4RCOA

1.9 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
192
Chain Sequence
b'NPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 1.9 Angstrom Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus, in Complex with Sialyl-LewisX.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 51
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rcoA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rcoA01
4RGMA 4OHJA 1SBBB 1EWCA 1GOZA 2AQ2B 1ET6A 1HTLD 1V1OA 1HXYD 2WV6D 1LT3D 1S5CD 1D5XC 1PRTF 1PZKD 1LT6D 1QILA 1D5ZC 2RDHA 4RFBA 2AQ1B 1ENFA 1LTTD 1CHQD 3W2DA 5ELCA 2XN9C 4C56C 3EFXD 1YN5A 1FD7D 4DXGA 1T5XD 1STEA 1KLUD 1TS3A 1KLGD 1JQYD 1LTGD 3DWAA 1JR0D 1V1PA 1MD2D 1LT5D 1SEBD 3OWEB 1JCKB 1SE3A 2ICIA 5I4DA 1HQRD 1SXTA 1S5DD 1D5MC 1CHPD 1I4QA 5D3DA 3BYYB 1HA5A 3R2IA 4Z9CB 2TSSA 1I4HA 2IJ0A 3GP7A 1BCPB 1S5ED 1XTCD 1I4XA 1LTSD 1SE4A 1EFID 1BCPC 1PTOB 3BYTB 3R2TA 1DYQA 1RD9D 4RGTA 4BWGB 1LTBD 1PZID 3MFGA 5ELBA 5FKAC 1LTID 1SJHD 1PTOC 2NTTA 1SE2A 1RF2D 1SJED 1PZJD 1BCPD 4TSSA 1RDPD 1PYWD 1TS2A 4L6TB 1D6EC 3TSSA 1DJRD 2J4XA 1FNWA 1PTOD 1UUPA 1UNSA 3O13A 1FNVA 1LLRD 1TS5A 2G9HD 1PTOH 1JWMD 4RH6A 3EA6A 4RHRA 1LO5D 2NTSA 1F77A 1EEFD 1M4VA 1TS4A 1TY2A 3BVGA 1V1PB 5FK9C 1CK1A 1I4PA 1L0YB 1B44D 1RCVD 1KTKA 1PTOF 3CHBD 2QILA 1LT4D 3BVZA 3DWPA 1EU4A 1XXGA 2SEBD 5D3IB 1LTRD 1EU3A 4K6LA 4UDUC 3MC0B 3KLSX 3R8BA 1CQVA 1FGBD 1S5FD 4RGNA 5TSSA 5ELEA 1L0XB 1ESFA 2AQ3B 1LTAD 3V05A 1S5BD 2XNAC 1JWUD 4NZLB 1EEID 4RHSA 4O1NA 1BXTA 1YN3A 1PRTB 4RGOS 4ZYSA 1B1ZA 1FNUA 2O2LD 2RDGA 1I4RA 1PRTC 2R61A 5ELDA 1BCPF 1G8ZD 1TY0A 1AW7A 5ELFA 1CT1D 4DXFA 1YN4A 1I4GA 3BVMA 3BZDB 1PRTD 4RCOA 1AN8A 3DWQA 3URYA 2XRQD 1ET9A 2CHBD 4L63B 1JWSD 2Z8LA 2QEJC 2IPKD 2XRSD 3SEBA
chains in the Genus database with same CATH superfamily
2JEBI 2RCNA 1WR1A 2FUHB 2CH4A 4TKNA 1SMXA 1WX8A 1GUWA 3IHPC 4EQNA 1IL2A 4URKA 3DHIC 3I8ZA 5C5MA 1X3GA 4XGAB 3BK1A 5T8IA 4BY1G 1PH4A 2KQ4X 2NB0A 3MXPA 2LHEA 4ZRIA 2WGSA 3CAMA 2EY2A 5A2QL 1CHQD 2MH7A 3VA7A 1EIYB 5C4JB 1PFNA 4JVZA 3GTPB 1S40A 2DJFC 2D9UA 4DXGA 1F9QA 3IVFA 2XWBB 1U0LA 1RODA 1U4LA 4IC7B 3S9WA 4PQXA 2KCMA 2BH2A 2B63B 1I3QB 3I4MG 1X3FA 3CCSA 2DAFA 4II2B 4KIKA 1Y8PB 2ZW0A 4KY5A 3PSEB 4L5SA 5BMHA 1VQ6A 4PS8A 1MHWC 4XDDA 3HOUG 1L6UA 3B1LX 3G6JB 1WJNA 4OX9Q 3X3NA 4GSWA 2KYWA 4OZBA 4XZ4A 1Y69U 3TQYA 4N8X1 4DV4Q 1KAWA 1HJPA 3EROA 3Q3MC 2FJ2A 3DEOA 2RPVA 1V2YA 5IGEA 3N9YC 4PNYA 3GP7A 5KIXA 2K1FA 4GOPC 4R8NA 1XTCD 4B3SQ 3S14B 4L8JA 1IL8A 3QB3A 3LDZE 4PK1A 2UU9Q 4WFN3 1IBXA 1HR0Q 3VTUA 3OIQA 2A69C 1KDCA 3A9KA 3T1YQ 4G7OC 1CZGA 4KZ0A 1VQOA 2XK5B 4M0WB 5DPSA 1L0WA 3DVGY 3A54A 4OGQC 3KYCD 4W9EA 4CO7A 1BCPD 4ZHOA 4L6TB 1D6EC 3FKIG 1A63A 5IN7A 3ND8A 1U4PA 5KGUA 3Q3FA 3HRDD 2B2WC 5IP7G 3GTOH 1QZGA 2UUAL 1QOHA 1OTRB 2FE8A 3GZNI 3FRPB 1A70A 2EJFC 4GLVB 4J1MA 1V6EA 4I6PA 3NXWA 3UQBA 2M19A 5DPWA 1DOYA 3OAWA 4KHVA 1T0QC 1I4PA 4QL5A 1BBXC 3T1HL 1P16A 3ZRFA 4GGQA 3HRZC 3CF6E 3QCAA 3A8JE 4XX5A 1ZKOA 4DK0A 3I55A 4DV5Q 2GBRA 3VYRA 1QOAA 1BBUA 5H8YE 1L2NA 2MJ3A 4HTHA 1WTOA 2K8CA 2K5QA 5BO4B 3TREA 1C9OA 3TS0A 2PZUA 3TP8A 1YX6B 3Q3OC 1SE8A 3PRZA 1CTMA 2MQHA 1BNZA 1MSHA 3S14H 1U9RA 4DV0Q 2LXKA 1G6JA 1XLOA 2J0JA 1MGSA 1RRBA 4BY7B 3BDCA 1PRTC 4JOIA 4BBRH 3LXFA 2PCFB 3MTSA 2NBUA 1HNWQ 2REXA 4O42A 4F7XA 2XEWA 4A3GH 1JJCB 1X3QA 1KNAA 2B76B 1CT1D 4NXNL 3ML8A 3R3OA 1KQSA 2QEXA 2MO1A 1YQ3B 3HOWG 1UD7A 1K28A 2ID0A 4KKSA 5BN4A 1X6OA 4JI7Q 5E3FA 1YHQA 1PGBA 3B6YA 1J6QA 1KIXA 4JLCA 2R3ZA 2QEJC 5BMIA 2D5DA 2O5JC 1MHXA 4OX9L 2BDNA 2ZPNA 4LUVA 3U4EG 4BY1H 4DV4L 1QLBB 1JORA 3CQZB 1NYRA 3OW2A 1QWYA 4JV5Q 2NR2A 3J80c 1YI2A 2KA7A 3CSTA 4R1JA 3HOXG 4P1CC 3KUDB 3L13A 4B3SL 4IM2A 5J2RA 2K22A 3P63A 1KNEA 2UU9L 5C6AA 1HR0L 3DHQA 2F0DA 2JA5G 4Q0FA 2PKOA 3T1YL 2A6HD 4FF1A 1Q8IA 3I4MH 4YTMB 4X65Q 3M4YA 3ZYYX 1SIFA 1QF6A 1YJNA 1GB4A 4Y7NB 4KDLB 2D0PA 3C3LA 1M94A 3J81j 3DWAA 5C5LA 4LK1C 2LGIA 4JIOU 1MSGA 2TMPA 5BN5A 1LT5D 4A3IB 3HOUH 1DGJA 1D4BA 3AH7A 2DZKA 1LM8B 4TQ0A 2VRRB 2GRIA 2Z6BA 2H5XA 1Z6HA 4BA1I 1W3SA 5JJIA 2HE7A 5FJ8G 1TKEA 3PT2B 3L54A 1WGGA 3E9SA 3E5SA 3C8YA 1I4XA 3J80L 1D2BA 1IKMA 1J19A 3SVMA 3VA5A 3RYTA 1WZ3A 1EFID 3R2TA 2EYLA 3J81i 1VR9A 2DBYA 1K51A 1KC8C 1N34L 1GJXA 1OQQA 4AP4C 1PTOC 3H3VH 3W3AA 3LYYA 3MP9A 3FKIH 1PDQA 5E6NA 3HOWB 2VUMB 1OXTA 1EIHA 1DJRD 1E6EB 3CIRB 2C35B 3EFCA 5IP7H 3VDYA 2PE9A 3WIMA 3KQ4A 1HZCA 4DR5Q 3J7AV 3JAML 1FGUA 2BB5A 1XCTL 1PTOH 3NBHB 1H9SA 4GDKB 3SR1A 2V1CC 1N63A 3M95A 4MM3B 3DM3A 4DUZQ 2L76A 3AEDB 1K0SA 4LNQA 3KUPA 2DZIA 2KX3A 4AOFA 3I2ZA 4MHEA 4Y7NH 1HH2P 3HK0A 3FVQA 1UE5A 3ZTCA 3C1EA 3MXGA 1BUVT 2L11A 3HGBA 4DV6Q 2F0VA 1SYCA 4JI0Q 2EKEC 4HJ7A 1FYCA 5I6YA 3TN2A 4JI7L 1NNXA 2KO3A 3IT6B 2GB1A 3QX1A 2F0GA 3ZJVA 1MI0A 2LXAA 1VS0A 3CCLA 2ICEC 3TMEA 1IGCA 1SMYD 4AQ7A 1SN8A 4O1NA 1EF5A 2HTHA 3A33B 4JV5L 2MEKA 4RGOS 1C3TA 1NR2A 1FNUA 1X55A 5E1FA 3CD6A 2MW5A 1V97A 1VJKA 4N58A 4GN3B 3IT4B 2F0KA 3PUXA 4BBNF 3WDNA 5J3BA 5KNDA 3H0GB 5D65A 3K57A 1A0IA 3K5MA 3P4QB 1YNTE 3HOWH 2EELA 1GUOA 2UUBQ 3T4AC 3BZKA 4X65L 1GNUA 3NHHA 2I2YA 1VQLA 2JE6I 1KRSA 4RCOA 5IYDG 2HCIA 4POGA 3A9JB 3ML9A 2CHBD 4OVUA 1HA6A 1K9MC 2JX5A 1XPOA 4OZAA 1CMXB 2Y5PA 1B2TA 3J9CA 2LS01 1EYAA 4C3IG 4LWCA 3HOXH 1B70B 3KF8A 4L2YA 2JA8B 2RBMA 1N5XA 1QG7A 2O4XA 3GB1A 1C9FA 2FIDA 2JA5H 4RFBA 1S3SG 4PS3A 2F1MA 1TBEA 4A3KG 3WAMA 1B9RA 1A8VA 5ELCA 2KEEA 3RLNA 2PTLA 5BYSA 2FAZA 3ALBA 4PZ6A 1D7QA 3VYSA 1E24A 4HCSA 5LMUQ 3PPAA 1IUEA 1P9DU 3PMFA 1R9TB 5E6PA 1L4DB 1EQTA 3AI5A 4DAVA 2IDYA 5BR8Q 1SEBD 1HZ9A 1SNDA 3S1RB 3PHWB 4CKEA 4R9WA 5IO9A 3V96A 3L16A 5FJ8H 4DR5L 4AIMA 2MBHA 3STBC 1MFWA 3PGZA 4DPGA 2KOXA 3PIO3 1UBQA 5D3DA 1WTXA 1IHZA 4DUZL 3EFUA 1EIGA 1HA5A 2E3TA 3AXCA 5DNFA 1ASZA 2K03A 5LXIB 2BTEA 1SNPA 3E0JA 3KUZA 3TP7A 1HZ6A 1ZPSA 3KDFA 4NJ7A 1LV9A 2IX3A 4R4IA 3DPDA 4A3MB 3VFKA 4DV6L 4IM0A 4JI0L 2N7JA 5JVH3 2JWZA 3JW0X 1OGWA 1KFYB 3ND9A 1PH3A 3ZNZB 3LWUA 3BY4B 3P1MA 4RKBA 3IKJA 4KVGB 4MGZE 1A6XA 2WXJA 3TZUA 1PHJA 1J5EL 3GV6A 3I4OA 2JA8H 1VZ8A 2JWUA 2LEKA 3U7ZA 2ON8A 3I57A 1CQFA 2LY7A 3M85A 4W9FA 2C60A 4YY3Q 2L83A 2LGDA 5JH5C 3JC66 1N33Q 2MBQA 2O2VB 2X8XX 5C4XB 1LO5D 2BYVE 3D0FA 1E7VA 2KJ6A 4P16A 2ZNVB 4ACFA 3UE0A 3OYYA 3I3TB 2WXOA 1WVLA 4A3BG 3S16B 1GXDC 3I56A 2UUBL 4FDBA 3PUZA 4B6WA 2L8JA 1GD7A 2E6XA 2J0MA 2YVCA 3B2GA 4I7ZC 5D3IB 2CHWA 2LRWA 5J18A 5EQ0A 4FJVB 2ZVNA 5T1GA 2KHIA 4IUVA 3I4NG 1IKLA 1FRRA 1A2TA 1TWFB 3CC7A 4NZLB 2HIXA 2BKFA 5LMNQ 1WM3A 1B1ZA 5BYRA 1MJCA 2Q2IA 2ZT9C 4K2KA 5KNCA 4ME5A 1XNQQ 4RM9A 2MCNB 4OO1I 3SHQA 3ZIMA 1E2WA 2F0MA 2K8HA 3H9DA 3S1QH 2INNE 3ZGZA 2PI2E 5ELDA 2O6VA 4QJFA 4DNRB 4A3JG 4NJCA 4TQ1A 2IO3B 1VQJA 1PA6A 5IYDH 1KH0A 2KJXA 3FAHA 2K01A 4KHPQ 3AE8B 1PRTD 5LMUL 3FEWX 2KTRA 5IGFA 3AE9B 3E0EA 2W3RA 2XRSD 2LWPA 2BWFA 3VHTC 2CR5A 1A3TA 5C4HA 4HDQA 5C4XH 3P7JA 1NUCA 4XQQA 4LFBQ 1AYFA 3G6EA 1VQ7A 2PQEA 4G57A 2GN5A 2PZTA 4EZKA 3JSVA 4JYAQ 1WCMB 4YCVA 4BKSD 4ZK9B 5I9OA 4GZYC 2JQRB 2L0TA 4A3KH 2KN4A 1X65A 1D5ZC 3T9LA 2R7ZB 3ZO5B 1EUJA 3W2DA 3ZRCA 2NVYB 4FHJA 3P75A 1YJWA 4OWTB 4ZRQA 4FLHA 3TEYA 5H1SE 1QE6A 1VQNA 4HAEA 3F2DA 3A74A 1NYQA 3M4QA 1H4RA 4NDXA 2N4FA 2OHFA 3N1ZC 1JQYD 4C2MB 3SXHA 2CU3A 3NSWA 2C7MB 4K5WA 1EY9A 1HZBA 3WWVA 5C0XI 2LVPA 3IAS1 2K8BA 5LLIA 2V3SA 1JCKB 3HOVB 2FXQA 1IYJB 1C76A 2QF7A 5HURA 5JAVA 2C7HA 2UYZB 4YY3L 3S1MH 3OSOA 1N33L 2JF5A 1F9JA 4HDOA 1BCPB 2KCCA 3SK5A 1SSOA 2KCTA 1X32A 2PQAA 4EGVA 4OXPA 4JBKA 3PUVA 2FCMA 2JRIB 1F9RA 2FUG1 4QGUA 1D3ZA 2ZCBA 3VR4A 2E8GA 4C1NK 1Y1WG 3ZNHB 3GTKB 1XX8A 5KNBA 4G50A 4IFDI 5HHDG 4R8IA 2E2DC 2JA7G 4Y52H 4IOCA 1WIAA 1WSPA 2HJ1A 3ZNGC 1RDPD 4EOYA 2DHZA 1TKWB 1NCVA 2CH4W 3GTMB 1PTOD 1I5FA 4KK7A 3T16A 2N0SB 2WHIA 5IGDA 1AZPA 2QMTA 2BQQA 1CI3M 4DAPA 3B08A 4BZAA 1FNVA 1MIUA 4MJSB 3OTOQ 3TUOA 2E2JH 5LMNL 4RH6A 2EY5A 3IBEA 2AWNA 3CWIA 3ONSA 1XNQL 3AQQA 5C0XJ 2NPTA 4DA2A 3OMGA 4A3BH 4BBSG 4F8MA 1TY2A 1VQEA 3DQVA 4C2MH 2RQXA 4TVAB 2N8NA 3I73A 1V80A 1YBYA 4WH4A 4LUOA 2JU6X 1U4AA 4DR2Q 4KHPL 2O5IC 1UWMA 4GXBA 2Q8IB 2R93B 4GDLB 3ECIA 1QVGA 1F9SA 3I4NH 5CORA 1WTQA 4J3OD 5DM63 3I70A 1TQOA 2I46A 3GTQB 1LQBA 2NZ1D 3AEAB 3AM9A 2AQ3B 4TKOB 1ZE3D 1IYUA 1S5BD 4LFBL 4KSKC 2B8FA 3S24A 2ZJQA 2N3SA 4EZLA 1E7UA 2YTXA 2KN5A 4JYAL 2Z0DB 1K50A 2N9XA 2O2LD 4GMVA 1MPEA 3PO2G 4BKTA 1MVKA 4A3JH 4WWNA 1AE2A 1TJEA 3SFDB 1JQ4A 2R61A 1P1AA 3EVQA 4B3RQ 3RN9C 2WB1B 1YNNC 1OQYA 3IL8A 3K81C 5GADC 1WD0A 3QJZA 4NQKE 1SE9A 3VDZA 3RUZA 2LFIA 3FPPA 1DGSA 1WJ4A 2FNJB 1KXLA 2Z0SA 4DWFA 4KDIC 2Q8TA 4N6EB 3VR3A 1ET6A 1NMFA 1HTLD 2KCNA 1DCZA 2ENBA 2K3UA 3V60A 3JAMi 1KHIA 4JI1Q 4NXMQ 2CS4A 3D4DA 2EE1A 2F4VQ 1K8AC 3MJWA 1STYA 3AFPA 5CC4A 3C46A 2F0WA 4LMQD 1E10A 1A15A 1LTTD 4DV7Q 2KMCA 2G45B 4PG3A 2JRHA 4BBSB 3IFWB 2SDFA 5IGGA 1WY8A 1RJTA 4NKLA 3HVZA 1ZGUB 1NE3A 4LDTD 1KLUD 3BJUA 2KT7A 4CKBA 3ZDMC 3RPFC 2IHFA 4OO1G 1MD2D 4YHHQ 1V5OA 3PS6A 5I4DA 4ANVA 2L12A 1SXTA 1EY5A 4B9WA 1V9JA 2ZTEA 1JICA 3OTOL 1HRJA 1C4AA 1FXTB 1QZEA 2WQYB 2NYZD 4IO9A 5GAHC 4DR3Q 3R2IA 4P1BC 4RCNA 1TWAB 2PJHA 1YHAA 4TMAB 4GN5A 3UQAA 4UP8A 1LTSD 4KY7A 4XIGS 4N9F4 2WXFA 3KF6B 4RGTA 3VQIA 1L1OC 1TWGB 3N52A 2JA7H 2MQJA 4EEWA 1Q1BA 4DR2L 4A3FG 1JJGA 2M1MA 4H0LC 2A5UA 4NAWB 2GOWA 4KZCA 1TS2A 5E7NA 5M5XH 3N32A 3NVZA 5HGTA 4FP5D 4MT5A 1ICFB 5DM73 3O65B 2ZM6L 5TR5A 2RGFA 1KRTA 4HK2A 2RF4A 5IY0A 4X57B 3NTIA 2EXZA 5JEAG 1R4NI 2I38A 4BBSH 4KD3A 5EBCA 5EKKA 2WXNA 2NTSA 4A93G 4LNKA 1M4VA 1T0SC 3M4PA 1HR0W 4AYBE 4B3RL 1H9KA 1LTLA 2UXCQ 3ULLA 2WXMA 1TT5B 3V3XA 4C3JB 5D6JB 2J7ZA 3NEMA 3DDCB 2EY1A 2HDLA 2H1EA 3WOFA 1WTRA 1SNOA 3HKZB 2KVRA 2LD9A 3R66C 4BA2I 5LXHA 4ULLA 2K05A 1XO3A 4P74A 4YWMA 1PXUA 4HSVA 1TWAH 3VUXA 4ANUA 5BN3A 3DBLI 3VUYA 4NXML 4JI1L 3S1NB 4GKKQ 3PO2H 4DAYB 4K0KQ 5FOBB 3PIP3 3M3YB 2F4VL 1FXIA 1WJ6A 2L7RA 3M9BA 3CPWA 1UE1A 4IFDG 1L2FA 4A4IA 4CJ0B 1K52A 1VQBA 2Z4IA 1TU2B 3L0OA 1EQVA 4HJ5A 3W1SC 3GE8C 1EWYC 1RFKA 3TS2A 2R2QA 2Z4HA 1XT9B 3W9CB 4P7IA 3SK8A 1HZAA 2GBMA 1DOXA 4FXCA 3DWQA 3URYA 3C0RB 3H91A 5J1ZA 2DAJA 3PO3G 1WWTA 4L63B 4L5QA 3P42A 2XSCA 4YHHL 4OHJA 4N9PA 4USAA 3CKIB 3SGIA 3PGEA 2NN6I 1WE6A 3RMKC 2QHOA 4FJZA 3AEVA 1FRDA 2K5VA 2M00A 1JB3A 3NWTA 4KV2A 4IUTA 4DR3L 2I1KA 3PVLA 2W9NA 3AEFB 3U8ZA 3DBRI 1TVXA 2BWES 2MNAA 2LMCB 2N78A 5C3WA 5JZEB 1PGAA 2INCC 3NQIA 1J8IA 2BA0A 3RNBC 1VLBA 4WQOB 1TR5A 4W9CA 3VR2A 2R7FA 2F0LA 4H13C 2MJ8A 4CDCC 4OO1H 2L1AA 4ME3A 1R4MI 4JI8Q 4J8QA 1WMHB 2F0FA 3F2BA 3VTVA 4AYBG 1CZPA 1JRPA 2Z9HA 1HHVA 3PRPB 4DAMA 1MJEA 2KANA 3TEWA 2KECA 4K5XA 4KKTA 3U2SC 4JOIC 4GOPB 1QOBA 1MKHA 1NTGA 2JA9A 2L00B 2HJ8A 2LJ5A 5DEHA 3JVZX 4K3BA 2CQAA 4F88A 1A3VA 3AU5A 3GTOB 4XYQA 4BBNC 4A3FH 1PV4A 4U68A 2M0XA 4DQOC 1RD9D 4BWGB 3MHZA 5HKHA 1WRIA 1PZID 2HQLA 5ELBA 2AL6A 2DYOA 3U4ZA 1BDOA 1WM2A 2A5HA 4UHVA 2KX0A 1CKNA 1PYWD 3L08A 2KJRA 1WI0A 2J4XA 3I90A 3EECA 1E1OA 2CWPA 2OT2A 5D7GA 5JEAH 2AKWB 3RCZA 4GKKL 4GNXB 4K0KL 1TS5A 2Q5WD 4LF8Q 3N30A 3QHTA 1VF5C 5EE1A 4OVZA 4A93H 3OMCA 3HVDA 5C0XH 2BB6A 2K14A 1V1QA 5CGKA 3Q23A 3CRLC 2WXQA 1CZWA 3Q8BA 5KYIA 3VTWA 4KGSA 5EKLA 3Q8DA 4NMZA 2UU7A 4KN7C 2QKIC 3W1SA 4BBRB 1N8RC 4A3GB 3MC0B 3DEPA 1CQVA 1KAAA 2MFIA 4RGNA 1Y8OB 1O80A 5ELEA 3TMPB 3V05A 3PF5A 2IO0B 1QQRA 2UUCQ 4RHSA 4IFDH 4JPBW 5CV8A 1V86A 4ASWC 1JOQA 3DUZA 1IBLQ 1PRTB 1A2UA 4ZYSA 4QB4A 1VD2A 2AX5A 1N60A 3I7FA 1WE7A 4IPCA 2E2IH 2WX0A 2IGGA 1G8ZD 1B50A 4H2AA 4BY1B 3ENEA 3EJIA 1TY0A 4M1UB 1OFFA 1Y14B 5K36G 2C5LC 2GVBA 4HCEA 1PH6A 4LF5Q 1KRHA 3PO3H 1B3AA 4HJGE 4JI8L 5IYBG 1WI5A 2G9DA 4N8FA 4QUCA 2YTVA 4RNAA 1XEEA 1YNND 2DGYA 2IL8A 2BDOA 4MNOA 3HOZG 1NR4A 1EWIA 5CV5A 3K5NA 4KKUA 1YEZA 1VQPA 3I4MB 2N9PC 4HROA 2H88B 5IP4D 4AJYB 3KLRA 1SFOB 1TIFA 2K6DB 1VQAA 5IWAQ 3MEHA 4QCLA 3ZXRA 3P20A 3VR5A 4A75A 5CHFA 3KLWA 4JI5Q 4W9HA 3HOUB 3M4OH 3SDZA 3TBLD 4X3TA 1O7IA 5C3JB 2GVAA 4DDGD 2MGSA 2XWJB 1K73C 2GMIC 3K9PB 1BF4A 2R92G 1FD7D 3AEEB 2LUEA 3RZFA 3TCAA 4C4VB 4WURA 1ZOYB 1YX5B 4PZ8A 2VH1A 4C7YA 1KLGD 5FO7B 1HEZE 1HTPA 1NI2A 1SLJA 4TRDA 2MUYA 2YU9H 2K5NA 1ISNA 2WIIB 4IQZA 3HZXA 1HTQA 1OEYJ 1I35A 4IN3A 3KFUA 3H94A 2AEHA 5KHOA 1F2ZA 1C1YB 3VAWA 4LF8L 2HHHQ 3FKIB 1G291 1VQCA 4KJNA 5GROA 4LK0M 2KD0A 1I4HA 1VQGA 1VQ9A 1Q90A 1SE4A 4FULA 2DENB 3FHWA 1PTOB 2VL6A 3CPFA 4IM3A 5KRUA 4EUTA 2D11A 2NN6G 5FKAC 2CU1A 5AUIA 3H7SA 3SR6A 2KHSA 1SFOH 1EOTA 1ML0D 1RF2D 2XGTA 3G48A 5A35A 2LUMA 4CQNA 3QWNA 2PMVA 3PZDA 1IW7C 1SROA 3MA2B 4IDIA 5AEKB 2C9OA 3Q8EA 1QVFA 3ZDTA 2ZTCA 3K0YA 2LSSA 1UNSA 1UAPA 2I5HA 4OEMB 2UUCL 2OWOA 4OONA 2KNBA 3OW7A 3MXNB 2V3NA 4YL8A 1CKMA 1GUNA 2WFWA 1IBLL 3EA6A 1V49A 2MO0A 3RNGC 4GN4B 3HOYG 2M17A 4IUMB 3X3MA 1YNJC 5JVG3 2KOLA 4KLKA 1L5PA 1V1PB 3VRBB 1L0YB 3PV1A 4NAMA 1PH7A 2QCZA 4XQJA 4CDDC 4LF5L 2B2UC 1ICWA 1WH3A 2PPHA 4C3HG 2C9WB 3OLMD 4DV5L 2V4DA 1PFBA 1SB3C 2KXJA 3ICEA 4HIMA 1EYCA 4MEMA 3CC2A 5C3EG 3KLSX 1P7EA 2BYEA 3Q3JA 2HQEA 4A8XC 4RMFA 3HKSA 5IWAL 3G4SA 2IX0A 5DCNA 4E74A 3ZJUA 4KJOA 4KY6A 5CV9A 4DV0L 4JI5L 2BA1A 1FEHA 2Y5BB 3LB8C 4K7UA 2RHSB 3I91A 3KK7A 2ES2A 1YOVB 2MSED 5DPRA 1N36Q 4HPMB 1QB5D 4GNXA 1Q81C 5K36H 3HUIA 1PVOA 3CCUA 3HM6X 4IPGA 1HNWL 3G71A 3HOXB 2M8SA 4PT5A 1UE6A 4AQYQ 4LF6Q 5IYBH 1YN4A 1E90A 2F0HA 2RSUA 2KDFB 5JJZA 5G2NA 5EDSA 3KLSA 2JA5B 3A4RA 3QC8B 3NBIA 5IT9E 1JWSD 3TIXA 4CDEC 5CYUA 3RNCC 4M0WA 2XK5A 3CCQA 3KUCB 2F0SA 3ZQ4A 1ACCA 1RAXA 3DBRB 5DPTA 4A3OA 2DX5B 2E74C 1HXYD 1NMGA 2Y0SE 2WV6D 3Q22A 5LMNW 2HHHL 1S5CD 4LDTB 1E8ZA 2LVQA 4MGIE 4WQMA 3C19A 2KMAA 5EJWA 2K50A 5IOIA 4FYDA 5KEEA 5J22A 4K1RB 1JMLA 4EZJA 3EC8A 1TT2A 5CX3A 1QZHA 4XT3B 1HNXQ 4JWUC 2K9XA 3E56A 3NVYA 1A62A 2BOSA 4V190 2WX1A 4AS1A 1E2VA 1HFNA 3DHHC 4K14A 2Z59B 1VDZA 3IAYA 2VZKD 2DLBA 4E3CA 2JYEA 2EXDA 4YXDB 5HGQA 3R3MA 1W6KA 1RTNA 2DUDA 1T6BX 3W5UB 1VCBA 3HP3A 4XWTA 3BDOA 2FCSA 2ZXRA 3U52E 2NCNA 1EY0A 4DN4M 3ZKJC 5MPOA 3VR9B 1EUVB 2IYDB 2DNFA 1F2MA 2G4SA 1I4QA 5AZFA 1TKGA 1XYIA 1N32Q 4A3EG 3GE3C 4L5RC 2CCZA 3UE1A 1XLNA 2NN6H 2G5DA 2GBJA 2CHZA 2M56B 3RD4A 1GHKA 2KC2A 3J81E 3GQBA 2VB3X 1EFWA 4FXDA 1RM6C 3TL5A 1WF9A 4R4TA 3RNUA 2WS3B 2ALYB 4G4KA 1CA6A 1JROA 2SNMA 1AZQA 2RCFA 1PDXA 2WNMA 3I5JC 4E6IA 3PZ8A 4JC0A 4IKGA 1N62A 4LNNA 2B2UA 5C44G 4TV3A 3J7AF 1ZUD2 1PQSA 2LASA 4WJOA 1E5WA 4DR7Q 1HUMA 4PZ7A 1ROEA 3ZVVA 5J17A 2BE5C 2QIEB 5EE9A 3E3XA 3HOYH 5LL6S 5LNK1 2P5ZX 1IPGA 4FN2A 1O7YA 1PH1A 1KM7A 3CSFA 1E8WA 5GMVA 1V81A 1SR3A 4HPPA 4W9KA 3CC4A 1N36L 4K8JA 5JJKA 1TS4A 2BT6A 1KDAA 3SDLC 2WAQE 1VMCA 5CV6A 2Y0SG 4O2DA 2KTFA 4AQYL 2IW3A 3MHSD 4JG2A 1Y1VG 1BT0A 3VVWB 4QF4A 4HCNB 3S1QB 5C3EH 1YJJA 3VR6A 1I94Q 3N1YC 1U4MA 1V5TA 3NJTA 5M3MG 2A69D 3P1HA 2RD0A 3GZNB 5FR3A 3NELA 1C78A 3ZJTA 4FF3A 1GUAB 1LTAD 1O7LA 2SNSA 3EIVA 2LXJA 2KDEB 5ELNA 1XMOQ 1YIWA 5EE0A 5DLQE 4C3IB 4DHZB 4OWXB 1Q0WB 3Q69A 3Q8AA 3RD2A 2QC8A 3PRMB 1HNXL 1E0ZA 5M5WH 1VZ7A 2MA9B 3VXWA 1PH9A 4DXFA 2X69A 1TIID 4A3KB 1ZYRC 4J6HA 4JI2Q 1AFPA 1AN8A 3A8KE 3Q14C 3Q8CA 4ARCA 4JI6Q 5I2XA 4ZKCB 1R7SA 2Z8LA 5EE3A 1SYDA 2EPBA 3BINA 1SBBB 1NEKB 4A90A 3R7RA 1UGMA 2OJRA 4HKQA 1TWHB 4B3MQ 2J42A 3D4WA 1WFQA 2MP2B 2B3AA 4HEA1 1ONLA 1P98A 1JWBD 1KLVA 1J9OA 1RYJA 2K33A 1PRTF 2EY6A 4K7WA 2AQ1B 4CJ2C 1QUQB 3T3NA 2FMCA 3ONAB 2K5WA 3WANA 4F7ZA 2UXDQ 4GDKA 4R3DA 3NBHA 3S1MB 1X3EA 3S17H 1SNQA 1X54A 1ZDVA 4MM3A 4ZRPA 5FR6A 1T5XD 1H9MA 4YCUA 4JI3Q 3UDGA 3H7PB 5FO9B 3AULA 1MI2A 2WAQG 3RT3B 3L7ZC 4I6NB 3WAOA 3RLFA 5BR8L 3I9V1 1HQRD 3CCMA 4DV2Q 1D8LA 4C3IH 4F87A 1XTDA 2QDBA 1E7ZA 4DV3Q 4DR7L 2EQSA 1F2LA 3WALA 4A3EH 1H8CA 1SYFA 1ZXHA 3BYYB 1SNMA 4JL9A 1Q46A 3C2PA 2TSSA 2JPHA 1VQKA 2ZTDA 1CJEA 2PIAA 1WYWB 3UDXA 2D5GA 4TQUS 1Y56A 1PFDA 2BW2A 2ZNVC 4CKCA 2E2JB 3V61A 3PF4A 1XQQA 3L2PA 5HY6A 1LTID 3PHXB 2WXPA 2ZZPB 4A3BB 2K0PA 1TWHH 2AL3A 1I94L 5EPJA 4H02A 3TP6A 2FCNA 4JE3B 3RZOH 3UDIA 4OELB 4PMCA 1VQFA 3EHVA 1X3PA 1MJDA 2PZWA 2E2HB 3PREA 5COYA 2DJGC 4ZKBB 3PIOA 2NVXB 2X6GA 1G2TA 1LLRD 1Z7TA 5M5YH 3A9JA 1XMOL 4LF4Q 1JW9D 3GOEA 1IW7D 4X64Q 3I4NB 3J7ZC 3A5ZB 1B53A 3NZUA 4KI0A 1F77A 1B8AA 4PV1C 1K8RB 4JPSA 3Q6SA 3D32A 3RULA 2F0JA 1Y1VH 1LACA 1RCVD 2K52A 4JW0A 3T51B 4B08A 1KTKA 1PTOF 2Q2TA 3QO2A 1WXSA 2KACA 2NZOA 3NK9A 1EU4A 2MBBB 4UP7A 4JI2L 4GLAC 5M3MH 1KDBA 4EVOA 4A3JB 1YNJD 1J7AA 3A1QB 2LKVA 3GO5A 1B4OA 4IZ8A 3QR8A 4WORA 4JI6L 3RNAC 1BUIC 2LRUA 1VQDA 2E76C 3FMCA 4UDUC 2XTIA 5CV7A 5E4WC 1FGBD 1TWCH 3ULJA 5AZGA 4HVBA 2JXXA 1ESFA 1EZ8A 2K75A 4B3ML 3ZLZA 5C4ZA 3VRAB 2N1VA 3A7LA 2JXMB 3QOJA 2F0QA 5JEAJ 1VRAB 1CA5A 4IOAA 4GKJQ 4FHKA 3CMMB 1BR9A 1FJGQ 3GTGH 4NPNA 2KENA 1Q3LA 3HG9A 2YLMA 5M3FG 1JRUA 4RMAA 2J7QB 1FCCC 1EQRA 2UXDL 2UWQA 1F9PA 2OEOA 1AW7A 3AMUA 4L23A 4UP9A 4BOSC 4YT0B 4LCDE 5FLXE 2E2HH 2AUJD 3IFTA 5IT9c 3K0XA 2A6EC 2Z6KC 4JI3L 2MBOA 2WYQA 2H4OA 4DHJD 1XLPA 4M02A 1ET9A 2NVXH 3L17A 1YITA 3NHEB 1WXMA 5G3LF 3ZTDA 2MWSB 4CGYB 4RGMA 2JP1A 1UH6A 4DV2L 4DV3L 1CUKA 3EQLC 1G51A 2D62A 5L37A 2KDBA 3HKZE 1YD8U 1SF0A 4IFDJ 2KUMA 4OWWB 4MSMB 1ZXTA 2EDGA 3T56B 2RSOA 1N5WA 2WXHA 3S2HH 3J80i 1OXXK 4K5VA 2NMQA 2OOBB 2EIFA 2OXPA 2OCEA 2OTLA 2L0CA 3EFXD 4DF7A 4FA6A 3DCGA 4NW2A 2V1YA 2O2VA 5CHWA 2JZPA 1PMRA 4ZUIA 1UGJA 3ETRA 1GAQB 4BKGA 4U673 4K81A 4WJQA 1P8LA 2L55A 5IT9L 1Y1WB 4D2KA 2KWDA 3B0AA 5F2DA 1CFMA 2B2TA 1E9MA 2ZJPA 2JA7B 4XE0A 2JEAI 1DOLA 5JXVA 2DYMA 4HXDA 1QOGA 4OW0A 3FILB 1F2YA 4PMBA 4AJWA 4KHZA 1AEXA 1OXSC 3CCVA 4LF4L 4X64L 1Q86C 4K6DA 5M5XB 3ZW3A 3TEXA 2KFKB 3NE5B 3U9OA 1VQ4A 4CYEA 3J81c 1NVID 1L1OB 2KQSA 2EYOA 3F1ZA 4ZHPA 2KMMA 4REZA 2CHXA 5CR3A 2O6VD 4HJKA 3MFGA 3AB5A 2F3IA 2B2VA 3QJYA 2KHWB 2Y5CA 1EY4A 3KJOA 3JYUA 5CTRC 3AU7A 2JZ3B 1F2RI 4F8CB 5KHQA 1VCIA 3K59A 3L4PA 5JHAA 3TSSA 5L83A 3KYHC 4IPHA 2FFKB 1PH8A 3PUWA 4A6QA 4YWLA 1EY7A 1FNWA 2JSOA 4LJPB 4BS9A 5IOCA 3CMEA 1GO3E 2BPSA 3VUWA 4HMIA 2F3VA 2HD5B 2PEAA 4RAUC 4GKJL 2Z1CA 3F2CA 4KKIA 1K3RA 2QA4A 3A0JA 3QIAA 1FJGL 3TRZA 2D3GA 2IBIB 4XDXA 5JPMC 4YWGG 2LGYA 1T9HA 2BE5D 2L05A 4M00A 4KIKB 2KAJA 2PNHA 2K7VA 3STBD 3PO2B 2L4NA 5HG2A 1Y1WH 2FMMA 1C79A 4FBJB 2ZW1A 4FF2A 2VY3A 3HIZA 4B0MA 2QJLA 3NVWA 4IWOA 2FIFA 1N6ZA 2PYKA 1EIFA 2J52A 2QGQA 1ZKHA 4ID6A 2D3CA 2B39A 3OJ4B 4NPSA 1LFDA 3UINB 1A5RA 3R8BA 2BH8A 2QDLA 2Z6KA 4C1NI 2PPBC 3WOEA 2R6GA 1STAA 2F0IA 3CU7A 3GS2A 4FJYA 1EEID 1IBXB 2RPQA 4B3TQ 2DYBA 3A9KB 2A6HC 2PW9A 3G7LA 3MZ5A 2EMSA 5M3FH 4IUQA 3ER0A 1UEBA 4XT1B 1S72A 3D31A 3OOCA 5CMDA 1QT9A 1GG3A 1QVCA 2YTYA 5BMGA 5AFWA 5CHVC 1GJZA 2Q8RE 2JY6A 4ZRKA 1PYBA 1XPUA 3DVNV 1J0GA 1GVPA 3PLUA 3MHBA 2QW7A 2BS2B 1XNRQ 1EF1A 2CW0C 2EMTA 1RL2A 1PH2A 3L9AX 2HTME 3NP8A 2N7DA 1ZXIA 4HWIB 5GAEC 3D4RA 1EYGA 2WLBA 1ZYRD 1ASYA 3EN2A 3NTKA 1FXAA 1SYEA 1YHBA 5IYCG 4ZYNA 3JAME 1I6HB 2JZZA 2K04A 2VQEQ 2PNRC 1RWSA 4WWOA 1JB7A 4JQWC 1MHHE 2EYJA 1G91A 1J7CA 3TDQA 2GBKA 4MJSA 4DV7L 2G1EA 2K6QA 3KYDD 3T3OA 3TZDA 4LJOB 2NVTB 4FADA 3N20C 4DNIA 4W9GA 2WP9B 3NZSA 1FD6A 1R4QB 3DXJC 3MC9A 1RKNA 1ILQA 3IFDA 4HJ9A 4MN3A 1NAPA 4QIWB 4A3FB 3CCEA 2D10A 4QY7A 1SE3A 1DXMA 4HCPB 1ZEQX 4DK3C 3OWFA 5IODA 4ZRJA 4IURA 3LWEA 2BVCA 2L15A 4GDLA 2A8VA 2K5DA 2ZJRA 2LZ6A 3PTFC 2BKRB 1GC7A 3K80C 4H7BA 4NP5A 3FP9A 3MJ5A 4ALPA 4PS7A 3R7QA 1N61A 4POFA 1S5ED 2B29A 4EQ5A 3NRZA 4XYCA 3S2DH 2XVSA 3BK2A 3PQIA 2B63G 2KZRA 3E6ZX 3HEJA 2R2OA 4CHTB 2IO1B 4A93B 5I2YA 2AWOA 1LM0A 1IYFA 4ZQ3A 2W82A 4Q5VA 4WJPA 3Q2AC 2KDIA 2EVBA 2GLSA 3KBXA 2EYHA 1I6HH 1KABA 3I63C 1MG4A 2F0EA 2LHDA 3T53B 4AH6A 2J0TD 3QAQA 3VH4B 1HNZQ 3BU2A 5FO8B 1UUPA 4MTNA 3A5UA 3O13A 3H6MA 3P4PB 4B3TL 2JXTA 2N9LA 1CSQA 2HD3A 4GLSC 1V9PA 2N49A 3WAPA 2NVTH 1LABA 3W1GA 1SYGA 4EQPA 3K7AH 1K8OA 2PVOD 1CK1A 4R4CA 4X3KA 4DR6Q 5CBAE 2NBFA 2UXCL 1KOTA 3SD5A 1UWXA 3BVZA 1II3A 1B9NA 2RHQB 2E2IB 2IHEA 2PMZB 4ABNA 4LNIA 4N9TA 1LXDA 1VQHA 3QARA 1K83H 3S15H 2D3AA 2F52A 5G55A 3PO3B 2AHOB 2W55A 5I6WA 2XNAC 3RMHA 3AE2B 2ASBA 3NVVA 5EKIA 1AWDA 2VQEL 1XWEA 1JMCA 2F0OA 4MZ9A 3AE7B 4W9DA 4X62Q 2M4NA 3T13A 5CV4A 5C3XA 1P7FA 1WGYA 3LNNA 1C7YA 1BCPF 2IZVB 2J0KA 2K39A 5FLXc 4NQLB 3ZXVA 1WJJA 4NXNQ 2AWTA 3K7UC 4I6LB 5IAAC 3BZDB 3F2UA 3M4OB 3OHXC 3ZNID 1YJ1A 4K7SA 1H9SB 1VQIA 3DMUA 4HSPA 5G5GA 4HLEA 1VMPA 3R93A 1XCQL 3AE6B 3SK4A 3KF6A 3SEBA 5IYCH 3U50C 2BGFA 1AE3A 1FL0A 1GOZA 1UEAB 3TP5A 4IUPA 1JALA 2N7EA 2A6ED 4AYBB 2INDC 4YSZB 4HPLB 3PIPA 4DUYQ 4BY7G 2ZVOA 1SRUA 5AZHA 2YU9B 4B9KA 1C4QA 4NAWA 1I42A 2PO4A 3VYTA 4JI4Q 5C1ZA 2B2YA 1FM0D 2G3QB 1EY8A 3MFYA 5HFYA 3EUB2 3RN2A 1TXYA 2XN9C 3H8HA 2ZXOA 4DK1A 2DNCA 2Q2HA 1OQRA 5FLXL 2AYOB 1ENAA 4EQOA 5LL6X 3UDFA 4LJZC 2KVZA 4RKLA 1BQQT 3AV8A 1WTVA 2BBCA 2PVGC 2A4ZA 4GIVA 1DOMA 3KOJA 1Q5WB 3TEHB 2LVOA 2ICIA 1HNZL 3IXSA 4NNJB 3V6EB 1OXVA 1WOCA 3AE4B 3NWSA 4WRDA 5C4JH 1SYBA 3GTPH 4P6VF 4GNXC 2N1WA 2B63H 1I3QH 2KJHB 4DR6L 1T0RC 2SOBA 4DAYA 5JJLA 1N34Q 4QAYA 1W2BA 2FINB 4JWSC 2VXWA 4LF7Q 4A3IG 4FO2A 4G3XB 1EQQA 1PZJD 1WGDA 4K8IA 3KF8B 4OIJA 1RIPA 2SAKA 1PFMA 4HRSA 3APDA 4ITKA 2VS1A 1K3BC 4ZAIA 2NZHA 2R7DA 2YEPB 4LAAA 4WJNA 4B9XA 4AUQC 3FDTA 3AFQA 4RHRA 3QIJA 4X62L 1BO0A 1PGXA 2CKHB 4II3B 4C7ZA 1K8MA 1IYVA 2L1BA 2LGSA 2CWAA 1G6ZA 2VUMG 1F2RC 4MGKE 4L5TA 2LMCA 3A7AB 4A3CG 3H6NA 5D2MB 2Q2UA 2F0NA 4HMJA 2EZVA 1S5FD 4DFAA 1R4NB 3ZJYC 2LGXA 1WR6E 4S3SA 2VNUD 4M8NA 2HUGA 4AWJA 1NENB 2PW5A 2IY5B 2NVUI 5D14A 4DUYL 3HOZB 2NUCA 3HHMA 3KH0A 4DBGA 2MHVA 3KDFB 4ODGA 1WMHA 3W1YA 3V6CB 4F1SA 4DK5A 1K8GA 2JVCA 4LNOA 2NBVB 1Q7YC 4JI4L 3IAM1 4DHJB 3LX0A 2L3ZA 1HFGA 3QQ8B 4G0NB 2YYZA 1JE5A 1L4ZB 3L10B 1AP0A 3PZ7A 3IRBA 4YWKA 4BVUC 5IKCM 1DOIA 1DOKA 4B95A 4GOPA 4A76A 4KKJA 3PCOB 2DN8A 1JE4A 3U4VA 3NUCA 2VB2X 1GHJA 2BS4B 4MH0E 4FXGC 2K6AA 2R92B 4LNFA 3ULPA 1U5KA 4LLGM 5E4XA 1WYGA 2WKDA 1Q1OA 3DBLB 3GTJB 1T3QA 3JAMc 3ABVB 4WWMA 4B0EA 2A1AA 3H09A 2EYFA 4BY7H 4JK1C 2KWUB 1H9RA 4LUZA 2CW0D 4CHKA 1FFVA 4KGRA 4YSXB 3RR5A 1IGDA 1GUTA 3H3VC 2L52A 4GB9A 2L0FA 2C7NB 4JBWA 1JC7A 1IXRA 1J8CA 3H0GG 3M63B 1LT6D 1QILA 1BBWA 2B2WA 4KV6A 2RDHA 3I3CA 1K0RA 3HS0C 2NVQB 1NDDA 4MH8A 4C56C 5C2TB 4XWWA 3KJPA 5AJ3Q 1QCBD 3WA0A 2UXBQ 4LF7L 1STEA 4DHZE 1HPCA 1E1TA 4WAFA 4O0AA 3HOZH 2M2LA 2NS5A 3CQZH 1ENCA 3AEGB 4L1BA 3CF5A 1YVCA 2RA4A 3OWEB 1WGRA 2G4DB 2JA8G 4ICVA 2JYTA 2O6VB 1IZ6A 2F3WA 4ZLTF 1IBKQ 3RNFC 4HJAA 5GQOA 3CCRA 2EYPA 2WWZA 3DWMA 1SAPA 2K32A 2WP8J 4WIPA 1RHPA 4MSQB 3GDEA 2IJ0A 2F0TA 3QOLA 4A55A 1TZ1A 4X3SA 1RLFA 2KTRB 2R92H 5AUKA 2A73B 2N88A 4DNTB 2QSDA 1R4MB 3HOYB 1Z47A 4J15A 4A3IH 2EJGC 1B7YB 1DZ1A 4OVVA 1LTBD 3GTJH 1PFSA 1P0RA 3TEZA 1CM9A 2D2QA 1FIQA 3RFZB 2A74C 4C80A 1SJED 2HIVA 1OO9B 5HI1A 4HJ8A 3JSVB 4OZCA 1GUGA 3FC4A 4C3HB 1J5EQ 1KF6B 1YQBA 3UIOB 2WDQB 1I6VC 2HT1A 2JSVX 3SFEB 5C3EB 4BKSA 2NVQH 2MHJA 2WDRB 3HM3A 4X6AH 1STBA 3PUYA 4H44C 3NG0A 4A20A 2W54A 2I07B 2KHJA 1QKZA 4A3MG 2M0AA 3J7YW 1GM5A 4PMWA 2KLCA 2OQ0A 4UY8C 2VUMH 3V2TA 2L32A 4R4OA 2D2CC 2ZJDA 5GAGC 4S17A 1WX9A 4GLXA 4MACA 1WJUA 5IE8A 4A3CH 2AUKA 1SDFA 1NBFC 1TZOA 3EBEA 3KBGA 1TTNA 1JT8A 3CMAA 5M5WB 4C4VA 2F0UA 2MPMA 4G7HC 4DV1Q 1Y8NB 2I5MX 2EYMA 2PQAB 2WDVB 2IY1B 5C4XG 3OPOA 2ONQA 3W5VB 3ZUNA 3APFA 4DDID 4DXAB 2CJNA 3MTNB 4CDFC 3AE1B 1T5EA 1Q12A 2A68C 3VH3B 2RDGA 1H9JA 4HKZE 1I50B 5E6OA 3ERQA 4PYUA 1XPRA 3OG5A 1E2ZA 2I1JA 4HIDA 4DR4Q 2BYTA 5AJ3L 2JK8A 4C3HH 2GI9A 2AMCB 1WGHA 2UXBL 2K28A 4LF6L 1QNUA 2CFMA 3A55A 3A8IE 4GS3A 4IW0A 3V62A 5J39A 3RZDB 1XMQQ 2A19A 2K5HA 4DKAC 3UI2A 1Z2MA 2I0QA 4E71A 2IPKD 4LF9Q 1C77A 1V8CA 3K8AA 4RM8A 4RA8A 1EWCA 3S17B 1FMAD 2N55A 2NPTB 2AQ2B 3MC8A 3UGBB 2E75C 3H15A 4GN1A 4FF4A 2MRPA 2V4LA 2OTJA 1YZ6A 1V1OA 1WD1A 5EBDA 3H0GH 4LW1A 1IBKL 3AE3B 1WXAA 3H1UA 4CBVA 1LT3D 1JJ2A 1L6VA 1WX7A 1Z5SB 3P4SB 3DM1A 1K53A 2IT1A 3GTLB 2RVLA 1YNXA 3U58A 2BF8B 5H92C 2KEDA 3I4LA 1H95A 4HN7A 3MXNA 4IOIE 3SE0A 4A3EB 4BFRA 1Y8RC 2QCPX 1X56A 5IP9G 2KWCA 2BYFA 2X6LA 1UE7A 3D6WA 3VYUA 2RDBC 4US9A 4XDCA 4C00A 4GU2A 1V1PA 4HEDA 4XTCS 3ERSX 1PYSB 2K5PA 2WXRA 1XJVA 1WYDA 1Q82C 2F4IA 4IUNA 1DD2A 3QG1A 1QJOA 1WCMG 1MG8A 1CHPD 2YV5A 1I50H 1E8YA 2C5CA 3D8GA 5C44B 2IGDA 1D1KA 2R7ZG 1VQ5A 3RZOB 2WXGA 2DY7A 1XLQA 2RSNA 2KKCA 3QWZB 2VQFQ 1N32L 4UPAA 2WINB 1IP9A 4IWQA 1GPXA 3PSIA 3RZDH 1R9TH 2ATWA 3DBHI 1FPYA 3HFZB 3P4RB 2CQOA 5M5YB 5EPKA 1VQ8A 3GV3A 1HE8A 1STNA 1DYQA 2NBWB 3S1RH 4ANWA 4JX1C 2JT4B 5IGCA 1SJHD 1FFUA 1EWHA 1NBWA 2NTTA 1B9MA 1SE2A 2Y0SB 3HOVG 1Q10A 2RR9A 1FVIA 1T0YA 4TSSA 1O78A 3RZWC 1Y1VB 2WB1E 1A3UA 4DV1L 3GTLH 4ARIA 4KN4C 3TBIB 3APCA 5M3MB 4WJ3M 2BCOA 3CW2C 2MLBA 3I72A 1FCLA 2RMMA 2GA4B 1SSNA 1D1IA 1G2SA 4A3MH 1UZXB 4ZDVA 1GC6A 2DZMA 1TWCB 4PYZA 3U30A 4JBJA 4A3LG 3NQTA 4DK6C 1EEFD 3M3JA 3BVGA 3N1XC 5FK9C 4US8A 5M9OA 3U7DA 4DR4L 4DR1Q 2QILA 2IGHA 1XXGA 2B2TC 3GTGB 1WRDB 1DM0B 2K4KA 3D3RA 1XMQL 4IWPA 1M90C 4ZOHC 4X3UA 5C44H 4HIOA 3N6RA 1EU3A 4G7ZC 4LF9L 4IJHA 3KWVA 4W9IA 1SGHA 1FO4A 4OIKA 5TSSA 4FXKC 1PLFA 3MXUA 1X9NA 4WJWA 3IG3A 1JWUD 2YEPF 3S16H 2PLPA 5K5PA 3RN5A 4ZUJA 3AECB 4NJ6A 4I65A 4LFCQ 4QMGA 3SK6A 2FHTA 1J7BA 2MJEA 1I4RA 2D0OA 5A2QE 2J53A 3Q24A 2B2VC 3AYHB 3BG3A 1UBIA 2R93G 2OEDA 1VDVA 4EX5A 2N9KA 2CJOA 4NY0A 3MWYW 1KD1C 1QOFA 1UWVA 1TWFH 1P3QU 2JQOA 4JCVE 2JA6G 3S2HB 4M8AA 4ILWA 3AEBB 3DWGC 2MJDA 1I7HA 4IUUA 1RTOA 2B8GA 3K9OB 3RI7C 4MGYE 4P2CB 1UF0A 2DWQA 4A9AA 3B2FA 1YMHE 2K1BA 2KWVB 4P75A 3FKYA 2WAQB 3RLOA 4ZCKA 5KYLA 1BOSA 2BS3B 2KQ7A 1S4ZA 5FLMG 4EKUA 3MAQA 1D5XC 4JGHB 1PZKD 2VQFL 2WB1G 2JJQA 4TUUA 1GKHA 3DVNU 5G5HA 4MTKA 2WDTB 2RKSA 4A3DG 5IP9H 2X38A 4RG1A 4WAAA 4P72A 3VR8B 2KBNA 1NI3A 5T1IA 2E5LQ 1VZ6A 3UF8A 2L9HA 2JN4A 3U9SA 1OTCA 3N3KB 1G6PA 4K2LA 1WCMH 2IO2B 1E22A 2R7ZH 2HDMA 1S5DD 3BIID 3C1FA 3DOWA 4APVA 5EAYA 1S1QB 2IWHA 2NVYH 2F03A 4RF0A 4Z9CB 1JWAD 2CVRA 2OF1A 3A56A 3AMZA 4RF1A 3GD7A 2VZAA 4DGZA 5E6JA 1EZ6A 1ILPA 1CSPA 1PH5A 1O7ZA 2K25A 4XYOA 1L0VB 1BCPC 4DR1L 2ACZB 3K5LA 1OEYA 4CJ1B 3HOVH 3KW5B 2F0PA 3L3OC 1EL0A 1TYGB 2WU5B 4IALA 1Z9FA 1AARA 3BS1A 1E8XA 2ZCCA 4ANXA 3EGRA 2JA6B 2INPE 2ZM6Q 1QNKA 5EPLA 2MBEA 3L0WB 1F1HA 5IA7A 5IIFA 1S3OA 1E3PA 1C8CA 1WTWA 2JUOA 3OIPA 2WU2B 3Q6BA 4QIWE 1JWMD 5G3LD 4A3LH 4W9JA 4I7AA 3Q8FA 4LFCL 1WXVA 3GTKH 2MX2A 4BXXG 2KFJA 3J7A5 1DONA 3B9JA 4OL7A 1EO6A 2VH2A 5ISRA 1BKBA 2EOTA 2ASQA 4MDKE 2MP2A 1B44D 2EJMA 2PW7A 1EYDA 3CHBD 1LT4D 5M3FB 4A3DB 3GTMH 2LFNA 1RFAA 2EKIA 2OJWA 2QDFA 2LI5A 2SEBD 4BAXA 2OQKA 4KX6B 1QUQA 1MBYA 2M9VA 3X23A 4P73A 4K6LA 1BVSA 4ZRZA 1C4PA 2WXIA 3MEFA 3M62B 2KVMA 4V0BA 3OJ3A 4N59A 1Q8KA 1L0XB 2XIWA 4BOZB 5JHBA 3CXCA 3DLLA 1WZ0A 2XBBC 3DVGX 1X1MA 4J6IA 4IG7B 3H7PA 3PLVA 4LFAQ 1F52A 2ZPYA 1BXTA 1YN3A 1CKOA 2DZJA 2H89B 4ICUA 2KDMA 1KL9A 3DBSA 2JYOA 2R93H 2CKZB 4RWSC 4C3JG 4G11A 1CKNB 1Q1EA 3D6CA 3W5OA 4JBMA 1AH9A 4MIUA 2FCQA 4A3PA 2JA6H 2A68D 3J81L 3GTQH 1GB1A 1I4GA 3E9HA 3HKZG 3BVMA 2E5LL 2HDEA 4LTUA 4KSLC 2XRQD 3UIPB 5JPNC 5ELOA 3ITPA 3NY5A 3WCQA 1OXUA 1C4CA 1SNCA 5FLMH 1WGKA 3KVFB 1STGA 4KGTA 1C0AA 1LUZA 1R4PB 4HR7B 3QK0A 3CP0A 2V0GA 4WWPA 2PMZE 3T8MA 2LJIA 2V4IB 5L95C 2D3BA 4X66Q 1WTHA 1ZDXA 4HIKA 1EY6A 1STHA 2IX1A 1JOOA 1HCZA 4XXEA 3H3VI 1FR3A 4A3DH 2L5TA 1HUNA 3NUHB 1WXQA 2W3SA 4UAIA 3J80E 1UELA 1ENFA 2HCCA 2IY0B 4NB3A 1YQ4B 1YN5A 4KMUC 4M8MA 4YSYB 3NTHA 3SHLA 3CCJA 3NENA 1HTOA 5CBEE 1TS3A 1L7YA 2B3GA 1LTGD 5I9PA 3S2DB 3BZCA 5DAUA 1V8QA 3Q0AA 1JR0D 4S0RA 1ZW7A 4W9LA 1W6JA 1IBMQ 2WXKA 4Q2JA 2PE6B 5NUCA 4K3CA 2D07B 4YTPB 1TKYA 1SIJA 1D5MC 3KWLA 3AB9A 4P71A 2ZEQA 1WTPA 3RUIB 1M8AA 3A1QA 2WACA 1VQMA 3DBHB 2LXCA 3S2AA 4QQBX 3F8TA 2VZKB 3BDLA 4MELA 2KC1A 3K6OA 5C0XG 1GUSA 1V43A 2WKCA 5EGTA 2V3PA 3NOBA 3NS8A 1HZ5A 3CRKC 3BYTB 5BYQA 1XD3B 5IGBA 1NY4A 3RNEC 1TGZB 1B3QA 2DY8A 2KQ3A 1EOVA 2WXLA 1U4RA 2DNEA 3K7AB 3NPPA 2KLGA 3NS1A 3PO0A 1YJ9A 4QUFA 3LJ3A 4KD4A 1M1KC 4YIJA 2FBWB 2RDFA 5C23A 4IPDA 1ESRA 1PUTA 2VW9A 1E0BA 2B2YC 2G9HD 4FVMA 4LFAL 4BXXH 5JOBA 1BMLC 4FNFA 2NWGA 1TWGH 1WFYA 1F0ZA 4R4QA 1K83B 1LGRA 3S15B 1YJIA 1LYLA 1N9WA 2MP1A 2KK8A 1YIJA 3PV0A 3W1BA 2Z0EB 3MVVA 5D94A 3NZ3A 4IJLA 4YTNB 3DWPA 1NJIC 3FPUB 3X0WA 2V9HA 4M01A 1SMYC 1LTRD 3E9IA 3AE5B 3AN1A 1ZP0B 1E7PB 1NSNS 5GXGB 5LHY1 4KTAA 3DHGC 2Y3AA 2UUAQ 3AU4A 4XC2A 3LGJA 4X66L 3M7NA 4YCWA 4WJ4A 1C48A 1HQMC 4C3JH 3QA8A 4XQNA 4GOCA 3SU8X 2N9EB 2PI2A 3FILA 3P2BA 3M7GA 4BBRG 3T1HQ 5ELFA 4DU9A 1VF7A 1KJTA 3BWUD 1EM7A 1XF5L 2KFKA 4A3GG 4EFOA 1XNRL 1L1OA 1JOKA 3S1NH 3A4SC 2GBNA 3Q3NC 3M3YH 3K5OA 3TJPA 3UI3A 3K58A 2ZXPA 4EE2A 2I5LX 1IBML
chains in the Genus database with same CATH topology
2JEBI 1GUWA 4EQNA 3I8ZA 5C5MA 3BK1A 5T8IA 2KQ4X 2NB0A 3MXPA 2LHEA 2EY2A 5A2QL 1CHQD 2MH7A 3VA7A 5C4JB 1PFNA 3GTPB 4DXGA 2D9UA 1F9QA 2XWBB 1RODA 1U4LA 3S9WA 4PQXA 2B63B 1I3QB 1Y8PB 2ZW0A 4KY5A 5BMHA 4XDDA 1L6UA 3G6JB 4OZBA 3X3NA 1Y69U 3EROA 2FJ2A 3DEOA 2RPVA 5IGEA 3N9YC 4PNYA 3GP7A 5KIXA 4R8NA 1XTCD 3S14B 4L8JA 1IL8A 3QB3A 4WFN3 1IBXA 3OIQA 2A69C 1KDCA 4G7OC 1CZGA 3A54A 4OGQC 4ZHOA 1BCPD 4L6TB 1D6EC 3ND8A 1U4PA 5KGUA 3HRDD 2B2WC 2FE8A 1QOHA 3FRPB 1A70A 2EJFC 4J1MA 3NXWA 2M19A 4KHVA 1I4PA 1BBXC 3HRZC 3A8JE 1ZKOA 4DK0A 3VYRA 1QOAA 5H8YE 2MJ3A 4HTHA 1WTOA 2K5QA 2PZUA 3TP8A 1CTMA 1BNZA 1MSHA 1U9RA 1XLOA 1MGSA 4BY7B 3BDCA 1PRTC 3LXFA 2PCFB 3MTSA 4O42A 4F7XA 1X3QA 1KNAA 2B76B 1CT1D 3R3OA 1YQ3B 5BN4A 2ID0A 4KKSA 5E3FA 1PGBA 2R3ZA 2QEJC 5BMIA 2D5DA 2O5JC 1MHXA 2BDNA 3U4EG 1QLBB 1JORA 3CQZB 1NYRA 1QWYA 2KA7A 2K22A 3P63A 1KNEA 5C6AA 3DHQA 2F0DA 4Q0FA 2PKOA 2A6HD 4FF1A 1Q8IA 4YTMB 3M4YA 3ZYYX 1QF6A 1GB4A 4Y7NB 3C3LA 3DWAA 5C5LA 4LK1C 2LGIA 1MSGA 2TMPA 5BN5A 1LT5D 4A3IB 1DGJA 1D4BA 3AH7A 4TQ0A 2GRIA 1Z6HA 4BA1I 1TKEA 3E9SA 3E5SA 3C8YA 1I4XA 3J80L 1D2BA 1IKMA 3SVMA 3VA5A 1EFID 3R2TA 2EYLA 1VR9A 2DBYA 1K51A 1GJXA 1OQQA 1PTOC 3W3AA 3LYYA 3MP9A 1PDQA 3HOWB 2VUMB 1OXTA 1EIHA 1DJRD 1E6EB 3CIRB 3KQ4A 3J7AV 3JAML 2BB5A 4GDKB 1XCTL 1PTOH 1H9SA 3SR1A 1N63A 4MM3B 3AEDB 3KUPA 4MHEA 3FVQA 3C1EA 3MXGA 1BUVT 2L11A 3HGBA 2F0VA 1SYCA 1FYCA 5I6YA 3TN2A 3IT6B 5EE1A 2GB1A 3ZJVA 2F0GA 1MI0A 2ICEC 3TMEA 1IGCA 1SMYD 4O1NA 2MEKA 4RGOS 1NR2A 1FNUA 5E1FA 1V97A 1VJKA 4N58A 3IT4B 2F0KA 3PUXA 3WDNA 5KNDA 3H0GB 5D65A 3K57A 3K5MA 3P4QB 1YNTE 2EELA 1GUOA 2I2YA 3T4AC 3NHHA 2JE6I 4RCOA 2HCIA 2CHBD 1HA6A 2JX5A 4OZAA 2Y5PA 3J9CA 1B2TA 2LS01 1EYAA 4C3IG 3KF8A 4L2YA 2JA8B 2RBMA 1N5XA 1QG7A 2O4XA 3GB1A 1C9FA 4RFBA 2F1MA 1B9RA 5ELCA 2KEEA 2PTLA 3VYSA 4HCSA 1IUEA 3PMFA 1R9TB 1L4DB 1EQTA 4DAVA 2IDYA 1SEBD 1SNDA 3S1RB 4CKEA 4R9WA 3V96A 3PIO3 5D3DA 1WTXA 1IHZA 1EIGA 1HA5A 2E3TA 5DNFA 2K03A 2BTEA 1SNPA 3E0JA 3TP7A 1HZ6A 1ZPSA 1LV9A 2IX3A 4A3MB 2N7JA 5JVH3 1KFYB 3ND9A 3LWUA 3P1MA 4RKBA 3IKJA 1A6XA 2WXJA 3TZUA 1VZ8A 3GV6A 2JWUA 2LEKA 3U7ZA 2ON8A 3I57A 1CQFA 2LY7A 3M85A 2L83A 5C4XB 1LO5D 4P16A 2WXOA 1WVLA 3S16B 1GXDC 3PUZA 2E6XA 3B2GA 4I7ZC 5D3IB 5EQ0A 5T1GA 4IUVA 1IKLA 1FRRA 1A2TA 1TWFB 4NZLB 1B1ZA 5BYRA 3ZJTA 2ZT9C 4K2KA 5KNCA 4ME5A 4OO1I 3ZGZA 1E2WA 2F0MA 2INNE 5ELDA 4DNRB 4NJCA 4TQ1A 1KH0A 2KJXA 3FAHA 2K01A 3AE8B 1PRTD 3FEWX 5IGFA 3AE9B 2W3RA 2XRSD 5C4HA 1A3TA 3P7JA 1NUCA 4XQQA 1AYFA 2PQEA 4G57A 2PZTA 1WCMB 4ZK9B 5I9OA 4GZYC 2JQRB 2KN4A 1D5ZC 2R7ZB 3W2DA 2NVYB 3P75A 4ZRQA 3TEYA 1NYQA 1QE6A 2OHFA 4HAEA 4NDXA 1JQYD 4C2MB 3SXHA 2CU3A 3NSWA 4K5WA 1EY9A 5C0XI 3IAS1 1JCKB 3HOVB 1C76A 2QF7A 5HURA 5JAVA 3OSOA 1BCPB 2KCCA 3SK5A 1SSOA 4EGVA 1X32A 3PUVA 1F9RA 2FUG1 3VR4A 4C1NK 3GTKB 1XX8A 5KNBA 4IFDI 5HHDG 4R8IA 2E2DC 1WSPA 1RDPD 1TKWB 1NCVA 3GTMB 1PTOD 2N0SB 4KK7A 3T16A 5IGDA 1AZPA 2QMTA 4AQ7A 1CI3M 4DAPA 1FNVA 3TUOA 4RH6A 2EY5A 2AWNA 3CWIA 5C0XJ 4DA2A 3OMGA 4F8MA 1TY2A 2RQXA 3I73A 4WH4A 2JU6X 1UWMA 2O5IC 2Q8IB 2R93B 4GDLB 1F9SA 5CORA 1WTQA 4J3OD 5DM63 3I70A 1TQOA 2I46A 3GTQB 3AEAB 2NZ1D 3AM9A 2AQ3B 4TKOB 1ZE3D 1IYUA 1S5BD 2B8FA 1K50A 2O2LD 1MPEA 1MVKA 1TJEA 3SFDB 1JQ4A 2R61A 3EVQA 2WB1B 1YNNC 3IL8A 1WD0A 3RUZA 2LFIA 3FPPA 2Q8TA 4N6EB 3VR3A 1ET6A 2KCNA 1HTLD 2K3UA 1DCZA 2ENBA 3D4DA 2EE1A 1STYA 5CC4A 3C46A 2F0WA 4LMQD 1E10A 1A15A 1LTTD 4BBSB 2SDFA 5IGGA 1RJTA 4NKLA 3HVZA 1KLUD 4CKBA 3RPFC 4OO1G 1MD2D 5I4DA 2L12A 1SXTA 1EY5A 4B9WA 1JICA 2WQYB 1HRJA 1C4AA 2NYZD 3R2IA 4RCNA 1TWAB 4TMAB 1LTSD 4KY7A 4XIGS 2WXFA 4RGTA 3VQIA 1TWGB 3N52A 1Q1BA 4H0LC 4NAWB 1TS2A 3NVZA 5HGTA 4FP5D 4MT5A 5DM73 3NTIA 2EXZA 5JEAG 2I38A 4KD3A 5EBCA 5EKKA 2WXNA 2NTSA 1M4VA 1H9KA 2WXMA 3V3XA 4C3JB 2J7ZA 2EY1A 2HDLA 2H1EA 3WOFA 1WTRA 1SNOA 3HKZB 4BA2I 4ULLA 2K05A 1XO3A 1PXUA 4HSVA 5BN3A 3VR8B 3S1NB 1FXIA 3M3YB 5FOBB 3PIP3 4IFDG 4CJ0B 1K52A 2Z4IA 1TU2B 1EQVA 1EWYC 1RFKA 2Z4HA 3W9CB 3SK8A 1DOXA 4FXCA 3DWQA 3URYA 3H91A 5J1ZA 1WWTA 4L63B 3P42A 2XSCA 4OHJA 4N9PA 4USAA 3CKIB 2NN6I 1FRDA 2M00A 1JB3A 3NWTA 4IUTA 3AEFB 1TVXA 2LMCB 5C3WA 1PGAA 3NQIA 1J8IA 2BA0A 1VLBA 1TR5A 3VR2A 2F0LA 4H13C 2MJ8A 5BYSA 4OO1H 2L1AA 4J8QA 2F0FA 1CZPA 1JRPA 1HHVA 3TEWA 2KECA 4K5XA 4KKTA 3U2SC 1QOBA 5DEHA 2CQAA 4F88A 1A3VA 3GTOB 4XYQA 4DQOC 4U68A 1RD9D 4BWGB 3MHZA 1WRIA 1PZID 5ELBA 2DYOA 1BDOA 2A5HA 1PYWD 2J4XA 3I90A 2OT2A 5D7GA 5JEAH 1TS5A 2Q5WD 1VF5C 4OVZA 3HVDA 3OMCA 5C0XH 2BB6A 5CGKA 3Q23A 3CRLC 2WXQA 1CZWA 3Q8BA 5KYIA 4KGSA 5EKLA 4NMZA 3W1SA 4KN7C 2QKIC 4BBRB 4A3GB 3MC0B 3DEPA 1CQVA 1KAAA 4RGNA 1Y8OB 1O80A 5ELEA 3V05A 1QQRA 4IFDH 4RHSA 5CV8A 1JOQA 3DUZA 1PRTB 1A2UA 4ZYSA 4QB4A 2AX5A 1N60A 2IGGA 1G8ZD 1B50A 4H2AA 4BY1B 3EJIA 1TY0A 4M1UB 1OFFA 5K36G 4HCEA 1KRHA 1B3AA 4HJGE 4RNAA 2G9DA 4QUCA 1XEEA 1YNND 2IL8A 1DOYA 2BDOA 1NR4A 5CV5A 3K5NA 4KKUA 3I4MB 4HROA 2H88B 3KLRA 1SFOB 3MEHA 4QCLA 3P20A 3VR5A 3HOUB 3SDZA 4X3TA 5C3JB 2MGSA 2XWJB 1BF4A 1FD7D 3AEEB 4WURA 1ZOYB 4C7YA 1KLGD 5FO7B 1HEZE 1HTPA 4TRDA 2MUYA 2WIIB 4IQZA 3HZXA 4IN3A 3H94A 1F2ZA 3FKIB 1G291 4KJNA 4LK0M 1I4HA 1Q90A 1SE4A 1PTOB 5KRUA 2NN6G 5FKAC 5AUIA 3SR6A 2KHSA 1EOTA 1ML0D 1RF2D 5A35A 2LUMA 4CQNA 3QWNA 2PMVA 1IW7C 3MA2B 4IDIA 2C9OA 3Q8EA 3K0YA 1UNSA 1UAPA 3OW7A 2V3NA 1GUNA 3EA6A 3X3MA 1YNJC 5JVG3 2KOLA 1L5PA 3VRBB 1V1PB 1L0YB 4NAMA 4XQJA 2B2UC 1ICWA 4C3HG 2V4DA 1PFBA 1SB3C 1EYCA 3KLSX 1P7EA 2HQEA 4A8XC 2IX0A 3ZJUA 4KJOA 4KY6A 5CV9A 3LB8C 1FEHA 2BA1A 3I91A 3KK7A 1QB5D 5K36H 3HUIA 3HOXB 4PT5A 1YN4A 2F0HA 5JJZA 3KLSA 2JA5B 3NBIA 5IT9E 1JWSD 5CYUA 4M0WA 2F0SA 3ZQ4A 1ACCA 2E74C 1HXYD 2WV6D 3Q22A 1S5CD 4WQMA 5EJWA 4FYDA 5KEEA 5J22A 1JMLA 1TT2A 4XT3B 4JWUC 2K9XA 3E56A 3NVYA 2BOSA 4V190 4AS1A 1E2VA 1HFNA 4K14A 1VDZA 3IAYA 2VZKD 2DLBA 2JYEA 4YXDB 1W6KA 1RTNA 1T6BX 3W5UB 3HP3A 4XWTA 3BDOA 2ZXRA 1EY0A 4DN4M 5MPOA 3VR9B 1F2MA 1I4QA 1TKGA 1XYIA 1XLNA 2NN6H 2M56B 3RD4A 1GHKA 3J81E 3GQBA 2VB3X 4FXDA 1RM6C 2WS3B 4G4KA 1CA6A 1JROA 2SNMA 1AZQA 1PDXA 2WNMA 3PZ8A 4E6IA 4IKGA 1N62A 2B2UA 3J7AF 1ZUD2 1HUMA 1ROEA 2BE5C 2QIEB 5EE9A 5LL6S 5LNK1 1O7YA 2BT6A 4K8JA 1TS4A 1KDAA 1VMCA 5CV6A 2IW3A 4QF4A 3S1QB 1YJJA 3VR6A 1U4MA 2A69D 3P1HA 5FR3A 1C78A 4FF3A 1LTAD 1O7LA 2SNSA 5EE0A 4C3IB 3Q69A 3Q8AA 1E0ZA 1VZ7A 4DXFA 2X69A 1TIID 4A3KB 1ZYRC 4J6HA 1AFPA 4ARCA 1AN8A 3A8KE 3Q8CA 5I2XA 4ZKCB 1R7SA 2Z8LA 5EE3A 1SYDA 2EPBA 4A90A 1SBBB 1NEKB 4HKQA 1TWHB 2J42A 3D4WA 4HEA1 1ONLA 1JWBD 1J9OA 1RYJA 2K33A 1PRTF 2EY6A 2AQ1B 4CJ2C 3T3NA 2FMCA 3ONAB 2K5WA 4R3DA 3NBHA 3S1MB 1ZDVA 1SNQA 4ZRPA 1T5XD 1H9MA 5FO9B 1MI2A 3L7ZC 3RLFA 3I9V1 1HQRD 4F87A 2QDBA 1F2LA 1SYFA 1ZXHA 3BYYB 1SNMA 3C2PA 2TSSA 1CJEA 2PIAA 2D5GA 4TQUS 1Y56A 1PFDA 2BW2A 4CKCA 2E2JB 1LTID 2WXPA 4A3BB 2K0PA 5EPJA 3TP6A 4JE3B 4PMCA 1X3PA 2PZWA 2E2HB 5COYA 4ZKBB 2NVXB 1G2TA 2X6GA 1LLRD 1Z7TA 1JW9D 1IW7D 3I4NB 1B53A 4KI0A 1F77A 4PV1C 4JPSA 3Q6SA 2F0JA 1LACA 1RCVD 3T51B 4B08A 1KTKA 1PTOF 2KACA 3QO2A 3NK9A 1EU4A 1J7AA 4A3JB 1KDBA 4EVOA 1YNJD 2LKVA 3GO5A 1B4OA 4IZ8A 4WORA 1BUIC 2E76C 4UDUC 3FMCA 5E4WC 5CV7A 1FGBD 1ESFA 1EZ8A 5C4ZA 3VRAB 3A7LA 2JXMB 3QOJA 2F0QA 5JEAJ 1VRAB 1CA5A 1BR9A 1Q3LA 3HG9A 1FCCC 1F9PA 2OEOA 1AW7A 3AMUA 4L23A 4YT0B 5FLXE 2AUJD 3IFTA 2A6EC 2H4OA 1XLPA 1ET9A 5G3LF 4CGYB 4RGMA 2JP1A 3EQLC 2D62A 1SF0A 4IFDJ 2KUMA 1ZXTA 2EDGA 3T56B 2RSOA 1N5WA 2WXHA 1OXXK 4K5VA 2NMQA 2OXPA 2L0CA 3EFXD 4DF7A 4NW2A 2JZPA 1PMRA 4ZUIA 1UGJA 3ETRA 1GAQB 4U673 2L55A 5IT9L 1Y1WB 4D2KA 2KWDA 5F2DA 1CFMA 2B2TA 1E9MA 2JA7B 4XE0A 2JEAI 1DOLA 5JXVA 2DYMA 1QOGA 4OW0A 3FILB 1F2YA 4PMBA 4KHZA 1AEXA 1OXSC 4K6DA 5M5XB 3TEXA 3NE5B 3U9OA 1NVID 2EYOA 4ZHPA 2KMMA 4REZA 5CR3A 3MFGA 3AB5A 2B2VA 3QJYA 2Y5CA 1EY4A 3AU7A 1F2RI 1VCIA 3K59A 3L4PA 3TSSA 2FFKB 3PUWA 4A6QA 1EY7A 1FNWA 2JSOA 4BS9A 5IOCA 4HMIA 2F3VA 4RAUC 2Z1CA 4KKIA 3QIAA 4XDXA 5JPMC 4YWGG 2BE5D 2KAJA 2K7VA 3PO2B 5HG2A 2L4NA 2FMMA 1C79A 2ZW1A 4FF2A 4B0MA 2QJLA 3NVWA 2PYKA 2J52A 4ID6A 2B39A 3R8BA 4C1NI 2PPBC 3WOEA 2R6GA 1STAA 2F0IA 3CU7A 3GS2A 1EEID 1IBXB 2A6HC 2PW9A 3G7LA 3MZ5A 4IUQA 4XT1B 3D31A 3OOCA 5CMDA 1QT9A 5BMGA 5AFWA 2Q8RE 3MHBA 2BS2B 2CW0C 3L9AX 2HTME 3NP8A 1ZXIA 3D4RA 2WLBA 1ZYRD 3NTKA 1FXAA 1SYEA 3JAME 1I6HB 2K04A 2PNRC 1RWSA 1MHHE 2EYJA 1G91A 1J7CA 3TDQA 2G1EA 3T3OA 3TZDA 2NVTB 2WP9B 1FD6A 1R4QB 3DXJC 1RKNA 1ILQA 3IFDA 4MN3A 1NAPA 4QIWB 4A3FB 1SE3A 1DXMA 1ZEQX 3OWFA 5IODA 4IURA 3LWEA 2K5DA 4H7BA 4NP5A 3MJ5A 1N61A 1S5ED 3NRZA 2XVSA 3BK2A 3E6ZX 3HEJA 4CHTB 4A93B 5I2YA 2AWOA 4ZQ3A 2W82A 4Q5VA 2EVBA 3KBXA 2EYHA 1KABA 2F0EA 2LHDA 3T53B 2J0TD 5FO8B 1UUPA 3O13A 3H6MA 3P4PB 2JXTA 2N9LA 4GLSC 1LABA 1SYGA 4EQPA 2PVOD 1K8OA 1CK1A 4X3KA 5CBAE 2NBFA 1UWXA 3BVZA 1II3A 1B9NA 2E2IB 2PMZB 4ABNA 4N9TA 3PO3B 2W55A 5I6WA 2XNAC 3RMHA 3AE2B 3NVVA 5EKIA 1AWDA 1XWEA 3AE7B 2F0OA 3T13A 5CV4A 5C3XA 1P7FA 3LNNA 1BCPF 3BZDB 3F2UA 3M4OB 3OHXC 1H9SB 3DMUA 4HSPA 5G5GA 1VMPA 3R93A 1XCQL 3AE6B 3SK4A 3SEBA 1UEAB 1GOZA 3TP5A 4IUPA 1JALA 2A6ED 4AYBB 4YSZB 2YU9B 1C4QA 2PO4A 3VYTA 2B2YA 1FM0D 1EY8A 3MFYA 5HFYA 3EUB2 2XN9C 3H8HA 2ZXOA 4DK1A 2DNCA 1OQRA 5FLXL 1ENAA 4EQOA 5LL6X 4LJZC 3AV8A 4RKLA 1BQQT 1WTVA 2BBCA 2PVGC 1DOMA 2ICIA 3IXSA 1OXVA 3AE4B 3NWSA 4WRDA 1SYBA 4P6VF 2SOBA 4DAYA 2FINB 4JWSC 2VXWA 4FO2A 1PZJD 4K8IA 4OIJA 2SAKA 1PFMA 4HRSA 4ITKA 4ZAIA 2YEPB 4LAAA 4B9XA 3FDTA 4RHRA 1BO0A 1PGXA 4C7ZA 1K8MA 1IYVA 2L1BA 1G6ZA 1F2RC 2LMCA 3A7AB 2F0NA 4HMJA 2EZVA 1S5FD 4DFAA 4S3SA 2VNUD 2HUGA 1NENB 2PW5A 5D14A 3HOZB 2NUCA 2MHVA 4ODGA 3IAM1 3LX0A 1HFGA 2YYZA 1L4ZB 3PZ7A 1AP0A 1DOIA 1DOKA 4KKJA 2DN8A 1JE4A 3NUCA 2VB2X 1GHJA 2BS4B 4FXGC 2K6AA 2R92B 4LLGM 5E4XA 1WYGA 2WKDA 3GTJB 1T3QA 3ABVB 4WWMA 4B0EA 3H09A 2EYFA 4JK1C 1H9RA 2CW0D 1FFVA 4KGRA 4YSXB 1IGDA 1GUTA 3H3VC 2L52A 4JBWA 1JC7A 1LT6D 1QILA 2B2WA 4KV6A 2RDHA 3I3CA 3HS0C 2NVQB 4MH8A 4C56C 5C2TB 4XWWA 1QCBD 1STEA 1HPCA 4WAFA 2M2LA 1ENCA 3AEGB 4L1BA 3OWEB 2RA4A 2JYTA 4ZLTF 2F3WA 2EYPA 3DWMA 1SAPA 2K32A 2WP8J 4WIPA 1RHPA 2IJ0A 2F0TA 3QOLA 4A55A 4X3SA 5AUKA 2A73B 2N88A 4DNTB 2QSDA 3HOYB 1Z47A 2EJGC 1DZ1A 1LTBD 3TEZA 1CM9A 1FIQA 3RFZB 2A74C 4C80A 1SJED 1OO9B 5HI1A 4OZCA 1GUGA 3FC4A 4C3HB 1KF6B 2WDQB 1I6VC 2JSVX 3SFEB 5C3EB 2WDRB 1STBA 3PUYA 4H44C 2W54A 2I07B 1QKZA 2M0AA 3J7YW 4PMWA 2L32A 3V2TA 2D2CC 4MACA 2AUKA 1SDFA 1TZOA 3KBGA 5M5WB 2F0UA 2MPMA 4G7HC 1Y8NB 2EYMA 2WDVB 3OPOA 2ONQA 3W5VB 2CJNA 3AE1B 1T5EA 1Q12A 2A68C 2RDGA 1H9JA 4HKZE 1I50B 3ERQA 1E2ZA 2BYTA 2GI9A 2K28A 1QNUA 3A8IE 3A55A 5J39A 3RZDB 3UI2A 2IPKD 1C77A 1V8CA 4RA8A 1EWCA 3S17B 1FMAD 2N55A 2AQ2B 2E75C 4FF4A 1V1OA 1WD1A 5EBDA 3AE3B 4CBVA 1LT3D 1L6VA 3P4SB 3DM1A 1K53A 2IT1A 3GTLB 2RVLA 5H92C 2KEDA 3I4LA 4HN7A 3MXNA 4IOIE 3SE0A 4A3EB 2QCPX 2X6LA 3VYUA 3D6WA 4US9A 4XDCA 1V1PA 4HEDA 4XTCS 2K5PA 2WXRA 2F4IA 4IUNA 1DD2A 3QG1A 1QJOA 1CHPD 2C5CA 3D8GA 5C44B 2IGDA 1D1KA 3RZOB 2WXGA 2DY7A 1XLQA 2RSNA 2WINB 1GPXA 3P4RB 5M5YB 5EPKA 3GV3A 1STNA 1DYQA 4JX1C 5IGCA 1SJHD 1FFUA 1EWHA 2NTTA 2Y0SB 1B9MA 1SE2A 1Q10A 4TSSA 1O78A 1Y1VB 1A3UA 4ARIA 4KN4C 3TBIB 5M3MB 2BCOA 3I72A 1FCLA 2RMMA 2GA4B 1SSNA 1D1IA 1G2SA 1TWCB 3NQTA 1EEFD 3BVGA 5FK9C 4US8A 5M9OA 2QILA 2IGHA 1XXGA 2B2TC 3GTGB 1DM0B 3D3RA 4ZOHC 4X3UA 3N6RA 1EU3A 4G7ZC 1FO4A 3KWVA 4OIKA 5TSSA 4FXKC 1PLFA 3MXUA 4WJWA 1JWUD 2YEPF 2PLPA 5K5PA 4ZUJA 3AECB 4I65A 4QMGA 3SK6A 2FHTA 1J7BA 2MJEA 1I4RA 5A2QE 2J53A 3Q24A 2B2VC 3BG3A 2OEDA 1VDVA 2N9KA 2CJOA 3MWYW 1QOFA 3S2HB 4M8AA 4ILWA 3AEBB 3DWGC 2MJDA 1I7HA 4IUUA 1RTOA 2B8GA 4P2CB 2DWQA 4A9AA 3B2FA 1YMHE 2K1BA 2WAQB 5KYLA 1BOSA 2BS3B 1S4ZA 3MAQA 1D5XC 1PZKD 5G5HA 2RKSA 2X38A 1NI3A 5T1IA 1VZ6A 2L9HA 3U9SA 4K2LA 2HDMA 1S5DD 3BIID 3C1FA 2IWHA 2F03A 4RF0A 4Z9CB 1JWAD 2CVRA 2OF1A 3A56A 3AMZA 4RF1A 3GD7A 4DGZA 5E6JA 1EZ6A 1ILPA 1O7ZA 4XYOA 1L0VB 1BCPC 2ACZB 3K5LA 4CJ1B 2F0PA 3L3OC 1EL0A 1TYGB 2WU5B 4IALA 3BS1A 3EGRA 2JA6B 2INPE 1QNKA 5EPLA 5IIFA 1C8CA 1WTWA 2WU2B 3OIPA 3U52E 1JWMD 5G3LD 3Q8FA 1DONA 3B9JA 4OL7A 5ISRA 2EOTA 1B44D 2EJMA 2PW7A 1EYDA 3CHBD 1LT4D 5M3FB 4A3DB 2EKIA 2LFNA 2SEBD 4KX6B 2M9VA 1MBYA 4ZRZA 4K6LA 1C4PA 2WXIA 2KVMA 4V0BA 4N59A 1L0XB 2XIWA 1BXTA 1YN3A 2H89B 2KDMA 2JYOA 4RWSC 4C3JG 1Q1EA 3D6CA 4MIUA 1GB1A 2A68D 3J81L 1I4GA 3BVMA 2HDEA 4LTUA 2XRQD 5JPNC 3ITPA 3WCQA 1OXUA 1C4CA 1SNCA 1WGKA 4KGTA 1STGA 1R4PB 4HR7B 2V0GA 2LJIA 2V4IB 1ZDXA 1EY6A 1STHA 2IX1A 1JOOA 1HCZA 4XXEA 1HUNA 1FR3A 5BYQA 2L5TA 3NUHB 1WXQA 2W3SA 4UAIA 3J80E 1ENFA 2HCCA 1YQ4B 1YN5A 4KMUC 4YSYB 3NTHA 3SHLA 5CBEE 1TS3A 1LTGD 5I9PA 3S2DB 5DAUA 1V8QA 3Q0AA 1JR0D 1W6JA 2WXKA 4Q2JA 5NUCA 4YTPB 1TKYA 1SIJA 1D5MC 3KWLA 3AB9A 1WTPA 1M8AA 2WACA 2VZKB 3BDLA 3K6OA 5C0XG 1GUSA 1V43A 2WKCA 5EGTA 2V3PA