2YTCA 1TELA 2O3DA 2Z56B 4USJC 4X66J 1JLGB 4DV2J 4KTQA 4M5IA 2FYXA 2HHHJ 1RT5A 4C3LA 1QLNA 1FI4A 1OY6A 4M8LA 4LF8F 1A0OB 1VMBA 1FNMA 1Z2LA 4MK7A 2ZZNA 4QIVA 2WVDA 4L74A 1GX6A 5KOWA 2R8JA 1HNWJ 4CO3A 5F9LA 2H5EA 3R1LA 2AJ0A 4EMDA 3GR0A 4ZVRB 2OAUA 3MMJA 5U47A 4DFMA 2HMIA 1U49A 1HBMA 2OPRB 2E7XA 3M8RA 3CULA 4I2PB 4OLPA 4DS4A 1ZOTA 4I2QB 3KOAA 5DG7A 4DV3F 3T3FA 3AJ2A 2QLFB 4YS2A 1X4EA 5KT2A 4KYZA 1T8EA 4KB7A 1TKTA 3LP2B 1R43A 4M5DB 2C42A 4PXDA 2ZVIA 5HQ8A 2HFNA 1SVDA 1YK9A 4L76A 2MKIA 3W9HA 1NKBA 1N5QA 3GFHA 1SKWA 1KC8T 6AT1B 4RLEA 1XEZA 2O5DA 3WC0A 3BJYA 1UVMA 5I3UA 2QO3A 3BV8A 4LUBA 4MKAA 4CH1A 1YZ6A 4OI3A 1V3SA 1P1TA 2DT9A 1CQNA 3OFFA 3QWPA 2RIJA 4IRDA 4HT7A 4NXNF 2AYMA 1S0VA 1FTRA 5LJ5Y 4P73A 3SCKE 4JI3J 2V9KA 4ZHRA 2V8GA 3HKWA 4H54A 1TK5A 4DR7J 2MQMA 3DRRB 5E7OB 2K1RA 4RW7A 2AIRB 2DNRA 4C98A 1PYTA 3HHLC 1D09B 2RDIA 2WRMA 3R6GB 2HNDB 4DF8A 1S1XA 4P74A 2D74B 1IM6A 4WXWA 1TU0B 5IT4A 2AW0A 2W1BA 1WC6A 3ZZPA 2FVQA 2CQ3A 3FDSA 3RUBL 4RUBA 3OJSA 4DR3F 2K06A 1S6QB 5ITHA 4B9UA 4C4WA 2A2CA 3VAJA 3UO0A 4DV1F 2QV6A 4ZPBA 2WVEA 3DI6B 4OI0A 2VL1A 1M5PC 3KJVB 4LVNP 3EGNA 4PG4A 1VS3A 3DRPA 5F0WA 3VTIA 5LT5A 3R27A 4U7CA 2QA2A 3C8YA 1KOOA 3M32B 3M8YA 1RWUA 1ZZNA 1J5OB 4L3KA 2CQ2A 2PSZA 2IRXA 3GSDA 1F2GA 2CPZA 3DOLA 2QG9B 1R8AA 2YKNB 3D3CJ 1AZSA 3MM6B 4C8YA 1Y3JA 1OY9A 4ATNA 4NLSA 4J9LA 3CC4S 1VQMS 3DOLB 3ENWA 3ENVA 5E3CA 2MQOA 2YQ0A 4U8VA 3ILJA 1NJIT 2Y3YA 3U27A 4OX8A 3M6XA 1R27B 4FS1A 3RRHA 4AUKA 3GU0A 3HVAA 3GJSB 4R5PA 3MR3A 3TUJC 1OJ4A 2AEMA 3MWBA 3G8SA 2IVMA 2KL8A 5CXTA 2KZMA 3ELHA 2RQMA 3OL6A 1NU4A 2A18A 3HXMA 3SSSA 2YWHA 2HQFA 2E1AA 3AHPA 3C66A 3SIPB 3TYTA 3EZOA 1QTMA 4HKQA 2VFVA 1TL7A 1FT8A 2AV5A 4DR6J 3ISNC 3OW2R 3Q83A 1YRUA 2BZ2A 2DNMA 3TO8A 1Q95G 2KM8C 4WTOB 2YKAA 2BABA 4W90B 3N5BA 4ZVTB 5LM7E 4OV1A 7FD1A 2YY3A 2MGZB 4JBCA 4O4GB 3LALA 3MEGA 4I69A 5BXIA 3CD6S 2LDIA 3M05A 3RG6A 4NI2A 4UT4A 3OSNA 2E5GA 2YXLA 4DN0A 2AGPA 1G1XA 4QZVB 1HNWF 4DR6F 4LF4F 3W2WA 1WOOA 3M30A 5HQMA 3CCVS 3LOUA 2ZC3A 3CMES 3BDPA 1P8GA 5KFTA 1KNZA 5GAHU 3KXDA 2DNQA 4DI6A 3QLHB 1SJQA 4ES2A 1YTYA 4LFAF 1FERA 3M4XA 3KK3A 2HGNA 1WSRA 3Q8YA 4K4WA 3PYFA 1IBLF 2BW7A 1O0PA 3MFHA 1U7LA 3AOCA 1W25A 4DX5A 2C2DA 1LNQA 2RF2B 4H4MA 4QR1A 4BC7A 4RNNA 1NJZA 3DLEB 2V4QA 3W9IA 1M1KT 2CZVC 4GC6A 3KLGA 1GK8A 2FC9A 1FF2A 5E3PA 3V6JA 2LEBA 4PYDA 2RHSB 3DRXA 3EGVA 3R7NB 1JQGA 2J0WA 1S6PB 3L95X 3H59A 3UCUP 3DYAB 2VBYA 1QVFR 3RBDA 3MAAA 2BJ9A 5B08A 1LEOA 2HYIB 2CXEA 2RVJA 2J9EA 2RH3A 3QIPA 4U7UD 3ET6A 4V1Ak 1UPPA 1RJJA 2XHCA 4QR0A 3U1LA 5KG3A 3DRPB 1O6XA 1I3OB 3CPWR 4DV1J 4LBPA 1F6TA 3Q8QB 1VQ9S 2DR8A 5D4PA 4LMZA 1QD1A 5AXNA 3EDQB 2HRTA 4ENOA 1D0EA 3HHEA 2H65B 3L3CA 1XNQJ 1H7WA 2VOPA 2OFHX 2DR7A 3IAS9 1OY8A 4EYIB 1SQFA 5LJ3Y 3HO1A 2EW9A 1NJYA 3FSIA 1QSYA 3G8QA 3M2UA 1MN7A 2YX7A 1TTHB 2ZITA 4Y2IA 2GIFA 2YNHB 4OMFG 4RPFA 2X1AA 2EK1A 1QSLA 3IWLA 3K58A 1TK8A 4NLUA 2RHQB 2EPIA 2D3UA 4ZVHA 3JSMB 5FJ4A 3I5BA 3I0SA 3DXBA 5D8HB 1A9NB 2CQGA 3SQGA 1N0VC 3BYPA 3MCNA 5A8WB 5C42A 3Q8RB 1KQSR 4DSKA 1YJ7A 4AT1B 3GILA 3MAQA 2UUBF 3ZZZA 4U7UK 1FDNA 3BBBA 3ZZOA 4E98A 3B4DA 4IR1A 4TU9A 3HI9A 2GHVC 3R2CJ 2GCFA 1RK8A 2FZKB 3WX8A 3S6EA 1RTHB 2CG8A 2QA4G 2L48A 1S1VA 1Y5LB 4EZ9A 3VAGA 4Y3CA 1SKUB 3NGKA 3M1VB 1VRUB 2DGXA 3AB2B 4FVMA 3RBXA 3W2WB 2BM1A 3B8HA 3TA1A 3DMJA 2KRBA 4DPUA 3TNVA 1CJUA 2FVRA 5DG8A 1CS4B 2LLZA 1T9WA 2MY7A 2YKQA 3BH6B 3GCWP 2Q6CA 5A8RB 3TARA 4CLPA 2AGQA 3PJ9A 2XMMA 5IC6B 1ZYQA 2W2PP 3N0VA 4HH0A 3J81Y 3JQKA 5CZXA 2NPIA 3W2VB 2A0FB 2DY1A 3C14A 1JLEB 3UDLA 4BC9A 1T03A 1N36J 2IIHA 2LVWA 1LW2B 2KI2A 4O44A 5A8WA 5C42B 4ER8A 2XY5A 4O4GA 4FS2A 1VQOS 4K8RA 2BE7D 2QJ3A 3D66A 3K0JA 2XMUA 5A8KA 4ILMA 1DTTB 3NGUA 2IDEA 2DRDA 4PXBA 1FXRA 3W9JA 2ALYB 4URGA 1IBMF 2V68A 2X1FA 2HS3A 1L3SA 4GVLA 4FF1A 1KWMA 3DKDA 2GO8A 4N8OA 4QYRA 4F4YA 2QLXA 2R2UA 2R42A 4G1IA 2HGLA 2JOQA 3G82B 3VQSA 3M8PA 1ZH5A 4HACA 2LEAA 4CWBA 2EI5A 2XWXA 4I6YA 4ALZA 3M30B 2HAFA 2Q6BA 3OVSA 4DL0C 2I1RA 3B4MA 4LFCJ 3G2XA 4YHHJ 2X3DA 2JEFA 1C1CA 2RU9A 2HNDA 4B9SA 3GFXA 2BJ1A 2G0IA 3NOCA 3MOZA 4NLRA 2DTJA 1BQNA 4IYQA 1NSAA 3AAWB 3T9NA 2FY8A 4XO0A 3OTOF 1R8HA 3BN4A 1HBOB 1NKEA 4KGVB 4IDKB 4PG6A 4E0DA 2VIHA 2E1MC 4IOCQ 4YEAA 1Z1ZA 1QSSA 1DLOB 3MEEB 3GIKA 2XNRA 3NGSA 2PDAA 4LF1A 2LMIA 3AOAA 4DHVA 5L1LA 3IBCB 2EFQA 2C2RA 3DLHA 1VQ4S 4ZLNA 2JH3A 3HMJG 2YWGA 1JJ2R 2M52A 2XMTA 1VC0A 1JX4A 2OSRA 2ZDPA 5KG5A 4U6PA 2VICA 4CYUB 4G1PA 5A6WA 5DM7Q 2B4VA 2F8EX 3TUIC 2B3TB 1ZA1B 3JQMA 3PYGA 3PYDA 4LR9A 2NYHA 4RW9B 4JI6F 2Y0SD 3W8PA 2PE8A 3SSQA 4PUOA 2UU9F 2C3PA 2B6AB 4LF9J 4PWUA 5B0DA 1JLCB 2NXEA 2MQ8A 1WD6A 2ZDOA 4NRUA 4KGKA 2LXUA 3CDAA 3OXLA 2KHDA 4UOCA 1FRLA 2FLOA 3TWZA 1R8PA 4B9MA 1NDLA 3K8VA 3W66A 4RBUA 4KFBA 2J6SA 2NXUA 1QUPA 2CUYA 2ADBA 2M2BA 3M2VB 4Y2KA 3KLFB 3PW0A 3T1HF 2GO9A 2BKPA 1NHKL 1BGXT 4KKOB 3J7ZT 4PWDA 3NG8A 2JLEA 3GJQB 3H5SA 3PW2A 3C19A 1RWNB 2W9BB 4EK2A 3RAMA 4F26A 2ZE2B 3H2VE 2ZBPA 3HFKA 4HT5A 3CCWA 5KFCA 2MQPA 2FPHX 4JI7J 1TAUA 2LYVA 2MTLA 2B7CB 2RRBA 2CQHA 3HDSA 4FP9A 3EX7B 1JLCA 1NDKA 3GZ7A 1UWBA 2LQ5A 2FQQB 4BWJA 3GIMA 4K4XA 4QU7A 4MIWA 1RHUB 1K8AT 4ZLLA 4DWIA 1U25A 3PR5B 2RDJA 3PHEA 5B0GA 3KNGA 2CNNB 3VVTA 5CCLA 2J0QD 3KHGA 1FO1A 5A8KB 1TKXB 4LSZB 3TAQA 2CQPA 1CVJA 4USIA 3QZ7A 2QYCA 2V69A 4FYVB 3KK3B 1HQ2A 2VDHA 5KG7A 4XPCA 4P7TA 1IKVA 1JLGA 1U02A 1VYAA 1IR1A 1RQ0A 3CW2C 3MPUB 2J7UA 2ZNZA 4OI1A 3TW0A 4X4UA 3DDKA 3TR5A 2G1DA 4FVCA 2WONB 2QRRA 3CUNA 1YX2A 4C3MA 2W9CA 1VK8A 3VAKA 4FKYA 3DGPA 5E41A 4IFYA 3LW5C 4DXLA 3GMGA 4NA3A 1JXEA 4BLGA 2CJQA 3T1YJ 3LANA 4MAKA 3FFIA 5HN0A 2AGOA 3BR8A 2C1EB 3IAM9 3R5BA 4NASA 2E7VA 1Q8BA 2YVSA 3IG1B 5KT4A 4F0MA 3RAXA 1EJ7L 1HNXJ 1PC5A 3IR7B 3R6LB 1OQ3A 4H4KC 1LV5A 4X64J 5J1EA 5L9NA 1EAYC 2YWEA 4URSA 3ZZRA 3HK2A 4HR2A 1RTJB 1ZM3A 2AHOB 2YX1A 4Z7YA 4FYDA 5GAHI 2JJ4D 4OIXA 3M6WA 3KJFB 1RWPB 5D15A 1S0MA 1IKWA 1C0UA 1IKYB 1HPZB 2W25A 4MIBA 4QR2A 5HI7A 4DR5J 2B4UA 3CJ5A 4WXOA 5B0FA 4CYUA 2OH2A 4ZPDA 5ETQA 5LSRA 2XI2A 1RLCL 1WORA 2DGVA 4I7FA 1GMVA 4CP5A 3E3XA 3O1LA 4O0NA 4CDIA 3KLFA 2CA9A 3UR3C 3MUMP 5HLFB 1WHYA 2Y0BB 3TI0A 2HNYB 2OPPA 3I56S 3M9NB 3ICLA 4NWBA 1SKRA 1M1GA 1SQGA 3B54A 4E2FB 2HBZB 3W3SA 5C2GA 3A8JA 5IT9Y 3OLAA 1MMDA 2BUNA 3SQOP 5KFEA 5MLCV 4IKAA 4O4RA 3AT1B 2FLPA 3S01A 2OTJS 3CJ2A 3H7HB 2Y1IA 4J9UE 1RKJA 4RU2A 2DRBA 3OFGA 1D9AA 3P5BP 4MK9A 5EGYA 4YR3A 3OJUA 4ED2A 1HNZF 2Q43A 1KONA 1F3VA 1RT4B 2LA6A 1TVRB 3BGFA 3T6BA 1VJQA 3WBZA 4FF4A 2DCUB 4HL9A 4C8NA 4RR5A 2NZCA 2U1AA 3DRSB 5E3RA 2B9EA 3F44A 1GQEA 2HNZB 5HMXA 3JTPA 2KH9A 5KG2A 4ZK7M 3KHHA 3VAFA 2V94A 2DGQA 5DGAA 1SIZA 1YWXA 3DRSA 5CD4A 4XDCA 4MKYA 3TZYA 1X9WA 1IR0A 3NAHA 2J9DA 3I32A 3QJJA 4KO0B 2VBWA 3FQLA 3J80Y 4DUZJ 4X4NA 1NNDA 4DX6A 4CLWA 1EX8A 4ZVPB 2E9ZA 1N33F 1KN6A 3CD5A 5H1SV 5D4NA 4OZNA 2HLUA 1F2HA 3IS9B 4TYAA 5IT9U 1QAXA 1IWGA 4DL2A 2JRSA 2N3OA 5F8LA 3CNQP 3W62A 4Y0FA 4M95A 1KP6A 2CDQA 1T9VA 2ZWPA 2GAGC 4UZBA 3NOGA 2G2OA 3MF5A 4KT0C 5GVQA 4CO1A 2AT1B 3SZ2A 4LF6F 4IG3A 4ECQA 3MM7B 1CLFA 1P9YA 5I3QA 1M5SA 3HVWA 4B3OA 2EVZA 2YQ1A 4J91A 3I82A 3UVJA 4DPXA 4RNMA 2AF6A 2HNZA 4NX9A 5DM6Q 1XWLA 1E6VB 1RT2A 3CJ0A 4H4OB 5I3PA 1UZHA 5IQ6A 3ET6B 1HHTP 3HHLB 1RBOB 1NHVA 1TP7A 1PILA 3D0IE 2X3GA 5LMUF 4N47A 4B9TA 1YI2S 2AQ4A 2E5LF 4LF6J 1G3OA 4O0IA 2WSEC 3FGVA 1KOHA 4DPWA 1HWUA 2YNFA 3HJVA 3KYLA 3TX0A 1R7IA 2H51B 4DPOA 4QYZJ 3LP1A 3AQOA 3SFUA 2CWKA 4NXMF 3RRKA 1Q8KA 5FD1A 4WJBA 1WJ9A 2IVFB 3TRGA 3MMCA 1CG2A 2PA8D 2VQEJ 1YRTA 5HP1A 2XB2D 4ELTA 1JLQA 3V6DA 5CYQA 3MPWA 4P75A 3PCOB 4ZVFA 5CAAA 4PABA 3V6KA 2M8DB 1U2FA 2FD2A 2CPYA 5AXKA 4W92B 4Y34A 1KKHA 4WK1A 4RZRA 4RW6A 1U09A 3RBZA 4NXNJ 1MROB 2B9YA 4RNHA 4FPRA 2CYYA 4I7FB 2XYHB 3ULHA 4F36A 2BANB 2I8EA 3FEYB 1X5TA 3QGGA 5T41A 4ED4A 1JWWA 3QPIA 4OV6A 2ZH7A 4F4XA 2O66A 4IH7A 4NYOA 2D41A 2HQDA 4C8OA 2XS7A 2B5JA 1NK9A 2VA2A 2UXBJ 1VOMA 2VC1A 4DZ6A 4A8WA 1KLNA 2GAHC 3MXHP 2VPXB 3KG0A 3QGHA 2FJBB 2DNOA 2PGCA 4DUTA 3MMBB 4Y2AA 2XTJP 2OI2A 1Q5VA 4NPOA 4EGLA 4N5SA 3OSPA 1YG0A 2V2KA 2MZ1A 5E0OA 4MT1A 2OD4A 2AP6A 2DNZA 3LQVA 1NB2A 1TZ0A 3LPEA 5K14B 4EWTA 4J9RA 2ADCA 4PQAA 3ITHB 3BO4A 2ZZMA 1RYRA 4ZVEA 1S4FA 5E2QA 5HMZA 1IR2A 3UN2A 2RUSA 2ZD1B 2DHHA 1U8WA 4KQZA 2QEXS 2A3JA 1UVKA 1FNOA 2UUWA 3C15A 2VD3A 5LOQA 5IOLA 4CQ1A 1KQFB 2IJNA 1X7VA 2K1RB 3CO9A 4RW7B 3G71S 3G4SS 4I64A 1LFWA 2C2MB 4XIUA 2ZE2A 3OR1A 2UUAJ 3PVXA 2MSSA 3W65A 3ZO7A 5CA5A 1EP4B 1HKAA 1RCOB 2FIUA 5AXMA 3UW1A 2JNJA 3UVJB 2O01C 2OMLA 3CTRA 1NPPA 3NS7B 4UOHA 3P45B 3SCJE 2J0SD 4DMZA 2MSTA 2XNQA 4LFBJ 4QU6A 3KUGA 5FIIA 4WE1B 4I2QA 3KHLA 2JVRA 5EX0A 4AQYJ 5KFWA 4LSNA 3JAMU 1HBNB 4NRTA 2BOAA 2M88A 1MLAA 3CGIA 4I4BA 1V3RA 4KPCA 5D4LA 4EUVA 4XPEA 5JVHQ 2N82B 2C2EA 2FVPA 3AXMA 2VG5B 1CJKA 3M8WA 4ES3A 5BR8J 1VQLS 1CJVB 4OQJA 4KO0A 3VVUA 1RAJA 5LMNJ 4N56A 1PAEX 1JLQB 3AJDA 4EYHB 4ECUA 1KFDA 1NZAA 4HH1A 1B3TA 3T1AA 3V81A 4WFYA 2FHJD 4N7TA 3AFGA 1L3VA 2MKYA 2XWYA 1YRXA 3GYGA 1GNKA 3NS5A 3PACA 4GVBB 3FCWA 1H74A 4Q44A 1VQPS 4JV1A 2P9CA 2C2OB 4JV5F 3A13A 3D4JA 2P5VA 5KFMA 5DLFA 1UFWA 3ONQA 2X51A 3EZ5A 2J76E 4J9KA 3Q2SC 1NJWA 1FWKA 3IFEA 1FEEA 1HI1A 1AYEA 1JLFA 2BKNA 2XSJA 5KAKA 5JMNA 4ID5A 5CD4H 4WP8A 3EE3A 5G0RA 2X7IA 4KIAA 5H9FJ 1Y5IB 4QPXA 5IQQA 4O3QA 3CCTA 5KFRA 2VG6B 1U0SA 3JB9k 1TQLA 3NXZA 1QAIA 4B3MJ 3PY8A 1JJHA 1WI6A 1REGX 2RUGA 1QVGR 3GQCA 4JOUA 3P3DA 1U6ZA 4CLSA 3KG1A 4V19J 1S77D 1WACA 2BYCA 3FBBA 1M90T 1FFWB 3F56A 4YY3F 2DR9A 5KFIA 1HHQA 1YBTA 1HI8A 1UVIA 2IMOA 1RDRA 2XY7A 4CLFA 2QZ8A 3LUYA 3TEHB 4DLGA 3CCES 4CLUA 3LGMA 1RUSA 5D0EA 3I9V9 2KB2A 1RTZA 3C6UB 4NCGA 4X4OA 1DTTA 1Q53A 3BKFA 4CO5A 2DXEA 5GADU 3G8TA 2IC3B 3C6TA 4AXJA 4CNYA 4PWDB 2D9OA 1K1QA 1LW2A 4G1QB 2ERRA 3VGTA 2XS2A 1RHQB 1C4AA 1RT6A 4M5NA 3ZZ0A 1GXLA 3K57A 2ZHAA 4K4TA 3P96A 4IFVA 3GYXB 4WPAA 3MR2A 1CQMA 2B43A 2YWFA 5KFHA 1UVNA 1IVZA 3QIPB 5GMKa 3HVTB 1LK5A 1XR6A 4IO9Q 1FVQA 2P6SA 1T02A 3PW4A 5KOXA 4NZ6A 2I6WA 3KMQA 3OBIA 5HBMB 4C11B 1RTHA 5GAGU 1GTEA 1WDDA 4AYBD 5ETSA 4CCHA 3Q2TC 4C9DA 2FGOA 3H0PA 3M6UA 2C3YA 2PD1A 2VJVA 1HQEA 4AL5A 1WC3A 3W1YC 1D9DA 4DQPA 2L9WA 4ANEA 1DFDA 3P8BB 2IA6A 2VH7A 2IY5B 3PFOA 4AFFA 3LTOA 5L1JA 1H2UX 2QMXA 5EN1A 5KFPA 4OYOA 2APOA 3KLHA 3CC7S 2RMLA 1Q8IA 1RAFB 2RQKA 3MZIA 2RKIB 4ZLPA 2D1CA 1LW0B 3KLIB 3QLHA 4EO8A 4ZN3A 1CJTA 1E6YB 1HNIA 4Z7CA 1KTQA 2DGSA 1SJ4P 1B99A 3HFVA 2E1PA 2LDYA 2MZRA 3FSXA 1ZPVA 2BA9A 3NLCA 4CTAA 4I0WA 3J81U 3ADAC 3OTOJ 1BQXA 5A76A 4KGMA 2X1BA 3D2WA 1VQ6S 3EUNA 1TKZB 1JMTA 3TA0A 3PZPA 2W2NP 3KJQB 3QAUA 1KQGB 3K7RA 4L6V3 4UOFA 3DLJA 4LIWA 2AZ3A 2OMOA 3BDEA 4FKXA 1URRA 4DSJA 2AKWB 1S6PA 3FMWA 3P49B 5D77A 3RB0A 3G82A 3QNWB 2A1BA 1Q81T 1U2CA 4OJGA 3ISZA 5AE3A 1RT1B 2W7PA 2R7OA 3DNCA 2EFPA 2G2YA 2DNLA 2GS8A 3F41A 3P4UB 4ICLB 2FHJA 2AMCB 5BJRA 2R8IA 2MGZA 2MY8A 3D28A 2XO7A 1WELA 1U1PA 4F3OA 2DXFA 2YH0A 2FJEB 2P8IA 4CNZA 2ZM6J 4OFZA 3KLEA 4DFJA 1IBLJ 4JI5F 1Q7LB 2UXDJ 4CH7A 2R2SA 2IBOA 2QTWA 4A8SA 2ILYA 2Z30B 1N5YB 4P2SA 1WF2A 5KG1A 3CB4A 3OUYB 1VQ5S 5EWGA 2DRAA 4PPDA 3CIZA 4FNHA 4J9OA 1WHXA 2CJKA 2R7TA 2HVZA 3TZZA 2YPZA 1NBEB 5IT0A 4ZVQB 2ZH8A 2KU7A 3MAHA 2UUBJ 2KFYA 5DDOC 4ZVOB 1SL1A 1ZTWA 2RILA 2DK2A 2QSFA 5THWA 3R5AA 4F3QA 3IWXA 3T9ZA 2H54B 4F4KA 1DAXA 1J5EF 3E8OA 4KH1B 3MM8B 3CJRA 1X4DA 2V4JA 1MNEA 4DFPA 2G13A 1UWBB 3TUZC 1X4FA 1D8YA 1FRJA 1H2TZ 1RKIA 5J2QB 2BX6A 2H5IB 2GMJA 2GVZA 1BWEA 1VRTA 4U9RA 1N4LA 2UVVA 1W2IA 2BW2A 3FJ2A 4Q2MA 4DG1A 3MTKA 4ZLJA 3GIIA 1NEEA 1N56A 4TQRA 1TKDA 3OT9A 3LWMA 1Z2ZA 5IM0A 3CD0A 3ZTQA 3D0HE 1DY3A 1HA1A 3AQPA 4B3RJ 3DLBA 5J2MB 3CJSA 3TAPA 1HR0J 1K1SA 1UWAA 3D68A 3VGVA 2BM0A 2EKNA 1HARA 4FNIA 4KV8B 2LCWA 2PA3A 3EXCX 4WBFA 4ED5A 1BHNA 4ID8A 1LWFA 1R3NA 3MHYA 3TQEA 5H9EJ 3R2DJ 4LIRA 4X4PA 3TAMA 1BWVA 2AJ2A 3MPVA 2LXIA 5CHCB 3OFEA 4DR1F 1DZ5A 3JQJA 5IXUA 1WEXA 4YB6A 5D3GB 2XQCA 4A8KA 4CTAB 1MWZA 3A8KA 4HI2A 4DZDA 1JLBB 1VHIA 3DOMB 3KUEA 1OPZA 5CQGA 2N4DA 2UV8G 3QO9B 2VQFF 1MG7A 1U1QA 1JLAB 3V2UC 4XTTA 4OHVA 4X64F 2MKHA 3F0NA 1RAHB 2IBKA 3NS6A 3W61A 1YJNS 4C48A 2HRYA 2N7CA 2VFSA 4HDGA 1VISA 4PR6A 1UEUA 1VHFA 2EK6A 2ZNYA 4KV8A 5ETMA 3RJMB 3T1YF 4NZ0A 2YBVA 4B3MF 4TN2A 1HQEB 1VIOA 2DGWA 2PMHA 4DUYF 4XDDA 1HNXF 3OVBA 3AD7C 3UCGA 4DR3J 4HHUA 3NMRA 2G0CA 3FZBA 3KLVA 2DHAA 3NGRA 4QWBA 1NK6A 3MTJA 2AEJA 3NRBA 4KE5A 5HJYA 4WU2A 3QJPA 3TUPA 2C3OA 1FJCA 5G0RB 5CYJA 2B4OA 2C2NA 2JSXA 4M1KA 4ED0A 2ZH5A 1D3WA 4KBIA 2HHSA 3B82A 4ED3A 2W8KA 4NLDA 1YQHA 3VZIA 1RTIA 1R8BA 3R7BB 2XG8A 1SJ3P 1KDNA 3FRYA 4LF9F 2W4DA 2XZDB 4ZITA 5KFGA 2HWHA 3N01A 4HYKA 3DCAA 1PIEA 2XHWA 1N5YA 5J2NA 2DVIA 4IRKA 1PGZA 3DDIA 2OO4A 4DV6J 4DQSA 1XMOJ 4DSLA 1P6TA 4RW4B 3S8SA 1KTVA 2JFKA 4X84A 4O3RA 3IRXB 3MECB 2IM2A 2IJFA 5KFOA 4OYIA 2L9NA 1PBAA 3LPYA 3VQTA 5EDWA 3J7YU 2AD9A 2XLJA 2BVZA 5LL6d 1HD0A 1R31A 4JI0J 4M5KA 5IM0B 3U1MA 1FJ7A 2NUUG 4RBVA 2FGCA 2WVCA 4USUA 2BJDA 2PEBA 3FMBA 3VGSA 2J6TA 1OYEA 3GJTB 2PMZD 2HHWA 1DBDA 4ZPVR 5F8HA 2K7KA 4G65A 5ETPA 2HK2A 4MTPA 3RB6A 4DV4F 1J5EJ 1IXKA 2N3LA 3OD2A 2V4JB 3HSGA 3VGUA 1ICEB 3TQ1A 3HVTA 1R6VA 4DCJB 4F67A 4FXDA 3W7BA 2F3JA 3TVKA 1KVKA 5I3UB 2JEJA 4G3IA 3C16A 4LSLA 3A8EA 4B02A 4YR2A 1U47A 1PJ7A 2J7KA 3GWCA 3H5UA 4A8FA 4FYWB 1ULRA 4TLRA 4WIIA 5L39A 3SYZA 1FWLA 1VR6A 2U2FA 3C14B 4DR1J 4DLEA 1NPKA 3BKUA 5SZTA 1WOSA 1N54B 3DLEA 3PJWA 4OJ3A 4F02A 1TK0A 2VQFJ 1NUEA 3B6BA 5IZHA 3E51A 2DYAA 4NMXA 3R9LA 5D3GA 5K14A 4LRBA 5F3ZA 3Q89A 3TAMB 2DY9A 3MMCB 2KM8B 3JSBA 2XBPA 3NNHA 3VR1A 2DKOB 1HNVA 3BYRA 1HWJA 1MMLA 2GJIA 2Z2YB 1SC3B 1ZS6A 4K0KJ 3MMAB 3PRDA 4JI8J 1BXNA 1ZBTA 3TVZA 4OZJA 1RHJB 4RWWA 4ZIVA 1S0NA 2V6AA 5DDPC 5D0GA 3C16B 4LSLB 2ZOGA 4P72A 2QC3A 4LQ3A 1S76D 3K5PA 2A6MA 4ZA1A 3PXGa 2HGMA 1FFGB 2ZUGA 3M8ZA 3QFWA 4FYXB 5ETNA 3I55S 5K8MA 4NCBA 1NHUA 1IKXB 1YJVA 2HHPA 4OHXA 1SQEA 3POTB 4LREA 1KRPA 2J9DE 4EI2A 2MXYA 4QIGA 1XN9A 1V6HA 3CDWA 4LRAA 4YHHF 1TL1B 4HTIA 2AJFE 2N4CA 2GMLA 2XMVA 4LRCA 4N77A 3K59A 1RXOB 2QL7B 1F9EB 1EHWA 2DGUA 2L3MA 3GFZA 1WWHA 1TMMA 2R3VA 4D3GA 1AW0A 4NXMJ 2RQCA 2H3EB 3A12A 2ZH1A 1VQKS 3BO2A 3MD3A 1B70B 4UQTA 1RHKB 4ECWA 1N48A 2CVEA 2CNOB 2NUHA 1I51B 2CQ4A 2JC0A 4R0JA 2B9XA 2CQ0A 3IM9A 4MFBA 4RJVA 1KD1T 4WZQA 4DCOB 3QJLA 1NMEB 5KFBA 2E29A 2GJ2A 2J7WA 3PX0A 4LRFA
chains in the Genus database with same CATH topology
3CJ4A 4NYZA 2HMIB 3R5DA 3M9OB 3GV7B 1D8ZA 2ASLA 1DQ8A 2MKCA 1S10A 2YQ3A 4IUFA 1LFPA 2Z4PA 2CZ4A 2KXNB 3PIOQ 3OTCA 1UW4A 2D3OR 1PO6A 4F50A 2ZH4A 2AJQA 1M5OC 2NR0A 5AXLA 3KK2A 4GO7X 3K5OA 2I5JA 2DO4A 1C0TB 4Z37A 5DLGA 5CYMB 2L08A 5FLXY 4WFZA 3MEEA 1N5TA 3BGRA 3Q22A 2XS5A 4PXEA 2WTFA 1LWFB 1T95A 1C0TA 3M2RB 2UXBF 3EXYA 2GIRA 1VFJA 2OPSB 4ZHRB 1FKOA 2HS0A 4F2SA 1JKHB 1HMVB 3TANA 1RYSA 4KPYA 2RU3A 5B0BA 3LP1B 4NLQA 1RA7A 5L1KA 1AXQA 2PI5A 2J0XA 3SCLE 2EFVA 1IKYA 4ZVGA 1NRKA 3BM7A 3T6JA 2YX4A 4ECVA 3S1TA 2F4VF 5KFZA 4JYAF 3LAKA 1LWCB 2HPUA 2ZH3A 3BSOA 2DH9A 5C25B 3OPKA 4A8QA 2MZTA 1IKXA 3CWJA 2XMJA 5HO4A 4YB7A 5F9NA 2M0GB 2BQRA 3ISND 4FN5A 1WF0A 5DDRC 3MI7X 2A2DA 1TUVA 2JHEA 3KLIA 1N5SA 2QA1A 2GFFA 1W2BR 4ED1A 1YJRA 1U26A 5EWEA 1U1LA 2Q79A 1JB0C 3QZ8A 2C3MA 1S1XB 4X4RA 1TR0A 2JZ5A 1TV6A 1UP1A 1UFLA 1H7XA 2R7SA 5L38A 4PKDB 2OJ3A 3H25A 1T3NA 2BE2B 3D5MA 3BGUA 2ZM6F 4DDFA 4BDPA 3OL8A 3EPGA 1B0PA 2M3DA 4JI7F 3G6XA 2MJNA 2EFGA 2RJZA 1VRUA 5KTQA 2FJXA 3MR6A 5HROA 4TU8A 1V3ZA 3I9ZA 1XK8A 1AROP 5T7LA 3O3LA 4A4JA 3MFIA 4ECZA 2LQJA 1SH0A 1Y3KA 4MYUA 4J9PA 2PIIA 2C3UA 2DJWA 4H4KA 3T5LA 2IC3A 2KFNA 3HF5A 1M5KC 1S1VB 2MQNA 1MMNA 1S6UA 3PNIA 1Y5NB 4C0HA 2HVIA 2BR0A 2MHNA 4KHPF 4C0BA 1AFIA 3K5LA 1X4GA 4UW2A 1X0FA 2ROPA 3I87A 3HPOA 1B64A 2R8HA 3HVRA 3PR4A 1OS5A 4NA2A 1LXJA 2UVRA 1X5SA 3OTDA 4OI4A 2R2RA 3ENQA 1FRXA 2NZ4A 1ZM2A 4ED7A 2QIFA 4R0EA 2PI4A 2OKQA 1UJ4A 3A1YG 3OLBA 3VZHA 4WFAQ 1JJ4A 4NYPA 3BO3A 3KK1B 1FJGF 4NLWA 1S0OA 4PG8A 2RKIA 4DV7F 1U4BA 1KLMA 4KSEB 3DYAA 5KFDA 2M70A 4RW8B 1HD1A 1ZETA 1N8RT 2C28A 4J9QA 3HZGA 2VZ9A 2EWHA 2UZAA 4HLBA 3LP2A 2CIMA 4M5DA 2HRUA 4K5SA 1BLUA 4J5OA 5LSOA 2E7WA 4TY8A 4AE5A 1XNQF 4DEZA 4YDDB 2E9TA 4JI8F 3WX4A 4QOTA 5KG6A 4QJVA 1N34F 3CMAS 2BJEA 3Q23A 1S9EB 4IG0A 4DSFA 5J1EB 2OPQA 2YNFB 1HWKA 4UUWA 2Z8QA 4WFBQ 1P1LA 5G4DA 5KFLA 2FB0A 3DHXA 4LF5F 3CT9A 4ZCKA 3FEXB 1IKWB 1C0UB 4A8XA 2AJ4A 5KFNA 3SFGA 5L1IA 1NJYA 1FE0A 2CPIA 4OHWA 3KLHB 5B7WA 3Q8SB 5A6PA 3NMAA 4AL6A 2JFDA 5B0EA 3SXLA 5M2UA 2CQCA 2ROGA 3BS9A 1FEHA 1I1GA 2CG4A 4PCQA 1Y00A 4RUCA 1HBUB 4I56A 4FXVA 3JTOA 4EO6A 1UA0A 2FJAB 4WFXA 3NWGA 4I2PA 3AY0A 3BGLA 2DNKA 2QMWA 4ELUA 1REVB 3FQKA 1WTBA 3HM9A 2HQ3A 3RW7A 1FHTA 1CPZA 2XMWA 1MWYA 3CCRS 4R8UB 3G6YA 1U1KA 2LA4A 2FVCA 2G9OA 3N6MA 1K0VA 4IO1A 2V4RA 1HR0F 1UL3A 2A10A 2J6UA 2DD8S 4CO0A 2BXJA 1S9GB 3O2IA 2IA0A 4ZS6A 1KSPA 1TFYA 4DN9A 1MU2B 4A47A 1T05B 5E3QA 4I67A 1RP5A 2ZFHA 2CJBA 2DBBA 1L5UA 4ERDA 2WBRA 4C8ZA 4F25A 3ZZYA 3DLGB 4HHJA 2V0NA 3HJFA 1JKHA 1LOUA 3TVYA 4DQIA 2KKHA 3NKYA 4AQYF 1JLEA 3MECA 2OP5A 2UUAF 1RT2B 2VPWB 5E3AA 4UUXA 2E1CA 4NZ7A 5BR8F 1S49A 1IKVB 1OSCA 2M9KA 4TY8B 1SJ1A 3GB0A 4IG3B 3JSYA 2LKZA 7FDRA 5K8NA 2IMWP 3V6HA 4ECSA 3KLGB 4CI0B 4LSNB 2PC6A 3QAEA 2ROEA 1N6QB 2DNGA 4C2MA 4JV0A 2IM0A 1MU2A 2R9LA 3P5TL 1I94F 4RUHA 3N28A 1LK7A 1YJWS 2YNGA 3HHKA 1NK8A 5I42A 3OUYA 3CF5Q 2AWZA 3CC2S 1LWEB 4I6AA 1TFWA 3LGNA 3POTA 3MM9B 3CD7A 4J37A 3PKYA 2XCPA 2ZOFA 3GE9A 2ZBCA 3CCUS 4K2XA 2KFZA 1SI9A 1S7HA 1TL5A 3BZQA 3CDUA 3L7OA 5A0YA 2E5HA 1R6YA 1SUQA 2IVYA 3DU6A 4WKRA 2C22A 1FXDA 3QO9A 2GX8A 3DFEA 4ED6A 1Y0HA 4IR9A 4JV2A 3NP5A 4Y28C 4F2RA 1EETB 3H5XA 1X4HA 2GQ2A 1L3UA 1A6LA 1TL1A 2QE5A 5L8RC 2L41A 2W24A 2FVSA 4B9LA 4RX6A 3MOJB 1QE1A 5FDLA 1JXLA 2IFXA 2K3IA 2RNEA 2VG7B 1XMQF 2WSCC 3MCSA 3M1VA 2HIQA 5JUMA 4NLVA 3NL0A 3DXSX 4UQGA 2CVIA 4X66F 3H5YA 5KG0A 4JUZA 4QPTA 4NMLA 3IN5A 4C7QA 4Y2MA 2KN4A 3DHWC 3CSKA 2FHMA 1GX5A 2LU2A 3IR6B 3LO3A 3CCMS 1U45A 1T03B 1KVIA 4OHYA 1C1BA 1SH3A 3CEDA 3EZUA 4LJMA 3I0SB 4CZCA 4WFNQ 4YUDA 2XGPA 1N36F 2W9BA 3RB3A 2ZOMA 2BOPA 4Q45A 2HHHF 2ZKTA 3Q8PB 1BQNB 4QIFA 4ZPAA 5D78A 2Q66A 3DLKB 3FCHA 3N6NA 1CEZA 2MYFA 4Z2XA 4N41A 2OFGX 2WW8A 3D1OA 2FY1A 3F73A 2AJ1A 4ECYA 1HNVB 3O5TB 1VQ7S 3EPIA 4QWCA 1FDAA 5F3TA 4J9SA 3I6PA 3WDOA 4IRCA 5KT6A 2QA4S 5IS2A 3NBPA 2R7VA 1YJUA 2B51A 1BQMA 3E01B 1C1BB 2DHSA 1FKOB 2QT7A 3I0RA 3IO1A 1M0SA 4CT8A 1VQ8S 3MM7A 1LWCA 4PQUB 2JC1A 2ASDA 2PN6A 3T5KA 5AE2A 3FFIB 3FEZA 3RB4A 4Y65A 2BBEA 4HI1A 5EHHA 3HT3A 1NJXA 4ILLA 3GFYA 4NLOA 3SEOA 4ES1A 1ELOA 4NLXA 4F3MA 4IDKA 3ZZTA 1H3DA 2MQLA 4DBQA 4ECRA 2BQUA 2B0GA 1SC6A 3G96A 1LWEA 2XSJB 3DDNA 4DV6F 1XMOF 4YB5A 3KTQA 4OI6A 2N7YA 1SL0A 2W7OA 2WAQD 2YKMB 2AYBA 4ICLA 5I4MA 2M4MA 2EG1A 2ZHBA 2EFNA 3H8YA 4MFBB 1FK9A 4MK8A 5KG4A 1NKCA 2Z2LA 3M2VA 4WKYA 3R1HA 3H20A 3KFWX 3SV3A 2XC9A 4J9NA 1SH2A 2DHGA 2WOMB 2CPJA 1S9FA 4NCGB 4RBTA 2ZH6A 1SV5B 4XK8C 1FKAF 1F60B 5KFQA 2R7RA 1B7FA 4BHQA 1SV5A 4X62F 3CCQS 1S97A 4NCAA 1F0XA 3FSYA 5DGBA 1B0TA 1VQSA 1Y9OA 1YBAA 2KVIA 3UDCA 4C8YA 2ZHOA 2ZD1A 1F5CA 3PX6A 2LQBA 4DQQA 4WTYA 2NS1B 1X5OA 1YVFA 2P9EA 4GC7A 4OI2A 3WZ0A 2NQPA 3MEGB 3ETOA 2EG2A 4DUZF 2R7UA 3JTNA 1RT3A 4YP3A 1XR5A 4OZ5A 3AA8A 3MM5A 1FRMA 1S9GA 2PT0A 4O3PA 3B78A 5KFSA 2XLIA 1T94A 2ZJRQ 1TKZA 4EBCA 3RR7A 1UJ5A 4K4SA 3PO4A 4I68A 3DLKA 2NSCA 3CDEA 3H2UB 1H6KX 4ZPWR 3V4IA 2XEXA 4HTJA 1YJ9S 2FHKA 1S1WA 3HX9A 3D0GE 4OZ1A 2J8AA 3CVKA 3G9CA 4GKKF 4C8KA 2WCXA 4QIEA 1LW0A 2GHWA 1K0TA 4X4QA 4IQMA 4GMKA 4QW8A 1XC9A 2AX0A 5CZVA 5HMYA 1D9FA 1DQ9A 2KDOA 2V8HA 2DR5A 2F9DA 1UJ6A 3HZEA 4DL3A 4QW9A 2RRNA 3IXQA 4Q8EA 3JAMY 1FXLA 3CXCR 5SUHA 5B0CA 5CYMA 3M6VA 4QBUA 3DOMA 1XMBA 3JYTA 4LFCF 3E01A 4MYTA 2DPIA 2KG1A 3H98A 3SSRA 2FJWA 1XBWA 3OXGA 1RTJA 4IFYB 3QGIA 1FA0A 5AE1A 1Q1KA 1FDBA 1U24A 4EU0A 4PPZA 2GA7A 2YKMA 1MW7A 1FRHA 3H4BA 4DV2F 3K2YA 2AX1A 2OLWA 3VF0B 1BD6A 3UQSA 2R8KA 2NLWA 3IBWA 4HVZA 4K4UA 2W4PA 3KK1A 4RUAA 5B0AA 4X65F 1U2RA 2P9GA 3ZFVA 3D1HA 3I4HX 5A0YB 1PC4A 2G4BA 5LXYA 5GAEU 2GGPB 4PUOB 5C25A 4TNOA 2ASJA 1F5AA 1U48A 3DOKB 1VBXA 1EETA 4B9NA 4DL7A 1RA6A 3NNAA 2D7SA 3M2UB 2R2TA 3J7A1 5M2RA 1X8DA 3GV5B 3MM8A 5EUHA 3HP6A 1RT4A 2EFOA 1H38A 5LSLA 1RISA 4X4VA 3PDNA 1IN0A 3IRXA 2MKSA 3KKFA 2O67A 2COLA 3M2RA 4RU9A 3OV7A 2SXLA 4LQ9A 2HHTA 5J2NB 4CT9A 1DARA 4QWAA 1TL4A 4KKOA 3BQ1A 1FK9B 1MSWD 2Y1JA 3AA9A 5GAGI 3J7YI 3BEGB 5KT7A 2E44A 1HBNA 4KFBB 4LT6A 4C8MA 2ZJPQ 1ZM4A 3MR5A 3H4DA 2KRRA 4IH5A 1QAYA 4DR2F 3QWUA 4TXSA 4DJBA 2HG4A 2CPEA 3GIJA 4TYBA 2RSQA 5AJ3F 3BQ0A 1S1UA 2EBEA 1FDDA 4O3NA 2VUGA 4OHZA 1HWLA 1GXUA 4ED8A 1E6YA 1JLBA 3BSCA 1N32F 4DL5A 1H0HB 4X4TA 3FVYA 3G6VA 3VAMA 4ZCLA 1SL2A 3UCZP 5EX3A 5DJBA 5CCMA 3RBEA 2Q1LA 2RRAA 3IG1A 2I2YA 3AB4B 3OR2A 2OD6A 1C4CA 4R8UA 4BBYA 3QIDA 1S79A 1N6QA 3SDEA 2ZH2A 1AFJA 3I5AA 4DSEA 1HBOA 1HQUB 5HL7Q 5BYRA 1WI8A 2CPDA 1IQTA 3OFHA 4ITSA 4Y6IA 3D1QA 1Q78A 3DI6A 2VPYB 1L3TA 2DNYA 2R7WA 1IQZA 4ZOSA 1FVSA 2MKKA 1WG1A 2M5YA 5F0UA 1P27B 2Z2MA 1RT7A 1FJEB 2XI3A 2CQIA 4DL6A 2AYEA 5DQIA 2HAIA 2BV3A 1RT7B 2FHOB 3ITHA 3DRRA 1X9MA 3WC2A 3NCQA 4KR0B 3JSMA 4XAKA 1G6BA 2DIVA 2VASA 3MM9A 1HBUA 5JXSA 3S7RA 1QJHA 2OSQA 3NAIA 1SXLA 4NLTA 4BWMA 1G2EA 4TQSA 3HHNB 2LXFA 3OHBA 2EC0A 4G1QA 5KFVA 4B08A 4GO5X 4A8OA 1TVRA 4ZKAA 3RRGA 3C6UA 3OTEA 3Q0AA 3TOQA 4CO4A 1REVA 4UY8T 2EKYA 2W8LA 3J7Z5 4F4ZA 3PM9A 4RKUC 4BS2A 2GC8A 3KG4A 1XTZA 2KT5A 5F8JA 4JI4F 3PKMA 1VQYA 3LP0B 1GXTA 1IJEB 4YMEA 3K5MA 4RW6B 2IAJB 3SV4A 2VFRA 4I1TA 1YITS 5E5NA 1VIXA 2YNHA 4DSIA 1VI7A 3KNAA 3RU0A 1N0UA 2MMYA 3DMJB 1N52B 3M8QB 4ZCIA 3QYYA 5F41A 1X5PA 1HYSB 3DLGA 4WK3A 4R5PB 4UY85 5KT5A 3GG1A 3GR1A 4B3TF 1RT5B 1URNA 3O8WA 2PFFB 2MZSA 2RF2A 2VKZG 4H4MB 1B0VA 6FDRA 1CSJA 5KFJA 1S1WB 5DO2A 3KMSA 1X9SA 4DR7F 4C11A 2BRKA 2POKA 2JEGA 1Z4UA 2DO0A 4YB1P 3VWSA 1UMJA 2CPHA 3OL9A 4LF7F 4OX7A 4W92B 2MB0B 2WBMA 1QUVA 1HW8A 4Y2CA 3HHLA 3VALA 1DRZA 4IG0B 3OQ2A 3DN9A 2I5JB 2VOOA 4GKJF 2CFXA 2YWKA 2Y1RI 4P6QA 3LF0A 2VA3A 1O51A 2VFUA 3KJVA 4ILRA 1RI7A 2DISA 3IR5B 5DRKA 3UFCX 4B3SF 1J2VA 2FLNA 3N6LA 3OTBA 3X1LB 1WG5A 1JIHA 4MJKA 3CCJS 1O8BA 1SJFA 3NCRA 1NAQA 3RYLA 3OL7A 1FD8A 4NL5A 2KYZA 1KQKA 1UVIA 2YNIA 4WZMA 2M8HA 4RNFA 4G6VB 3T5HA 3UWTA 4A48A 3EYZA 2DHXA 3BB5A 2ZH9A 3RAQA 4OL8A 2JDJA 5LMNF 4DF4A 1ZPWX 5J2PB 1KHWA 4N76A 4CO2A 3UD4P 2EBGA 3HLUA 2KXHA 2V5HG 1I6JA 4M63A 4DX8H 4YOEA 2LEPA 4C0OC 4EBEA 3AJ1A 4FBUA 4J9MA 2UVUA 4PQUA 1ZAVA 2HWIA 1OO0B 1S9EA 1SIWB 5A2QY 2JWNA 1TL3A 4EFAC 1VRTB 2FJVA 2HHUA 3LH2S 2CQBA 3MEKA 2B5JB 1ZAXA 1G7CB 3LAMA 3V6DB 4V19X 5F8NA 2MPUA 4K5RA 3NGDA 1RTDA 4O44B 1WF1A 1NK5A 2B56A 1JLFB 2DITA 3PEJA 3V5RA 5GADI 4K50A 2RD5C 2HWTA 5T7LB 5J2QA 2XGQA 3MUVP 1DHMA 4P7VA 2DCLA 4AXIA 1S1TA 2BQ3A 4X4SA 2KHCA 4K59A 2F8HA 4KHMA 3RW6A 2PO4A 3KK2B 2KG0A 1TL3B 4IOAQ 2LU1A 3MDFA 4O23A 1QE1B 5FDLB 2KYXA 1X4AA 4M94A 1UVJA 1FCAA 2K3KA 3PV8A 2XLKA 4KHRA 1Q86T 2ALZA 3DRYA 2HS4A