4RCOA

1.9 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
192
Chain Sequence
NPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 1.9 Angstrom Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus, in Complex with Sialyl-LewisX.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 51
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rcoA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rcoA01
3MC0B 1F77A 1JQYD 1HA5A 1EFID 1XXGA 2XN9C 1RCVD 4DXGA 3BYTB 1CHQD 3DWQA 1L0YB 1D6EC 1I4XA 1LTBD 1PTOC 1V1OA 1LT6D 3DWAA 1LTRD 1QILA 1FD7D 2NTTA 1JWUD 3TSSA 2RDGA 5ELEA 1T5XD 1JCKB 1EU3A 1RD9D 1LTAD 1PTOD 1YN5A 1PYWD 1CHPD 1STEA 3BYYB 3R2TA 4O1NA 1KLGD 4RHSA 1GOZA 1I4GA 1SE3A 1SEBD 3OWEB 4C56C 4ZYSA 4DXFA 2J4XA 1YN4A 1XTCD 1TY0A 4K6LA 4BWGB 1FNWA 1I4PA 3BVMA 1S5FD 5D3IB 5D3DA 1L0XB 1ET6A 1B1ZA 1S5BD 5FKAC 4OHJA 1D5MC 1TS5A 3KLSX 2O2LD 1TS2A 3W2DA 1PRTB 3SEBA 3EFXD 1BCPB 1RDPD 2XRQD 1CQVA 1S5DD 4RFBA 4RCOA 1PRTF 1HQRD 1G8ZD 2RDHA 1LTSD 1SE4A 2IPKD 1I4RA 2AQ3B 1KLUD 4L63B 2G9HD 3R2IA 5TSSA 1CT1D 5ELFA 2WV6D 2XRSD 1ENFA 2AQ1B 5ELBA 5FK9C 1FNVA 1S5CD 1LTID 2ICIA 1SXTA 3URYA 1PRTC 1YN3A 1PZKD 3CHBD 4RGTA 1EEFD 1B44D 1JR0D 1PTOH 4Z9CB 5ELCA 4RGNA 1I4HA 1SJHD 2Z8LA 1FGBD 1LO5D 1PRTD 1LT4D 1TY2A 4RH6A 1M4VA 1HTLD 1I4QA 5I4DA 5ELDA 1BCPF 3BVGA 3V05A 1SJED 1EU4A 1S5ED 1SBBB 1TS3A 1V1PB 3MFGA 1D5XC 1SE2A 3O13A 1D5ZC 4RHRA 1KTKA 1HXYD 2TSSA 1FNUA 1UNSA 2QILA 4RGOS 1PZID 2SEBD 3R8BA 1JWSD 1LT5D 4NZLB 1DJRD 1CK1A 1ET9A 2AQ2B 2QEJC 1LTTD 1ESFA 2XNAC 4RGMA 1BCPC 1LLRD 1BXTA 1LT3D 3BZDB 1DYQA 1PZJD 1V1PA 1MD2D 3DWPA 1PTOB 1EEID 3GP7A 1UUPA 2NTSA 1AN8A 1BCPD 1LTGD 3BVZA 1JWMD 1EWCA 1PTOF 3EA6A 4L6TB 2CHBD 1AW7A 1RF2D 1TS4A 2IJ0A 4TSSA 2R61A 4UDUC
chains in the Genus database with same CATH superfamily
1EYCA 3AU7A 1C76A 1JOQA 3VTUA 2Y5PA 5HFYA 4XQNA 2JA6G 4FF3A 4K8IA 2CKZB 1ZYRC 2C5CA 3SK4A 4A3IH 3GTLH 3Q8CA 1KF6B 2WU2B 1E2WA 3MA2B 2WNMA 3H8HA 2KMMA 1YMHE 1WD1A 1EY6A 5L83A 1IXRA 3C8YA 1R9TH 1T5XD 2FIDA 4P6VF 2M1MA 4X66Q 3KW5B 4MACA 3BY4B 2C9OA 2KWUB 4FN2A 5C3XA 3CCEA 4Q5VA 4A55A 4LJZC 2DLBA 2MBBB 1TKWB 4BBNF 1XTCD 5KGUA 3RYTA 4JI3Q 1TWCB 3FAHA 5GROA 3WIMA 2IX3A 4QL5A 1V81A 2CJNA 3DEPA 3E9IA 3J81c 1C79A 4IJLA 1J5EL 4M02A 2OTJA 5E7NA 1JWBD 4K14A 1UD7A 3W5OA 3DVNU 3MFYA 1A2UA 2LY7A 2ZJQA 2KWVB 4R3DA 1KAAA 2KQ4X 3EFXD 3HVZA 2WB1G 4KDLB 2Z9HA 3SR1A 2MLBA 1S5DD 1HQRD 1N9WA 1VQKA 1JWAD 3PIO3 2KOXA 2UXBQ 2VZKB 2KXJA 3VAWA 3DHIC 4HIKA 2QIEB 1N36L 3K0XA 4FJZA 3B2GA 1J7AA 3IT6B 2PNRC 4DN4M 1KRSA 5LMNL 1ENAA 1ZE3D 4PYZA 3H0GB 2Z0EB 3HOUB 4CHKA 1NENB 2N9LA 2EJGC 2F0GA 1R4QB 3OWFA 2IO3B 1JR0D 4GSWA 4A3KG 3VTVA 3QQ8B 2VB3X 4TRDA 2O4XA 4G7HC 2KHSA 3KUCB 2KMAA 1Q90A 4HSPA 4YCVA 4DV1Q 2GI9A 1YHAA 1WYWB 1Y1VG 3PGEA 1TWHH 2A5HA 4HJ7A 3OPOA 1A3UA 1U4LA 2HD3A 3M4PA 2JA5H 5CHFA 4ZHPA 1HTLD 2JU6X 2Z4HA 3NBHB 2LJ5A 3VYTA 4LNKA 1EF1A 1CSPA 1UWMA 2GA4B 2N0SB 3RZDB 4A3BG 1FM0D 2Y5BB 1HNZQ 1SBBB 1V1PB 2GRIA 3NRZA 3NQIA 1ZXTA 4C3HH 3RN5A 1NTGA 1IHZA 3KYDD 4XC2A 1SRUA 1KTKA 2M0XA 3RNUA 1HH2P 2INDC 2BS4B 4EKUA 4NJCA 1BBWA 2R3ZA 4MDKE 1AZQA 1WCMG 3QJZA 4GMVA 3WDNA 1VD2A 1N32Q 4LF4L 3CWIA 2AQ2B 2UXCL 1O7IA 1ESFA 2CQOA 1AFPA 3IFWB 1MHWC 1OTRB 3NBHA 3I55A 5JJLA 5C4XB 4JWUC 1EOVA 3KYHC 2LFIA 4M00A 1V1PA 4A3MH 5I6YA 2PIAA 3SHQA 4YXDB 3TEHB 2WS3B 2KVRA 2PI2E 2VY3A 4KGRA 4XDCA 4GLVB 3NY5A 2CQAA 2K32A 2UUBL 1TJEA 2PZTA 3AB5A 2D9UA 1VQOA 2DGYA 1Z47A 1QOFA 4IWPA 1QJOA 4GLSC 1TIFA 5KYIA 1F77A 2WP9B 2KZRA 3SDLC 1HTQA 1HA5A 1EFID 3F2CA 4A3LH 3K7UC 5FR6A 2KX3A 2FCMA 3RZOB 4C3IB 2B76B 4GXBA 3J7ZC 1GB4A 3HOWG 2VQFQ 3U9OA 3U58A 1W6JA 2WXRA 4O42A 3UI3A 4X62Q 2N49A 3KJOA 5JJKA 1N63A 2REXA 4AQYL 3FILB 3H7PB 3T3OA 2L11A 5GAEC 2W82A 5HHDG 4Y7NB 2K5VA 3M9BA 1STEA 3R2TA 4O1NA 2HDMA 5IGCA 3S17H 1STHA 1EY4A 1YJIA 4EQOA 1I4GA 1Y14B 1HRJA 4CJ0B 3OWEB 2JVCA 3DHQA 4GIVA 4A3BH 2VRRB 1NEKB 4AYBG 5FOBB 1Q0WB 1FCCC 4W9JA 5DNFA 2E2IB 5TR5A 2H88B 1I4PA 4X3TA 3K5MA 2SNSA 3QR8A 4CDEC 3FILA 3H7PA 5A2QE 1NMGA 3EECA 1KDCA 4BFRA 2L9HA 2KLGA 5KNBA 1LV9A 4HCEA 1IBXB 2QDLA 2M00A 1XPOA 2L1AA 3I8ZA 5EPKA 4YTNB 5IP9H 3V2TA 1HUNA 2M2LA 3GQBA 2VUMB 2NPTB 1BMLC 1Q46A 3BINA 1OO9B 2N9EB 4A20A 2JZPA 2VH2A 1GUGA 1E5WA 4B95A 4ZHOA 4OO1I 4PYUA 1KLUD 3ZRFA 2EY6A 5FJ8H 3NVWA 1CT1D 1Y56A 1I42A 3S1MH 1K51A 4DHJD 2CVRA 1IBXA 1J19A 1L2NA 1NBFC 5T8IA 2MBQA 2KFKA 4OIKA 2BWES 5BMHA 2ZM6L 3GTJH 1WTXA 2K05A 2NPTA 2DX5B 3Q8DA 4DV7L 4C80A 2R93B 2F0SA 2YV5A 3AE7B 3WAMA 4TQ0A 1IBKL 2L4NA 2Z8LA 3I72A 1E0BA 3B2FA 3RN9C 5JZEB 1NNXA 4B3SQ 4RH6A 1IBML 1I4QA 4A93B 5EAYA 1QF6A 3FKYA 2KA7A 1WM2A 5M5WB 1I6HB 1SROA 3MVVA 1WFQA 4G57A 1SE2A 4IO9A 2DZMA 2AUJD 4IZ8A 1Z5SB 2Y0SG 3CCMA 4BKTA 5E6NA 1X54A 3WAPA 2WX0A 5LMUQ 2L0CA 5IYBG 4RM9A 3ZJTA 2FINB 1T0QC 3G71A 2EYMA 1K3BC 1TR5A 2QEJC 3HEJA 2ATWA 1KH0A 3J7AF 3S2DB 1DYQA 2F0EA 2HE7A 5M5YB 2K1FA 4K6DA 3T1YL 4ABNA 1QVGA 2A6EC 1C0AA 2NTSA 2PKOA 2Z6KC 2E2JB 4K5XA 4I6PA 5EE3A 4ME3A 1YJWA 3D3RA 4IFDI 2Y3AA 3H0GG 2B2YC 3HRZC 4FF4A 3IFTA 1B50A 3HOUG 1HFNA 1WE7A 2OTLA 2PMZB 2SDFA 3WANA 4F1SA 4MIUA 2ZCCA 2W55A 1S3OA 1AE3A 4DXGA 2I5HA 2XN9C 4HIOA 3GTQH 1B4OA 2UXDQ 1ISNA 3HRDD 3I4LA 1T0RC 2PNHA 4MGZE 2L5TA 2YLMA 4NPNA 4DUYQ 4LFAL 3CC7A 1IKMA 5G3LF 5K5PA 4DR3Q 4ZKBB 1RFAA 3P4RB 2RDGA 2DZKA 3PRPB 4NQKE 3CCSA 4YL8A 2R7ZB 2NR2A 2BB5A 2HHHL 1WTHA 3SHLA 2J4XA 2B2VA 3SK5A 4DXFA 1PH6A 3AE4B 1NMFA 4K6LA 3N32A 2JA7B 3ITPA 1QNUA 3ZUNA 5IE8A 2IZVB 5D3DA 3KDFB 1WYGA 3LWEA 1KIXA 1Z2MA 1CQFA 1SNQA 4KTAA 2B3AA 1D2BA 1BBXC 4L1BA 2MRPA 4EQPA 1GKHA 1MIUA 4FO2A 4X65L 1SNMA 1JJ2A 3A56A 4KHPL 5C2TB 1ROEA 1SDFA 2PE9A 5G5HA 1RDPD 3X3MA 3GTGB 3RULA 3GV3A 4POFA 1WXAA 1FL0A 4D2KA 3R3OA 4CJ2C 1JRPA 2JQRB 2MBHA 2FIFA 2IPKD 1A2TA 4DR4Q 5KEEA 3KDFA 2FXQA 4A75A 3ULPA 4WJ4A 1QLBB 2K3UA 3PO2B 1JORA 1UWXA 2MHVA 1IBLQ 3H0GH 3PMFA 4ZUJA 4C3IG 2L32A 3QIAA 1Q3LA 1YNTE 3VDZA 2NMQA 3J7A5 2K75A 4FNFA 4JI0L 3ZKJC 1TWAB 5IA7A 1SN8A 2PQEA 3H6MA 2BVCA 2KQ7A 4AQ7A 3Q14C 2A69C 4KIKA 4DWFA 4AUQC 4LF8L 3HFZB 1N62A 2KANA 2CH4A 3FVQA 2C7NB 3DMUA 2Q8IB 1WTRA 2EELA 3RI7C 2IGDA 1UGMA 2I5MX 2BS3B 2ASBA 2JA9A 1MKHA 1Q8KA 5AJ3Q 2H89B 3BWUD 3RZDH 1XJVA 1HZ5A 1QQRA 1SJED 5KYLA 1EU4A 2IO1B 3H7SA 2KJHB 2E5LQ 2Z59B 3CSFA 2OOBB 2Q2IA 2NZHA 2KHJA 4ODGA 2WGSA 1F2RC 4NB3A 4L5RC 4RKBA 3OMCA 2MWSB 3T9LA 4V190 1EIHA 4HEDA 3A74A 5MPOA 3ZNZB 2EYFA 1X3QA 2ICEC 4WWNA 1VF7A 5C4XH 1YNJC 3HOVH 2VUMG 1D3ZA 2PZUA 4JX1C 1IPGA 2AUKA 2MX2A 4FHKA 5FLXc 5M5XB 3ER0A 1DOKA 1WJNA 1TYGB 1UE1A 3PLUA 1O78A 1A8VA 1STGA 3ZTDA 5IT9E 3HHMA 2GLSA 2RPQA 1OFFA 2LMCB 3PS6A 3V6EB 1C4PA 1UGJA 4BY1B 2WU5B 2LGXA 3M3YB 1PH3A 2DJFC 3P2BA 3J81E 4LUZA 3MTNB 1HZAA 2Q5WD 1X6OA 3DXJC 2W54A 1ACCA 2R93G 3BYTB 1PGAA 2K8BA 3W3AA 2DWQA 4MM3B 4HDOA 2XIWA 1XCQL 4TV3A 1DOIA 5T1IA 3FDTA 3A8IE 1IZ6A 4OVVA 1TVXA 4A93G 3HS0C 2JUOA 3KWLA 1TIID 1MI0A 1LTRD 4WQMA 3J7AV 2G4DB 1XNQL 1JJCB 2LMCA 3PLVA 1RD9D 2E2HB 3GDEA 5JEAG 3T56B 1A3TA 3DQVA 4R4IA 1TKGA 2UUCL 1HR0L 1G291 3V62A 4P73A 3NPPA 4NP5A 3T51B 1YNND 2OF1A 1F52A 4K5VA 1GOZA 2VH1A 4BXXG 2AWNA 1WYDA 2OCEA 4BKGA 1P16A 1PH9A 1RWSA 2HD5B 2SAKA 4MM3A 4JI2Q 3DPDA 4HRSA 2WAQE 1FNWA 1GUOA 2HDEA 4G11A 4QUCA 4HLEA 1OXVA 3DCGA 2SNMA 4DR2Q 4G7ZC 1ET6A 1SR3A 3RD2A 2F0FA 4MGYE 4JE3B 2A19A 3D4DA 5DM63 3BU2A 3PZ8A 3S24A 4WWPA 1PRTB 5CORA 2VNUD 1TGZB 2WXGA 3CD6A 4QMGA 3H3VI 5AUIA 1EIFA 1X56A 5JH5C 4KKSA 1G51A 2A73B 2WDQB 3PUYA 4DR5Q 3N52A 1FVIA 3L10B 3NVVA 1WX9A 1JQ4A 3WOEA 2EIFA 3H94A 2J0KA 1QKZA 2CHZA 4M8NA 3EFUA 2BGFA 2IY5B 3AQQA 4K5WA 4KI0A 2YTXA 2WP8J 3L4PA 3E9SA 2IHFA 2ONQA 5BN3A 2LGYA 1SXTA 2AYOB 1PRTC 4N8FA 1UELA 5J39A 1WX8A 2EYHA 3J81j 1FMAD 4M8MA 4JG2A 1T5EA 2EYJA 2R93H 1FCLA 2NYZD 1HUMA 2D11A 4B0EA 3NEMA 4Z9CB 1YHBA 2R7ZG 1TZOA 4H0LC 3APFA 2KK8A 4A93H 1K73C 1FXTB 4W9GA 2KC2A 2HQEA 1JOKA 2EYPA 3HP3A 5M5WH 1I6HH 3U52E 3P7JA 3R7QA 3D6WA 2JA7G 4OVZA 2A4ZA 1JE5A 2N7EA 1OXTA 1SMYC 5C5LA 1VQ8A 3PT2B 4DA2A 4NKLA 1EF5A 2IO0B 2RD0A 2WDRB 4BS9A 1WGGA 1WXQA 2KC1A 1VQGA 5AZFA 1E1TA 2EY1A 4NMZA 4JYAL 1XO3A 4LJOB 1F1HA 3AULA 4DR7Q 5JOBA 4HIMA 3S2DH 3VHTC 1HHVA 3BZDB 4FP5D 1TU2B 3FC4A 2LKVA 4AP4C 3E0JA 3BDOA 2D3CA 3DBLI 3T4AC 3GP7A 2CKHB 3W5UB 1D4BA 2KEDA 1ESRA 2LRUA 2FFKB 2YEPB 3NK9A 1VQMA 3PO2G 2JA5B 1UE5A 4ZRKA 5GXGB 2ZTDA 1TQOA 4LFBL 1E24A 2DNEA 1G2TA 4C4VB 4B9XA 1Z6HA 2Q2HA 2KFJA 3TEWA 4XWWA 1V8QA 1R4MI 4JI4Q 1GD7A 1JQYD 4JI8Q 4WJQA 1SFOH 4DUZQ 3HOZH 3DVNV 4XT3B 2K0PA 3CPFA 4HJKA 1MG8A 2K28A 5JJZA 1N60A 1G91A 2ID0A 4X64Q 1L0WA 5CBEE 4G0NB 1U4RA 4HXDA 5G55A 3I4MH 4FBJB 4P16A 5IYCH 2WQYB 4PT5A 4C4VA 4FXGC 1X65A 2R7ZH 2WXHA 2L3ZA 4A3MB 4ZKCB 3IKJA 2XSCA 1PFSA 3BYYB 3A4SC 3KYCD 2JQOA 4ANWA 1QOGA 5DPSA 2MH7A 1HCZA 3L2PA 4GOPC 1CZWA 2NVTH 3D6CA 3HOXB 2JA7H 3L08A 3NVYA 4HJ8A 1IYVA 1PDXA 3IL8A 4B3TQ 3CSTA 3QHTA 4XDXA 1X3PA 4KD3A 1SMXA 4GKJQ 2IBIB 4R4CA 1VDZA 5IWAQ 2ZXPA 3DWGC 3W1SA 4JVZA 3P20A 2PVOD 3W2DA 2PLPA 2K7VA 3GTGH 2LVQA 4GKKL 1GPXA 1GXDC 3V61A 3VYRA 1PRTF 2JT4B 1GUSA 4KKTA 4UP9A 4EEWA 1QVFA 1ZGUB 1KAWA 2I0QA 3AE6B 1C1YB 1G6PA 4BY1G 4APVA 3CC2A 1RFKA 1WIAA 1GB1A 1F9RA 4B9KA 2Q2UA 3MXUA 3CCUA 3PZ7A 3FKIB 3TEYA 2ON8A 1PVOA 1JRUA 4EZLA 2K5WA 3AN1A 1FNVA 3DEOA 1TWAH 3EHVA 2GOWA 1LABA 3URYA 2EZVA 3QCAA 5T1GA 2MNAA 3BJUA 3O65B 4LCDE 1KLVA 2PW9A 2F0IA 2I07B 2N9XA 4ZRIA 3SFEB 4EQ5A 4WJWA 4LFCL 2H1EA 2N78A 1CFMA 3M85A 2VQEL 3CCRA 2DNCA 1FRDA 4AOFA 3OW2A 2AL3A 5EQ0A 4ME5A 1HNXL 1JALA 2E76C 4LF5Q 2JX5A 4RNAA 4HKQA 3HGBA 1KJTA 1KD1C 2KDMA 1VQDA 4H7BA 4A3IG 3AM9A 2R2QA 5BR8L 1XCTL 4W9HA 2KYWA 2Z0DB 4QAYA 3WA0A 4FLHA 1LT5D 3QX1A 3T16A 3ENEA 5C0XI 2DAFA 2QC8A 2GBRA 2ZCBA 2LGIA 2WDVB 1YEZA 3HUIA 3KBXA 4IN3A 2DZIA 2EKEC 1CZGA 2K33A 5M5XH 2L83A 1X3GA 3QAQA 2N88A 3KLRA 4HPLB 4C3JH 1WTOA 1YZ6A 4LF9L 4B3RQ 4GLXA 1IGDA 3B0AA 3JYUA 1F2YA 2WLBA 3RNCC 3VR8B 4L6TB 1WZ3A 1LYLA 4K81A 1CA5A 3I56A 3QIJA 4BY1H 1UEBA 1Q1EA 2BPSA 2IJ0A 4L23A 2JPHA 5EGTA 3M3YH 3P75A 1BQQT 2CJOA 4YHHQ 3A8KE 3S15B 4HCPB 1K8GA 4WFN3 2OXPA 1VDVA 3GE8C 3N3KB 1TT5B 2WDTB 1GJZA 2F3IA 1WR6E 3OMGA 2N7DA 4DDID 2JZ3B 2BE5D 2ZNVB 4YWMA 2NN6I 3ONSA 5D7GA 3VH3B 1UWVA 1A6XA 5D6JB 5JJIA 4X66L 1X55A 2EXDA 2E2HH 4OO1G 4IALA 1HFGA 4QJFA 4IUNA 3R93A 1MJEA 1AEXA 3RN2A 4DU9A 2Q8RE 5ISRA 2OWOA 3UQBA 1OQQA 3G6JB 2BDOA 4RHSA 3LYYA 3CKIB 1EIYB 1SE3A 4DHJB 4JI3L 4GLAC 3RNBC 2Z1CA 4CKBA 3ULJA 4XWTA 1VCIA 1J7BA 2NZOA 1KFYB 2ZT9C 3BVMA 3G7LA 2MCNB 2JJQA 1CM9A 2B8GA 2F3VA 2FHTA 2P5ZX 4Q0FA 1K8OA 3AEVA 4A3CH 2K9XA 4ARIA 4IG7B 3GTQB 4XQQA 4B3MQ 1V5TA 3FRPB 3BZCA 2WXPA 3K9OB 1MFWA 4KV2A 1WGRA 3VUYA 4FA6A 3TMPB 1BCPB 2JA5G 1ZOYB 2I38A 4P1CC 1CKOA 4DK3C 2B29A 4RCOA 4BA2I 1WJ6A 1NUCA 4DAPA 2RDHA 1O7ZA 3ERQA 2DN8A 2F0QA 1D7QA 5E4WC 4IWOA 4X3KA 4C3HG 2WXIA 1KHIA 4GOCA 1OXXK 3PO0A 1MVKA 2GBJA 3ZDMC 2AKWB 1V9JA 5E1FA 2RGFA 3RUIB 4JI7Q 1EUJA 3HKZE 3OOCA 4R4QA 3OSOA 3LNNA 4ARCA 4LLGM 4KX6B 1X1MA 3IG3A 1XMQQ 2IHEA 1ICWA 2WXQA 5E4XA 2CH4W 4JPBW 1ZUD2 2K5HA 5IT9L 3I7FA 3PF5A 1WGKA 2UWQA 5FLXE 2L7RA 3A9JB 3OJ4B 4A3OA 1BVSA 3KBGA 4A3MG 3BS1A 3GE3C 3LXFA 2L00B 2K14A 3HVDA 2ZZPB 3MHSD 2VXWA 3I70A 4F8MA 4JOIA 1B7YB 5EKIA 2RQXA 1HNZL 4OO1H 3Q69A 1QOHA 4JOIC 1BUIC 1DXMA 3HZXA 2NB0A 1TS3A 4DV0Q 1RHPA 4RM8A 4L5QA 1D5XC 1LFDA 2KO3A 1D5ZC 1SNDA 4JQWC 1HXYD 1FNUA 3TRZA 1EY5A 2LUEA 3A9JA 1VQIA 4A3LG 1S1QB 4ANVA 4XQJA 3PO3H 1AYFA 2BT6A 1C4CA 2LHDA 3TEXA 2MBOA 3NWTA 3KF8B 2JRIB 4K3CA 3K5NA 2K25A 2EYOA 1V49A 4X3SA 5IIFA 2V1YA 2JXTA 3B6YA 3RMHA 3RR5A 3E0EA 1Y69U 1XLNA 3HIZA 3NZ3A 3D4WA 3SK8A 2A68C 3A7AB 3A8JE 3FKIG 2EYLA 1YIJA 1YX5B 2KNBA 3L17A 3ND8A 5EE1A 3AE3B 3CRKC 3C0RB 3I4NB 4MHEA 2D3AA 4GNXB 3AMUA 3M95A 4UDUC 4N9TA 4YWLA 2RF4A 4PG3A 2DAJA 2ALYB 2LXAA 4L2YA 4P2CB 2JSOA 1UH6A 5CV7A 2W3RA 3TJPA 3M3JA 3H15A 3DWQA 1GC7A 1B53A 5CV4A 3A4RA 5IP9G 1J5EQ 3KK7A 3NUHB 3DBLB 4H44C 4IUVA 4ANXA 2E6XA 5D14A 3HOVB 1HZCA 2RR9A 1JWUD 1VQ4A 1L1OB 4CQNA 3S1NB 3JAMc 4GNXA 2IX0A 4IFDH 1PTOD 4JBJA 2B8FA 3IFDA 1K83B 4IFDJ 1E0ZA 2K04A 2BS2B 5DCNA 3DBSA 1WOCA 1VQHA 4KY5A 5FJ8G 2PQAB 4F87A 3HOXH 1PH5A 4DV4Q 1R4MB 1WJ4A 4N8X1 2KECA 2JYOA 4DV3Q 1VR9A 3IAS1 1S4ZA 4J6IA 5LHY1 1EWIA 2CW0C 1B1ZA 1S5BD 2KENA 4CKEA 3PCOB 2F0UA 5C4JH 1L1OA 2LRWA 2KAJA 2O2LD 3CMEA 2NVXB 2YU9H 2RCFA 1WXSA 2Z4IA 1PGBA 3TS0A 5EPJA 4AJYB 3AFPA 4DAYB 3F8TA 3CXCA 4B9WA 2NBWB 2F3WA 3ICEA 1SE4A 5EJWA 1EM7A 5JHBA 2N3SA 3MZ5A 2WHIA 4KGTA 2AQ3B 2B2UA 4L63B 3FKIH 1KABA 1P7FA 3VDYA 2D2CC 2B2UC 1LQBA 4W9IA 2XRSD 5JHAA 2BA1A 1GM5A 1RJTA 3IAM1 1C4QA 3KH0A 1AWDA 4DAYA 4IM3A 3STBD 1YJ1A 3QA8A 2RSUA 2RSOA 3QOLA 4XT1B 2LI5A 5IGDA 1PTOH 3WOFA 4ICVA 1V1QA 2JEAI 3GZNB 1I4HA 2O2VB 4B3SL 3MP9A 2INCC 1F0ZA 3PSEB 4P75A 5ELDA 4YTPB 1N5WA 1WX7A 4PNYA 4RF1A 2NVQB 1I3QH 1S72A 1T0SC 2JYEA 1FR3A 3CCVA 3ZLZA 4GB9A 5LMUL 2QDFA 1O7YA 3RLFA 1LM0A 4LNOA 1NE3A 4E71A 2WX1A 5CMDA 2MGSA 2CU3A 4K7UA 4LW1A 2EDGA 5LMNW 2O2VA 4NZLB 1FD6A 1J8IA 2V4IB 1M94A 4A3PA 3NE5B 1EO6A 5E6OA 5J1ZA 2BYTA 4RGMA 3TIXA 5DPTA 1FPYA 1ZYRD 3A7LA 1PHJA 1Z7TA 2R6GA 1XF5L 4J3OD 3UF8A 5CV6A 3CMAA 1UZXB 2IYDB 2PI2A 3G48A 3X23A 3DWPA 5DM73 4KLKA 3J7YW 4GN4B 3B1LX 2M4NA 1AN8A 1XX8A 4IJHA 1BCPD 5EKKA 1V80A 1DOYA 1DCZA 1I6VC 3TDQA 2EVBA 1SYBA 1CI3M 3OTOQ 5H1SE 4C2MB 2IL8A 4A3EB 4HAEA 4X57B 5D94A 4K2LA 4FJYA 4DK1A 3S15H 3AE5B 3PHXB 2BW2A 1QZHA 4ALPA 3S1RH 2DYBA 1H9MA 5CBAE 4NJ6A 4DUYL 1QT9A 3I90A 3ZDTA 4MN3A 4KKJA 1D6EC 1I4XA 2LSSA 3M4QA 1BR9A 5M3FH 1V1OA 2K50A 1TBEA 2NBVB 5LL6S 4LUVA 4WH4A 1TT2A 1JMCA 4HMJA 1ZKOA 2F0HA 5AZHA 4F7ZA 3E5SA 1EU3A 1WM3A 4BVUC 3T8MA 4DAVA 3W9CB 2J7ZA 2PPHA 2MQHA 3UDIA 5HGTA 4NXNQ 4HDQA 3FMCA 2PEAA 1WR1A 4MSMB 4REZA 1PV4A 3V96A 2PE6B 2K01A 3JC66 2Q2TA 4YSYB 4QF4A 1TY0A 3AE1B 4IQZA 1HQMC 3RCZA 3NQTA 4LF6Q 1U4PA 2ZPYA 5GMVA 5J22A 4PZ6A 1SFOB 3HOZB 1D5MC 5JVG3 4QIWE 1EYGA 1MSHA 2IW3A 3EGRA 1L4DB 3ZTCA 4GZYC 3RNGC 4A8XC 2A6HD 2L0FA 4A3GB 1GUTA 4RWSC 4DV7Q 4UP7A 1L6UA 1BDOA 4KVGB 1IBKQ 2KCMA 4LAAA 3Q2AC 5C1ZA 3ZVVA 2QCPX 3LDZE 3I4MB 2NZ1D 1LTSD 3I4NG 4XX5A 1IBMQ 3TN2A 4DR4L 1FRRA 1NVID 2D5DA 3QG1A 2MHJA 2IGGA 2D07B 1M90C 2CWAA 4PZ8A 1VS0A 3KF6B 4KD4A 2B2TA 2JY6A 2NVTB 1IW7D 4BY7B 1SB3C 2B2VC 4RAUC 3GS2A 1EY9A 2JZZA 3CP0A 3KUPA 1A70A 1B70B 3TP7A 1QNKA 3HOYB 5C4XG 4JWSC 2OQKA 2YYZA 3HOVG 3H3VH 2ENBA 3AEBB 1ZXIA 2C35B 4W9CA 3Q24A 3D0FA 4KSKC 4HCSA 5FO8B 5AJ3L 2G4SA 4JI1Q 3T1YQ 2Z6BA 1H95A 2CFMA 5I4DA 3KF6A 2MJDA 5L37A 2LGSA 3A9KB 3KLWA 4PMWA 2RPVA 3DBHI 4JGHB 1S5ED 1WJJA 3MFGA 4KY6A 2R2OA 1STAA 2HTHA 1C9FA 1N6ZA 4DHZE 3Q6SA 3U4VA 2PJHA 5BN5A 1UNSA 5F2DA 1PZID 2UU9Q 2JF5A 3ML9A 4IUPA 2KEEA 2ZJRA 2KDIA 1EY7A 1DGSA 3UQAA 2X69A 5CHVC 1XEEA 1SNOA 4BOZB 4LWCA 4DV2L 2PW5A 1SAPA 2HCIA 1EY0A 1C48A 3A9KA 4ANUA 4LFAQ 5EBDA 4CGYB 1EQVA 2L05A 5H92C 3BVZA 4H2AA 5IGBA 4M01A 4R4OA 2KUMA 1N33Q 2JEBI 3I4NH 4X6AH 4DK0A 3P4PB 5I2XA 2EMSA 2PCFB 4B08A 1D1KA 4ULLA 1SYDA 4J15A 4RA8A 3LX0A 4ZCKA 4K2KA 4CDDC 1S40A 1ZDVA 3RMKC 2F0TA 4DNIA 3ERSX 3L7ZC 1WFYA 3E9HA 1C77A 3S9WA 1CUKA 1E8XA 5HY6A 3UINB 2F0VA 2V3SA 2BDNA 3MHBA 3ONAB 1XD3B 2F4VL 3AE8B 1LT6D 4KHPQ 3EN2A 1E8YA 3S1NH 2PZWA 1XMOL 1OQYA 4DBGA 1QUQB 1A3VA 5C3WA 1I5FA 2FMCA 5ELEA 1VQ7A 3MC8A 1K83H 3GTMB 2DY8A 2LXKA 4C3JB 2JWUA 2N1VA 3CMMB 1UEAB 4LNNA 3VTWA 3VQIA 4HSVA 4DR6Q 2ZVOA 3I73A 5FLXL 3U7DA 3A5ZB 1FFVA 3KUZA 3U7ZA 4DV6Q 4R1JA 1GVPA 2INNE 4K0KL 1FJGQ 1QVCA 1JMLA 3MEFA 5COYA 1VZ6A 2CU1A 2ACZB 5D3IB 3K5LA 2IY0B 2MBEA 2E3TA 4BBRB 4DV5L 2KWDA 5CX3A 3JW0X 1VJKA 4LJPB 2NVXH 4DNTB 1HZBA 4JI6Q 1M8AA 2N55A 1JW9D 4GDLB 5J17A 1IYJB 1XLOA 2AWOA 3PF4A 1N34Q 3CCJA 2IX1A 2DNFA 5G5GA 4PS3A 1ICFB 1PH1A 3J81i 4RCNA 2D2QA 4W9LA 4RFBA 1GUAB 4JK1C 1KNEA 1B2TA 1G6ZA 2BBCA 3VUXA 3MJWA 4A3EG 5AEKB 1I35A 1EZ6A 5ELNA 3PUXA 4DGZA 2BH2A 5IN7A 1PMRA 5IGEA 1PH2A 1H9KA 4WQOB 4IPHA 1HNWQ 2FBWB 3OLMD 3PVLA 3SDZA 4GDLA 5FK9C 4TKOB 1S5CD 2D3GA 3UI2A 1ML0D 3GV6A 1A5RA 3Q0AA 1WTQA 1E7ZA 2K8CA 5FLMH 5C44H 4IM0A 1EFWA 2QHOA 1ILQA 1B9NA 2KVMA 1SJHD 2OJRA 3ZXRA 1FEHA 1F9PA 3FPUB 3DLLA 3U8ZA 1BO0A 4KJOA 2D62A 3OHXC 1M4VA 4BBSB 2NVQH 2PYKA 1RAXA 2F0DA 2MA9B 3ETRA 4FADA 3H9DA 1E6EB 3MHZA 4WURA 3KLSA 2A6ED 4MNOA 3O13A 3NENA 5KIXA 1T0YA 3EUB2 3ZJUA 3X3NA 2QILA 4POGA 1EYAA 4IOCA 3HOZG 2XEWA 4YY3L 4O0AA 1N5XA 3KWVA 4HVBA 3HM6X 2E8GA 4KN4C 2N7JA 2UUAQ 1XYIA 1LTTD 3T1HQ 2F03A 5D2MB 2ZXRA 3I4MG 3JAME 5IYCG 1PZJD 3J80c 3PUZA 4OZAA 4HN7A 1XNRQ 2WXOA 2NBUA 3BK2A 4CKCA 2KHWB 3NG0A 1EWHA 2IY1B 1HZ6A 3EA6A 2N9KA 2F0PA 1PXUA 4MEMA 3SR6A 2DHZA 2UUCQ 1DM0B 4C2MH 3JAMi 4A3EH 1K9MC 1RF2D 4L5SA 1WH3A 1Q1BA 3C1EA 3K57A 4JI4L 4LTUA 4P1BC 2C9WB 3OJ3A 3HOYG 1JE4A 4I6NB 4DUZL 1FGUA 3VH4B 1B9MA 2WKCA 4KGSA 2EXZA 5C0XH 2YTYA 4CDCC 1E3PA 2A74C 2DBYA 5C0XJ 2WAQB 2JWZA 2OT2A 3PO3B 2GBMA 3VYUA 2BYFA 4BOSC 5IP7H 5E3FA 2W3SA 1E10A 4G4KA 1PFDA 4ZRQA 3KVFB 3Q3MC 4P71A 1Q5WB 3RT3B 5FR3A 2Q8TA 4OWTB 2G3QB 3BDCA 2NTTA 3W5VB 1NI2A 4OVUA 2WB1E 3F2DA 4OEMB 4LDTB 3V6CB 4A90A 1PYWD 4YIJA 1VCBA 1G2SA 3I3CA 5BMIA 5A2QL 1L5PA 1GHJA 4C56C 3VR4A 2I1JA 1YN4A 2L12A 1WJUA 2QJLA 4GKJL 4BWGB 1WTWA 2LXJA 2FUHB 1HA6A 1EYDA 1C4AA 2WACA 3SE0A 1LACA 2WXMA 2NN6H 4OL7A 5J3BA 1NCVA 2Y5CA 1RM6C 2ZTCA 4A3GH 4XYCA 2BB6A 3ZQ4A 4YT0B 1CQVA 3VFKA 4W9DA 4DR1Q 3RNEC 1G8ZD 2FCNA 3ND9A 3OG5A 3D4RA 1I94Q 4W9EA 3P1HA 1FXIA 1HJPA 4EGVA 1WY8A 3IRBA 2HQLA 3MXNB 4UAIA 1HR0W 2K6DB 4JBMA 4DXAB 2G9HD 4NW2A 5KNCA 2QDBA 4BY7H 5JVH3 3QWNA 5DLQE 1V97A 3HOYH 3U2SC 5H8YE 5CHWA 2EE1A 3VR2A 2YVCA 4PS7A 4S17A 4F8CB 4R8NA 3DVGY 3TREA 4JYAQ 2KCTA 1ASZA 4KZCA 3VR5A 2WXJA 5C4JB 4IUMB 5JXVA 1JC7A 5I2YA 2LJIA 1V8CA 4U673 5IP4D 2DJGC 1SIFA 3VA5A 3NP8A 2YU9B 4C3JG 3MXNA 3KFUA 1MHHE 3W1SC 1X9NA 5C3JB 2ASQA 1PDQA 1YNJD 2DYMA 1EZ8A 2JA8H 2MJEA 4LFBQ 2RKSA 5J18A 4WJPA 3M7GA 1WGHA 2K03A 3NUCA 1CZPA 4ACFA 3LWUA 1DOMA 2E2DC 3FHWA 4R9WA 3ZRCA 2RHQB 4ZRPA 2JN4A 5FO7B 3GD7A 4LF7Q 4PK1A 4FDBA 2QKIC 2R7DA 5M9OA 4NAWB 4GN5A 1LT3D 1TKYA 4A9AA 2X6GA 4ZRJA 2F0KA 4B3RL 4YWGG 5E6JA 1PTOB 1OXSC 1WI0A 1ZEQX 1H8CA 3NZSA 2RA4A 3P4QB 4CYEA 4LNIA 2QGQA 3TP6A 2BA0A 2L8JA 4MGKE 5NUCA 1LM8B 1K53A 1TS4A 5JAVA 4TSSA 4JV5Q 1I3QB 4TVAB 4YHHL 1V86A 5IKCM 3P1MA 4NAWA 4AYBE 4A3CG 3BG3A 2G5DA 3NTKA 1U9RA 1VMCA 2M9VA 2FE8A 4ITKA 2MP2B 4G50A 4JI5L 4I65A 2LHEA 1L0YB 3TBLD 1WCMB 1PTOC 3TP8A 3LJ3A 2WXNA 4BBSG 4JLCA 5LNK1 1MHXA 1FO4A 1QILA 1FD7D 1C3TA 2B2WA 2V1CC 5GAHC 2C60A 3GTMH 2KJXA 3K59A 1YHQA 4YSZB 3W1BA 5I6WA 1LTAD 1UBIA 2B2WC 3B08A 4NNJB 1WD0A 4OX9Q 2I5LX 1WWTA 3ABVB 3Q3OC 2O6VD 4BAXA 5EBCA 3UGBB 4HIDA 1A62A 1D1IA 1VQ6A 3S16B 2BOSA 3OW7A 1VQBA 1VQEA 4ZYSA 2LASA 2MP2A 2YEPF 3MXGA 4IOIE 2CCZA 4NY0A 4MSQB 2B39A 3AMZA 4IUQA 5CC4A 3DUZA 4BBRH 4HJ5A 1ASYA 4AJWA 4HJ9A 4ZQ3A 1DOXA 4HEA1 4CHTB 4JCVE 5FKAC 2KDBA 2CS4A 3GTPB 1EUVB 1OXUA 3S1RB 3H09A 2ZVNA 1ZDXA 3DOWA 1P3QU 3FP9A 2M56B 4J6HA 3P42A 3SEBA 4OONA 5M3FB 3HOWB 1W2BA 4EX5A 1WSPA 1QB5D 4V0BA 4GN1A 1Q86C 1EY8A 4LFCQ 4I6LB 4NJ7A 2LFNA 2VQEQ 2ZEQA 4RG1A 4JBKA 1Y1WB 2R92B 3IHPC 5LLIA 1HZ9A 1GG3A 1HNXQ 1RYJA 4FXKC 4ZUIA 2KWCA 4XZ4A 5AUKA 3R2IA 4KJNA 3I91A 5AFWA 2WAQG 3STBC 3PO3G 1F9QA 1SYEA 4NXMQ 3SFDB 2Y0SE 3L13A 1XMQL 1J8CA 3IT4B 2V4DA 2H5XA 2MJ3A 4WWOA 2RVLA 2LWPA 1SMYD 4B0MA 4HCNB 1P9DU 1CKNB 1L6VA 2ZNVC 3ZJVA 4J8QA 2KJ6A 1SSNA 3EIVA 3TQYA 3APCA 1EIGA 2WWZA 2KQ3A 1SNPA 4O2DA 1IYUA 3UDFA 1K8RB 4OELB 4P74A 1FGBD 3SGIA 3ALBA 4WJNA 2N4FA 1Y8PB 1W6KA 4BBSH 3L9AX 2UXBL 2NWGA 1GHKA 1CKMA 3I5JC 4DV0L 2HJ1A 2J52A 4XYOA 4N58A 1Y8RC 3AYHB 2RCNA 3RLNA 4LDTD 4N6EB 3EQLC 2EY2A 2HIVA 4TQUS 3MXPA 1Q7YC 1YJJA 1CKNA 1OEYA 4BA1I 4HJGE 4CBVA 4UY8C 2GN5A 3Q3NC 3VUWA 3P4SB 2ZJPA 1Z9FA 2Z0SA 3PUWA 2LZ6A 3M4OB 2MFIA 1CK1A 1DJRD 3D8GA 1ET9A 1ONLA 2F0LA 1F2LA 4E6IA 1FXAA 3B9JA 3I3TB 3N9YC 1PH8A 4IKGA 4A3DB 1NSNS 2AEHA 4XDDA 1BCPC 1L4ZB 4IUUA 4DV1L 1EL0A 4IUTA 1GJXA 2E74C 3ZNHB 2KDFB 2MJ8A 1KNAA 3D32A 1X3FA 5HURA 4IFDG 1UBQA 3Q8AA 1H4RA 2M19A 2E75C 3MC9A 3J81L 4EQNA 1IGCA 1JWMD 1YX6B 1PTOF 1J6QA 4TQ1A 1EQQA 3HOXG 1AW7A 1TWFB 1NYQA 3AECB 3E6ZX 1K8MA 4DNRB 3LB8C 5IT9c 4IWQA 4C00A 1VF5C 3DBRI 1KRHA 2FAZA 3HM3A 4ICUA 4TUUA 1WE6A 4LNFA 3EROA 4EFOA 2INPE 3WAOA 3UIOB 3DDCB 2PW7A 2Y0SB 4HMIA 1N32L 2BH8A 1K50A 2UYZB 3L54A 5IYDG 4BKSD 1CHQD 4HWIB 2V3NA 3H3VC 4U68A 5C6AA 1F2RI 4M0WB 1LTBD 2DUDA 1FIQA 3ZGZA 4FVMA 3KOJA 3C19A 2PO4A 2ZTEA 1YJ9A 3DWAA 3Q23A 4DPGA 4K7WA 3VXWA 4A3FB 2HUGA 1CJEA 2BQQA 3ZJYC 4EUTA 2MUYA 4ZAIA 3G6EA 1N61A 1YN5A 2GVAA 3DHHC 3MEHA 1DZ1A 4GDKB 1KLGD 3D31A 1KL9A 2WIIB 2OQ0A 4DV4L 5AZGA 4J1MA 2I2YA 1SEBD 1MBYA 3WWVA 4DV3L 2PPBC 2GVBA 3W1YA 4ASWC 1KQSA 2L15A 5BYQA 1U0LA 1B3AA 4M0WA 4AH6A 2G9DA 1BOSA 2QW7A 5IGGA 2A6HC 3KF8A 3PSIA 4JPSA 5GQOA 3HKZB 2A5UA 4DDGD 2JA6H 5CR3A 2MW5A 1Q82C 4OHJA 2VQFL 3NS8A 1QWYA 3KLSX 4XTCS 3K7AB 3SXHA 4X62L 4IPCA 1XQQA 3IVFA 2K8HA 4DFAA 3R66C 3CPWA 3UIPB 2JP1A 4GDKA 2AL6A 4K7SA 5LXHA 1I7HA 4HK2A 2EOTA 4UPAA 2OJWA 2F0NA 4H02A 4ZOHC 4QQBX 2KD0A 3NJTA 1CTMA 1Q8IA 2KACA 1IW7C 4GNXC 2F0MA 1I4RA 5CV8A 1CMXB 4G3XB 1B9RA 2KLCA 2VW9A 4MZ9A 3JAML 1JB7A 1GNUA 2F0WA 1VLBA 1N36Q 2NVUI 3PGZA 4NAMA 1U5KA 4QGUA 4B6WA 1KM7A 1WZ0A 1RIPA 1M1KC 1LTID 4PMCA 1IL2A 2ICIA 5LMNQ 3S2AA 3NZUA 4F88A 1YN3A 1PZKD 3J80E 2QEXA 1EWYC 5IYDH 2K5NA 4YTMB 3M63B 1JJGA 2K6QA 1L1OC 4RGNA 1HPCA 2VB2X 5GAGC 4CJ1B 3NHEB 1A15A 2VS1A 1VQ5A 2NUCA 1JICA 3K58A 1P0RA 2PQAA 1PUTA 3F2UA 3NS1A 3J80i 1J0GA 1BCPF 1EQRA 5DAUA 2DYOA 1WRIA 3TP5A 4OW0A 2ZJDA 4FXDA 4URKA 1VQ9A 2PVGC 1VQFA 3K5OA 4KV6A 1UE7A 3L16A 4RGOS 3JSVB 3RUZA 3BDLA 3Q8BA 4MT5A 4WAAA 1YQBA 5M3FG 4X3UA 3ZXVA 4LF4Q 2UXCQ 3CQZB 2LUMA 1QZEA 4A3KH 3ZNGC 5C44B 4NDXA 1Y1WG 3CC4A 2L55A 5GADC 2R92G 3ZW3A 5CYUA 1Y1VH 2XWBB 1I50B 1C7YA 2DY7A 3JSVA 1SLJA 1MPEA 3ZYYX 3OTOL 5J2RA 2QCZA 3T13A 4II3B 1L7YA 1F2MA 1A63A 1E8WA 4HPMB 2K6AA 4AIMA 4HROA 1OTCA 1H9RA 2R61A 1PFBA 4LMQD 4ZK9B 5M3MB 1NDDA 2UUBQ 1YITA 2B63B 1YD8U 2KVZA 3VR6A 3AE2B 5DPRA 5IO9A 1YQ3B 3A5UA 3CCLA 1WCMH 3RZFA 2J0TD 3I63C 4QB4A 3AEGB 1P98A 1NYRA 3EVQA 4DAMA 3S14H 2CHWA 1MGSA 4DF7A 4N9PA 3VYSA 2A8VA 2KFKB 2FJ2A 5EE0A 4PV1C 1H9SB 2FMMA 2QF7A 1XWEA 3TSSA 3L0WB 1SYGA 1WI5A 1KRTA 4NXNL 4AQYQ 3EFCA 3BK1A 1XPRA 5BYRA 4JW0A 3KJPA 2ZW1A 2BYVE 4ID6A 4OXPA 3S16H 3ZNID 2PMZE 1CSQA 1JOOA 1NR4A 1TWGB 2L0TA 1R4NI 4ZYNA 1WMHB 2CR5A 4LF6L 4Y52H 4FULA 5IOCA 4IC7B 4A3DG 4DK6C 2UXDL 2KT7A 1B3QA 2KHIA 3L3OC 4A76A 1H9SA 1NJIC 1VMPA 3VA7A 4OGQC 4MTKA 3GTPH 2KDEB 1TS5A 4DKAC 4PZ7A 1DOLA 1PH4A 1TS2A 1E1OA 5KNDA 3A54A 2ZW0A 3HOWH 4GS3A 4DR3L 3QARA 1QG7A 4M8AA 5HGQA 3M4YA 3PIPA 1YNNC 2D0PA 1J7CA 2YTVA 1AARA 1WMHA 1V43A 2FCSA 2K5PA 1QOAA 3U50C 1NI3A 3GTKB 4JL9A 1Y1WH 2R92H 1Y8OB 3TS2A 3NTIA 5C5MA 3U4EG 5EKLA 2MQJA 5I9PA 3IAYA 2JK8A 3U4ZA 2MP1A 4KDIC 3S1QB 1JROA 2AX5A 2B3GA 2OEDA 1FYCA 5ELBA 3A33B 2KCNA 1D8LA 3BZKA 3ULLA 3QOJA 1OEYJ 1T9HA 3CHBD 4RGTA 1KOTA 1LUZA 1B44D 2XGTA 4A3FG 2ZM6Q 1VQJA 4A3JB 2D5GA 2FUG1 2Z6KA 4JI1L 1VZ7A 4RMFA 1UE6A 2V4LA 4R8IA 2B2YA 2C7MB 2J7QB 3GTOB 3PTFC 3R3MA 2VZKD 2GB1A 3OIQA 1Q1OA 1SGHA 3N1YC 3TZUA 2NVYB 3HKZG 1IBLL 2UU9L 3TCAA 2A68D 5CTRC 4C7YA 3TEZA 4UP8A 1E7UA 2IDYA 2KX0A 2SEBD 1MI2A 3M4OH 1UF0A 1IP9A 2B2TC 5EPLA 1P8LA 4II2B 3EC8A 3TUOA 2AMCB 4A3DH 2XNAC 1K8AC 4M1UB 1PLFA 1STYA 1E2VA 3AH7A 3PHWB 4IPGA 1X3EA 2IWHA 1R4PB 1ZXHA 1PFNA 1EEID 1LGRA 1BUVT 1N33L 2RDFA 1KXLA 1EWCA 2GBNA 5BYSA 2LGDA 1STBA 2X38A 1TWFH 4AS1A 2EY5A 3M62B 2E5LL 4Q2JA 3ML8A 2JA8B 1TWCH 2CWPA 3GO5A 1ENCA 4H13C 2EJFC 2OEOA 3PUVA 3TMEA 3F1ZA 3A55A 3OYYA 3QWZB 1OQRA 1JT8A 3HK0A 1RCVD 4S0RA 5LL6X 5IYBH 3VRAB 1ZW7A 2EMTA 3V60A 4QCLA 4MH0E 3QB3A 3K0YA 2WFWA 4QIWB 2CW0D 2C5LC 4A3FH 1N8RC 3T53B 5C4HA 2GMIC 2EQSA 1VQAA 5IY0A 2KCCA 2HTME 4JIOU 4KIKB 3U30A 4DR6L 2NS5A 3PZDA 1WVLA 1PGXA 1RLFA 4W9KA 3DBRB 5IOIA 3APDA 4DV6L 1GUWA 3IBEA 1FJGL 4KMUC 2HHHQ 4HJAA 1JB3A 3HOUH 3WCQA 3I2ZA 2MEKA 4US9A 3T3NA 3N1XC 1K28A 3NELA 4JI6L 3QC8B 4YCWA 4EVOA 3K7AH 1AE2A 5ELOA 5FLMG 5C44G 1N34L 3EJIA 1QE6A 2JRHA 2KN5A 4N59A 5BO4B 5G3LD 3CIRB 1SYCA 2DZJA 2XRQD 1U4MA 4X65Q 1PH7A 2M8SA 3KUDB 1J9OA 2I1KA 4C7ZA 1E90A 4IW0A 4QUFA 3CF5A 2X8XX 1Q12A 3CW2C 1GO3E 4L5TA 4EZKA 4XIGS 5M3MG 1H9JA 4OZCA 2V3PA 4WAFA 3K8AA 2B63G 3F2BA 4WRDA 4YCUA 3AXCA 2N8NA 1HNWL 4RMAA 2WINB 3NBIA 4JI2L 1DD2A 1PYBA 4YWKA 3NSWA 5JPMC 3G4SA 1IYFA 2WV6D 4DHZB 1ENFA 2AQ1B 3MAQA 3M7NA 4DR2L 3L0OA 4KK7A 2X6LA 3CF6E 3S2HB 3AEDB 1E7VA 2GBKA 4KHZA 2XK5B 1QUQA 4JI0Q 2PTLA 4ZDVA 4PMBA 2ES2A 1QCBD 4DV2Q 4OZBA 2J0MA 1UAPA 2K52A 2XBBC 4LF8Q 3JVZX 1LT4D 1SYFA 1L2FA 1E9MA 3IXSA 4DR5L 2HDLA 2ZXOA 1SE8A 4FF2A 5TSSA 3QK0A 5KHQA 3PPAA 5C3EB 2XK5A 2UU7A 5C0XG 4K1RB 3WALA 1SIJA 4GN3B 1S3SG 4XYQA 2UUAL 3RZOH 5D65A 3U9SA 4C3IH 3H1UA 4GGQA 3T1HL 3NWSA 2AWTA 1JWSD 4EE2A 5IP7G 1E2ZA 1ILPA 2BKRB 4G7OC 2KKCA 1K0RA 3CQZH 1WXMA 3N20C 2O5IC 1BXTA 1XNRL 1F2ZA 2F0OA 2F4VQ 4Y7NH 1T3QA 1YVCA 1IL8A 1I50H 1ZP0B 1XMOQ 2O6VB 4MELA 1MG4A 2AHOB 1II3A 1YQ4B 1IKLA 2LXCA 2XVSA 2M0AA 1NBWA 5M3MH 3ECIA 1HEZE 5DPWA 4KHVA 2E2IH 2B63H 2I46A 2NBFA 4OWWB 2VZAA 3MC0B 5HG2A 1SF0A 4C1NK 4K0KQ 1C9OA 2NN6G 2LVOA 1A0IA 1XXGA 4A3JG 1RRBA 1WRDB 4A3IB 3GTLB 4DR7L 4TMAB 4A3GG 3DWMA 1K3RA 4DV5Q 4FHJA 3N1ZC 2O6VA 2XTIA 2F0JA 2PMVA 4WJ3M 1TKEA 2JYTA 3P63A 2F1MA 3PRZA 3TL5A 1YNXA 5I9OA 2VUMH 3PRMB 1Q81C 2EPBA 3OIPA 3C3LA 2K22A 1JCKB 2BCOA 4N9F4 2MSED 3Q6BA 1R9TB 1XNQQ 3FPPA 1R7SA 3ZIMA 1CHPD 4LUOA 1TWGH 3J80L 1NR2A 1K0SA 3Q8EA 3QJYA 1XTDA 2IO2B 1SSOA 4KN7C 1HR0Q 3NHHA 4KY7A 3AI5A 4BY7G 4EOYA 2K1BA 2L76A 2BKFA 2D3BA 4US8A 4JI8L 1E7PB 3PQIA 4NQLB 4A4IA 3Q3FA 4XE0A 3DM1A 1QOBA 2BE5C 4QY7A 1WTVA 1K52A 2K4KA 5HKHA 2RSNA 3HG9A 4FF1A 1SE9A 3E3XA 2VL6A 2HT1A 5FO9B 1NY4A 4X64L 1XPUA 1GC6A 3AU4A 3J9CA 1T6BX 4W9FA 3CAMA 4XXEA 4DR1L 4PS8A 3Q8FA 4FXCA 2N9PC 2D10A 3PIP3 3GTKH 1I94L 4CO7A 5L95C 3PIOA 2JA8G 1U4AA 3RLOA 4MGIE 1AH9A 5JEAH 1CA6A 4I7ZC 2KQSA 5IGFA 1BF4A 1R4NB 5JEAJ 4WWMA 1HE8A 4AWJA 5C23A 3Q3JA 1HTPA 3AEAB 1G6JA 2KBNA 1C8CA 4MTNA 2MO0A 4PQXA 3S1QH 2C7HA 2D0OA 4BXXH 5IAAC 3V3XA 4B3TL 3MJ5A 1F9SA 2V0GA 3DVGX 1F9JA 4RKLA 3A0JA 3RPFC 3NTHA 4F7XA 2F4IA 4YY3Q 3BIID 1VQLA 3NXWA 3CRLC 2SOBA 5IWAL 2KMCA 3MWYW 4MJSB 3NOBA 4MH8A 2JA6B 4A3JH 1E8ZA 5M5YH 1IUEA 1C78A 1LXDA 1BT0A 4IDIA 3K80C 2MO1A 2BTEA 2E2JH 3TBIB 3AEEB 4JBWA 1P1AA 1TWHB 2A69D 2HJ8A 4P7IA 3VR3A 3RNAC 4ZLTF 1O80A 3GTOH 3H6NA 3BVGA 1RODA 3MTSA 1Q10A 5BMGA 1EOTA 3R7RA 3V05A 4LK0M 5K36G 2ZPNA 3AU5A 1X32A 2L1BA 2NVYH 1RKNA 1MJCA 4RHRA 2V9HA 3A1QB 4LK1C 4IM2A 4MJSA 4C3HB 3GB1A 3SVMA 2TSSA 4NPSA 4GOPB 4LF7L 3EBEA 1V2YA 1ZPSA 1YI2A 3AV8A 1XLQA 3R8BA 2MPMA 1KDBA 1B8AA 4UHVA 2LS01 3E56A 4WIPA 3VR9B 1W3SA 3N6RA 3Q22A 1AP0A 3X0WA 2XWJB 3A1QA 4ILWA 3TZDA 3ZO5B 3H91A 1WGYA 2WXLA 1VQPA 1O7LA 1LTLA 1LTGD 5DEHA 4WJOA 3UDGA 2LEKA 2H4OA 4GOPA 4KSLC 2WB1B 4A6QA 4LF5L 3I9V1 2CHXA 2CHBD 2F52A 4BKSA 2IT1A 4JV5L 4JC0A 1PFMA 1GAQB 4OWXB 3SD5A 2WXKA 2RDBC 4BBRG 1RTOA 2KTRB 3AFQA 4OIJA 4ZRZA 4K8JA 3DHGC 1TXYA 3VRBB 3UE0A 4HKZE 3CU7A 4I7AA 2J0JA 3SU8X 1GUNA 3K81C 4P72A 3I57A 3VVWB 4YSXB 4EZJA 2M17A 3GZNI 5IODA 1SNCA 4A3KB 4OX9L 1L0VB 2FNJB 1YJNA 2WYQA 4C1NI 2N1WA 5EE9A 1PYSB 5C3EG 3K9PB 3W1GA 3DBHB 2KTRA 1Y1VB 5HI1A 1AZPA 3RZWC 3PO2H 1ZKHA 1YOVB 3K6OA 3S17B 1YIWA 1PQSA 2FCQA 3FEWX 3GOEA 2RBMA 2DENB 5K36H 4DQOC 1PA6A 5BN4A 2K5QA 4A3BB 2A1AA 4BZAA 3KQ4A 2BYEA 5KRUA 3QO2A 1S5FD 2J53A 1YBYA 3NVZA 1BKBA 1L0XB 3RD4A 2QA4A 4E3CA 1V5OA 4FYDA 1TZ1A 3N30A 1VQCA 2EJMA 1MJDA 2K39A 3UE1A 1BNZA 3CCQA 1DONA 2JXXA 4GU2A 4R4TA 3S14B 3HKSA 3C1FA 5A35A 1WGDA 1V9PA 1DGJA 2K5DA 5CV9A 4GKKQ 2KJRA 4BBNC 3LGJA 1VZ8A 1OGWA 4LNQA 4XGAB 4RF0A 4WORA 1XLPA 2O5JC 3PV1A 2JE6I 4NXML 1E22A 3RNFC 5G2NA 1RL2A 1WTPA 2EKIA 5ELFA 2G45B 5C4ZA 3S1MB 4IPDA 3S2HH 4S3SA 3PV0A 1P7EA 2L52A 3AE9B 4B3ML 5KHOA 2WKDA 4KZ0A 1EEFD 2QSDA 3GTJB 4HTHA 2QMTA 5ELCA 2LVPA 1LO5D 5CGKA 2LD9A 1KDAA 4E74A 1PRTD 1TY2A 4KKIA 2JXMB 2OHFA 4HPPA 2J42A 5JPNC 4TKNA 1EQTA 2JSVX 2WXFA 4IURA 1WXVA 5C3EH 3DM3A 2IGHA 4FJVB 4JI7L 2RHSB 4L8JA 2BWFA 2W9NA 2KTFA 4CDFC 4K3BA 1FFUA 5LXIB 4KKUA 5EDSA 4IOAA 2R7FA 1HTOA 3SK6A 5BR8Q 4AYBB 1TTNA 4USAA 3C2PA 4JI5Q 2KOLA 3OAWA 1LLRD 1BBUA 2HIXA 4HR7B 1VRAB 2BF8B 3AB9A 5CV5A 3UDXA 1VQNA 1MSGA 1WF9A 1V6EA 2G1EA 1NAPA 2TMPA 1MD2D 3PREA 4DK5A 1STNA 1UUPA 1XT9B 2KN4A 2RMMA 3RFZB 3AEFB 3I4OA 1Y8NB 4LF9Q 1RTNA 2HCCA 1QZGA 3C46A 5E6PA 1KC8C 2NCNA
chains in the Genus database with same CATH topology
1EYCA 3AU7A 1C76A 1JOQA 2Y5PA 5HFYA 4XQNA 4FF3A 4K8IA 3SK4A 1ZYRC 2C5CA 3Q8CA 1KF6B 2WU2B 1E2WA 3MA2B 2WNMA 3H8HA 2KMMA 1YMHE 1WD1A 1EY6A 3C8YA 1T5XD 4P6VF 4MACA 2C9OA 5C3XA 4Q5VA 4A55A 4LJZC 2DLBA 1TKWB 1XTCD 5KGUA 1TWCB 3FAHA 2IX3A 2CJNA 3DEPA 1C79A 1JWBD 4K14A 4R3DA 3MFYA 1A2UA 2LY7A 1KAAA 2KQ4X 3EFXD 3HVZA 3SR1A 1S5DD 1HQRD 1JWAD 3PIO3 2VZKB 2QIEB 3B2GA 1J7AA 3IT6B 2PNRC 4DN4M 1ZE3D 1ENAA 3H0GB 3HOUB 1NENB 2N9LA 2EJGC 2F0GA 1R4QB 3OWFA 1JR0D 2VB3X 4TRDA 2O4XA 4G7HC 2KHSA 1Q90A 4HSPA 2GI9A 2A5HA 3OPOA 1A3UA 1U4LA 4ZHPA 1HTLD 2JU6X 2Z4HA 3VYTA 1UWMA 2GA4B 2N0SB 3RZDB 1FM0D 1SBBB 1V1PB 2GRIA 3NRZA 3NQIA 1ZXTA 1IHZA 1KTKA 2BS4B 4NJCA 2R3ZA 1AZQA 3WDNA 3CWIA 2AQ2B 1ESFA 1AFPA 3NBHA 5C4XB 4JWUC 2LFIA 1V1PA 5I6YA 2PIAA 4YXDB 2WS3B 4KGRA 4XDCA 2CQAA 2K32A 1TJEA 2PZTA 3AB5A 2D9UA 1QOFA 1Z47A 1QJOA 4GLSC 5KYIA 1F77A 2WP9B 1HA5A 1EFID 3RZOB 4C3IB 2B76B 1GB4A 3U9OA 2WXRA 1W6JA 4O42A 3UI3A 1N63A 3FILB 3T3OA 2L11A 2W82A 5HHDG 4Y7NB 1STEA 3R2TA 4O1NA 2HDMA 5IGCA 1STHA 1EY4A 1YJIA 4EQOA 1I4GA 1HRJA 4CJ0B 3OWEB 3DHQA 1NEKB 5FOBB 1FCCC 5DNFA 2E2IB 2H88B 1I4PA 4X3TA 3K5MA 2SNSA 3FILA 5A2QE 1KDCA 2L9HA 5KNBA 1LV9A 4HCEA 1IBXB 2M00A 2L1AA 3I8ZA 5EPKA 4YTNB 3V2TA 1HUNA 2M2LA 3GQBA 2VUMB 1BMLC 1OO9B 2JZPA 1GUGA 4ZHOA 4OO1I 1KLUD 2EY6A 3NVWA 1CT1D 1Y56A 1K51A 2CVRA 1IBXA 5T8IA 4OIKA 5BMHA 1WTXA 2K05A 4C80A 2R93B 2F0SA 3AE7B 4TQ0A 2L4NA 2Z8LA 3I72A 1E0BA 3B2FA 1QF6A 4RH6A 1I4QA 4A93B 2KA7A 5M5WB 1I6HB 3MVVA 4G57A 1SE2A 2AUJD 4IZ8A 2L0CA 3ZJTA 2FINB 2EYMA 1TR5A 2QEJC 3HEJA 1KH0A 3J7AF 3S2DB 1DYQA 2F0EA 5M5YB 4K6DA 4ABNA 2A6EC 2NTSA 2PKOA 2E2JB 4K5XA 3D3RA 4IFDI 2Y3AA 2B2YC 3HRZC 4FF4A 3IFTA 1B50A 1HFNA 2PMZB 2SDFA 4MIUA 2W55A 4DXGA 2XN9C 1B4OA 3HRDD 3I4LA 2L5TA 1IKMA 5G3LF 5K5PA 4ZKBB 3P4RB 2RDGA 2R7ZB 2BB5A 3AE4B 3SHLA 2J4XA 2B2VA 3SK5A 4DXFA 4K6LA 2JA7B 3ITPA 1QNUA 5D3DA 1WYGA 3LWEA 1CQFA 1SNQA 4KTAA 4L1BA 1D2BA 1BBXC 4EQPA 4FO2A 5C2TB 1SNMA 3A56A 1ROEA 1SDFA 5G5HA 1RDPD 3X3MA 3GTGB 3GV3A 4D2KA 3R3OA 4CJ2C 1JRPA 2JQRB 2IPKD 1A2TA 5KEEA 2K3UA 3PO2B 1JORA 1UWXA 2MHVA 3PMFA 4ZUJA 4C3IG 2L32A 3QIAA 1Q3LA 1YNTE 2NMQA 4FNFA 1TWAB 2PQEA 3H6MA 4AQ7A 2A69C 1N62A 3FVQA 3DMUA 2Q8IB 1WTRA 2EELA 2IGDA 2BS3B 3BWUD 2H89B 1HZ5A 1QQRA 1SJED 5KYLA 1EU4A 4ODGA 1F2RC 4RKBA 3OMCA 4V190 1EIHA 4HEDA 5MPOA 2EYFA 1X3QA 2ICEC 1VF7A 1YNJC 2PZUA 4JX1C 2AUKA 5M5XB 1DOKA 1TYGB 1O78A 1STGA 5IT9E 1OFFA 2LMCB 1C4PA 1UGJA 4BY1B 2WU5B 3M3YB 3J81E 2Q5WD 3DXJC 2W54A 1ACCA 1PGAA 3BYTB 3W3AA 2DWQA 4MM3B 2XIWA 1XCQL 1DOIA 5T1IA 3FDTA 3A8IE 1TVXA 3HS0C 3KWLA 1TIID 1MI0A 1LTRD 4WQMA 3J7AV 2LMCA 1RD9D 2E2HB 5JEAG 3T56B 1A3TA 1TKGA 1G291 3T51B 4NP5A 3NPPA 1YNND 2OF1A 4K5VA 1GOZA 2AWNA 1RWSA 2SAKA 4HRSA 1FNWA 1GUOA 2HDEA 4QUCA 1OXVA 2SNMA 4G7ZC 1ET6A 2F0FA 4JE3B 5DM63 3D4DA 3PZ8A 1PRTB 5CORA 2VNUD 2WXGA 4QMGA 5AUIA 4KKSA 2A73B 2WDQB 3PUYA 3N52A 3NVVA 1JQ4A 3WOEA 3H94A 1QKZA 4K5WA 4KI0A 3L4PA 2WP8J 3E9SA 2ONQA 5BN3A 1SXTA 1PRTC 5J39A 2EYHA 1FMAD 1T5EA 2EYJA 1FCLA 2NYZD 1HUMA 4B0EA 4Z9CB 1TZOA 4H0LC 2HQEA 1JOKA 2EYPA 3HP3A 3U52E 3P7JA 3D6WA 4OVZA 1OXTA 1SMYC 5C5LA 4DA2A 4NKLA 2WDRB 4BS9A 1WXQA 2EY1A 4NMZA 1XO3A 5JOBA 1HHVA 3BZDB 4FP5D 1TU2B 3FC4A 2LKVA 3E0JA 3BDOA 3T4AC 3GP7A 3W5UB 1D4BA 2KEDA 1ESRA 2FFKB 2YEPB 3NK9A 2JA5B 5GXGB 1TQOA 2DNEA 1G2TA 4B9XA 1Z6HA 3TEWA 4XWWA 1V8QA 1JQYD 4XT3B 2K0PA 2K28A 5JJZA 1N60A 1G91A 2ID0A 5CBEE 1U4RA 4P16A 2WQYB 4PT5A 4FXGC 2WXHA 4A3MB 4ZKCB 3IKJA 2XSCA 3BYYB 1QOGA 2MH7A 1HCZA 1CZWA 3D6CA 3HOXB 3NVYA 1IYVA 1PDXA 3IL8A 4XDXA 1X3PA 4KD3A 1VDZA 2ZXPA 3DWGC 3W1SA 3P20A 2PVOD 3W2DA 2PLPA 2K7VA 1GPXA 1GXDC 3VYRA 1PRTF 1GUSA 4KKTA 3AE6B 1RFKA 1GB1A 1F9RA 3MXUA 3PZ7A 3FKIB 3TEYA 2ON8A 2K5WA 3AN1A 1FNVA 3DEOA 1LABA 3URYA 2EZVA 5T1GA 2PW9A 2F0IA 2I07B 3SFEB 4WJWA 2H1EA 1CFMA 3M85A 1FRDA 2DNCA 5EQ0A 4ME5A 1JALA 2E76C 2JX5A 4RNAA 4HKQA 3HGBA 2KDMA 4H7BA 3AM9A 1XCTL 1LT5D 3T16A 5C0XI 2LGIA 2WDVB 3HUIA 3KBXA 4IN3A 1CZGA 2K33A 2L83A 2N88A 3KLRA 1WTOA 1IGDA 1F2YA 2WLBA 3VR8B 4L6TB 1CA5A 1Q1EA 2IJ0A 4L23A 5EGTA 3P75A 1BQQT 2CJOA 3A8KE 3S15B 4WFN3 2OXPA 1VDVA 3OMGA 2BE5D 5D7GA 2NN6I 1A6XA 4OO1G 4IALA 1HFGA 4IUNA 3R93A 1AEXA 4DU9A 2Q8RE 5ISRA 1OQQA 3G6JB 2BDOA 4RHSA 3LYYA 3CKIB 1SE3A 2Z1CA 4CKBA 1VCIA 1J7BA 1KFYB 2ZT9C 3BVMA 3G7LA 1CM9A 2B8GA 2F3VA 2FHTA 1K8OA 4Q0FA 2K9XA 4ARIA 3GTQB 4XQQA 3FRPB 2WXPA 1BCPB 1ZOYB 2I38A 4BA2I 4RCOA 1NUCA 4DAPA 2RDHA 1O7ZA 3ERQA 2DN8A 2F0QA 5E4WC 4X3KA 4C3HG 2WXIA 1OXXK 3PO0A 1MVKA 5E1FA 3OOCA 3OSOA 3LNNA 4ARCA 4LLGM 4KX6B 5EE3A 1ICWA 2WXQA 5E4XA 1ZUD2 5IT9L 1WGKA 5FLXE 3KBGA 3LXFA 3BS1A 3HVDA 2VXWA 3I70A 4F8MA 5EKIA 2RQXA 4OO1H 3Q69A 1QOHA 1BUIC 1DXMA 3HZXA 2NB0A 1TS3A 1RHPA 1D5XC 1D5ZC 1SNDA 1HXYD 1FNUA 1EY5A 4XQJA 1AYFA 2BT6A 1C4CA 2LHDA 3TEXA 3NWTA 3K5NA 2EYOA 4X3SA 5IIFA 2JXTA 3RMHA 1Y69U 1XLNA 3NZ3A 3D4WA 3SK8A 2A68C 3A7AB 3A8JE 2EYLA 3ND8A 5EE1A 3AE3B 3CRKC 3I4NB 4MHEA 3AMUA 4UDUC 4N9TA 4XWTA 4L2YA 4P2CB 2JSOA 5CV7A 2W3RA 3DWQA 1B53A 5CV4A 3KK7A 3NUHB 4H44C 4IUVA 2E6XA 5D14A 3HOVB 1JWUD 4CQNA 3S1NB 2IX0A 4IFDH 1PTOD 2B8FA 3IFDA 1K83B 4IFDJ 1E0ZA 2K04A 2BS2B 4KY5A 4F87A 2KECA 2JYOA 1VR9A 3IAS1 1S4ZA 5LHY1 2CW0C 1B1ZA 1S5BD 4CKEA 2F0UA 2KAJA 2O2LD 2NVXB 2Z4IA 1PGBA 5EPJA 4B9WA 2F3WA 1SE4A 5EJWA 1EM7A 3MZ5A 4KGTA 2AQ3B 2B2UA 4L63B 1P7FA 1KABA 2D2CC 2B2UC 2XRSD 2BA1A 1RJTA 3IAM1 1C4QA 1AWDA 4DAYA 2RSOA 3QOLA 4XT1B 5IGDA 1PTOH 3WOFA 2JEAI 1I4HA 3MP9A 1F0ZA 5ELDA 4YTPB 1N5WA 4PNYA 4RF1A 2NVQB 2JYEA 1FR3A 1O7YA 3RLFA 5CMDA 2MGSA 2CU3A 2EDGA 4NZLB 1FD6A 1J8IA 2V4IB 3NE5B 5J1ZA 2BYTA 4RGMA 1ZYRD 3A7LA 1Z7TA 2R6GA 1XF5L 4J3OD 5CV6A 3DWPA 5DM73 3J7YW 1AN8A 1XX8A 1BCPD 5EKKA 1DOYA 1DCZA 1I6VC 3TDQA 2EVBA 1SYBA 1CI3M 4C2MB 2IL8A 4A3EB 4HAEA 4K2LA 4DK1A 3AE5B 2BW2A 1H9MA 5CBAE 1QT9A 3I90A 4MN3A 4KKJA 1D6EC 1I4XA 1BR9A 1V1OA 5LL6S 4WH4A 1TT2A 4HMJA 1ZKOA 2F0HA 3E5SA 1EU3A 4DAVA 3W9CB 2J7ZA 5HGTA 3FMCA 4REZA 3V96A 2K01A 4YSYB 4QF4A 1TY0A 3AE1B 4IQZA 1HQMC 3NQTA 1U4PA 5J22A 1SFOB 3HOZB 1D5MC 5JVG3 1MSHA 2IW3A 3EGRA 1L4DB 4GZYC 4A8XC 2A6HD 4A3GB 1GUTA 4RWSC 1L6UA 1BDOA 4LAAA 2QCPX 3I4MB 2NZ1D 1LTSD 3TN2A 1FRRA 1NVID 2D5DA 3QG1A 2IGGA 4KD4A 2B2TA 2NVTB 1IW7D 4BY7B 1SB3C 2B2VC 4RAUC 3GS2A 1EY9A 3KUPA 1A70A 4JWSC 3TP7A 3HOYB 1QNKA 2YYZA 2ENBA 3AEBB 1ZXIA 3Q24A 4HCSA 5FO8B 5I4DA 2MJDA 4PMWA 2RPVA 1S5ED 3MFGA 4KY6A 1STAA 1C9FA 3Q6SA 5BN5A 1UNSA 5F2DA 1PZID 4IUPA 2KEEA 1EY7A 2X69A 1XEEA 1SNOA 2PW5A 1SAPA 2HCIA 1EY0A 1C48A 5EBDA 4CGYB 1EQVA 5H92C 3BVZA 4H2AA 5IGBA 2KUMA 2JEBI 4DK0A 3P4PB 5I2XA 2PCFB 4B08A 1D1KA 4ULLA 1SYDA 4RA8A 3LX0A 4K2KA 1ZDVA 2F0TA 3L7ZC 1C77A 3S9WA 2F0VA 2BDNA 3MHBA 3ONAB 3AE8B 1LT6D 2PZWA 5C3WA 1A3VA 2FMCA 5ELEA 3GTMB 2DY8A 2JWUA 4C3JB 1UEAB 3VQIA 4HSVA 3I73A 5FLXL 1FFVA 3U7ZA 2INNE 1JMLA 5COYA 1VZ6A 2ACZB 5D3IB 3K5LA 2E3TA 4BBRB 2KWDA 1VJKA 4DNTB 1JW9D 1M8AA 2N55A 4GDLB 1XLOA 2AWOA 2IX1A 5G5GA 4RCNA 4RFBA 4JK1C 1KNEA 1B2TA 1G6ZA 2BBCA 1EZ6A 4DGZA 3PUXA 1PMRA 5IGEA 1H9KA 2FBWB 3SDZA 5FK9C 4TKOB 1S5CD 3UI2A 1ML0D 3GV6A 3Q0AA 1WTQA 1B9NA 1ILQA 2KVMA 1SJHD 1FEHA 1F9PA 3FPUB 1BO0A 4KJOA 2D62A 3OHXC 1M4VA 4BBSB 2PYKA 2F0DA 3ETRA 4WURA 1E6EB 3MHZA 3KLSA 2A6ED 3O13A 5KIXA 3EUB2 3ZJUA 3X3NA 2QILA 1EYAA 1N5XA 3KWVA 4KN4C 2N7JA 1XYIA 1LTTD 2F03A 2ZXRA 3JAME 1PZJD 3PUZA 4OZAA 4HN7A 2WXOA 3BK2A 4CKCA 1EWHA 1HZ6A 3EA6A 2N9KA 2F0PA 1PXUA 3SR6A 1DM0B 1RF2D 1Q1BA 3C1EA 3K57A 4LTUA 1JE4A 1B9MA 2WKCA 4KGSA 2EXZA 5C0XH 2A74C 2DBYA 5C0XJ 2WAQB 2OT2A 3PO3B 3VYUA 5E3FA 2W3SA 1E10A 4G4KA 1PFDA 4ZRQA 5FR3A 2Q8TA 3BDCA 2NTTA 3W5VB 4A90A 1PYWD 4YIJA 1G2SA 3I3CA 5BMIA 5A2QL 1L5PA 1GHJA 4C56C 3VR4A 1YN4A 2L12A 2QJLA 4BWGB 1WTWA 1HA6A 1EYDA 1C4AA 2WACA 3SE0A 1LACA 2WXMA 2NN6H 4OL7A 2Y5CA 1NCVA 1RM6C 2BB6A 3ZQ4A 4YT0B 1CQVA 1G8ZD 3ND9A 3D4RA 3P1HA 1FXIA 4EGVA 4UAIA 2G9HD 4NW2A 5KNCA 2QDBA 5JVH3 3QWNA 1V97A 3U2SC 5H8YE 2EE1A 3VR2A 4R8NA 3VR5A 2WXJA 5C4JB 5JXVA 1JC7A 5I2YA 2LJIA 1V8CA 4U673 3VA5A 3NP8A 2YU9B 4C3JG 3MXNA 1MHHE 5C3JB 1PDQA 1YNJD 2DYMA 1EZ8A 2MJEA 2RKSA 3M7GA 2K03A 3NUCA 1CZPA 3LWUA 1DOMA 2E2DC 4R9WA 4ZRPA 5FO7B 3GD7A 2QKIC 5M9OA 4NAWB 1LT3D 1TKYA 4A9AA 2X6GA 4YWGG 2F0KA 5E6JA 1PTOB 1OXSC 1ZEQX 2RA4A 3P4QB 3TP6A 2BA0A 5NUCA 1K53A 1TS4A 5JAVA 4TSSA 1I3QB 3P1MA 3BG3A 1U9RA 3NTKA 1VMCA 2M9VA 2FE8A 4ITKA 4I65A 2LHEA 1L0YB 1WCMB 1PTOC 3TP8A 2WXNA 5LNK1 1MHXA 1FO4A 1QILA 1FD7D 2B2WA 4YSZB 2KJXA 3K59A 5I6WA 1LTAD 2B2WC 1WD0A 3ABVB 1WWTA 5EBCA 1D1IA 3S16B 2BOSA 3OW7A 4IOIE 4ZYSA 2YEPF 3MXGA 2B39A 3AMZA 4IUQA 5CC4A 3DUZA 4ZQ3A 1DOXA 4HEA1 4CHTB 5FKAC 3GTPB 1OXUA 3S1RB 3H09A 1ZDXA 2M56B 4J6HA 3P42A 3SEBA 5M3FB 3HOWB 1WSPA 1QB5D 4V0BA 1EY8A 2LFNA 1Y1WB 2R92B 1RYJA 4FXKC 4ZUIA 5AUKA 3R2IA 4KJNA 3I91A 5AFWA 1F9QA 1SYEA 3SFDB 3IT4B 2V4DA 2MJ3A 2RVLA 1SMYD 4B0MA 1L6VA 3ZJVA 4J8QA 1SSNA 1EIGA 2KQ3A 1SNPA 1IYUA 1FGBD 1Y8PB 1W6KA 3L9AX 2NWGA 1GHKA 2J52A 4XYOA 4N58A 4N6EB 3EQLC 2EY2A 4TQUS 3MXPA 1YJJA 4BA1I 4HJGE 4CBVA 3P4SB 3PUWA 3M4OB 1CK1A 1DJRD 1ET9A 3D8GA 1ONLA 2F0LA 1F2LA 4E6IA 1FXAA 3B9JA 3N9YC 4IKGA 4XDDA 4A3DB 1NSNS 1BCPC 1L4ZB 4IUUA 1EL0A 4IUTA 1GJXA 2E74C 2MJ8A 1KNAA 5HURA 4IFDG 3Q8AA 2M19A 2E75C 3J81L 4EQNA 1IGCA 1JWMD 1PTOF 4TQ1A 1AW7A 1TWFB 1NYQA 3AECB 3E6ZX 1K8MA 4DNRB 3LB8C 1VF5C 1KRHA 3EROA 2INPE 2PW7A 2Y0SB 4HMIA 1K50A 1CHQD 2V3NA 3H3VC 4U68A 5C6AA 1F2RI 3ZGZA 1LTBD 1FIQA 4FVMA 2PO4A 3DWAA 3Q23A 4A3FB 2HUGA 1CJEA 2MUYA 4ZAIA 1N61A 1YN5A 3MEHA 1DZ1A 4GDKB 1KLGD 3D31A 2WIIB 4J1MA 2I2YA 1SEBD 1MBYA 2PPBC 5BYQA 1B3AA 4M0WA 2G9DA 1BOSA 5IGGA 2A6HC 3KF8A 4JPSA 3HKZB 5CR3A 4OHJA 1QWYA 3KLSX 4XTCS 3K7AB 3SXHA 4DFAA 2JP1A 1I7HA 2EOTA 2F0NA 4ZOHC 1CTMA 1Q8IA 2KACA 1IW7C 2F0MA 1I4RA 5CV8A 1B9RA 3JAML 1VLBA 2F0WA 4NAMA 1LTID 4PMCA 2ICIA 4F88A 1YN3A 1PZKD 3J80E 1EWYC 4YTMB 4RGNA 1HPCA 2VB2X 4CJ1B 1A15A 2NUCA 1JICA 3K58A 1PUTA 3NS1A 3F2UA 1BCPF 5DAUA 2DYOA 1WRIA 3TP5A 4OW0A 4FXDA 2PVGC 3K5OA 4KV6A 4RGOS 3RUZA 3BDLA 3Q8BA 4MT5A 4X3UA 3CQZB 2LUMA 5C44B 4NDXA 2L55A 5CYUA 2XWBB 1I50B 2DY7A 1MPEA 3ZYYX 3T13A 1F2MA 2K6AA 4HROA 1H9RA 2R61A 4ZK9B 4LMQD 1PFBA 5M3MB 2B63B 3VR6A 3AE2B 1YQ3B 2J0TD 4QB4A 3AEGB 1NYRA 3EVQA 1MGSA 4DF7A 4N9PA 3VYSA 2FJ2A 5EE0A 4PV1C 1H9SB 2FMMA 2QF7A 1XWEA 3TSSA 1SYGA 3BK1A 5BYRA 2ZW1A 4ID6A 1JOOA 1NR4A 1TWGB 5IOCA 3L3OC 1H9SA 1VMPA 3VA7A 4OGQC 1TS5A 1DOLA 1TS2A 5KNDA 3A54A 2ZW0A 1QG7A 4M8AA 3M4YA 1YNNC 1J7CA 2K5PA 1V43A 1QOAA 1NI3A 3GTKB 1Y8OB 3NTIA 5C5MA 3U4EG 5EKLA 5I9PA 3IAYA 2MP1A 3S1QB 1JROA 2AX5A 2OEDA 1FYCA 5ELBA 2KCNA 3QOJA 3CHBD 4RGTA 1B44D 4A3JB 2D5GA 2FUG1 1VZ7A 4R8IA 2B2YA 3GTOB 2VZKD 2GB1A 3OIQA 3TZUA 2NVYB 3TEZA 2A68D 4C7YA 2IDYA 2SEBD 1MI2A 2B2TC 5EPLA 3TUOA 2XNAC 4M1UB 1PLFA 1STYA 1E2VA 3AH7A 2IWHA 1R4PB 1ZXHA 1PFNA 1EEID 1BUVT 2RDFA 1EWCA 5BYSA 1STBA 2X38A 4AS1A 2EY5A 4Q2JA 2JA8B 3GO5A 1ENCA 4H13C 2EJFC 2OEOA 3PUVA 3TMEA 3A55A 1OQRA 1RCVD 5LL6X 3VRAB 4QCLA 3QB3A 3K0YA 4QIWB 2CW0D 3T53B 5C4HA 2HTME 2KCCA 1WVLA 1PGXA 1GUWA 4KMUC 1JB3A 3WCQA 2MEKA 4US9A 3T3NA 4EVOA 3EJIA 1QE6A 4N59A 5G3LD 3CIRB 1SYCA 2XRQD 1U4MA 4C7ZA 1J9OA 4QUFA 1Q12A 4XIGS 1H9JA 4OZCA 2V3PA 4WAFA 4WRDA 2WINB 3NBIA 1DD2A 3NSWA 5JPMC 2WV6D 1ENFA 2AQ1B 3MAQA 3M7NA 4KK7A 2X6LA 3S2HB 3AEDB 4KHZA 2PTLA 4PMBA 1QCBD 4OZBA 1UAPA 1LT4D 1SYFA 1E9MA 3IXSA 2HDLA 2ZXOA 4FF2A 5TSSA 5C3EB 5C0XG 1SIJA 4XYQA 5D65A 3U9SA 4EE2A 3NWSA 1JWSD 1E2ZA 1ILPA 4G7OC 2O5IC 1BXTA 1F2ZA 2F0OA 1T3QA 1IL8A 1ZP0B 1II3A 1YQ4B 1IKLA 2XVSA 2M0AA 1HEZE 4KHVA 2I46A 2NBFA 3MC0B 5HG2A 1SF0A 4C1NK 2NN6G 1XXGA 4TMAB 4A3IB 3GTLB 3DWMA 2F0JA 2PMVA 1TKEA 2JYTA 3P63A 2F1MA 5I9OA 2EPBA 3OIPA 3C3LA 2K22A 1JCKB 2BCOA 1R9TB 1R7SA 3FPPA 1CHPD 3J80L 1NR2A 3Q8EA 3QJYA 1SSOA 4KN7C 3NHHA 4KY7A 2K1BA 4US8A 1E7PB 4XE0A 3DM1A 1QOBA 2BE5C 1WTVA 1K52A 2RSNA 3HG9A 4FF1A 5FO9B 3J9CA 1T6BX 4XXEA 3Q8FA 4FXCA 3PIP3 5JEAH 1CA6A 4I7ZC 5IGFA 1BF4A 4WWMA 5JEAJ 1HTPA 3AEAB 1C8CA 4PQXA 3V3XA 3MJ5A 1F9SA 2V0GA 4RKLA 3RPFC 3NTHA 4F7XA 2F4IA 3BIID 3NXWA 3CRLC 2SOBA 3MWYW 4MH8A 2JA6B 1IUEA 1C78A 4IDIA 2BTEA 3TBIB 3AEEB 4JBWA 1TWHB 2A69D 3VR3A 4ZLTF 1O80A 3BVGA 1RODA 3MTSA 1Q10A 5BMGA 1EOTA 3V05A 4LK0M 5K36G 1X32A 2L1BA 1RKNA 4RHRA 4LK1C 4C3HB 3GB1A 3SVMA 2TSSA 1ZPSA 3AV8A 1XLQA 3R8BA 2MPMA 1KDBA 3E56A 2LS01 4WIPA 3VR9B 3N6RA 3Q22A 1AP0A 2XWJB 4ILWA 3TZDA 3H91A 2WXLA 1O7LA 1LTGD 5DEHA 4A6QA 2LEKA 2H4OA 2WB1B 3I9V1 2CHBD 2IT1A 1PFMA 1GAQB 2WXKA 1RTOA 4OIJA 4ZRZA 4K8JA 3VRBB 4HKZE 3CU7A 1GUNA 3I57A 4YSXB 5IODA 1SNCA 4A3KB 1L0VB 4C1NI 5EE9A 1Y1VB 5HI1A 1AZPA 3K6OA 3S17B 3FEWX 2RBMA 5K36H 4DQOC 5BN4A 2K5QA 4A3BB 3KQ4A 5KRUA 3QO2A 1S5FD 2J53A 3NVZA 1L0XB 3RD4A 4FYDA 2EJMA 1BNZA 1DONA 3S14B 3C1FA 5A35A 1DGJA 2K5DA