4RCOA

1.9 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
192
Chain Sequence
NPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9 Angstrom Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus, in Complex with Sialyl-LewisX.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Putative uncharacterized protein
total genus 51
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rcoA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rcoA01
1I4XA 1SE3A 1LO5D 1XXGA 1RD9D 3DWPA 3R2IA 1I4GA 1SEBD 3BZDB 1SBBB 1EEFD 5FKAC 1LTID 1LTRD 2XNAC 3DWQA 1LTBD 1I4HA 1D6EC 1ET9A 3TSSA 3BVMA 3URYA 1KLUD 1PTOC 3BYYB 1KTKA 1PRTD 5D3DA 2G9HD 1TS2A 2RDGA 1RDPD 2NTSA 4OHJA 2TSSA 1JQYD 1LTSD 2SEBD 4BWGB 2AQ2B 4RGMA 1RCVD 1V1PB 3BVZA 1JWUD 1SE2A 2RDHA 3MC0B 2ICIA 1HA5A 1TS4A 2QILA 1D5MC 1HXYD 1RF2D 1YN5A 3KLSX 2XRSD 1FD7D 1L0YB 1S5DD 2WV6D 2AQ3B 1PZJD 1FNVA 1I4RA 1LTTD 1HQRD 3GP7A 3BYTB 1BCPD 1JWSD 1PZID 1DJRD 1QILA 3OWEB 1G8ZD 4TSSA 2IPKD 2J4XA 1YN4A 1EU3A 4L63B 1S5CD 3EFXD 3W2DA 1BCPB 1PRTC 1TY2A 1PTOB 1PTOD 2QEJC 1I4QA 1LT4D 1CHQD 1SXTA 2R61A 4RGTA 1L0XB 3BVGA 1EFID 1PZKD 1CT1D 4UDUC 2XRQD 4RHSA 1LT5D 4RGNA 1MD2D 1SJED 1LT3D 1D5XC 1XTCD 1LTGD 2NTTA 3R2TA 1PTOH 1AW7A 1V1PA 1B44D 1PTOF 1FGBD 1JWMD 1FNWA 1UUPA 1YN3A 1BCPF 1STEA 1PRTB 1SJHD 1D5ZC 1EEID 1HTLD 1JCKB 1S5FD 4RCOA 4ZYSA 2O2LD 3EA6A 1SE4A 4RGOS 5TSSA 1JR0D 3V05A 4RH6A 5ELDA 1ESFA 1LLRD 1TS3A 1TY0A 1GOZA 4RHRA 1PYWD 1S5ED 1DYQA 1EU4A 1CHPD 1ENFA 4C56C 3R8BA 4O1NA 3O13A 1M4VA 4DXFA 1F77A 2XN9C 1FNUA 1TS5A 1V1OA 4DXGA 1LTAD 5ELCA 1BXTA 1UNSA 2Z8LA 5D3IB 2CHBD 1ET6A 1T5XD 5FK9C 4L6TB 1PRTF 1EWCA 1KLGD 5ELEA 1CK1A 1B1ZA 2IJ0A 5ELBA 1AN8A 3DWAA 1I4PA 1BCPC 5I4DA 1CQVA 4K6LA 2AQ1B 5ELFA 1LT6D 1S5BD 3MFGA 4RFBA 3CHBD 4Z9CB 3SEBA 4NZLB
chains in the Genus database with same CATH superfamily
1RKNA 1E22A 4G7ZC 1NE3A 5IYBH 4A3IH 4US9A 2PIAA 1I4GA 4TQUS 1ZPSA 2MP2B 4C00A 2Q8TA 2MPMA 2D3CA 4XE0A 1BO0A 1I94Q 1QG7A 3TP7A 3DWQA 3PTFC 2DYOA 4HCPB 2N9PC 3KQ4A 3URYA 4L5SA 4OO1H 1YMHE 2QDFA 3RR5A 1QOFA 3RT3B 1VZ6A 4B9WA 4GB9A 3NBHA 1JMCA 1VF7A 2GBMA 4TQ1A 2SEBD 2N88A 3W5OA 2KX0A 5G3LF 4MM3B 1FD6A 3BJUA 3T1YL 4WJQA 3C1FA 2EPBA 1VQMA 1V1PB 2K05A 3HOWH 1SSNA 1C9FA 2RDHA 3ZQ4A 2YTYA 1J0GA 3EJIA 3PZ8A 5DLQE 3M4QA 3T53B 1RHPA 3TBLD 4BY1B 1MBYA 4P2CB 4BBSG 1O78A 1AZPA 2MH7A 4ZRQA 4IUQA 2AKWB 4OVVA 2J52A 3UE1A 4KIKA 3OW2A 3MXPA 2MRPA 2PTLA 1WTVA 5M5XH 3HM3A 2QCPX 5I2YA 4LF9L 1TWAH 4A3EB 3M85A 1QNKA 1XMOQ 3AE6B 4ARIA 3PSIA 4X65L 2K25A 2FCSA 2K5PA 4RF0A 4TRDA 2AYOB 3VRAB 2P5ZX 2L0FA 1T0QC 3T3NA 1YNJC 2WDTB 4FF4A 2WU2B 3DVGX 1Q90A 4GDKA 3K5NA 1IGDA 1UBQA 2CCZA 5D6JB 3P4QB 1KL9A 1C0AA 2EYLA 4RHSA 1MJCA 2RSNA 3V61A 1VQLA 1M90C 1QOHA 2LXJA 2RCFA 1VDVA 4DR4L 3AEAB 2A68D 1B44D 3ONAB 3BS1A 2IL8A 3PV0A 1BCPF 2LEKA 3P1MA 4DV1Q 4LF5L 1PFDA 2MUYA 3EROA 4NAWB 4C7YA 4JVZA 2K5QA 4GDLA 3DBRB 4NJ7A 3MXNA 4DUYL 3BK1A 2A6HD 4LK0M 2QDBA 1PXUA 4JI6Q 2B76B 3M62B 1GG3A 4ULLA 2CKHB 3L17A 1EU4A 1X54A 4A4IA 2V3NA 3JW0X 2WP8J 1S72A 1E7ZA 2EMSA 2JXMB 4KY5A 2VUMB 3L08A 4IWOA 3G71A 1D1KA 2V4LA 2WXHA 3KWVA 2YV5A 4ZLTF 1WXVA 4YSZB 1C7YA 2ON8A 4NKLA 1O7IA 2OEDA 1BT0A 2WAQG 2KQ4X 4GLVB 3DM3A 4IUVA 1MVKA 5IAAC 5C4HA 5BO4B 1GHJA 1HNZL 3A5UA 3QR8A 4KHVA 2ZTEA 1N62A 3CC7A 3EQLC 5EQ0A 4JI1L 3W1SA 4DAPA 3A54A 3STBC 4G0NB 3I4NB 2WDRB 4MSMB 4DR1Q 1NR4A 3ABVB 2GBKA 4JI4Q 4JYAQ 1NMFA 1ACCA 3C19A 1XNRQ 2VQEQ 3WWVA 5AZFA 4XQQA 1JE4A 4UAIA 1J7AA 2V9HA 3L16A 3FKIB 4LFCQ 1ZYRC 2I5LX 4R4CA 2BS3B 3S16B 2NVYB 1BUIC 2MQJA 3HIZA 2AWNA 5LLIA 3VTWA 3W5VB 2V4IB 4WH4A 1I50H 1EEFD 5FKAC 2L52A 2LXKA 4TVAB 4NPSA 4R4OA 1ET9A 5TR5A 3IAS1 3H94A 2YTVA 3BVMA 3NUCA 3GTJH 2L05A 3KJOA 2M4NA 2F0PA 2QJLA 3ZJTA 1E7UA 2RDGA 4MEMA 4HJAA 2HE7A 4R1JA 1WGDA 2JA8H 1TYGB 2KNBA 1FIQA 2G9DA 4URKA 4MACA 4OZCA 3BDOA 2UUCL 3U2SC 4CDDC 4DV0L 3GZNI 4NJ6A 5C3WA 2QCZA 4FA6A 5I2XA 2JXTA 3RZOB 4OO1I 1ICFB 4I7ZC 3N30A 1EF5A 4YCWA 3DWMA 3VYSA 1V97A 4DR2Q 1SYFA 2MSED 4WJOA 3V62A 2MJDA 1PZJD 3HG9A 5C4ZA 3ZNHB 4M00A 2OXPA 5C5MA 3SHLA 5IGGA 3PMFA 2RA4A 1C1YB 3E3XA 3CU7A 4JI8Q 1J7CA 1F2ZA 1HZ5A 1K83B 2KXJA 1K53A 3OWEB 3F2DA 1C76A 2J4XA 4P72A 2H88B 3AH7A 2VB2X 3H6MA 1B8AA 5IKCM 1KDAA 2EYJA 4HIOA 1HZBA 4K5XA 3J80c 4LF9Q 2QEJC 5CGKA 2R93G 2BQQA 3V6EB 4YY3Q 2XVSA 1HPCA 2WX1A 3A9JB 3OAWA 5DM73 2BWES 4JK1C 2DGYA 3N9YC 1KOTA 1V8CA 1P7FA 1F2MA 2A68C 2GI9A 5FR3A 2UU9Q 3H7PB 5D2MB 1Y8RC 1YJIA 1WX9A 4C7ZA 1SJED 4YT0B 2DY7A 1YNND 3P20A 2ZW1A 1NJIC 3UQAA 2EE1A 3KUDB 2DAJA 4I65A 1SR3A 3GQBA 4X3KA 4ACFA 2WKDA 1XMQL 1YN3A 2PEAA 5HHDG 4N8X1 2KJHB 1EY9A 3S2HB 3ER0A 5LL6S 3TP6A 1KDCA 1LTLA 1WZ3A 2ZNVC 3TQYA 2ZNVB 4LDTB 2R2OA 1Y14B 2K03A 2GVAA 4NXNL 1YHQA 3CCQA 1SIFA 1TS3A 4RHRA 3TS0A 3UE0A 1SYEA 3JAME 3FKIH 4KJOA 4JI2L 4EGVA 3I90A 4L5RC 1I6HB 2JA5G 1OEYA 1YQ3B 2N4FA 2YVCA 3P2BA 4Q2JA 4PS8A 1PGAA 2B29A 5J17A 1A8VA 4GLXA 1I3QH 1NTGA 2N55A 3K8AA 3H0GB 3M4OB 3TEZA 3T3OA 2I2YA 2R93H 3QAQA 3VR3A 2QIEB 1VJKA 2MBHA 4NJCA 2Z8LA 2ACZB 1SNOA 4DDGD 2INDC 5HFYA 1KLGD 2ZEQA 4XIGS 2D2QA 1S4ZA 2ZCCA 3N1XC 2O2VB 4HCEA 4DGZA 2IO1B 3AB5A 3VYUA 2F0FA 4DN4M 1BCPC 4HIKA 1EIHA 3BY4B 3KH0A 4NDXA 4W9DA 3AM9A 3QG1A 4WJWA 1EUVB 3I55A 2NBWB 1IL8A 3RLOA 2YYZA 1EZ8A 4WFN3 1N34L 4W9KA 4JI7Q 4G7OC 2JA7G 1PQSA 1WOCA 2DN8A 3KBGA 2VH1A 4I6NB 4HN7A 4JG2A 4LJPB 3S17H 5IT9L 1MG8A 3OWFA 2PW5A 4N9TA 1MHXA 3NBHB 3KUPA 2HQEA 1SBBB 2PZWA 3K57A 3ZNGC 2JXXA 1VQ9A 2L8JA 2XNAC 1R4MI 3E9IA 2O4XA 1IBKQ 2LXAA 5C3EH 1I4HA 3SK5A 1OGWA 2JVCA 5E3FA 1Z9FA 1E2WA 2QC8A 3FILB 5EKIA 1PRTD 2J53A 5E6JA 1F2RC 4BBNF 3LJ3A 3N52A 2NVQH 2G4DB 3AECB 2MLBA 4FXDA 2BKRB 2O2VA 2ZJRA 1FMAD 2EJMA 1HNXQ 1NYRA 1RTOA 2ENBA 1HZAA 2K5WA 2KMMA 1QOGA 4DWFA 4DAMA 4DK0A 1YN5A 2UXBL 3P4SB 4JI8L 1M8AA 2WV6D 3TREA 1IW7D 2M0AA 1AE3A 4JV5Q 3CQZB 4IOCA 1UEBA 1PLFA 2OJWA 1TWCB 3RYTA 1X56A 2RBMA 3AE9B 3GP7A 4HEA1 5E6PA 1H9SA 2LFIA 2IY5B 2UYZB 3KLSA 1G8ZD 1RJTA 2JA6G 4FXCA 1O7LA 5BR8L 4A8XC 1JRUA 2K0PA 2XBBC 1WTRA 2CWPA 1X32A 5KYIA 2EKEC 3KF8B 2UUAL 2JN4A 4MTKA 1FR3A 1KRHA 3K0YA 2RR9A 4QF4A 3HKZE 2A4ZA 1XNQL 2YU9B 3ECIA 3TCAA 5C0XG 4FP5D 1G2SA 3U8ZA 1X3EA 1K52A 1A63A 4QJFA 5C3JB 4A3BG 3GZNB 3A8JE 2NS5A 1LT3D 2IO2B 4OIJA 4JC0A 1CI3M 2NTTA 4JBKA 3DVGY 1NENB 2HUGA 4YWGG 3RUIB 2L55A 3BG3A 5K5PA 2JA7H 1QZEA 3NZUA 2NVQB 1GUOA 2X6LA 1G6ZA 4NAMA 3AE7B 1VQ7A 2BTEA 1HTLD 4JBJA 1L1OA 3HKSA 1SB3C 4CBVA 5A2QL 2JJQA 1NYQA 1P9DU 1WGKA 2JPHA 3GE8C 4K8JA 4BBSB 5KNCA 1EOVA 1PDXA 1X3GA 2A5HA 1VCIA 4OGQC 2BB5A 1XLNA 3S15H 4A20A 5CV5A 1V6EA 4O1NA 5JJIA 5M5YH 5FR6A 3O13A 3D4RA 1WD0A 2C9WB 1UWMA 1DOKA 4FULA 3BDCA 2EOTA 3HOWG 4P1CC 4B95A 4F7ZA 4A3DB 1TZ1A 1FO4A 2K8CA 4B6WA 1ICWA 2UUBQ 1J5EQ 4DR5Q 1H95A 1NMGA 2LXCA 4FHJA 1UE1A 2WACA 2IY1B 3QA8A 4YHHQ 4I6LB 4EKUA 4YL8A 3TDQA 3ZNID 5JJLA 1WGGA 4QB4A 4HJ5A 2KMAA 1WSPA 3SEBA 2E2HB 3GTQH 1RWSA 1E24A 1ESRA 1EIYB 2Z6KA 1RFAA 3PRPB 2HD3A 1LO5D 3MXUA 2E76C 3S1RB 4A3LH 3NOBA 4DR7Q 4ZUJA 2NVTH 2RKSA 3KW5B 1ENCA 4BOSC 2EDGA 1K0RA 4PYUA 3CP0A 2FCQA 3GTGH 3UDXA 3RLFA 3WOFA 4KV6A 4ODGA 4PG3A 1PTOC 2DHZA 4HJ9A 1KTKA 2RD0A 4PT5A 4LF6L 3IAYA 3VR6A 3S2DB 1X3PA 4IJLA 1JQYD 4HJ8A 2V3SA 4TUUA 5CYUA 1ILQA 3P75A 2KLGA 2PPHA 3H8HA 4DR5L 4GXBA 4W9LA 1X9NA 2CW0C 1V80A 1CM9A 1E90A 3D0FA 1KC8C 5IT9E 1RF2D 1XPUA 2F0JA 1AFPA 2EIFA 4KY7A 4QQBX 1S5DD 5EBDA 1I6VC 1VQ4A 2AEHA 2N9LA 4X62Q 1S40A 1EY4A 1LTTD 1HQRD 3LGJA 1ONLA 4EQ5A 4ITKA 1FCCC 5GADC 1PZID 4GLSC 4AQYL 2SDFA 2WXQA 4CO7A 2WXIA 4OWXB 3AEEB 3WANA 1BF4A 2BYFA 1K83H 3S2AA 1HTQA 1IZ6A 1Q82C 3PO3H 3CW2C 4A3FB 4A3LG 4LF4L 5I9PA 2HD5B 2D0PA 3B2GA 5JEAJ 3TP5A 2CVRA 4JI0L 1VRAB 2IHFA 1VQBA 5BMHA 3NY5A 3VYRA 1L2FA 4AS1A 1KAAA 1ZYRD 2B3AA 4RGNA 5HG2A 1RTNA 3CC2A 2EYMA 3U4VA 3U9OA 3R2TA 1FJGL 4CQNA 1XNRL 2JA8B 3NPPA 2HTHA 1IHZA 1V1QA 3L4PA 3T4AC 3GTKH 2K5VA 3PO2G 3CF5A 3NJTA 1STEA 3WDNA 3D8GA 1S1QB 3A0JA 2DY8A 3EFCA 2F0HA 1S5FD 1A70A 2NN6I 1Y1VG 4RGOS 3H1UA 2PPBC 1WRIA 3GB1A 1XLQA 4L1BA 4DHZB 1WRDB 1TY0A 1KDBA 3WA0A 2WP9B 2B2UA 4FVMA 5T8IA 3CSTA 2F0VA 2PKOA 2K75A 4ZQ3A 4RM8A 2LMCB 2FHTA 2R3ZA 1B9NA 1HNWL 2BA1A 2KFJA 1U4AA 3GTKB 4K1RB 3UINB 3VTUA 3I7FA 4HDQA 1C79A 1DD2A 1XYIA 4B0MA 1M4VA 3RNBC 1BR9A 3OOCA 5KGUA 2M2LA 2F4VQ 4HSVA 4KHPQ 1KNAA 2YLMA 5FLMG 1GUNA 1U0LA 1EZ6A 4HIDA 3PF4A 1Y8PB 1EWCA 1RIPA 4EQOA 1OTCA 2UUBL 1E7PB 5ELBA 3STBD 4HIMA 5I4DA 3Q23A 3PLUA 4K6LA 1JWBD 3ULJA 4LCDE 2KFKB 2L0CA 3TEYA 4Y7NB 3VR2A 4EX5A 1ZDVA 3HOZB 1C4AA 1SE3A 1VQIA 1VS0A 3HGBA 3RD4A 2AUJD 3LXFA 4X6AH 1SEBD 1FFVA 4KHZA 1Y8NB 3GTPH 2N7JA 3P4PB 2G1EA 2I5MX 2GVBA 5E1FA 1QE6A 3CCVA 2JA9A 1D6EC 3AMUA 2EYHA 3QB3A 3TSSA 2JQOA 4HR7B 3T1HL 2RPQA 4LNKA 3I73A 5AJ3Q 4LTUA 3VR8B 4HDOA 1R7SA 5C4XB 3RULA 3SE0A 1R4MB 4NW2A 2PNHA 1CTMA 1LTSD 5CMDA 2UXDL 2RDBC 1TQOA 3NRZA 3NHEB 4ICVA 5G5HA 1KAWA 2AQ2B 3HFZB 4RGMA 4BA1I 5J18A 1OXVA 3V3XA 4L8JA 2JA5B 4YWMA 1TWFB 1AWDA 1KH0A 1XNQQ 4DQOC 4G4KA 4E71A 4OZAA 2JSOA 1JICA 3CXCA 1KJTA 1AARA 1WY8A 3S14B 2KVZA 5IP4D 4HRSA 4DNTB 2EXZA 3N3KB 3Q69A 1NR2A 2WIIB 3I4OA 2GBJA 4DAVA 4DUYQ 1YNJD 5FO8B 3M63B 3AV8A 4RM9A 2OQKA 1PFMA 3PS6A 1V9PA 4XQNA 1I5FA 2FIFA 2VZAA 2Q5WD 4M8MA 4HKQA 1J8CA 2OEOA 2NN6G 1CHQD 3X3NA 3PRMB 3T1HQ 1OXUA 3PHWB 2UWQA 1YNXA 4JIOU 3RN9C 4IOAA 4P16A 1B3QA 3BVGA 4HMIA 3ALBA 1Y8OB 5CV7A 1T0YA 3DCGA 4KN7C 1IUEA 4YSYB 5EPJA 3K5LA 1WGYA 4HJGE 2XK5B 1VQ5A 2KTRB 1A2UA 4PS7A 2Q8IB 1NY4A 4RA8A 2K28A 4C3JB 2LZ6A 4DBGA 5M5YB 3OYYA 2ZJQA 4W9IA 4UP9A 3SR1A 2UU9L 4LF8L 2B8GA 4L23A 4N9PA 1HFNA 4GNXB 1A6XA 2HT1A 3RI7C 3ZXRA 5EJWA 2HJ1A 4K81A 2KCMA 1HZ9A 1D1IA 4F8MA 3J81i 1YI2A 1T0RC 4YHHL 4GGQA 3RNAC 3CMEA 3W1SC 1CMXB 1ESFA 1Y1WB 4PZ7A 2KEEA 3I56A 2N7DA 1PYWD 3VQIA 1H9KA 1EF1A 1JB7A 1CJEA 2FCNA 5IO9A 4B3RL 2DZIA 2FJ2A 4ZAIA 3ITPA 3LB8C 3Q6SA 3N20C 4XDDA 5JVH3 1HNWQ 3ZDTA 1HQMC 1R4QB 2PQAB 3Q3OC 5JOBA 2W3SA 4BBRG 4DV5L 1MGSA 4MSQB 4B9KA 4JBWA 4US8A 5L95C 1UAPA 3SR6A 2FCMA 3UDIA 4ZK9B 5KRUA 3K9PB 2DX5B 4POFA 1CQVA 2NVYH 2RCNA 3I4MG 3HHMA 2BE5D 4AIMA 4PZ8A 5CV6A 4K3CA 3CHBD 1G2TA 3PIP3 2FNJB 3CMMB 4A3GH 1DZ1A 4NZLB 5DPSA 1F2YA 4KD4A 4DKAC 3DEPA 3J80L 3I57A 1HHVA 2DLBA 3BZDB 2CHXA 4F1SA 2MJ8A 5CV9A 2KANA 3CQZH 4PS3A 3R3MA 2CH4A 1GD7A 2CQAA 4L5QA 1K8MA 4Y52H 2QGQA 2UU7A 2K9XA 4IM0A 4GN1A 3G4SA 1RM6C 4BY7G 3RCZA 4IM3A 1RDPD 3CSFA 5AZHA 2KX3A 4NMZA 5IWAQ 1H9JA 1IBKL 2KDFB 2K6QA 2WGSA 3B0AA 3H0GG 1WZ0A 3ZRFA 4LF7L 2FBWB 2L83A 4X3TA 2OTJA 2PMZE 2KLCA 3ZJVA 4DU9A 2WQYB 3BVZA 5M3MG 3MC0B 4MZ9A 3RNGC 1SIJA 1TS4A 2WWZA 3AU5A 2DNCA 4O2DA 1PH8A 2KACA 3KLSX 1U9RA 5GROA 1WYDA 2LASA 3E9HA 1PGXA 2MBOA 4P74A 3QOJA 3NELA 1K3RA 3DQVA 2M0XA 4DAYB 1JJ2A 3KDFB 1C48A 2KVMA 5BMGA 4DV3Q 2K8BA 1BCPD 2Y5PA 3ZVVA 3CAMA 4TQ0A 4HWIB 3GDEA 1VQNA 3KWLA 3MVVA 3OTOQ 1BOSA 4IPHA 1WCMB 5IGFA 1EU3A 1KHIA 3FHWA 1V2YA 2WDVB 4ZOHC 3W2DA 2KT7A 4DV0Q 4AJYB 2OJRA 2MP1A 1LABA 3DBSA 2D5GA 1J5EL 2F0UA 4A3JH 5IA7A 1LV9A 4Q5VA 3ULPA 1EFID 2VL6A 3F2UA 4PMCA 5IYCH 3TUOA 1LQBA 1TJEA 2R92B 2PMZB 5J22A 4DR4Q 1X55A 2F52A 3K81C 2MO1A 1D5XC 3OJ4B 1W6JA 2NVTB 2MP2A 2FINB 5CORA 4JI7L 1P0RA 2R2QA 3DVNU 4A3CH 1OQQA 4P1BC 1EM7A 1EQQA 1N9WA 1RRBA 1PGBA 4ANVA 5IOIA 2ZT9C 1SJHD 4LFAL 4ZHPA 1CSQA 1EQVA 4BZAA 1T3QA 1JCKB 3EA6A 4DHJD 3U4ZA 4CJ1B 4LNOA 5G55A 5TSSA 5EE1A 5C44B 3V05A 2W54A 4AQYQ 1DGSA 2VS1A 4BY1H 1NVID 2LVQA 5C6AA 4GNXC 1UGMA 1VZ7A 3DDCB 4WQMA 3T16A 2F0NA 1DYQA 4E3CA 4K2KA 3WAPA 1LACA 2QEXA 1SYBA 4D2KA 4C56C 2EY2A 2E2DC 1WXAA 4BFRA 4GZYC 3A56A 1M1KC 3DOWA 2V1CC 5CBEE 2Z1CA 4DPGA 3PUVA 5M3MH 3W9CB 5EKKA 2JZPA 3HOXG 4DXGA 5J1ZA 4KSLC 4LNIA 3DEOA 1VQPA 2W82A 3J81j 4JI1Q 1OTRB 3L0WB 3QCAA 5E4WC 1GPXA 4YSXB 4IW0A 1EWIA 2MHVA 3HOUH 4GNXA 4BBSH 5H92C 3AEDB 3PQIA 2X8XX 2O6VA 4IFDG 5IN7A 2EYPA 2IJ0A 1S3SG 5DEHA 5IE8A 3AI5A 1FXIA 2MBBB 2KOXA 4HEDA 4MTNA 2EMTA 4JPBW 2IBIB 3E56A 1Q46A 3IKJA 4LK1C 1PH1A 3A1QB 3I9V1 4JE3B 4JV5L 1KRSA 4JI5L 3ZYYX 4DXAB 1IP9A 4LFAQ 1UE7A 2PVOD 4MH8A 1V43A 4V190 2HTME 3MXGA 1GNUA 2Q8RE 4WIPA 1RD9D 4A76A 1QLBB 1TWHH 1I42A 3HOYH 1MG4A 3A8KE 1MI2A 3AEGB 3MA2B 2KCTA 1FXTB 3KYHC 2LHEA 2B2TA 4JWSC 2R7ZH 2XSCA 1QCBD 1XJVA 2GA4B 1Y56A 2WXRA 2F0SA 4M01A 1VQJA 1YITA 3VTVA 2MGSA 3K7UC 2WHIA 4GMVA 1UE5A 2ZM6L 1P1AA 4J1MA 3KK7A 3AULA 4BWGB 3CIRB 2WFWA 2BDNA 2NPTB 2MW5A 1GM5A 4C3HH 1QWYA 1YHBA 4KIKB 1W6KA 3RZDH 1TGZB 2JF5A 5M9OA 1J9OA 2PCFB 1JORA 1ZE3D 2XRSD 4I7AA 3LNNA 5LL6X 1RODA 2KWDA 2OTLA 3WOEA 4IUTA 3HK0A 3NVZA 3Q8FA 5C44H 1K8GA 4DR6L 4GLAC 4IFDH 1HTPA 2UXCL 1KM7A 5CR3A 2HDLA 2L11A 2XGTA 1WXQA 4DNIA 2KD0A 2N9EB 3WAOA 2NWGA 4B3TQ 3S16H 2N78A 4WWMA 2B63H 3E9SA 1XEEA 3FPPA 2DAFA 4DR1L 4OXPA 1WGRA 3HOVG 1YN4A 2KDEB 4RWSC 4L63B 1S5CD 4DK5A 3W3AA 1EL0A 4WJNA 4FBJB 1PRTC 1WI5A 1TKYA 1TY2A 2NR2A 4GN4B 1EY0A 3HOXH 2MWSB 2K22A 3HOYG 1F1HA 1F9QA 5CHFA 1SXTA 5LNK1 5FLMH 2NB0A 2B8FA 2I0QA 1NSNS 3KFUA 1KQSA 2WXOA 2KENA 2PYKA 1RFKA 5E6NA 4XZ4A 1ZXTA 4LWCA 1IBXA 2B2WC 2AUKA 2Y0SE 1K51A 1WE6A 4C3HB 1U4PA 1XTCD 2LGSA 1R4NB 4X66L 1PTOH 4TKOB 4KJNA 3BDLA 1IYVA 4CGYB 4K0KL 1GUAB 2A6EC 2NVXB 2ZPNA 1NI2A 3FC4A 3UF8A 4WURA 1F9RA 4PYZA 3ZDMC 4Y7NH 4A3IG 3PV1A 4GOPB 2Q2UA 4H2AA 3A4RA 3QOLA 4RAUC 1JB3A 2IGGA 1A15A 3ZJYC 2R92G 2R7ZB 2O2LD 4CHKA 1EIFA 3K80C 1EUJA 4IFDI 3OJ3A 5HKHA 1STNA 3CRKC 2JSVX 2LY7A 4C2MB 2QKIC 2ZVOA 4RKLA 2IYDB 4MH0E 5AEKB 5CV8A 2MX2A 4ZKCB 5EE9A 2ASQA 3UIOB 4DV6L 1I3QB 4F88A 1JMLA 4K14A 3FEWX 3I3TB 1UBIA 3VRBB 2VUMG 4R8IA 5LMUL 4HJKA 4BS9A 1WWTA 4JW0A 3TEWA 1V1OA 2HCIA 2PE9A 1DCZA 2HJ8A 1ASYA 3NS1A 1N6ZA 3W1BA 2JYTA 4NB3A 3HOUB 3PPAA 2HDMA 4GOPA 5C44G 4BBNC 3CC4A 1V5TA 1B1ZA 2V4DA 3KF8A 5C23A 3AE8B 5LHY1 4MM3A 1PH4A 1WF9A 4CDFC 2JWZA 3BK2A 1XTDA 3P7JA 3S2HH 2AQ1B 3Q3MC 1WJUA 2NZOA 2IO3B 1X3FA 2KA7A 3PO2H 4A3PA 3KF6B 2DJGC 3MEHA 5C5LA 1YZ6A 4DHZE 2LGIA 3KVFB 3FVQA 4CKEA 1EYDA 3V96A 4II2B 4TKNA 4NNJB 1A3UA 1E8WA 4F87A 2CFMA 3PIPA 2F0OA 2KFKA 1K9MC 2NUCA 1DONA 3L13A 3T1YQ 1ISNA 2HDEA 1IBMQ 3W1GA 4H02A 1MHWC 2A8VA 2JEBI 1SMXA 2L12A 1YJNA 2CJNA 2KCNA 5E7NA 4EUTA 4ARCA 1BDOA 1SNCA 2EQSA 2M56B 1AH9A 4JL9A 2QW7A 1E6EB 4XWTA 4KGSA 2B2TC 4R3DA 1K8RB 3QIAA 2J0JA 2BYEA 1O80A 1MSHA 4B3MQ 4G50A 3CCRA 3ETRA 2QILA 2R92H 4A3KG 2LWPA 2M19A 4BAXA 1GO3E 5JEAG 1XQQA 4C2MH 1L0YB 3EIVA 3K59A 4ZRJA 1BBUA 1CZWA 1O7ZA 3RLNA 1FNVA 1I4RA 4G7HC 1NDDA 3PO3B 1LXDA 2CHZA 2ONQA 3RZOH 1OO9B 1XCTL 2IPKD 2LI5A 5DNFA 5GAEC 3VUWA 4EE2A 2JK8A 4KDLB 2KZRA 3KDFA 4IKGA 1LT4D 4ZRKA 1EO6A 5E4XA 2IZVB 2K1FA 1NEKB 3IT4B 3ZTDA 2AWOA 1EFWA 1Q1EA 2D9UA 1PZKD 2WKCA 1PYBA 2A1AA 1E8YA 3TJPA 1EQTA 2G4SA 4LJZC 3KYDD 3L54A 3GTGB 4HPLB 2LKVA 4X57B 4H13C 5AZGA 3GV3A 3I4MH 2MBEA 2XIWA 3BU2A 4RMFA 4MDKE 2BS2B 1FGBD 4FDBA 1UUPA 4MN3A 3S1MB 3HOVB 1F9JA 1FFUA 2GRIA 2F0KA 4A3KH 1UWVA 3R7RA 5C2TB 4HLEA 4JLCA 1U4MA 1SNPA 1A2TA 1T9HA 1GJXA 1C4CA 3OTOL 1QOBA 2LHDA 3HVZA 4XYCA 4GOPC 3AXCA 4XGAB 3JC66 1L2NA 1L4ZB 3Q8CA 2N8NA 1P98A 3U58A 1SYDA 1JALA 3R8BA 5EGTA 1HEZE 1BUVT 3NEMA 2ZW0A 4A3DH 2K04A 4DR3Q 3NWSA 4JI5Q 3VUXA 4QUFA 2KHIA 3NXWA 2LS01 5KNBA 5C4XG 4DXFA 1EY5A 1TS5A 4EQNA 3VA7A 3S15B 2AWTA 3SDZA 4K5WA 5JEAH 2PZTA 3VHTC 1Q81C 1PDQA 3SK4A 4OX9L 3C0RB 4JCVE 2B2VC 3MAQA 3AE2B 3IBEA 3IHPC 1DGJA 2LRUA 2F0TA 5JHAA 1X1MA 3C1EA 2CR5A 5C0XI 4IALA 2TMPA 4DV5Q 3RN5A 2JY6A 2KDIA 4XDCA 1WFYA 2CJOA 2RPVA 2JA6H 4DFAA 3TZDA 1MJDA 1TU2B 1CSPA 2ZJDA 2JA7B 1WCMG 1XXGA 2L7RA 1VQGA 3ERSX 1EY6A 3OMGA 2ZVNA 2NN6H 3K5MA 4K7UA 4BKGA 1WTHA 3F2BA 3C2PA 1NNXA 2BWFA 5D7GA 3VFKA 1SFOH 2JP1A 3JSVA 2D3BA 3FRPB 2KJRA 3RMKC 3NVVA 5D3DA 2F0DA 4GS3A 4DF7A 1L4DB 4IM2A 5IGBA 3VUYA 3JAML 2NTSA 4IURA 3CCJA 2J42A 5BN3A 4A3CG 5LMNQ 3EUB2 3TIXA 2KQSA 2M9VA 2GOWA 4UY8C 1DOYA 4C3JH 2F0IA 5IP7H 1JWUD 1Q3LA 1SE2A 1JJGA 1V49A 1XLOA 1CZPA 3V2TA 1HA5A 3X23A 1YEZA 2DNEA 1D5MC 1HXYD 1UE6A 1WTOA 1G91A 4OL7A 2LVPA 4FHKA 2L4NA 2R7DA 2E2IH 2EXDA 3RFZB 3QARA 3RUZA 2N1VA 4PZ6A 3Q8EA 3IFTA 1E1TA 1FL0A 4B3RQ 4YCUA 3BYTB 4GKJL 2W55A 2M17A 1MKHA 1GHKA 3WIMA 1JWSD 2WAQB 3PO2B 3Q3JA 1KRTA 1XF5L 4AJWA 4DV2Q 3QK0A 5CV4A 4X3UA 2NZ1D 4QUCA 5IT9c 1CKNB 1EIGA 1BCPB 5IGDA 1HZCA 4IO9A 1N33L 1Z6HA 2F4VL 1F2LA 3IG3A 3VDZA 4DV2L 2ALYB 5CBAE 3UDFA 4C3IB 4CJ0B 2FUG1 1IBML 1SNDA 1IYFA 3CCEA 4XXEA 4REZA 4DR2L 4IPDA 3DUZA 3K0XA 3Q2AC 1DOXA 3Q3NC 5IOCA 4LFBL 1SROA 2Z4HA 3EGRA 1XMQQ 2Y3AA 4G11A 5I6WA 1WXSA 1A0IA 4C80A 1EY8A 4XYQA 1WTPA 3ICEA 2N9XA 1HUNA 1A3TA 1TKWB 3ND9A 1GJZA 2FFKB 1STAA 2YTXA 5IGEA 1VZ8A 1B3AA 2G5DA 1JWMD 3DLLA 3IXSA 2KDBA 2OHFA 1WCMH 4FF2A 2NBFA 1D7QA 3A8IE 4A3MG 3RNCC 2JA6B 3DM1A 4MIUA 5BYSA 4CKBA 1QVFA 3A33B 2ID0A 5C3EB 2RSOA 2ZTCA 2E74C 1WE7A 2B2VA 4UP8A 2WXPA 2K14A 3NVYA 2PQAA 4KY6A 2VRRB 1SSOA 5JZEB 3ZKJC 1E0BA 4IDIA 2VQFL 5IYDG 1U4RA 1QOAA 1SMYD 2R7FA 2H4OA 3PIO3 3H0GH 4A3EG 2ZCBA 3C3LA 2EKIA 3NS8A 5CHVC 3R7QA 3E0EA 4AWJA 5A2QE 2G45B 2WB1E 2D5DA 4PMWA 4JOIC 4KDIC 3E0JA 4S17A 1VMCA 1ZEQX 3NBIA 2D11A 1KABA 3N1YC 3ND8A 3CF6E 1TVXA 5D3IB 2RMMA 5FK9C 1Q12A 5G2NA 3B08A 1U4LA 5ELEA 1VQ8A 4ZRZA 4RNAA 1E5WA 2HHHL 1AN8A 5HY6A 3A7AB 1YBYA 2IHEA 2ZXOA 3AQQA 4C1NI 3K7AB 1YJ9A 2IX1A 4C3IH 4IC7B 4X62L 4ZHOA 3H15A 3APCA 1MI0A 2E3TA 4AOFA 3TBIB 1LT6D 3HOVH 4Z9CB 1ZXIA 4NY0A 1TWAB 3I3CA 2MQHA 1WTXA 1Z2MA 4TMAB 4X3SA 2N3SA 3AEVA 2EVBA 2INPE 3J81c 1N5XA 2CWAA 3MJWA 2NYZD 1V8QA 2WXMA 5ELOA 2JQRB 5DPRA 5C0XH 3TN2A 1PFBA 2LJIA 4AQ7A 5IYCG 1J6QA 3BYYB 4ZKBB 4JI0Q 1LFDA 4LJOB 1N5WA 1TS2A 4PNYA 4MNOA 1NAPA 3HOWB 4JX1C 3Q3FA 2KHJA 5FOBB 3ZO5B 4F8CB 1C4PA 2Q2IA 4O0AA 1WTWA 3AEFB 4KKTA 1R4PB 1XCQL 1FGUA 4EZJA 1UD7A 1JOOA 4K3BA 3X3MA 2ICIA 4RMAA 3PCOB 3GO5A 1FRDA 5F2DA 5HGQA 2DENB 3L9AX 1Y1WH 1UELA 1PHJA 3K5OA 3HOUG 3NENA 2DZKA 1IBLL 2IX3A 3G6JB 4KGRA 2F0EA 4FN2A 2DYMA 4A3FH 3DXJC 5IYDH 2BF8B 3SXHA 5IGCA 4C3IG 1Q1OA 1TIFA 2DWQA 3FKYA 2KUMA 1TT5B 1B9MA 2CH4W 2DJFC 1HNXL 3S24A 5EBCA 4II3B 4MGYE 2PI2E 4MGIE 1H9SB 1ZKOA 2CU1A 1YOVB 4YCVA 2C7NB 5C0XJ 3J80E 3R66C 4QAYA 2K3UA 3W5UB 2F0WA 1QF6A 1ENAA 1TBEA 3BZKA 3HEJA 4CDEC 3WAMA 2KC2A 1LT5D 1MD2D 2VNUD 4FO2A 1MJEA 3HVDA 3DBRI 2MO0A 3J7AF 5EAYA 1Z5SB 3K9OB 3D6WA 4E74A 1K28A 5JJZA 1ZUD2 1FNWA 3HRZC 4V0BA 2VXWA 2F3WA 3JYUA 1XPOA 1D4BA 2LUEA 1EEID 3HM6X 1L0WA 4ZYSA 1JT8A 4OWTB 4WJ4A 3D3RA 4ME5A 3OHXC 3AU7A 4ZUIA 4XT3B 3AE5B 4X65Q 1WD1A 1FXAA 1ZP0B 2AMCB 3PIOA 3H3VH 4OO1G 5LMNW 2A5UA 3BWUD 4W9JA 1Q5WB 4KD3A 2D2CC 3AE4B 4KKIA 3DBLI 1AP0A 3NQIA 1ENFA 1PH6A 1WYWB 3WCQA 4C4VA 3QWZB 3AE3B 2B2WA 2VQEL 2WXJA 2E2HH 4KZ0A 3MC9A 3ONSA 4WWPA 4PQXA 1VR9A 1F77A 2LRWA 4GDKB 3PO3G 1FRRA 1D8LA 3SK8A 2I1KA 2CU3A 2MCNB 2JYEA 2DBYA 3I2ZA 1EWYC 1CA5A 2VZKB 5EDSA 4DK6C 4USAA 4CJ2C 1UEAB 4IWPA 4IZ8A 3X0WA 1WTQA 1STBA 4MHEA 4JI3L 1DOLA 1HR0Q 4OIKA 2CHWA 1WH3A 2K1BA 1GUWA 4B08A 5M3FB 1I4XA 3HOZG 3GOEA 4KI0A 3DWPA 5HI1A 1T0SC 3UDGA 3J9CA 1E8ZA 1K0SA 4H0LC 3T9LA 5C4JH 1XD3B 3N6RA 2CKZB 2QHOA 4WRDA 2LGXA 4N9F4 3MJ5A 3PF5A 2JRHA 4FJZA 2KQ7A 2D0OA 4E6IA 1WXMA 3LDZE 2X38A 4OX9Q 3ZIMA 2WDQB 3I4LA 3ZTCA 1QJOA 4NXMQ 3S1NB 2PE6B 4EZKA 3FILA 3Q24A 5M5XB 3Q8BA 4S3SA 4XQJA 4G57A 4KMUC 4RF1A 1WM2A 1I7HA 4PV1C 1VD2A 3CCUA 4FXKC 4M1UB 4K7WA 2E2IB 1UWXA 4L5TA 2ATWA 5HURA 3ML8A 2KQ3A 1OFFA 5GAHC 1RAXA 4B0EA 5JHBA 3ERQA 4A3DG 1VQHA 1N36L 4FYDA 4L2YA 5KEEA 3J81L 3Q0AA 3V60A 2KCCA 2K5HA 3VVWB 4ZCKA 1IYJB 2OOBB 4W9GA 2SNMA 4DAYA 3CWIA 4IOIE 1ZOYB 4N59A 2C9OA 4FADA 1MFWA 1B9RA 4QGUA 1M94A 1YIWA 3F2CA 2ICEC 1FJGQ 1GXDC 1SFOB 1JOKA 4B9XA 4A75A 4WJPA 2RQXA 2XRQD 2W3RA 3S1NH 4HXDA 2VQFQ 1LTGD 2BT6A 4GKKL 2F3VA 2OCEA 2LFNA 3M7NA 3A9JA 3B2FA 2A6HC 3AFPA 3F8TA 1F9PA 4DV4L 3SU8X 2DZMA 2B2UC 4IG7B 2UUAQ 3Q6BA 2EJFC 3NZ3A 1D5ZC 3IAM1 3OMCA 2KTRA 3NP8A 1L5PA 4DV1L 5BR8Q 3LYYA 2L9HA 4RH6A 1CKMA 1K8AC 2SOBA 2WINB 2KTFA 1LLRD 4DUZL 2VW9A 1IKMA 1YD8U 1S5ED 2BH2A 4IUMB 4MELA 4J6IA 3L3OC 5M3FH 2QA4A 2JA8G 3FMCA 4WQOB 4YTNB 3UI3A 2RVLA 4C3JG 4LFBQ 5IP7G 1L7YA 1T5EA 1X6OA 3FDTA 3NVWA 3T56B 1FNUA 4LUVA 3RN2A 1K73C 3PSEB 3RNFC 1P16A 4K7SA 2VY3A 5ELCA 2A74C 4OW0A 1F0ZA 2NBVB 2Y5CA 1YJWA 1QVGA 2IO0B 1PRTF 3BINA 4BKSD 1YNTE 2BCOA 5FLXL 1N32L 4NPNA 1OXTA 3DWAA 4QCLA 3KUCB 5M5WB 2F0GA 4LF6Q 2MJEA 4LUZA 3SK6A 5HGTA 5D14A 4LF5Q 3FPUB 4GN3B 1BKBA 1ROEA 2JEAI 3B6YA 4WAFA 2K4KA 3GTQB 1I6HH 4CDCC 2MA9B 1N61A 2B63B 5C3XA 3MP9A 1IXRA 1CZGA 1TXYA 2L1BA 4BVUC 3K7AH 5D65A 3ENEA 3IT6B 3HS0C 3VXWA 2UXDQ 3DMUA 4ME3A 2ZZPB 1KD1C 2A73B 2F0LA 1PUTA 1GUSA 3ZUNA 1WX8A 3EFUA 3TP8A 4GU2A 1E7VA 4ICUA 1QKZA 1IBXB 3TMPB 3BIID 3S1MH 3R93A 5KIXA 3L2PA 2C5LC 4DHJB 2NZHA 2GBNA 3GE3C 3RPFC 1CKOA 4IJHA 2V0GA 2PW9A 4HJ7A 2JUOA 3M9BA 3I4MB 5C4XH 4EQPA 2LGYA 1ASZA 4X66Q 3ZLZA 4QY7A 1VCBA 3NK9A 2EYOA 2B2YA 1T6BX 3AU4A 1HZ6A 1WJNA 4NQKE 4ID6A 1Y1VB 3A5ZB 3EC8A 1HH2P 5NUCA 4A93B 4JI2Q 3MWYW 2E6XA 3U7ZA 2Y0SB 4DV6Q 1QZHA 1WMHA 1V86A 3CPFA 3KOJA 2BBCA 1EYGA 4TSSA 5KHQA 1TTNA 3H7SA 3H91A 4XYOA 4N6EB 4ANUA 4A3GG 4ANXA 4KTAA 3IVFA 1PTOD 2I07B 2PVGC 1I4QA 4MGZE 5JPNC 2L1AA 1VDZA 1ZW7A 3IFWB 2NPTA 5GXGB 3NWTA 1AEXA 2Z0SA 3S1QH 1TZOA 3NG0A 1E2VA 4LNNA 1C3TA 1DOIA 1H9RA 3D6CA 2K5NA 2UXBQ 1K3BC 1QB5D 3IRBA 3VDYA 3H9DA 2MHJA 5M3MB 1XO3A 4IN3A 2KMCA 4HTHA 1V1PA 2K7VA 2PO4A 2FIDA 2O6VD 2J7ZA 1PTOF 1YQ4B 2ZM6Q 1NBFC 3QQ8B 5K36G 4BA2I 3JSVB 1WR1A 3T51B 1JROA 4YTPB 5D94A 1PRTB 1V81A 4IUNA 3M3YH 3APFA 3I70A 4NQLB 2QMTA 4KGTA 2WAQE 3Q8DA 1EYAA 4AH6A 2K5DA 5GQOA 2XWBB 1RYJA 1I50B 3I8ZA 5DCNA 4HPMB 2F1MA 4H44C 1SE8A 1N8RC 1GOZA 3GV6A 1XLPA 4HKZE 1SRUA 4KKJA 4BY7H 3A55A 1CHPD 2K32A 3LWUA 2N1WA 2SNSA 2ZXRA 3PUWA 3PO0A 2PW7A 3TL5A 4KZCA 3A7LA 3B9JA 2NMQA 1EOTA 3M95A 1DXMA 2L00B 4EVOA 4IQZA 1YX5B 1TIID 4DDID 3JAMi 1Q8IA 3I4NH 2A19A 3L10B 5ELNA 3GTLH 1UNSA 1VF5C 1GB4A 3HP3A 3AB9A 2CHBD 1EWHA 1J7BA 2VZKD 4S0RA 5AUKA 1GC7A 1G291 2ZTDA 2MBQA 5IWAL 1YIJA 4B3SQ 1N63A 4EOYA 2IWHA 5CC4A 2F4IA 1KXLA 1WR6E 4UP7A 5C4JB 2KWCA 4A3FG 3SFDB 2VB3X 2G3QB 4A3BH 2B63G 3PUXA 5FLXE 3K58A 4QIWB 3S9WA 5ELFA 4KX6B 2ZJPA 1PH7A 2INCC 4YTMB 3DWGC 2D3AA 3HUIA 3H7PA 4YWKA 2NVXH 1HCZA 1WI0A 4APVA 1K8OA 1IL2A 4DUZQ 2EYFA 2K50A 3P63A 4WWOA 1PFNA 1LTID 4K8IA 1LTRD 3Q8AA 4LDTD 2WB1G 4W9EA 1KLVA 2GB1A 1VQCA 4JWUC 1UF0A 4H7BA 3DHHC 2F3IA 3QJYA 2D07B 2WB1B 2N7EA 2RDFA 2F03A 3KF6A 4DK3C 1L1OB 3FKIG 2LUMA 2KJXA 4OHJA 4X64L 1MIUA 2H5XA 3HOXB 5FJ8G 2EZVA 4O42A 4N8FA 1F52A 5BYQA 1D3ZA 2C7MB 2DZJA 2RF4A 2Y0SG 3C46A 4J3OD 1QZGA 4HCSA 3W1YA 2AQ3B 3OIQA 1TT2A 1Q8KA 2IW3A 4BY1G 5JJKA 4R4IA 1B2TA 4LNFA 2E8GA 3J80i 4GN5A 5KYLA 1J19A 5C1ZA 2E2JH 1BBWA 1SAPA 2JZ3B 4A3KB 3UI2A 3OG5A 2OWOA 3UQBA 1TWFH 1SDFA 4KLKA 2O5IC 2O5JC 1DJRD 2BA0A 2BB6A 4DA2A 2PLPA 1QILA 2C7HA 4FF1A 4A3EH 2Q2TA 1E9MA 1WJ6A 5E6OA 2AL3A 1FEHA 1SNMA 3EHVA 3T8MA 1RLFA 2M00A 1VLBA 4JPSA 2Z0EB 2L5TA 3QC8B 3MFYA 5IYBG 2IDYA 3CKIB 3KUZA 4JGHB 4ILWA 1VQOA 2WXKA 2M1MA 4A9AA 2Y5BB 2MNAA 3SFEB 1HE8A 1I94L 1FYCA 2PJHA 2RHQB 3CMAA 1SMYC 1EQRA 1W3SA 5JVG3 3PGZA 4DV7L 5L37A 4NXML 1FPYA 3C8YA 3MHSD 4YXDB 1STHA 3HOYB 1L0VB 4FNFA 3H3VI 4AYBB 4DV7Q 5CTRC 3FP9A 3G7LA 4RKBA 5FJ8H 1GB1A 1P7EA 3MC8A 3HOZH 3V6CB 2KC1A 5DPWA 5I6YA 4AYBG 1UH6A 4IWQA 3FAHA 3J7YW 1BQQT 1VQEA 1W2BA 4KK7A 4RCOA 4A90A 1STYA 5IIFA 5IY0A 2NVUI 3K6OA 4HCNB 3U7DA 3L7ZC 1AE2A 2OQ0A 1YJJA 1Q0WB 4LLGM 1E3PA 3SVMA 3NTHA 4RCNA 2R7ZG 2WXFA 1CUKA 3I63C 3OSOA 2PZUA 1WJJA 2I46A 1XMOL 3RZWC 1TWHB 3OPOA 5KNDA 1F2RI 4A3IB 3HKZG 2L76A 2WXGA 1UGJA 1R9TB 1ML0D 1YQBA 3H09A 4ABNA 2BS4B 3DVNV 3PHXB 4HPPA 4W9FA 2EY6A 3EECA 4C3HG 1E0ZA 1KIXA 1QT9A 3MXNB 2XN9C 1MPEA 4PMBA 3J7ZC 2NBUA 5G5GA 2Q2HA 4A93G 1ZKHA 1SN8A 2KWUB 4J8QA 1GVPA 3VR5A 3VYTA 3VAWA 1HJPA 2J0TD 2YU9H 4JBMA 1WYGA 4LF7Q 2KWVB 2LJ5A 3ZJUA 1I4PA 2KN4A 4BOZB 3QO2A 2L32A 3OIPA 1FCLA 1VQDA 4KHPL 2GBRA 3VH3B 3AN1A 2KDMA 2XTIA 2I38A 3MFGA 1S5BD 4DNRB 3E5SA 2M8SA 1UZXB 3VR4A 1V9JA 2JWUA 4DK1A 5G3LD 1GUTA 1TWGH 2I5HA 4KKSA 3R2IA 4BKTA 4LFCL 3HRDD 1HR0W 1G6PA 4LNQA 1TWCH 1Y69U 2AHOB 3DHIC 1WGHA 3M4YA 3S1QB 1KLUD 4R8NA 1WFQA 1HTOA 2A69C 4P73A 4IFDJ 2ZXPA 4HMJA 1XX8A 2EJGC 2L15A 3NE5B 1N36Q 3TS2A 3BZCA 1IGCA 4KKUA 3T13A 2WX0A 3A1QA 2QDLA 3ZRCA 3GTMH 2VUMH 1C77A 2Z59B 2MEKA 1N60A 2DYBA 3NQTA 1WMHB 2O6VB 4F7XA 2C5CA 2Z6BA 4B3TL 2FMMA 3B1LX 2B39A 3APDA 3WALA 4KN4C 3CCSA 3P4RB 2JU6X 2J0KA 5T1IA 3MTNB 4M02A 1N34Q 3GTOB 5IP9G 3GTPB 4KV2A 4MT5A 5EE0A 1JC7A 3UGBB 3VR9B 3KLRA 4ASWC 1PH2A 4OWWB 3S17B 1YX6B 2KAJA 5M3FG 3AFQA 1PA6A 1P3QU 5AUIA 1HFGA 4HVBA 3F1ZA 2D3GA 4TV3A 2KKCA 1PTOB 1C4QA 1MSGA 1GKHA 2WS3B 4A3BB 2D62A 3O65B 4IUUA 3S2DH 2GLSA 3MZ5A 1STGA 1HUMA 4OVZA 2LMCA 2BKFA 1CT1D 2HIVA 4UDUC 5BMIA 2FXQA 2R93B 3GTMB 4BBRB 5EPKA 1C9OA 4GDLB 2BE5C 1ZDXA 1LM0A 1ZGUB 1TWGB 3RNEC 2E75C 3PRZA 1OQRA 1P8LA 2JE6I 3H6NA 2RSUA 4A55A 1OXSC 4W9HA 4FJVB 1JWAD 3NSWA 4MJSA 1FM0D 1HR0L 2RHSB 2BW2A 1KFYB 3HKZB 2C60A 4WJ3M 5M5WH 1HRJA 4YWLA 1IPGA 1LM8B 2QSDA 2K33A 5ELDA 1II3A 2A69D 1E8XA 2IY0B 1LYLA 1I35A 4OEMB 1VQAA 4P71A 3U9SA 3M3YB 3QX1A 1CKNA 1PH3A 1BNZA 1S3OA 1FVIA 1PH5A 1C78A 4OZBA 2YEPB 5JH5C 3KJPA 3P1HA 4POGA 1J8IA 1DOMA 1E1OA 3VA5A 5H8YE 1Q7YC 2L3ZA 1LGRA 1LTAD 3GD7A 1BXTA 2B3GA 1T5XD 1PVOA 1IYUA 1A62A 4Q0FA 2X6GA 2J0MA 4XTCS 3Q14C 4PK1A 2JYOA 3E6ZX 1E10A 3P42A 1O7YA 5LXHA 3TEXA 4BXXH 1Q86C 2PMVA 2DNFA 2KYWA 5CX3A 4J6HA 1PH9A 1SLJA 5J3BA 3H3VC 2EY5A 1VMPA 2I1JA 1R9TH 3SDLC 3HZXA 3ZGZA 2OF1A 2WYQA 4LUOA 2KN5A 5H1SE 5DM63 2KVRA 3OLMD 4HSPA 4FJYA 2OT2A 2Z9HA 1WX7A 2K6AA 4DR7L 2KECA 1Y1VH 3PGEA 1LTBD 4W9CA 4P6VF 2KJ6A 2BDOA 3CRLC 1ZXHA 2LD9A 1KNEA 4BKSA 5LXIB 2BYTA 1EY7A 3A9KB 4ZRPA 1DM0B 3PZDA 1PFSA 4NAWA 1NI3A 2AX5A 3NUHB 4ZYNA 2TSSA 3EN2A 4YY3L 3CCMA 3AYHB 3SD5A 4U68A 1A3VA 4K5VA 1N32Q 3DBHI 3QJZA 4B3SL 4RG1A 2E5LQ 2JT4B 2KBNA 3AE1B 3SHQA 1IW7C 3PUYA 4LW1A 3D4WA 1IBLQ 2Z6KC 4MGKE 1FD7D 4FXGC 3JAMc 1V5OA 2LSSA 1X65A 2L0TA 1JQ4A 5AFWA 2KO3A 3NZSA 3KYCD 2N0SB 4BXXG 4ZRIA 2Z0DB 2X69A 4R9WA 1IKLA 2JA5H 2BOSA 3I72A 4JI4L 3D32A 1JE5A 2WNMA 1JRPA 3KBXA 5DPTA 3R3OA 3TZUA 1F9SA 1TKEA 1NBWA 3D31A 4UHVA 2IT1A 2UUCQ 1PV4A 4EEWA 4K2LA 3NTIA 3DHGC 3JVZX 3SGIA 3I4NG 4BBRH 3S14H 2E2JB 5KHOA 4X64Q 4XT1B 3U50C 2N9KA 2JRIB 2F0MA 2R61A 4RGTA 5AJ3L 1L0XB 3RD2A 1BBXC 1C8CA 4DR6Q 1XPRA 2UXCQ 2KHSA 1QUQB 3QWNA 1QNUA 4YIJA 5FLXc 1YJ1A 4HROA 1TR5A 4G3XB 3RMHA 4K6DA 3ZNZB 3MHBA 2QF7A 3PVLA 4M0WA 4GOCA 3CPWA 1AW7A 1Z47A 1B70B 3MEFA 4IPCA 1L6VA 4JI3Q 4JYAL 2F0QA 4LAAA 2V1YA 2K8HA 3EBEA 4AUQC 1Q10A 4WWNA 2HIXA 3UIPB 5GMVA 3N1ZC 3G48A 3GTOH 1SE9A 5C3EG 4WAAA 3J7AV 5BN4A 4U673 1OEYJ 1QQRA 2IGHA 3L0OA 4M8NA 1XT9B 2FAZA 4CYEA 5EPLA 1JJCB 3GTLB 4NP5A 2ZPYA 1JOQA 2BYVE 3RZFA 3U4EG 3MTSA 3G6EA 3N32A 1U5KA 3TEHB 5FO9B 2REXA 2RGFA 1AZQA 2B2YC 1CFMA 3TRZA 1N33Q 3J7A5 2AL6A 5JAVA 2SAKA 2VH2A 1G51A 1ET6A 1SF0A 4L6TB 2KHWB 2FUHB 4JI6L 4QL5A 2J7QB 4DV3L 3CD6A 2WLBA 3GS2A 3U30A 1AYFA 2FE8A 4LMQD 2H1EA 2EELA 4LF8Q 4A3MB 2DUDA 3DPDA 3RNUA 4DR3L 4RFBA 3ULLA 1YNNC 3A4SC 4A3GB 1PYSB 1WJ4A 1QUQA 2WXLA 4OONA 3TMEA 4BY7B 2JZZA 4A3MH 2C35B 4HAEA 1MHHE 1B4OA 4N58A 4A3JG 2ES2A 4C1NK 1YHAA 2D10A 1H4RA 3I5JC 3EVQA 4XWWA 1X3QA 5EKLA 5T1GA 2H89B 4KVGB 2IGDA 5LMNL 2K01A 4CKCA 1D2BA 4MJSB 2G9HD 3M3JA 2MJ3A 4DV4Q 1QVCA 1XWEA 5IODA 4K0KQ 2XK5A 4A3OA 3QHTA 5DAUA 5K36H 2HQLA 1JW9D 2LVOA 2XEWA 1RCVD 2PNRC 4GKKQ 4OELB 3LWEA 2EY1A 5ISRA 2PQEA 5BYRA 3M4PA 2PI2A 5I9OA 4IPGA 4GKJQ 3OW7A 4FF3A 4I6PA 4XDXA 1WM3A 4C4VB 4JQWC 4A3JB 3PUZA 1OXXK 3LX0A 4ALPA 5MPOA 4OVUA 5FO7B 4P75A 4A6QA 2HHHQ 4J15A 5BN5A 3AEBB 1SYCA 4EFOA 1B7YB 2GN5A 3U52E 1L1OC 5GAGC 3A9KA 4QMGA 3EFXD 2GMIC 4NXNQ 2KOLA 3I91A 1K50A 3DBHB 4A93H 1WVLA 1SGHA 1ILPA 4AP4C 2K6DB 3PLVA 2A6ED 1HA6A 3GTJB 4GIVA 2BPSA 3NHHA 3PZ7A 3J81E 3CCLA 2NCNA 3AMZA 4FLHA 4B3ML 4IUPA 3PT2B 1CQFA 3NTKA 5COYA 3M4OH 1L6UA 3ML9A 5A35A 1GUGA 3VH4B 5JXVA 2E5LL 1B50A 1CA6A 5CHWA 2YEPF 3IFDA 4CHTB 1GC6A 2V3PA 2CW0D 1NUCA 1GAQB 2K52A 2BVCA 2W9NA 5L83A 2MFIA 2WXNA 5JPMC 1SNQA 1YVCA 3IL8A 1KF6B 4HK2A 2KK8A 2BGFA 1R4NI 1SE4A 3KLWA 1JR0D 1RL2A 4R4TA 4M0WB 4EZLA 2BH8A 4JOIA 3QIJA 1Z7TA 5J39A 1A5RA 4R4QA 1EYCA 3S1RH 1OQYA 3RZDB 3PREA 5EE3A 1NCVA 4XC2A 3Q22A 2XWJB 2N49A 1VQ6A 2K39A 3A74A 1TKGA 3ZW3A 4ANWA 1WIAA 5J2RA 2INNE 4WORA 1BVSA 2LGDA 1VQKA 3M7GA 1H9MA 4LF4Q 2WU5B 4XX5A 1LUZA 2FMCA 1PMRA 1Y1WG 4ZDVA 3DHQA 2JX5A 2IX0A 2KEDA 2Z4IA 4AYBE 3DBLB 4QIWE 3ZXVA 1CK1A 1H8CA 4UPAA 5IP9H 4M8AA 1Q1BA 5LMUQ 1HNZQ 4KSKC 1B53A 1E2ZA 1G6JA 1VQFA 2ASBA 2R6GA 3MHZA 1SYGA 2CQOA 4P7IA 2HCCA 4GSWA 1BMLC 3D4DA 2CS4A
chains in the Genus database with same CATH topology
1RKNA 4G7ZC 4US9A 2PIAA 1I4GA 4TQUS 1ZPSA 2Q8TA 2MPMA 4XE0A 1BO0A 1QG7A 3TP7A 3DWQA 2DYOA 3KQ4A 3URYA 4OO1H 1YMHE 1QOFA 1VZ6A 4B9WA 3NBHA 1VF7A 4TQ1A 2SEBD 2N88A 4MM3B 5G3LF 1FD6A 3C1FA 2EPBA 1V1PB 2K05A 1SSNA 1C9FA 2RDHA 3ZQ4A 3EJIA 3PZ8A 3T53B 1RHPA 4BY1B 1MBYA 4P2CB 1O78A 1AZPA 2MH7A 4ZRQA 4IUQA 2J52A 3MXPA 2PTLA 1WTVA 2QCPX 5I2YA 4A3EB 3M85A 1QNKA 3AE6B 4ARIA 2K5PA 4RF0A 4TRDA 3VRAB 3T3NA 1YNJC 2WU2B 4FF4A 1Q90A 3K5NA 1IGDA 3P4QB 2EYLA 4RHSA 2RSNA 1QOHA 1VDVA 3AEAB 2A68D 1B44D 3ONAB 3BS1A 2IL8A 3PV0A 1BCPF 2LEKA 3P1MA 1PFDA 2MUYA 3EROA 4NAWB 4C7YA 2K5QA 3MXNA 3BK1A 2A6HD 4LK0M 2QDBA 1PXUA 2B76B 4ULLA 1EU4A 2V3NA 2WP8J 2JXMB 4KY5A 2VUMB 1D1KA 2WXHA 3KWVA 4ZLTF 4YSZB 2ON8A 4NKLA 2OEDA 2KQ4X 1MVKA 4IUVA 5C4HA 1GHJA 4KHVA 1N62A 3EQLC 5EQ0A 3W1SA 4DAPA 3A54A 3I4NB 2WDRB 1NR4A 3ABVB 1ACCA 4XQQA 1JE4A 4UAIA 1J7AA 3FKIB 1ZYRC 2BS3B 3S16B 2NVYB 1BUIC 2AWNA 3W5VB 2V4IB 4WH4A 1EEFD 5FKAC 2L52A 1ET9A 3IAS1 3H94A 3BVMA 3NUCA 2F0PA 2QJLA 3ZJTA 2RDGA 1TYGB 1FIQA 2G9DA 4MACA 4OZCA 3BDOA 3U2SC 5C3WA 5I2XA 2JXTA 3RZOB 4OO1I 4I7ZC 3DWMA 3VYSA 1V97A 1SYFA 2MJDA 1PZJD 3HG9A 5C4ZA 2OXPA 5C5MA 5IGGA 3SHLA 3PMFA 2RA4A 1J7CA 3CU7A 4A90A 1F2ZA 1HZ5A 1K83B 1K53A 3OWEB 1C76A 2J4XA 2H88B 3AH7A 2VB2X 3H6MA 1KDAA 2EYJA 4K5XA 2QEJC 5CGKA 2XVSA 1HPCA 5DM73 4JK1C 3N9YC 1V8CA 1P7FA 1F2MA 2A68C 2GI9A 5FR3A 1YJIA 4C7ZA 1SJED 4YT0B 2DY7A 1YNND 3P20A 2ZW1A 2EE1A 4I65A 3GQBA 4X3KA 2WKDA 1YN3A 5HHDG 1EY9A 3S2HB 3TP6A 5LL6S 1KDCA 2K03A 1TS3A 4RHRA 1SYEA 3JAME 4KJOA 1YQ3B 4EGVA 3I90A 1I6HB 4Q2JA 1PGAA 2N55A 3H0GB 3M4OB 3TEZA 3T3OA 2I2YA 3VR3A 2QIEB 1VJKA 4NJCA 2Z8LA 2ACZB 1SNOA 5HFYA 1KLGD 4XIGS 1S4ZA 4HCEA 4DGZA 3AB5A 3VYUA 2F0FA 4DN4M 1BCPC 1EIHA 4NDXA 3AM9A 3QG1A 4WJWA 1IL8A 4WFN3 2YYZA 1EZ8A 4G7OC 2DN8A 3KBGA 4HN7A 5IT9L 1MHXA 3OWFA 2PW5A 4N9TA 3KUPA 2HQEA 1SBBB 2PZWA 3K57A 2XNAC 2O4XA 1I4HA 3SK5A 5E3FA 1E2WA 3FILB 5EKIA 1PRTD 2J53A 5E6JA 1F2RC 3N52A 3AECB 4FXDA 1FMAD 2EJMA 1NYRA 1RTOA 2ENBA 2K5WA 2KMMA 1QOGA 4DK0A 1YN5A 3P4SB 1M8AA 2WV6D 2M0AA 1IW7D 3CQZB 1PLFA 1TWCB 2RBMA 3AE9B 3GP7A 4HEA1 1H9SA 2LFIA 3KLSA 1G8ZD 1RJTA 4FXCA 1O7LA 4A8XC 2K0PA 1WTRA 1X32A 5KYIA 1FR3A 1KRHA 3K0YA 4QF4A 2YU9B 5C0XG 4FP5D 1G2SA 1K52A 5C3JB 3A8JE 1LT3D 4OIJA 1CI3M 2NTTA 1NENB 2HUGA 4YWGG 2L55A 3BG3A 5K5PA 2NVQB 1GUOA 2X6LA 1G6ZA 4NAMA 3AE7B 2BTEA 1HTLD 1SB3C 4CBVA 5A2QL 1NYQA 1WGKA 4K8JA 4BBSB 5KNCA 1PDXA 2A5HA 1VCIA 4OGQC 2BB5A 1XLNA 5CV5A 4O1NA 3O13A 3D4RA 1WD0A 1UWMA 1DOKA 3BDCA 2EOTA 4A3DB 1FO4A 1ICWA 2WACA 3TDQA 4QB4A 1WSPA 3SEBA 2E2HB 1RWSA 1ESRA 1LO5D 3MXUA 2E76C 3S1RB 4ZUJA 2RKSA 1ENCA 2EDGA 3RLFA 3WOFA 4KV6A 4ODGA 1PTOC 4PT5A 1KTKA 3IAYA 3VR6A 3S2DB 1X3PA 1JQYD 5CYUA 1ILQA 3P75A 3H8HA 2CW0C 1CM9A 5IT9E 1RF2D 2F0JA 1AFPA 4KY7A 1S5DD 5EBDA 1I6VC 2N9LA 1EY4A 1LTTD 1HQRD 1ONLA 4ITKA 1FCCC 1PZID 4GLSC 2SDFA 2WXQA 2WXIA 3AEEB 1BF4A 4A3FB 5I9PA 3B2GA 5JEAJ 3TP5A 2CVRA 1VRAB 5BMHA 3VYRA 4AS1A 1KAAA 1ZYRD 4RGNA 5HG2A 1RTNA 2EYMA 3U9OA 3R2TA 4CQNA 2JA8B 3NPPA 1IHZA 3L4PA 3T4AC 1STEA 3WDNA 3D8GA 2DY8A 2F0HA 1S5FD 1A70A 2NN6I 4RGOS 2PPBC 1WRIA 3GB1A 1XLQA 4L1BA 1TY0A 1KDBA 2WP9B 2B2UA 4FVMA 5T8IA 2F0VA 2PKOA 4ZQ3A 2LMCB 2FHTA 2R3ZA 1B9NA 2BA1A 3GTKB 4B0MA 1C79A 1DD2A 1XYIA 1M4VA 1BR9A 3OOCA 5KGUA 2M2LA 4HSVA 1KNAA 1GUNA 1EZ6A 1Y8PB 1EWCA 4EQOA 1E7PB 5ELBA 5I4DA 3Q23A 4K6LA 1JWBD 2L0CA 3TEYA 4Y7NB 3VR2A 1ZDVA 3HOZB 1C4AA 1SE3A 3HGBA 3RD4A 2AUJD 3LXFA 1FFVA 1SEBD 4KHZA 1Y8NB 2N7JA 3P4PB 2G1EA 5E1FA 1QE6A 1D6EC 3AMUA 2EYHA 3QB3A 3TSSA 4HR7B 3I73A 4LTUA 3VR8B 1R7SA 5C4XB 3SE0A 4NW2A 1CTMA 1LTSD 5CMDA 3NRZA 1TQOA 5G5HA 2AQ2B 4RGMA 4BA1I 1OXVA 3V3XA 4L8JA 2JA5B 1AWDA 1TWFB 1KH0A 4DQOC 4G4KA 4OZAA 2JSOA 1JICA 3S14B 4HRSA 4DNTB 2EXZA 3Q69A 1NR2A 2WIIB 4DAVA 1YNJD 5FO8B 3AV8A 1PFMA 4XQNA 2Q5WD 4HKQA 2OEOA 2NN6G 1CHQD 3X3NA 1OXUA 4P16A 4HMIA 3BVGA 1Y8OB 5CV7A 4YSYB 4KN7C 1IUEA 5EPJA 3K5LA 4HJGE 1A2UA 2Q8IB 4RA8A 2K28A 4C3JB 5M5YB 3SR1A 2B8GA 4L23A 4N9PA 1HFNA 1A6XA 5EJWA 1D1IA 4F8MA 1ESFA 1Y1WB 2KEEA 1PYWD 3VQIA 1H9KA 1CJEA 2FJ2A 4ZAIA 3ITPA 3LB8C 3Q6SA 4XDDA 5JVH3 1HQMC 1R4QB 5JOBA 2W3SA 1MGSA 4JBWA 1UAPA 3SR6A 4ZK9B 5KRUA 1CQVA 2BE5D 5CV6A 3CHBD 1G2TA 3PIP3 1DZ1A 4NZLB 1F2YA 4KD4A 3DEPA 3J80L 3I57A 1HHVA 2DLBA 3BZDB 2MJ8A 5CV9A 2CQAA 1K8MA 2K9XA 1RM6C 1RDPD 4NMZA 1H9JA 2FBWB 2L83A 4X3TA 3ZJVA 4DU9A 2WQYB 3BVZA 3MC0B 1SIJA 1TS4A 2DNCA 2KACA 3KLSX 1U9RA 1PGXA 3QOJA 1C48A 2KVMA 5BMGA 2Y5PA 1BCPD 4TQ0A 3KWLA 3MVVA 1BOSA 4ZOHC 1WCMB 5IGFA 1EU3A 2WDVB 3W2DA 2MP1A 1LABA 2D5GA 2F0UA 1LV9A 4Q5VA 1EFID 3F2UA 4PMCA 3TUOA 1TJEA 2R92B 2PMZB 5J22A 1D5XC 1W6JA 2NVTB 2FINB 5CORA 1OQQA 1EM7A 1PGBA 2ZT9C 1SJHD 4ZHPA 1EQVA 1T3QA 1JCKB 3EA6A 4CJ1B 5TSSA 5EE1A 5C44B 3V05A 2W54A 1NVID 5C6AA 1VZ7A 4WQMA 3T16A 2F0NA 1DYQA 4K2KA 1LACA 1SYBA 4D2KA 4C56C 2EY2A 2E2DC 4GZYC 3A56A 5CBEE 2Z1CA 3PUVA 3W9CB 5EKKA 2JZPA 4DXGA 5J1ZA 3DEOA 2W82A 1GPXA 5E4WC 4YSXB 2MHVA 5H92C 3AEDB 4IFDG 2EYPA 2IJ0A 5DEHA 1FXIA 4HEDA 3E56A 3IKJA 4LK1C 3I9V1 4JE3B 3ZYYX 2PVOD 4MH8A 1V43A 4V190 2HTME 3MXGA 2Q8RE 4WIPA 1RD9D 1QLBB 3A8KE 1MI2A 3AEGB 3MA2B 2LHEA 4JWSC 2B2TA 2XSCA 1QCBD 1Y56A 2GA4B 2WXRA 2F0SA 2MGSA 4J1MA 3KK7A 4BWGB 3CIRB 2BDNA 1QWYA 1W6KA 5M9OA 1J9OA 2PCFB 1JORA 1ZE3D 2XRSD 3LNNA 5LL6X 1RODA 2KWDA 3WOEA 4IUTA 3NVZA 3Q8FA 4IFDH 1WXQA 1HTPA 3PO0A 5CR3A 2HDLA 2L11A 2NWGA 4WWMA 3E9SA 1XEEA 3FPPA 1YN4A 4RWSC 4L63B 1S5CD 3W3AA 1EL0A 1PRTC 1TKYA 1TY2A 1EY0A 2K22A 5LNK1 1F9QA 1SXTA 2NB0A 2B8FA 1NSNS 2WXOA 2PYKA 1RFKA 1ZXTA 1IBXA 2B2WC 2AUKA 1K51A 4C3HB 1U4PA 1XTCD 1PTOH 4TKOB 4KJNA 3BDLA 1IYVA 4CGYB 2A6EC 2NVXB 3FC4A 4WURA 1F9RA 4H2AA 3QOLA 4RAUC 1JB3A 2IGGA 1A15A 2R7ZB 2O2LD 4IFDI 1STNA 3CRKC 2JSVX 2LY7A 4C2MB 2QKIC 4RKLA 5CV8A 4ZKCB 5EE9A 1I3QB 4F88A 1JMLA 4K14A 3FEWX 3VRBB 4R8IA 4BS9A 1WWTA 3TEWA 1V1OA 2HCIA 1DCZA 3NS1A 2JYTA 3HOUB 2HDMA 1B1ZA 2V4DA 3KF8A 3AE8B 5LHY1 3BK2A 3P7JA 2AQ1B 2KA7A 3MEHA 5C5LA 2LGIA 3FVQA 4CKEA 1EYDA 3V96A 1A3UA 4F87A 2F0OA 2NUCA 1DONA 2HDEA 2JEBI 2L12A 2CJNA 2KCNA 4ARCA 1BDOA 1SNCA 2M56B 4XWTA 1E6EB 4KGSA 2B2TC 4R3DA 3QIAA 1O80A 1MSHA 3ETRA 2QILA 2M19A 5JEAG 1L0YB 3K59A 1CZWA 1O7ZA 1FNVA 1I4RA 4G7HC 3PO3B 2ONQA 1OO9B 1XCTL 2IPKD 5DNFA 4EE2A 4IKGA 1LT4D 5E4XA 1NEKB 3IT4B 2AWOA 1Q1EA 2D9UA 1PZKD 2WKCA 1EQTA 4LJZC 3GTGB 2LKVA 4H13C 3GV3A 2XIWA 2BS2B 1FGBD 1UUPA 4MN3A 3S1MB 3HOVB 1FFUA 2GRIA 2F0KA 5C2TB 1U4MA 1SNPA 1A2TA 1GJXA 2LHDA 1C4CA 1QOBA 3HVZA 1L4ZB 3Q8CA 1SYDA 1JALA 3R8BA 5EGTA 1HEZE 1BUVT 2ZW0A 2K04A 3NWSA 4QUFA 3NXWA 2LS01 5KNBA 4DXFA 1EY5A 1TS5A 4EQNA 3VA7A 3S15B 3SDZA 4K5WA 5JEAH 2PZTA 1PDQA 3SK4A 3MAQA 2B2VC 3AE2B 1DGJA 2F0TA 3C1EA 5C0XI 4IALA 2TMPA 4XDCA 2CJOA 2RPVA 4DFAA 3TZDA 1TU2B 2JA7B 1XXGA 3OMGA 1EY6A 2NN6H 3K5MA 3C2PA 5D7GA 2JP1A 3FRPB 3NVVA 5D3DA 2F0DA 4DF7A 1L4DB 5IGBA 3JAML 2NTSA 4IURA 2J42A 5BN3A 3EUB2 2M9VA 1DOYA 2F0IA 1JWUD 1Q3LA 1SE2A 4US8A 1XLOA 1CZPA 3V2TA 1HA5A 2DNEA 1G91A 1D5MC 1HXYD 1WTOA 4OL7A 2L4NA 3RFZB 3RUZA 3Q8EA 3IFTA 3BYTB 2W55A 1GHKA 1JWSD 2WAQB 3PO2B 1XF5L 5CV4A 4X3UA 2NZ1D 4QUCA 5IGDA 1EIGA 1BCPB 1Z6HA 1F2LA 5CBAE 4CJ0B 4C3IB 2FUG1 1SNDA 4XXEA 4REZA 3DUZA 1DOXA 5IOCA 2Z4HA 3EGRA 2Y3AA 5I6WA 4C80A 1EY8A 4XYQA 1WTPA 1HUNA 1A3TA 1TKWB 3ND9A 2FFKB 1STAA 5IGEA 1VZ8A 1B3AA 1JWMD 3IXSA 2OHFA 4FF2A 2NBFA 3A8IE 2JA6B 3DM1A 4MIUA 5BYSA 4CKBA 2ID0A 5C3EB 2RSOA 2E74C 2B2VA 2WXPA 3NVYA 4KY6A 1SSOA 1E0BA 4IDIA 1U4RA 1QOAA 1SMYD 2H4OA 3PIO3 3C3LA 2EKIA 5A2QE 4PMWA 2D5DA 3E0JA 1VMCA 1ZEQX 3NBIA 1KABA 3ND8A 1TVXA 5D3IB 2RMMA 5FK9C 1Q12A 1U4LA 5ELEA 4ZRZA 4RNAA 1AN8A 3A7AB 2ZXOA 4C1NI 3K7AB 2IX1A 4ZHOA 1MI0A 2E3TA 3TBIB 1LT6D 4Z9CB 1ZXIA 1TWAB 3I3CA 1WTXA 4TMAB 4X3SA 2EVBA 2INPE 1N5XA 2NYZD 1V8QA 2WXMA 2JQRB 5C0XH 3TN2A 1PFBA 2LJIA 4AQ7A 3BYYB 4ZKBB 1N5WA 1TS2A 4PNYA 3HOWB 1NAPA 4JX1C 5FOBB 1C4PA 1WTWA 3AEFB 4KKTA 1R4PB 1XCQL 1JOOA 3X3MA 2ICIA 3GO5A 1FRDA 5F2DA 3L9AX 3K5OA 2IX3A 3G6JB 4KGRA 2F0EA 2DYMA 3DXJC 3SXHA 5IGCA 4C3IG 2DWQA 2KUMA 1B9MA 5EBCA 1H9SB 1ZKOA 5C0XJ 3J80E 2K3UA 3W5UB 2F0WA 1QF6A 1ENAA 3HEJA 1LT5D 1MD2D 2VNUD 4FO2A 3HVDA 3J7AF 3D6WA 5JJZA 1ZUD2 1FNWA 3HRZC 4V0BA 2VXWA 2F3WA 1D4BA 1EEID 4ZYSA 3D3RA 4ME5A 3OHXC 3AU7A 4ZUIA 4XT3B 3AE5B 1WD1A 1FXAA 1ZP0B 3BWUD 4OO1G 4KD3A 2D2CC 3AE4B 4KKIA 1AP0A 3NQIA 1ENFA 3WCQA 3AE3B 2B2WA 2WXJA 4PQXA 1VR9A 1F77A 4GDKB 1FRRA 3SK8A 2CU3A 2JYEA 2DBYA 1EWYC 1CA5A 2VZKB 4USAA 4CJ2C 1UEAB 4IZ8A 1WTQA 1STBA 4MHEA 1DOLA 4OIKA 2K1BA 1GUWA 4B08A 5M3FB 1I4XA 4KI0A 3DWPA 5HI1A 3J9CA 4H0LC 3N6RA 4WRDA 3MJ5A 4E6IA 2X38A 2WDQB 3I4LA 1QJOA 3S1NB 3FILA 3Q24A 5M5XB 3Q8BA 4S3SA 4XQJA 4G57A 4KMUC 4RF1A 1I7HA 4PV1C 4FXKC 4M1UB 2E2IB 1UWXA 5HURA 2KQ3A 1OFFA 4B0EA 3ERQA 4L2YA 4FYDA 5KEEA 3J81L 3Q0AA 2KCCA 2SNMA 4DAYA 3CWIA 4IOIE 1ZOYB 4N59A 2C9OA 1B9RA 2ICEC 1GXDC 1SFOB 1JOKA 4B9XA 2RQXA 2XRQD 2W3RA 1LTGD 2BT6A 2F3VA 3M7NA 2LFNA 3B2FA 2A6HC 1F9PA 2B2UC 2EJFC 3NZ3A 1D5ZC 3IAM1 3OMCA 3NP8A 1L5PA 3LYYA 2L9HA 4RH6A 2SOBA 2WINB 1LLRD 1IKMA 1S5ED 3L3OC 3FMCA 4YTNB 3UI3A 2RVLA 4C3JG 3NVWA 1T5EA 3FDTA 3T56B 1FNUA 5ELCA 2A74C 4OW0A 1F0ZA 2Y5CA 1PRTF 1YNTE 2BCOA 5FLXL 1OXTA 3DWAA 4QCLA 5M5WB 2F0GA 2MJEA 3SK6A 5HGTA 5D14A 3FPUB 1ROEA 4WAFA 2JEAI 3GTQB 1N61A 2B63B 5C3XA 3MP9A 1CZGA 2L1BA 5D65A 3IT6B 3HS0C 3DMUA 2A73B 2F0LA 1PUTA 1GUSA 3TP8A 1QKZA 1IBXB 3BIID 3R93A 5KIXA 3RPFC 2V0GA 2PW9A 3I4MB 4EQPA 3NK9A 2EYOA 2B2YA 1T6BX 1HZ6A 4ID6A 1Y1VB 5NUCA 4A93B 3MWYW 2E6XA 3U7ZA 2Y0SB 2BBCA 4TSSA 3H91A 4XYOA 4N6EB 4KTAA 1PTOD 2I07B 2PVGC 1I4QA 5JPNC 2L1AA 1VDZA 5GXGB 3NWTA 1AEXA 1TZOA 1E2VA 1DOIA 1H9RA 3D6CA 1QB5D 5M3MB 1XO3A 4IN3A 4HTHA 1V1PA 2K7VA 2PO4A 2J7ZA 1PTOF 1YQ4B 5K36G 4BA2I 3T51B 1JROA 4YTPB 1PRTB 4IUNA 3I70A 2QMTA 4KGTA 1EYAA 2K5DA 2XWBB 1RYJA 1I50B 3I8ZA 2F1MA 4H44C 4HKZE 4KKJA 1GOZA 3GV6A 1XLPA 3A55A 1CHPD 2K32A 3LWUA 2SNSA 2ZXRA 3PUWA 2PW7A 3A7LA 3B9JA 2NMQA 1EOTA 1DXMA 4EVOA 4IQZA 1TIID 1Q8IA 1UNSA 1VF5C 1GB4A 3HP3A 3AB9A 2CHBD 1EWHA 1J7BA 2VZKD 5AUKA 1G291 1N63A 2IWHA 5CC4A 2F4IA 5C4JB 3SFDB 2VB3X 3PUXA 5FLXE 3K58A 4QIWB 3S9WA 5ELFA 4KX6B 4YTMB 3DWGC 3HUIA 1HCZA 1K8OA 2EYFA 3P63A 1PFNA 1LTID 4K8IA 1LTRD 3Q8AA 2GB1A 4JWUC 4H7BA 3QJYA 2WB1B 2RDFA 2F03A 2LUMA 2KJXA 4OHJA 3HOXB 2EZVA 4O42A 5BYQA 3C46A 4J3OD 4HCSA 2AQ3B 3OIQA 1TT2A 1B2TA 2IW3A 5KYLA 1SAPA 4A3KB 3UI2A 2O5IC 1SDFA 2O5JC 1DJRD 2BA0A 2BB6A 4DA2A 2PLPA 1QILA 4FF1A 1E9MA 1FEHA 1SNMA 2M00A 1VLBA 4JPSA 2L5TA 3MFYA 2IDYA 3CKIB 4ILWA 2WXKA 4A9AA 3SFEB 1FYCA 1SMYC 5JVG3 3C8YA 4YXDB 1STHA 3HOYB 1L0VB 4FNFA 4AYBB 1GB1A 3G7LA 4RKBA 1P7EA 5I6YA 3FAHA 3J7YW 1BQQT 4KK7A 4RCOA 1STYA 5IIFA 3K6OA 3L7ZC 1YJJA 4LLGM 3SVMA 3NTHA 4RCNA 2WXFA 3OSOA 2PZUA 2I46A 1TWHB 3OPOA 5KNDA 1F2RI 4A3IB 2WXGA 1UGJA 1R9TB 1ML0D 2BS4B 3H09A 4ABNA 2EY6A 4C3HG 1E0ZA 1QT9A 1MPEA 2XN9C 4PMBA 5G5GA 4J8QA 3VR5A 3VYTA 2J0TD 1WYGA 3ZJUA 1I4PA 2KN4A 3QO2A 2L32A 3OIPA 1FCLA 3AN1A 2KDMA 2I38A 3MFGA 1S5BD 4DNRB 3E5SA 3VR4A 2JWUA 4DK1A 5G3LD 1GUTA 4KKSA 3R2IA 3HRDD 1Y69U 3M4YA 3S1QB 1KLUD 4R8NA 2A69C 4IFDJ 2ZXPA 4HMJA 1XX8A 2EJGC 3NE5B 1IGCA 4KKUA 3T13A 1C77A 2MEKA 1N60A 3NQTA 4F7XA 2C5CA 2FMMA 2B39A 4KN4C 3P4RB 2JU6X 5T1IA 3GTPB 3GTOB 4MT5A 3VR9B 5EE0A 1JC7A 3KLRA 2KAJA 3S17B 5AUIA 1HFGA 1PTOB 1C4QA 1MSGA 2WS3B 4A3BB 2D62A 4IUUA 3MZ5A 1STGA 1HUMA 4OVZA 2LMCA 1CT1D 4UDUC 5BMIA 2R93B 3GTMB 4BBRB 5EPKA 4GDLB 2BE5C 1ZDXA 1TWGB 2E75C 1OQRA 2JE6I 4A55A 1OXSC 1JWAD 3NSWA 1FM0D 2BW2A 1KFYB 3HKZB 1HRJA 2QSDA 2K33A 5ELDA 1II3A 2A69D 3M3YB 3U9SA 1BNZA 1C78A 4OZBA 2YEPB 3P1HA 1J8IA 1DOMA 3VA5A 5H8YE 1LTAD 3GD7A 1BXTA 1T5XD 1IYUA 4Q0FA 2X6GA 4XTCS 2JYOA 3E6ZX 1E10A 3P42A 1O7YA 3TEXA 2PMVA 4J6HA 3H3VC 2EY5A 1VMPA 3HZXA 3ZGZA 2OF1A 5DM63 4HSPA 2OT2A 2K6AA 2KECA 1LTBD 4P6VF 2BDOA 3CRLC 1ZXHA 1KNEA 2BYTA 1EY7A 4ZRPA 1DM0B 1NI3A 2AX5A 3NUHB 2TSSA 4U68A 1A3VA 4K5VA 3AE1B 1IW7C 3PUYA 3D4WA 1FD7D 4FXGC 1JQ4A 5AFWA 2N0SB 2X69A 4R9WA 1IKLA 2BOSA 3I72A 2WNMA 1JRPA 3KBXA 3R3OA 3TZUA 1F9SA 1TKEA 3D31A 2IT1A 4K2LA 3NTIA 2E2JB 4XT1B 2N9KA 2F0MA 2R61A 4RGTA 1L0XB 1BBXC 1C8CA 2KHSA 3QWNA 1QNUA 4YIJA 4HROA 1TR5A 3RMHA 4K6DA 3MHBA 2QF7A 4M0WA 1AW7A 1Z47A 1L6VA 2F0QA 4LAAA 1Q10A 3J7AV 5BN4A 4U673 1QQRA 2IGHA 5EPLA 3GTLB 4NP5A 1JOQA 3U4EG 3MTSA 5FO9B 1AZQA 2B2YC 1CFMA 5JAVA 2SAKA 1ET6A 1SF0A 4L6TB 2WLBA 3GS2A 1AYFA 2FE8A 4LMQD 2H1EA 2EELA 4A3MB 4RFBA 1YNNC 4A3GB 2WXLA 3TMEA 4BY7B 4HAEA 1MHHE 1B4OA 4N58A 4C1NK 3EVQA 4XWWA 1X3QA 5EKLA 5T1GA 2H89B 2IGDA 2K01A 4CKCA 1D2BA 2G9HD 2MJ3A 1XWEA 5IODA 5DAUA 5K36H 1JW9D 1RCVD 2PNRC 3LWEA 2EY1A 5ISRA 2PQEA 5BYRA 5I9OA 4FF3A 3OW7A 4XDXA 4A3JB 3PUZA 1OXXK 3LX0A 5MPOA 4A6QA 5FO7B 3AEBB 5BN5A 1SYCA 3U52E 4QMGA 3EFXD