4RCOA

1.9 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
192
Chain Sequence
NPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9 Angstrom Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus, in Complex with Sialyl-LewisX.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Putative uncharacterized protein
total genus 51
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rcoA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rcoA01
5ELCA 1BCPB 1S5ED 1DJRD 1LTSD 1TS5A 3DWPA 4L63B 1JWUD 3BVMA 1CQVA 1SE3A 1SJHD 1FD7D 5I4DA 1SE4A 2AQ1B 1LO5D 1FGBD 2O2LD 2Z8LA 4TSSA 4NZLB 1B44D 4OHJA 1LLRD 1S5DD 1S5CD 4BWGB 1FNWA 1LT5D 2ICIA 2XRSD 5FK9C 2WV6D 1I4RA 1HTLD 3EA6A 1FNUA 1EWCA 2NTSA 1M4VA 1TY0A 4O1NA 1HQRD 1BCPD 1SBBB 1STEA 1I4XA 1TS3A 1CT1D 1RF2D 1RDPD 2RDGA 1YN5A 1GOZA 3BZDB 1EFID 1TS4A 4DXFA 4RGMA 1JWSD 2QEJC 1S5FD 3V05A 1JR0D 2TSSA 1HXYD 1D5XC 1ENFA 2NTTA 1BCPC 1CHQD 1ESFA 1SE2A 1PRTF 1PYWD 2SEBD 4RGNA 4Z9CB 3SEBA 3TSSA 1PRTB 3DWAA 1YN4A 1BXTA 5TSSA 1JWMD 1KTKA 1LTAD 1LTID 3BVZA 2RDHA 1LTRD 3CHBD 1KLUD 1UUPA 1PTOD 5D3IB 3W2DA 1I4HA 3GP7A 2J4XA 1JQYD 1G8ZD 1LTTD 4RHRA 3R8BA 1AN8A 1V1PA 2IPKD 3BVGA 4K6LA 4RGOS 1I4PA 3URYA 4DXGA 3BYTB 1T5XD 1JCKB 1YN3A 1KLGD 1PTOC 3BYYB 1I4GA 1EU4A 1CHPD 2XNAC 1L0XB 3DWQA 1L0YB 1PZKD 1PRTD 1RD9D 1TS2A 1I4QA 1QILA 1LT4D 3OWEB 1D5ZC 5D3DA 1FNVA 1LT6D 3R2IA 5ELEA 2IJ0A 2R61A 1BCPF 4UDUC 3EFXD 5FKAC 1AW7A 1D5MC 2AQ3B 1EEFD 1PTOF 1F77A 1V1PB 1S5BD 1EEID 1PTOB 2AQ2B 3O13A 1ET9A 1LTBD 1ET6A 1PZJD 3MFGA 4L6TB 4RFBA 4RHSA 2XN9C 4C56C 1LT3D 1DYQA 2G9HD 5ELBA 2QILA 1EU3A 1SEBD 1SXTA 1XXGA 3MC0B 1CK1A 1PTOH 1D6EC 1LTGD 4RH6A 4RCOA 1HA5A 3R2TA 1PRTC 1RCVD 1PZID 1XTCD 2CHBD 5ELDA 2XRQD 4RGTA 1UNSA 1V1OA 3KLSX 1MD2D 4ZYSA 5ELFA 1B1ZA 1SJED 1TY2A
chains in the Genus database with same CATH superfamily
2I5HA 5ELCA 5IYBH 3DHGC 3TIXA 1FFUA 4KKJA 5M5WH 3V3XA 1YEZA 1Q1BA 3AE2B 2KVMA 2BA1A 4WQMA 2AQ1B 1FGBD 2Z8LA 2MNAA 4LFBQ 4JI2L 1EM7A 3SR6A 4OHJA 4OGQC 4YWKA 1O78A 4BWGB 4EQNA 4B3MQ 3K57A 1QOFA 5CGKA 2VNUD 2M56B 1ICWA 2QCPX 5JVG3 3NHEB 4K81A 1Q46A 2B29A 3PVLA 3APFA 1I4XA 3T13A 5FOBB 2PQAA 1WRIA 4DF7A 1FRRA 3MZ5A 3NPPA 2YYZA 4PZ6A 2D2QA 3M4QA 2IHEA 1Y1WG 4DQOC 4A93B 3I4LA 2KVZA 4HPMB 1WJUA 5C44H 2NZHA 4I6NB 2K75A 2L0CA 1JALA 4YY3L 1GJXA 1II3A 2KBNA 3T1HQ 3UI3A 1RIPA 4H0LC 1RLFA 2QCZA 1PRTB 2PCFB 5HY6A 4WQOB 1SMYD 1Z2MA 4G50A 2VS1A 1SSNA 2YVCA 1K8RB 4GKJL 4CDCC 1YIWA 2WXQA 1F2LA 1NEKB 3L0OA 4LK0M 4L5RC 5BR8L 2JRIB 1Z47A 2WHIA 3HIZA 4KDIC 4USAA 3H1UA 2OTJA 2A5UA 1HR0Q 3PUZA 1T3QA 3SVMA 3P4QB 1LV9A 2M4NA 3WWVA 3NG0A 1YN3A 2JE6I 1MG8A 1M1KC 1VQ5A 1TZ1A 1ZEQX 1FPYA 4DR5Q 1EU4A 4CDDC 1D1IA 3ULLA 3RZDB 3PRPB 4FF3A 4ZYNA 2ONQA 3AH7A 1IUEA 3TJPA 4UAIA 1PFDA 1LYLA 3OWEB 4A3FB 2BB5A 3TMPB 2I46A 4YL8A 1OGWA 3T4AC 2CWAA 2B8GA 4J8QA 5LL6S 3ZNHB 1N63A 3EFXD 1WGDA 1O7LA 1KRHA 1HHVA 1FXAA 1UD7A 1EWHA 2JU6X 4GSWA 3DVNV 5BMIA 4ANVA 1AP0A 2LUEA 5IGGA 1LTBD 1MPEA 3KJPA 3ENEA 3J81E 4RHSA 2E3TA 1YNXA 2NN6G 2LGDA 2BS2B 1YOVB 1YHBA 1VD2A 4N58A 1EU3A 3HGBA 1IYFA 3H9DA 4AQYQ 4K7SA 1D6EC 2WYQA 2R7ZB 4YCVA 5IP7H 4F8MA 3ZDTA 1JRUA 5IE8A 4KHPL 1Y8NB 1B7YB 3PUYA 1P7EA 1UELA 2ASBA 3CQZB 2JEAI 3A9KA 3Q3MC 4KHZA 1OEYA 2XRQD 5F2DA 2DZKA 2DY8A 1NMGA 3HP3A 4HEDA 4LF7L 2R2OA 2QDLA 2WXFA 5IKCM 2E2IH 1UEBA 4KX6B 4MSQB 2RF4A 4MT5A 2DENB 3CAMA 4J3OD 3ZTCA 5JAVA 3CSFA 2LJIA 4YTNB 3WANA 2F4IA 2K5NA 1D1KA 3QOLA 4I7AA 1WD0A 4O42A 4KK7A 2UUCL 1XF5L 3D32A 3MC8A 1WM2A 3VXWA 1QOGA 1BQQT 1AE3A 5I4DA 4JI3L 2FUHB 1LO5D 1TQOA 3KOJA 3MEHA 1I4RA 3GZNB 1G2TA 3EA6A 4GN1A 3RLFA 3A8IE 2UUCQ 1M4VA 3KJOA 1HE8A 1WMHA 1VF5C 2MFIA 2K8HA 1J6QA 2XEWA 3S2DB 3LX0A 4JI4Q 3OPOA 3EC8A 3PS6A 1TWGH 2RDGA 3VA7A 2KDBA 1WJ6A 1GOZA 4GU2A 2PI2E 3NJTA 4H2AA 2UU9L 4HPPA 5C4JB 2GBRA 2I07B 2NB0A 4G7OC 2GRIA 2W3SA 1TIFA 2LHDA 4LTUA 4P7IA 1LACA 1SF0A 3RN2A 4J1MA 2DZMA 1KAWA 1SNMA 1E24A 5D6JB 3S1NB 1YN4A 3I4OA 4KY6A 4OVZA 4DV5Q 1YIJA 2WACA 1LTLA 3MP9A 3F2DA 1Q8IA 1V5OA 3BDCA 2R7ZG 2VL6A 2KLGA 5BN4A 3N20C 4IPCA 4K7WA 1YJNA 2H4OA 2HHHL 1ZW7A 3AB5A 1HNZL 3DVGX 1KD1C 2QDFA 1GB1A 3PIPA 3F1ZA 1PV4A 4LDTB 2M2LA 4DXGA 2KDFB 3HOXB 2DWQA 1UWXA 1Y1VG 3RPFC 2MBQA 2L15A 1V6EA 3G48A 4OO1I 2N7EA 3HUIA 1TU2B 1CHPD 1RHPA 4IOCA 1TKGA 4IM3A 3NOBA 1EY4A 1L0YB 5BO4B 4R3DA 4WJOA 5CX3A 4IOIE 3J80E 3UIPB 3NENA 1CSQA 4H7BA 3X3MA 1XD3B 1J5EQ 3R2IA 1LT6D 4MTKA 4C3JB 4XQJA 1B70B 3H91A 2IY5B 3HS0C 2D9UA 2F3VA 2HDMA 2K1BA 2WKCA 2MUYA 3J7ZC 5J1ZA 1AARA 3DBSA 4KGSA 4HCSA 2PYKA 3VUYA 2O6VD 3LB8C 1BOSA 1MJCA 3FILA 3H7PB 1S5BD 4KLKA 2LZ6A 2AUKA 1I6VC 1VQPA 1S1QB 1WRDB 1WY8A 3QX1A 3RMKC 3VVWB 4B95A 3HRZC 4C2MH 3J7A5 1TGZB 4WIPA 2BS4B 1PFSA 3UDFA 4C3IH 1KDBA 3V62A 4IZ8A 4MN3A 1EQRA 3FP9A 3IG3A 1J7CA 4OX9Q 4BBRB 4JV5Q 2BE5C 3BZKA 4X65Q 4G7ZC 2E2IB 3MC0B 3WAOA 3RLNA 1H95A 1EWYC 2AYOB 4US9A 1WCMG 4H02A 4MH0E 2OJWA 4YSZB 5G2NA 5EPJA 1F2RI 1UBQA 1WWTA 1XCTL 3H94A 1OO9B 1XPUA 3LJ3A 1YX5B 3I3CA 4B9KA 2E8GA 5ELDA 1XNRL 1ACCA 3A0JA 3AECB 4JWSC 4PS3A 2B2UA 4BBSH 1W6JA 4GZYC 2F0MA 1HRJA 1EZ6A 1YJ9A 1K83B 3HKSA 2J0MA 3N3KB 1N32Q 3ERQA 2LI5A 4KY7A 1IBML 2MPMA 4XQNA 2EYLA 3CCSA 4GOCA 4AQ7A 1Y1VB 1S3OA 4DU9A 3Q0AA 3GTQB 1X55A 3HKZB 2C7HA 2A5HA 2C9OA 2I38A 2NBVB 3NZUA 4U673 4MSMB 3VDZA 4DV5L 4DV7L 2PE9A 3I4NB 4EUTA 1JWBD 1VQGA 4HSPA 1NAPA 4A3IG 1VQJA 1HZ6A 1J0GA 3NP8A 3TS0A 3N30A 5JXVA 3GO5A 3P42A 1OXSC 4L8JA 3NUCA 1YN5A 2K5VA 3HKZE 1I3QH 4R4TA 5I2XA 2RSUA 4CGYB 3CPWA 5FLXc 4CBVA 3U8ZA 1JOQA 2K3UA 3UDGA 1N5WA 2BDNA 3DMUA 3LXFA 1EIGA 2C60A 1VMCA 4BOSC 4JOIC 1KIXA 2PTLA 1C78A 2KQ3A 1B4OA 2UUBQ 1DOKA 4FXDA 2D3GA 5IWAL 1N36L 4LJPB 4DR2L 4MIUA 2QA4A 1S40A 2F4VQ 2SAKA 2BF8B 2WX0A 4FNFA 4DR3Q 2FINB 2GB1A 1LABA 1PFMA 1FIQA 3G6EA 2DNEA 3A4RA 5I9PA 2WXRA 3AE4B 2UUAL 2YEPF 1K28A 3JAMi 4DKAC 1IKLA 2CR5A 3SU8X 1JE4A 3KLSA 2SOBA 1B3QA 4CHKA 1TIID 3U50C 2F4VL 2ALYB 4IPDA 1NUCA 3FPPA 4HSVA 3JAML 5T1GA 2LWPA 2QIEB 1SRUA 2XK5A 3AFQA 2WAQG 4O0AA 1I4QA 1XMQL 2O6VB 3HVZA 3NE5B 4HPLB 3LWEA 5D3DA 3CMEA 2K5QA 1Z5SB 2G5DA 4N8X1 1GM5A 3IAYA 1WGYA 2H88B 2KLCA 3RNCC 3E5SA 4GLVB 4DR1L 1GAQB 1PFNA 2F0NA 1WGGA 2BKRB 4PQXA 2KHWB 4C3JH 4HR7B 3VUWA 2JP1A 2DNCA 1E8WA 3DBRI 5AZHA 4G11A 1M90C 5IO9A 3RULA 1JC7A 3K0YA 1UGMA 3O13A 3PO2B 2I1JA 3A5UA 2K5DA 2B2YA 4QY7A 4EZKA 3TEYA 2CW0D 2NN6H 1EQQA 5T1IA 1BR9A 3E9HA 5LMUQ 3AMUA 1H9MA 2AWOA 5CR3A 1PQSA 5ELBA 1NJIC 4A3GB 4QCLA 5EBDA 1WX8A 2JEBI 4JPSA 4BBSB 1ESRA 5DCNA 1R9TB 5EDSA 4LNOA 1XMOQ 4OZCA 2Y5CA 3JAME 4JE3B 4K5WA 3V2TA 1GO3E 2F0UA 1PRTC 5BMGA 1PZID 2PZUA 1FEHA 1V1OA 3HOVH 1PDQA 3NQIA 3H0GH 1XWEA 4K8JA 4P71A 4AQYL 1EF1A 2KN4A 2KQ7A 4FJZA 4RMAA 4IOAA 4CHTB 2IX3A 4X62Q 4A3MB 4KKIA 1E2WA 1S4ZA 1SMYC 1SYGA 1SE3A 4BXXH 2M19A 1PGBA 1Q90A 3F2UA 1UGJA 2JX5A 4XTCS 1YBYA 2BT6A 2KMAA 4KKUA 5GADC 3HOYB 1VS0A 1WMHB 4IFDI 2GBKA 5IIFA 4FP5D 1FNUA 2IZVB 1WR1A 1X54A 1TWFH 3I63C 4LK1C 1HQRD 1BCPD 2L05A 1SYFA 4HIMA 2PI2A 2G3QB 3TN2A 3AE6B 2WP8J 4OW0A 4CQNA 1HZ9A 3QIJA 3GE3C 1V9PA 1C76A 2V3SA 1S5FD 3NVWA 2PZTA 2KEEA 1JR0D 1N36Q 2B63H 2ZPYA 3Q8FA 5IT9E 1Q1OA 2N88A 4A3JG 5DPWA 2NMQA 1HTOA 2LRWA 4L23A 4BBRH 1ESFA 5C5MA 5AJ3Q 5FR3A 4HTHA 2KECA 4RWSC 1KTKA 2EY1A 3AEFB 3M95A 2E75C 4KN4C 3SGIA 2MWSB 4HIDA 4LF9L 2MEKA 3JSVA 4HKQA 4YCUA 4WJ4A 2KACA 1I4HA 3H0GB 1LM8B 2HQLA 5LHY1 2IHFA 1CUKA 1EWIA 1VZ8A 3KLWA 3PZ7A 3O65B 2MRPA 3I55A 2ZW0A 1MVKA 3B0AA 3Q8DA 4DXAB 1F52A 1H9RA 3BYYB 1I4GA 3G71A 3S1QB 4UP8A 3DWMA 1EY0A 4GN3B 3IBEA 1J8CA 4RCNA 1KNAA 3RUIB 4KD3A 1D5ZC 5ELEA 2EXDA 3MVVA 4YXDB 4ZRZA 3R7QA 2CU3A 1RTOA 1HZCA 4UHVA 1BCPF 3A7LA 3M9BA 2G4DB 3JYUA 3U2SC 1WTQA 2KANA 5BN3A 2Z0SA 3HEJA 3NK9A 2A68C 3C1EA 2K5HA 2AQ3B 4DV1Q 5HURA 3TRZA 2R92H 1STBA 2VB2X 3KYDD 2OEDA 1B50A 1FMAD 3H3VH 2K6DB 4R1JA 1TWFB 3HRDD 3X23A 2OEOA 2ZXOA 2CHWA 1JICA 1S72A 1PGXA 1IKMA 3GTOH 1YJJA 2CQAA 2FMCA 5M3FH 3MHZA 3AMZA 3SFEB 1SE8A 4A93G 1XLPA 2QILA 2JWZA 2LGYA 1W6KA 4KTAA 3C3LA 2KFKB 3CCRA 2IO2B 4OO1H 4A3CH 4FLHA 4IUVA 1F2RC 3UGBB 2GBJA 4BKTA 4HDQA 1VQNA 2CKZB 3R3MA 4A3BB 4JCVE 2KC1A 4YHHQ 3QIAA 2ID0A 2JN4A 4L5QA 2KDEB 4LF8Q 1XO3A 2G45B 2CFMA 1IBKL 3HOZB 3AE9B 1VQ7A 3EQLC 1A63A 4M01A 2IX0A 3KLSX 4NPNA 1XNQL 1V8QA 4LUOA 2N4FA 2A6HC 2GA4B 1ILPA 5LL6X 2FCSA 3WALA 4QF4A 1PH8A 4B9WA 3LDZE 1VQ6A 4H44C 1OQRA 1VQ8A 2RMMA 4G3XB 2PPBC 2N1VA 3HK0A 1CQVA 3L7ZC 1B9MA 3HOXG 2D5GA 3BG3A 1O7ZA 2CU1A 3ULJA 4PS8A 3AE5B 1PH9A 2LXKA 1M94A 1E8ZA 5LMNQ 3AE8B 4A3IH 2HHHQ 1ISNA 2LASA 2WV6D 4XDXA 2HCIA 1IBMQ 5FO7B 4N9TA 3T53B 3H15A 1GVPA 4X66Q 2CKHB 2XTIA 2VUMG 4YT0B 2KJRA 2WU5B 2ZNVC 4FXCA 4YIJA 2MSED 1FXTB 3SDZA 4K0KL 3ZUNA 1SGHA 1J9OA 4DNIA 2EYFA 3NQTA 1STNA 3IXSA 3E0JA 5IGDA 4ZKBB 4A3EH 3KYCD 1JOOA 1X3EA 3B2GA 2N0SB 1H9SB 1G291 4WAFA 4HK2A 3M3YH 5KNCA 3DEOA 1Y1WB 4MACA 4ZRPA 1OXXK 2HE7A 4HJ7A 2INCC 3A9JB 1QUQB 3WAMA 5E3FA 4LF9Q 4Q5VA 2EJFC 1K50A 2PW5A 1K0SA 4A3DH 2GBNA 2MW5A 3AE7B 1WFYA 3LWUA 4E3CA 2L12A 4DNTB 1P9DU 4OWXB 4Y7NH 2R93G 4TKOB 1Q81C 5IOCA 3Q6SA 2BE5D 3D6WA 4K6LA 4IG7B 5IOIA 4BVUC 2HUGA 3BYTB 3M7GA 1MSHA 2B3GA 2VQEQ 3HG9A 1JCKB 2HT1A 2JZZA 4HJAA 4P1BC 3RNEC 2BVCA 2DAJA 2JXTA 3U7DA 3Q23A 3L10B 3ND9A 2XNAC 2JZ3B 3ZXVA 4ZDVA 1IBXB 3AEAB 2KKCA 1DXMA 3RZDH 2AL3A 3MHSD 2F0FA 3AEGB 1YHAA 3DVGY 4P73A 3IHPC 5G55A 3DXJC 3KH0A 1CJEA 2R61A 3T3NA 3ULPA 2BCOA 4JBWA 1NR4A 4EGVA 4V190 3KFUA 1RRBA 3AEBB 4JGHB 5FKAC 3I4MH 5HG2A 1I42A 4A3FG 1C77A 1Y8RC 3A8JE 2OHFA 3GTGB 1PTOF 1F77A 3PREA 4A3EB 2JUOA 4QQBX 3R66C 5H92C 1A5RA 4KJNA 3NRZA 2LD9A 2KYWA 1WYDA 4C56C 4W9DA 5I9OA 1DYQA 2G9HD 3FDTA 2JRHA 1X32A 5G5GA 5CV6A 2EYPA 4PS7A 1WGRA 4HMIA 1XJVA 3A56A 1YMHE 3W5UB 4BBNC 4CJ1B 1WSPA 1WYWB 1KL9A 2A6EC 3GV3A 1L1OC 4GDLB 4ZLTF 3VTWA 2AKWB 4M0WA 4AJWA 3CP0A 4XYCA 1GPXA 3STBD 5FLXE 5GROA 1WXSA 1VQFA 1U5KA 1E7ZA 2JSOA 3MEFA 3CXCA 4BS9A 3RT3B 1FCLA 2WDTB 1WGHA 2LXCA 1CKOA 4NB3A 4R4CA 4XWTA 5IYDG 1NTGA 5DM63 2JA5B 3H09A 4UDUC 2PIAA 4DAVA 2NS5A 3QG1A 3D4WA 1VQHA 4DR3L 1S5ED 3TZUA 1HNWQ 2X6GA 4DFAA 4GLXA 4JC0A 3W3AA 4GS3A 3MXUA 3KF6A 1Q10A 3CWIA 4L1BA 5G3LF 4IPHA 3ZKJC 4XYOA 1P0RA 1E3PA 1UAPA 3CCEA 2QEXA 2F03A 2JA7H 4GGQA 1TZOA 3GE8C 3KBXA 1KH0A 2YTYA 4FF2A 5IP9G 1HTQA 1I94L 1HNWL 2JA6G 1UE1A 4KSLC 2QHOA 4S3SA 1PH7A 2G1EA 1RODA 1UWVA 1CT1D 5M3FB 1K53A 4AUQC 3DHHC 4NQKE 2KCNA 4LFBL 3S2DH 5C0XH 1TS4A 3TMEA 2W3RA 5ISRA 3D4DA 1P1AA 2KQSA 2JVCA 4GKKL 4YSYB 1WTPA 1T0YA 3PGEA 4ZRJA 4HJ5A 4DV2L 4OX9L 3PF5A 2F0DA 2UXCQ 2L0TA 2I5MX 4JI5Q 5EKIA 1ENFA 4YWMA 3L08A 2IW3A 1YZ6A 2ES2A 2CJNA 3RI7C 4MNOA 4LLGM 4A9AA 1TWAH 3D31A 2NN6I 3OWFA 2Y0SG 3X3NA 4BA1I 4K2LA 3S2AA 2FCQA 4X64Q 1I35A 1IXRA 1A2TA 1AWDA 2Z4HA 3EVQA 3UDXA 1U4AA 3APCA 2D0OA 2RHSB 3TBIB 1C7YA 3CCMA 5KYLA 5JJZA 5C0XJ 2AEHA 3RNFC 3U30A 3S1NH 2F0JA 4JI8Q 2EY6A 1AN8A 3ONAB 2INPE 3D6CA 3VR4A 5M3MH 4R8IA 1PUTA 2N9KA 3KVFB 4BY1H 3TCAA 3HOWB 1KLGD 1EIYB 4XGAB 5G3LD 4LFAL 4NDXA 2E2JB 2BYEA 1R4NB 1FCCC 4GKJQ 3DWQA 1GG3A 3QOJA 2JYTA 1WR6E 1PRTD 4KVGB 4KHPQ 3Q8CA 1LFDA 3H7PA 5CV7A 4GDLA 2F0QA 4C3HH 2GBMA 1SIFA 2K6QA 1VQLA 2R92G 4KMUC 1MHWC 5H8YE 2N9EB 1SNDA 4MM3A 2XWJB 5AZGA 4GMVA 3CCLA 2XBBC 1MKHA 4X3UA 2L8JA 4GIVA 2EY2A 4K1RB 3WAPA 3QB3A 5C23A 5J39A 4RFBA 2MP1A 2LVOA 4DAYA 1QNKA 4N8FA 3GDEA 1TKYA 1QOBA 2N7DA 1TTNA 1UZXB 5NUCA 1IYUA 1MSGA 3KF8A 2UUAQ 1ZOYB 4B6WA 3V6CB 5JEAJ 3J7AF 1OQQA 4HCNB 1R4QB 1NY4A 4JI1L 1YHQA 1Z7TA 4X6AH 5CTRC 2E5LL 3NY5A 4KKTA 5E6OA 3R2TA 4AWJA 1XLQA 4DK6C 3HOZH 2DYMA 2L1AA 5BMHA 3ZQ4A 1STHA 3NEMA 2QGQA 4DAMA 1NNXA 4AP4C 1F9PA 2MBBB 4DV4Q 2QF7A 2MP2B 1FR3A 5C3EB 5KRUA 4IUMB 1A15A 4GDKA 1N8RC 1KRTA 5IYCH 2ZJQA 3ZTDA 1L0VB 1HNZQ 2LGSA 2C7NB 4W9KA 1JJGA 4LW1A 1MHXA 1FD7D 5E4XA 2FBWB 1A70A 2LGXA 4A75A 3FKIH 3TL5A 2JYEA 4IO9A 2N55A 1S5DD 2OT2A 4RAUC 4LAAA 4A90A 1KLVA 1X3GA 2C5CA 3V6EB 4ZHPA 4CO7A 2DGYA 1JB7A 4ILWA 1TY0A 4W9LA 3G4SA 2GOWA 1ZGUB 1VJKA 1HFGA 1TS3A 2D10A 3L54A 2NVYB 5M5XB 1KF6B 1PH3A 2B3AA 3W1SA 2KTRA 3PPAA 3PO3G 3U7ZA 3ND8A 3VYTA 2Q2HA 3OTOQ 3Q3OC 4KGTA 3NWTA 1WOCA 4JPBW 2IL8A 4PMWA 3AULA 4IW0A 2AWTA 4NXML 1E0ZA 1HCZA 2GVBA 1STAA 4A4IA 4FBJB 1FFVA 4HMJA 2BYTA 2WLBA 3FHWA 4XT1B 4DK1A 2NBUA 1NE3A 3PQIA 1I7HA 4FXKC 1B3AA 4JI3Q 3HOWH 3NVVA 4GOPB 3BVZA 3E3XA 3KBGA 3QJZA 4PYZA 2K9XA 1L2NA 1AZPA 4KD4A 5IP7G 4AH6A 3NELA 3F2BA 1Q86C 2F52A 2K39A 1QB5D 1GXDC 2L00B 2K8BA 3QA8A 2P5ZX 2ON8A 1UE7A 1KNEA 3R93A 4WURA 2MJ3A 1T5EA 4DWFA 3MTSA 4XQQA 4HAEA 2M0AA 2NR2A 2RD0A 2LXJA 2O5JC 2L55A 5HHDG 5JH5C 1NCVA 4K14A 4YHHL 3MFYA 1E22A 4J6IA 1LT4D 3SK8A 4II3B 1YD8U 2KFJA 3ZRFA 2PNHA 4UP7A 3N9YC 1A0IA 1QOAA 3G7LA 3I91A 4A3FH 1KAAA 3I4MB 1TBEA 1PVOA 1CKNA 5CBAE 3ZJTA 2ZXPA 5EJWA 5EPKA 2KTFA 2N9PC 3M4YA 4R9WA 3T56B 1G6JA 2FUG1 4RM9A 1L7YA 2EYMA 1ZXHA 1PTOB 4ZUIA 3QWNA 2XSCA 4DDID 1GC7A 1VQBA 4IKGA 4DV6Q 3TREA 3PUVA 2MBOA 3X0WA 4MHEA 2C5LC 3RR5A 3RFZB 1CKNB 3MXPA 2LS01 5CMDA 1F9SA 1SYBA 2F3WA 3JW0X 2CHZA 4S17A 1K3RA 2PW7A 2E5LQ 3GS2A 4GLSC 3KLRA 3EGRA 2F0LA 4OIJA 5AJ3L 2LMCB 3ETRA 4BY7H 2BWES 4IWOA 4RCOA 4UY8C 1X3PA 4MJSB 1C4AA 5JZEB 2KD0A 4JBMA 3Q8BA 2IO1B 1QE6A 1Q1EA 4M1UB 2REXA 1YNJD 3GD7A 1CZPA 4HJGE 4WH4A 3HOYG 3P20A 2JYOA 3DEPA 3NTHA 2ZM6Q 5LMNL 3FKIB 3KYHC 3IT6B 2R7ZH 3PZ8A 3TP7A 3NZ3A 2DNFA 2J0JA 1AEXA 2J42A 3FPUB 1U0LA 1Q8KA 1DONA 1JJCB 1SJHD 2PZWA 1K0RA 3DM1A 5FJ8G 1F1HA 3VYSA 4LJOB 1X6OA 3HOVB 4FXGC 2Q8RE 4BY1B 5IP9H 1VQOA 1ZDVA 4IUQA 1EUVB 3OOCA 1LLRD 2FMMA 2XRSD 5FK9C 3Q24A 3BK1A 4C00A 2EYOA 1C9FA 1CMXB 2I0QA 2EVBA 1YJ1A 4L2YA 2JJQA 3DLLA 3WOFA 3NBIA 1X3QA 3IFWB 2MQHA 1QCBD 3TP8A 3EHVA 3RYTA 3QO2A 1EFID 1TWAB 4TMAB 3ZO5B 2BOSA 1VF7A 1IL8A 4F88A 1VQIA 3V05A 1I94Q 1A3TA 2RDFA 3W5OA 3WDNA 4FN2A 3DOWA 2D07B 4WWNA 4X57B 1I50H 4CKBA 3TS2A 2PJHA 2L83A 4HWIB 3Q14C 1B9RA 3JAMc 3BK2A 3PO3B 3UQAA 4TQ0A 4PMCA 2FNJB 4RGNA 2RPQA 2B76B 2CS4A 3CCUA 3DWAA 5H1SE 1DOYA 1A3UA 1VQEA 1R4MB 3H0GG 3RN9C 1VDVA 1TT2A 2QC8A 5CV4A 5E6NA 1U9RA 2UXCL 5BYSA 2IDYA 3S1QH 3S1MB 1UUPA 1N6ZA 2LUMA 2IO3B 1BBUA 1HZAA 2J4XA 5AZFA 2NPTB 4XIGS 4Y7NB 4JG2A 3NVZA 3FVQA 1I4PA 2KCMA 2UXDQ 2ATWA 2HDLA 3K5MA 1WXQA 4KSKC 2VY3A 2RSNA 2WXMA 1HA6A 1U4PA 1DGJA 1YNNC 5CYUA 1QT9A 2UWQA 1E2VA 1L0XB 4GN4B 4DHZE 4I65A 3Q8AA 2ZPNA 5J2RA 1SB3C 4WJ3M 2A69C 3T8MA 1WX7A 1W2BA 4A3LG 3SDLC 3M85A 1G6PA 2RBMA 1JJ2A 1E7VA 3FAHA 4ICUA 1QLBB 4MJSA 3Q6BA 4RG1A 4X3TA 4BKGA 3D0FA 1AW7A 1AE2A 3PO2H 3A54A 4UP9A 5IGEA 2N49A 2KJXA 2OJRA 2Z4IA 3B08A 4JW0A 2LSSA 1SAPA 1UE6A 2F0HA 4E6IA 1ET6A 3CSTA 3HFZB 2RGFA 3LGJA 4M8NA 3P4PB 1C3TA 4B3SL 3KUZA 3S1RB 4CJ0B 3OMCA 2BS3B 2VH1A 1WXAA 1NENB 1Q5WB 4DDGD 5J3BA 5LNK1 4IJLA 4KY5A 1IBLQ 1F9JA 1AYFA 1PTOH 2JXXA 2D3CA 3HOZG 2Z0DB 4QAYA 1Q3LA 4Q2JA 4DBGA 1QZHA 4GN5A 2FIDA 3ML8A 5D94A 4WFN3 3I70A 5IT9c 1GUAB 3A55A 3K7AB 4J15A 2VZKB 5HKHA 4NKLA 4GNXB 1E8XA 3MXGA 2O5IC 2KWDA 2L32A 4MGZE 3L0WB 4OWTB 5AEKB 3S16B 3EFUA 4G7HC 2WXJA 2KCTA 3L3OC 4N9F4 3CC7A 3AEVA 4HEA1 2B2VA 1XMQQ 4RA8A 1NI2A 2D5DA 2OF1A 1EFWA 1YJWA 2C7MB 3VYUA 1V1QA 1LTSD 3S2HB 3VR9B 2M9VA 1XLOA 3FC4A 2OWOA 3EECA 4EE2A 3NTKA 4RNAA 3GTMB 4ABNA 3S24A 1EY7A 4POGA 4DR7L 1XQQA 2W9NA 2WNMA 5HFYA 1XPRA 1B44D 2MO1A 4KI0A 3N1YC 2D2CC 4DK3C 4WORA 2CH4W 1OXVA 1Q7YC 4RKBA 4FF4A 2OQKA 3ZRCA 2DLBA 4LUVA 3UINB 2SDFA 4TQUS 2V4LA 1CZGA 1SBBB 4PZ8A 1PH4A 1HUMA 4JK1C 2LFIA 3B9JA 4ZRKA 4E71A 3D3RA 2O4XA 5C0XI 2R92B 2N8NA 4P74A 1SYCA 4RGMA 3TEHB 4P16A 3CIRB 4I7ZC 2HQEA 3CCJA 1PHJA 1A6XA 4XXEA 4C3IB 2Z59B 3KQ4A 4BBNF 3GQBA 4IUPA 4JOIA 2V1YA 1Y1WH 1HXYD 3RNGC 3OLMD 4LF5Q 4ANUA 2NWGA 5C44G 3EROA 4BKSA 2NUCA 4W9CA 1EIFA 4ICVA 2L9HA 1HUNA 1WI0A 5AUKA 1AZQA 2R93B 3GTLB 1QZEA 4B9XA 3ERSX 4W9JA 4XWWA 3UI2A 4ARIA 2KOLA 2GMIC 2IGDA 2RDHA 3R3OA 2WFWA 4L5SA 4JI7L 4PMBA 3Q69A 4TKNA 2F3IA 1HTPA 2MHVA 3G6JB 3LNNA 5D3IB 1DOIA 5J18A 1KDCA 2KWCA 4A3MG 1ZKHA 1QUQA 4X3SA 3KWLA 2CQOA 2Z0EB 5JPNC 1N5XA 3SK6A 1GUSA 1E90A 3ML9A 3PHXB 3DDCB 5I2YA 5D2MB 3WCQA 1VQ4A 1K8OA 1PZKD 1R4PB 3PRZA 3QARA 2A6ED 2WAQE 3Q8EA 2VUMH 2IGGA 2L0FA 1N9WA 1MBYA 1MJDA 2QMTA 4MM3B 2SNMA 3UDIA 2F0KA 3HOUG 5JJKA 4LWCA 2J53A 2KHIA 4LF7Q 1KXLA 3T1YQ 5CV8A 1WTVA 3OIQA 2CW0C 2M17A 2C35B 2E74C 1EY8A 2ZVOA 3IRBA 1U4MA 2RR9A 5DEHA 3AEDB 1QNUA 2LY7A 5D7GA 2VQFL 5E6PA 3CF6E 3I2ZA 4HRSA 5BYRA 3DWGC 3GB1A 1KHIA 4X3KA 4JV5L 1XLNA 2JZPA 2G4SA 3CCVA 3I57A 3JSVB 2DJFC 4DHJB 2KHSA 1Y69U 1HR0L 1GUNA 3QHTA 4A3DG 3GTPH 2LJ5A 3MA2B 3CMMB 2MQJA 1J7BA 2Z6KA 2RHQB 1ASYA 1TWHH 4N6EB 4EQPA 4NXNQ 4YWLA 3KDFA 2WS3B 4LFCQ 5JOBA 3A74A 1TKEA 2LFNA 4DA2A 2NVUI 4DHZB 4AS1A 2CCZA 3Q2AC 2INNE 4B08A 2V1CC 3C1FA 2JPHA 1ENAA 2EOTA 1JOKA 3DM3A 4M8AA 4R8NA 5C3XA 1ZP0B 2L76A 4JVZA 1B1ZA 3EUB2 1SFOH 3OW7A 5FJ8H 3ONSA 4JL9A 2J7QB 2HJ1A 3P1MA 1NMFA 3HM3A 3W1SC 3C19A 4L63B 3ZJYC 5DPSA 2JA5G 1K8MA 2J0KA 1UE5A 4TSSA 5M3MB 2D0PA 1JMCA 2ZM6L 4BOZB 1WTOA 4YTPB 3WA0A 3BWUD 3RNAC 4G4KA 1U4RA 3S9WA 3NXWA 1G2SA 4QUCA 4FJYA 3RCZA 2KEDA 2PMZB 3PTFC 5KHOA 2WIIB 4XE0A 2O2VA 1TR5A 3HOUB 3AE3B 1TWCH 4HXDA 2E2HB 4B0EA 1C4PA 3VR2A 5C4XG 1E1TA 2HD3A 2DZJA 1A8VA 3ER0A 1AFPA 4DK0A 2ZJPA 2EMSA 2LEKA 2JA6B 2DJGC 4KV2A 4C7ZA 5IA7A 2A19A 1EO6A 3Q3FA 1JWSD 3NHHA 3TZDA 2JF5A 2N78A 4F7XA 3RNBC 1B2TA 2WB1G 1YJIA 4P1CC 4XC2A 4POFA 4E74A 2UYZB 4MGKE 4W9HA 4B3SQ 2F0EA 2MCNB 3S1RH 5DPRA 5C1ZA 4NP5A 2B2WA 2NTTA 1HPCA 4PNYA 3P1HA 4FDBA 3VHTC 2HTHA 3IT4B 3ZNID 3KF8B 3SK4A 1YITA 4GNXA 3VH3B 2EIFA 5M3FG 2GLSA 2OXPA 1FM0D 2MJ8A 3GTPB 4YWGG 1D4BA 4YTMB 2ZJRA 1EY6A 1EOTA 1O7YA 2E2JH 2DHZA 5HGQA 3J81c 2XWBB 2BTEA 1F2YA 1SMXA 3BY4B 2X8XX 2ZEQA 1XT9B 5CHFA 1LTTD 3H6MA 4L5TA 2VZKD 4A3OA 1Y1VH 1V1PA 3BU2A 3BDLA 2BW2A 3RNUA 2W55A 3L16A 1RTNA 1GHJA 1IYJB 2Y5BB 1J19A 2WXOA 3CMAA 2UU9Q 2EZVA 5FLMH 3ZLZA 3T3OA 2WP9B 4IM2A 1FO4A 2FXQA 1QILA 2D62A 2DYBA 1F9QA 2PQAB 4BZAA 1T0SC 3MTNB 1MI2A 4C4VB 2NBFA 4U68A 2N9XA 4HCEA 3PO2G 5BYQA 2L11A 1AH9A 4EQOA 3SHQA 4LCDE 2RKSA 3CF5A 3VR6A 4A3GG 2AQ2B 3A9JA 3K81C 4PT5A 2DYOA 1XX8A 3OSOA 1RL2A 2A68D 4WJWA 1KC8C 1LT3D 1ONLA 3OTOL 4JI5L 2R2QA 2DUDA 3VR8B 1EQVA 1I50B 2NVYH 5M5XH 5C3EG 1MG4A 2WGSA 1H9KA 2KXJA 4KZCA 5C4ZA 1KOTA 1KRSA 4B0MA 4HVBA 1XXGA 4GXBA 1RJTA 3T1HL 5E1FA 3KUPA 4A55A 2OCEA 3PMFA 5GXGB 4DV0Q 3MHBA 3U4EG 2ZCCA 4NJ7A 1C9OA 1EYCA 4GB9A 2QJLA 5M3MG 5LMUL 4FADA 1EY9A 3A33B 3V61A 2YU9H 2H5XA 1X9NA 1WXVA 1E6EB 4RGTA 4KKSA 1UNSA 3CPFA 2WX1A 2PMVA 3ECIA 1FGUA 4BBSG 2Q5WD 1SNPA 3NS1A 4KZ0A 2LGIA 5EE9A 4B3TQ 1A3VA 3ZDMC 4JBKA 3IAM1 1DOXA 1WE6A 3CQZH 4RF1A 4CJ2C 2NVTB 3QJYA 2O2LD 5JEAH 4JI0Q 4XYQA 5GMVA 4ID6A 1VQDA 1FNWA 3AV8A 4P6VF 3CCQA 1EWCA 3CC4A 1JWAD 4QB4A 3M7NA 3J80i 5ELNA 3JVZX 4WWOA 2NVXB 2LHEA 1HNXQ 4GNXC 1I5FA 2IBIB 3C0RB 4IWPA 3K58A 2A4ZA 3J80L 4JI0L 3PSIA 2KUMA 4IDIA 1WTHA 1E8YA 1ZYRD 5EPLA 2JXMB 3A5ZB 2QEJC 1NYQA 5A2QE 4IFDG 2TSSA 2ZVNA 5AUIA 4APVA 5C4JH 4MDKE 3Q22A 2JA8G 1ML0D 5JJLA 3K59A 1ZE3D 2K14A 3P2BA 3QQ8B 1CHQD 4DHJD 1PYWD 3OHXC 2EKIA 4NAWB 1YI2A 5TSSA 1LTID 2BA0A 2WXGA 2VQEL 2B63B 3CRLC 1HH2P 2WU2B 1L0WA 1G51A 1VCIA 2KENA 3WOEA 5IYBG 4B3RQ 1GHKA 4IFDJ 1PTOD 1SYDA 1OQYA 3AN1A 3GTKH 5IAAC 4A3JB 1IW7C 4RHRA 4OONA 4RMFA 3NTIA 2PMZE 3URYA 3V96A 3N52A 1PH6A 1T5XD 3FKIG 3W1BA 1UF0A 3PCOB 1WH3A 3FRPB 2F0GA 1A2UA 4JI1Q 1SNOA 3S2HH 3IFDA 3D8GA 4NAWA 1E2ZA 1LUZA 3CW2C 1TS2A 2KDMA 4OZBA 5JVH3 5IYDH 1OXUA 2K28A 3A7AB 1KFYB 3S15H 3IFTA 4EEWA 3J81i 1K8GA 1EZ8A 2PVGC 2WXLA 1WTWA 2K1FA 3C46A 4EVOA 3A4SC 3H6NA 1QOHA 1P16A 4RKLA 2OQ0A 2A8VA 3AYHB 3DBHB 3ZJUA 1K3BC 1JB3A 4C3JG 1XCQL 1E0BA 1IYVA 3OJ3A 2FHTA 1ZXTA 1BF4A 2JA8B 4RF0A 4A6QA 1VCBA 3KF6B 5M9OA 2N3SA 5E4WC 1ROEA 4PYUA 4ACFA 3RLOA 2UU7A 1E10A 1BO0A 5K36G 5JJIA 1JMLA 2V3NA 2B2VC 4US8A 3H3VC 1NI3A 2EJMA 1JT8A 1CI3M 3AI5A 3GTGH 3B2FA 4NJ6A 3FEWX 4LNKA 4NPSA 3IAS1 2L7RA 4RH6A 1Z6HA 4H13C 3RN5A 4LF5L 4LF8L 3AE1B 4EX5A 3EFCA 4YY3Q 3KW5B 1PH2A 1E9MA 3W1GA 4GOPA 2JT4B 3NUHB 3M62B 4PZ7A 5C2TB 3KUCB 4MELA 2KVRA 3ZVVA 1G91A 4TRDA 5GAGC 3FMCA 3VTVA 2MA9B 2PPHA 4CDFC 3I73A 3GTJH 2KZRA 1JE5A 5L95C 2R7FA 2NVQH 3I56A 3MXNB 3U9SA 2KJHB 4PK1A 4I6LB 1MIUA 3TP6A 2JA5H 1N61A 5AFWA 1JWUD 2E2HH 4ZCKA 2RCFA 1N33L 1SE4A 2L4NA 3VQIA 1SR3A 3ZJVA 5GAEC 1XYIA 3PF4A 2NVTH 1B8AA 5LLIA 3TEWA 4TUUA 2Q8TA 2VUMB 3U9OA 1HNXL 4ZAIA 3AQQA 4GKKQ 1FRDA 1LGRA 5MPOA 4FA6A 5C4XH 2ZJDA 5I6WA 4DV7Q 1QWYA 1V97A 1TWGB 4F8CB 1YQBA 3KDFB 3I4NG 1Y14B 3SR1A 2HJ8A 1RDPD 1L2FA 3VTUA 4IJHA 1I6HH 1LQBA 1F9RA 4X66L 1VQCA 4DXFA 3OW2A 5C4HA 2B63G 4ODGA 4BKSD 5ELOA 5HGTA 2OTLA 5D65A 3DHQA 2V9HA 5EBCA 1NSNS 2KNBA 1CKMA 3I8ZA 1L1OA 3P75A 4A3BH 2ZTCA 1ZUD2 1WM3A 3MJWA 2K0PA 5COYA 2FCMA 2KAJA 1DOMA 1WYGA 5KEEA 4HDOA 1WE7A 1GKHA 2RVLA 3K0XA 4IM0A 1LTAD 2V4DA 4K8IA 4KIKB 4LNIA 4EFOA 1XTDA 4DR7Q 3I72A 4ZKCB 4IUUA 2PVOD 3RD4A 1YNJC 3VDYA 1KLUD 4R4OA 3M63B 1HFNA 1EYDA 4G0NB 2BDOA 1DOLA 3EBEA 1JROA 3AM9A 3GP7A 3E56A 3QAQA 1GC6A 4NJCA 1JQYD 5K5PA 3J7AV 1UBIA 2WXPA 1K83H 2IPKD 3BVGA 4DR4Q 2MGSA 3KUDB 4HCPB 2BBCA 4FF1A 5CC4A 4IUTA 1K51A 4MTNA 1LM0A 4LF4L 1IGCA 5G5HA 1WVLA 3PHWB 4KDLB 3KWVA 4D2KA 1N62A 2Y0SE 5EQ0A 3C8YA 1FJGL 2QKIC 2Z6KC 2IX1A 2B8FA 5FO9B 3HHMA 4F1SA 1VLBA 1PYBA 3AU5A 3VA5A 4CKCA 2KWVB 4O2DA 1CM9A 3L2PA 3VAWA 1TVXA 3SD5A 4GOPC 1GD7A 5KYIA 1EEID 2HDEA 2AMCB 3K5OA 4MH8A 1DGSA 2C9WB 1ASZA 3DVNU 4L6TB 1RAXA 4DR6Q 5EE3A 1BVSA 4XDCA 1CFMA 1SNCA 3IVFA 1Y8PB 1VQ9A 4ANXA 2G9DA 3PLVA 1SXTA 4HROA 5CBEE 3PO3H 3S1MH 3TEXA 4DV3L 1LTGD 1DM0B 3SHLA 4DR5L 3GTLH 4OO1G 2KX3A 1E1OA 2KWUB 2K01A 4FHJA 1WIAA 1RCVD 4REZA 2PNRC 2IWHA 1PGAA 2MHJA 3HVDA 1WJNA 4J6HA 3AU7A 5IGBA 3VR5A 1O7IA 3UE0A 2Q2UA 3TEZA 3I7FA 1OFFA 1D8LA 2JA7B 2XK5B 2B2UC 2E2DC 5C5LA 1BMLC 1STYA 2KFKA 1QF6A 3HOXH 2YTXA 1YNND 2CH4A 2PLPA 1X65A 1SN8A 4LFAQ 3M4PA 3GTQH 2BH8A 2JSVX 3I9V1 1WTRA 1MJEA 3STBC 4X62L 2K03A 3UQBA 4NZLB 3CU7A 2TMPA 4DAPA 1X1MA 2M0XA 2K52A 4KN7C 3PIOA 2BPSA 3NS8A 1GUOA 4AJYB 1N33Q 2F1MA 1K52A 2N9LA 1P3QU 2Q8IB 4O1NA 1NDDA 3DBLB 2EQSA 3S15B 3NVYA 5DNFA 4NNJB 2MH7A 3P63A 3FKYA 2WQYB 5A35A 4EKUA 3H7SA 4CKEA 1ZDXA 2A74C 4CDEC 2FE8A 2RPVA 4IFDH 3K9PB 2L1BA 4XT3B 1SROA 4FVMA 3ZXRA 1FYCA 3GTOB 3DCGA 1WCMH 3VRAB 4FHKA 1GUGA 4YCWA 3CC2A 1GUWA 2A1AA 4NMZA 4A3EG 1J5EL 1OEYJ 1VR9A 1D5XC 2RCNA 2B2YC 2ZCBA 3DBHI 4A8XC 5KHQA 1GB4A 3K7AH 3EIVA 1UH6A 3GTKB 4ZRIA 3E0EA 2GI9A 3FILB 3RZFA 1JWMD 4QJFA 2F0WA 1IW7D 2FJ2A 2Z9HA 4K5XA 5CV9A 1HJPA 4EQ5A 5I6YA 1W3SA 2GN5A 2R93H 1GNUA 1HEZE 3PZDA 4DK5A 1VDZA 1H8CA 2YLMA 5CHWA 1D3ZA 3S17B 4FO2A 3UE1A 2A6HD 3C2PA 2KO3A 5CV5A 1BDOA 5IWAQ 5M5YB 4LF4Q 2JA9A 4X64L 1V80A 4ARCA 1PTOC 3PRMB 2ACZB 2RSOA 4DR6L 2F0IA 2K5WA 1NR2A 2VZAA 5IY0A 1N32L 3BINA 4HLEA 4B3TL 3TQYA 2O6VA 3J80c 4LF6L 4ASWC 1CA5A 4HJ8A 1Q82C 2MX2A 4A20A 3A1QA 2IO0B 3Q3JA 3Q3NC 4KJOA 3QK0A 2E76C 1SLJA 3OMGA 1TWCB 1PFBA 2PO4A 3GV6A 2AX5A 1BNZA 4MGYE 2INDC 1V2YA 1FJGQ 1R4NI 1TKWB 3DPDA 4A3KH 3RZWC 4K3CA 2AHOB 3MJ5A 4C7YA 4A3PA 4UPAA 5BN5A 2MJEA 2WXNA 1V1PB 1FVIA 2X6LA 3BDOA 5CORA 4JI8L 5C3WA 4ALPA 1XNQQ 4ULLA 1HR0W 4KHVA 2Y3AA 2F0VA 5K36H 4DR1Q 3H8HA 3ZW3A 4NQLB 3A8KE 4JWUC 4W9IA 1WI5A 5EGTA 2BGFA 3M3YB 5C6AA 4W9EA 2NYZD 4ZUJA 1M8AA 2WB1B 3PV1A 2WDRB 4GLAC 1IZ6A 3BIID 4IQZA 1SEBD 4OL7A 2JK8A 4MGIE 2VW9A 3L4PA 1S3SG 2FAZA 4OELB 5DPTA 1L5PA 2WXIA 2PEAA 5FLXL 1TWHB 1XEEA 1EIHA 3DUZA 4R4IA 1XPOA 1QZGA 1WZ3A 4LNQA 1XTCD 3SXHA 1VQMA 2AUJD 5JHBA 2FFKB 3PGZA 4K6DA 4HJKA 3GTJB 3K9OB 4K2KA 1MD2D 2UXBL 1UWMA 4OIKA 3I3TB 1PA6A 1K9MC 2KT7A 1PDXA 2ZT9C 1WFQA 1YQ3B 3BS1A 5FO8B 4R4QA 4URKA 1BCPB 3S17H 4M00A 4IN3A 4ME5A 1STGA 3DWPA 3HOUH 2O2VB 3B6YA 3BVMA 2IY1B 2YV5A 1EOVA 3E6ZX 4DV6L 2KOXA 3HZXA 3PT2B 2VRRB 3OAWA 2DY7A 1VZ7A 4FULA 4HJ9A 1ENCA 3ALBA 2R3ZA 3LYYA 2DBYA 4RM8A 1Q0WB 5IODA 2JY6A 5C4XB 1WF9A 3J7YW 1YNTE 2KN5A 2SNSA 1QKZA 2NTSA 1JW9D 2Z1CA 4BA2I 3AXCA 5C0XG 2JA6H 3PO0A 2LKVA 3PLUA 4IALA 3HM6X 2EJGC 5L83A 1X3FA 4IUNA 1EL0A 5IN7A 1V43A 2HCCA 1L1OB 5EKKA 4X65L 1FD6A 3P4SB 4A3DB 2Z6BA 2B2TA 1KJTA 5TR5A 4DR2Q 1C4QA 3L9AX 3VR3A 2K7VA 3DBLI 2A69D 4N59A 3T1YL 4PV1C 1K73C 4S0RA 5DLQE 4EZLA 4V0BA 3MAQA 4C80A 1BUIC 3OG5A 2FCNA 4Y52H 3M3JA 1VQKA 4FJVB 1NBFC 3MC9A 3K6OA 2FIFA 3NBHB 4DUYQ 1CQFA 2Y5PA 5IT9L 1LTRD 3CHBD 1QVFA 2OOBB 4C4VA 4W9GA 4OEMB 3H3VI 3ZNGC 4JBJA 2NPTA 1P7FA 2LVQA 4BXXG 1QVGA 1R7SA 3PUWA 5GQOA 1DD2A 3UF8A 1MGSA 1CTMA 4KV6A 3GZNI 4IPGA 2EY5A 3S14B 4ZK9B 3T16A 1RD9D 4LFCL 1VRAB 2LXAA 4WAAA 4XDDA 1WTXA 2DX5B 2PKOA 2KK8A 2ZTDA 2EKEC 3VYRA 2I5LX 2L52A 3VUXA 1V5TA 3B1LX 4ZHOA 3RUZA 1H9SA 4C3HG 5KIXA 4LUZA 2VB3X 3QC8B 1YVCA 2EYHA 4TQ1A 1O80A 1SNQA 3K7UC 1EYGA 2BWFA 5A2QL 3TBLD 4DUYL 2D3AA 4JI4L 1D7QA 4ITKA 1A62A 4FYDA 1TT5B 1BKBA 1CSPA 1L6VA 1HZBA 1U4LA 3D4RA 4BBRG 4JI7Q 1MI0A 2CVRA 5C44B 1RWSA 1PMRA 1GUTA 1WCMB 2GVAA 1BBXC 4C2MB 3P4RB 1B53A 4LJZC 3I5JC 2UXDL 1Q12A 3L17A 3DBRB 2BH2A 2QSDA 2QW7A 2WXKA 2VQFQ 4W9FA 3BZCA 2J7ZA 2PW9A 5EE0A 1F0ZA 3OIPA 2K33A 1T0RC 2L3ZA 2WB1E 3EJIA 3ZGZA 1GJZA 1KDAA 2NZOA 3AU4A 1WX9A 1RFKA 3J9CA 5JPMC 4K5VA 3ZIMA 2K22A 2K4KA 2BYVE 5FR6A 1F2ZA 4NW2A 4I6PA 2BYFA 3BJUA 1WGKA 2ZTEA 5T8IA 4ZYSA 2N1WA 1VMPA 5ELFA 2B39A 1T6BX 3RZOB 2MO0A 2NBWB 2ZXRA 1BBWA 4CYEA 3I90A 4WJQA 2JQRB 5IYCG 5HI1A 4A3MH 2EYJA 3N1ZC 1EYAA 4DR4L 4A3IB 2J0TD 4C3HB 2B2TC 4DPGA 4GDKB 4M8MA 4OZAA 4ZRQA 1S5CD 2MP2A 1LT5D 2ICIA 4A76A 1HTLD 1SYEA 3VRBB 5J22A 2CJOA 2IY0B 2VXWA 3HKZG 4LNNA 1RYJA 5EKLA 1ILQA 4TV3A 3L13A 2R6GA 3UIOB 4MZ9A 4A3KB 1IHZA 2Y0SB 4OVVA 5D14A 2V0GA 3BZDB 4DNRB 2HD5B 2DAFA 2D3BA 1L4ZB 1TJEA 5DM73 5IGFA 1Z9FA 3QR8A 4QL5A 4LF6Q 4NXNL 2WXHA 4IURA 3IL8A 4OWWB 3OJ4B 2YEPB 4QGUA 1BCPC 2SEBD 3CRKC 1PRTF 2A73B 3SEBA 3K80C 2MLBA 2W82A 2YU9B 3HOWG 1IGDA 1K8AC 1I3QB 1G6ZA 2JWUA 4JYAQ 3VFKA 3NWSA 5M5YH 4OVUA 1V49A 1RKNA 4ZOHC 2EE1A 3DHIC 3J81j 1J7AA 4DV0L 3W1YA 5M5WB 1C48A 2CWPA 2E6XA 2Q2TA 1G8ZD 2DN8A 1HQMC 2CHXA 1PH5A 4K7UA 4TVAB 3SFDB 5L37A 1L4DB 2MBEA 3QWZB 4DAYB 2KC2A 4WWPA 1FL0A 3HOVG 3M4OB 2K5PA 4M0WB 2H89B 2F0OA 3TDQA 3RZOH 3QCAA 3PUXA 1E5WA 5KGUA 4HIOA 3F2CA 4NY0A 5CHVC 4JQWC 1VZ6A 4NAMA 1CZWA 2W54A 4A3KG 1V8CA 4HKZE 5LXIB 3F8TA 4JYAL 4F87A 1DCZA 1EUJA 2NZ1D 2V3PA 4ME3A 5E7NA 1EEFD 2KQ4X 2JA8H 1ZYRC 4DV4L 1TXYA 1WD1A 4DV3Q 1EF5A 2WKDA 2WAQB 3SE0A 1NYRA 1BT0A 3ABVB 4EOYA 5C3JB 2MBHA 4II2B 1IP9A 5KNBA 4AYBB 2K32A 4DUZL 3NBHA 3MXNA 3AFPA 3TUOA 4QIWE 4XZ4A 3S16H 2M00A 1WXMA 4Q0FA 3ICEA 4YSXB 5LMNW 2KCCA 3VH4B 1ICFB 1E7PB 3W5VB 1IBXA 3OYYA 1HA5A 4A3JH 4BY7G 4M02A 1V81A 1MFWA 1H9JA 2CHBD 3A9KB 3T9LA 1VQAA 1YX6B 4LMQD 1MHHE 5BR8Q 4AYBE 1SIJA 4K0KQ 2H1EA 1UEAB 3MWYW 3ZYYX 1IBLL 3DQVA 4BFRA 3HOYH 3IKJA 4F7ZA 1SJED 1TY2A 2L5TA 1C8CA 3WIMA 1B9NA 4P75A 2I2YA 1DJRD 3P7JA 1TS5A 4C1NI 2K25A 5EAYA 3CD6A 1T0QC 2PQEA 4B3ML 3EN2A 4AIMA 1WZ0A 4HN7A 1KQSA 3I4MG 1V9JA 2XIWA 2DZIA 1IPGA 2V4IB 2KMCA 4DV1L 3U4VA 3M4OH 2KMMA 3N1XC 2F0SA 5FLMG 3N32A 3T51B 2K6AA 1XNRQ 2J52A 4JX1C 1LXDA 2KHJA 4XX5A 4WRDA 2IYDB 3CKIB 1STEA 3GTMH 3TP5A 5IGCA 3PIO3 3V60A 4G57A 1RF2D 1QJOA 2PE6B 1WJ4A 2ZZPB 1N34Q 4OXPA 3E9IA 1H4RA 3PV0A 1IBKQ 4AYBG 4NXMQ 1N60A 1X56A 2AL6A 2F0PA 4IWQA 3N6RA 4JLCA 2BQQA 2BKFA 1C79A 3JC66 2WWZA 2JQOA 1NVID 4A3GH 2KTRB 2RDBC 1QVCA 1SE2A 4JIOU 1ZKOA 1N34L 1XMOL 1PYSB 4Z9CB 3TSSA 4BY7B 2X69A 2LMCA 2MJDA 1R9TH 1BXTA 1DZ1A 3U52E 3NZSA 5J17A 3ZNZB 4A93H 5C3EH 4JI6Q 1FXIA 3RD2A 4DV2Q 1J8IA 4QMGA 1P98A 1D2BA 2AWNA 4QUFA 2K8CA 4A3CG 1QQRA 3S14H 2NCNA 3K5LA 1JQ4A 3W2DA 2KDIA 1PLFA 3R8BA 5LXHA 4RGOS 2LRUA 2K50A 2RQXA 4WJNA 2BB6A 4AOFA 1E7UA 2YTVA 2ENBA 1NBWA 3U4ZA 1CA6A 2JA7G 2KA7A 1HZ5A 2LVPA 2EELA 2M1MA 4KIKA 1PH1A 2WDVB 2I1KA 3ITPA 3U58A 1JRPA 3A1QB 1RM6C 1T9HA 3J81L 1YQ4B 1C1YB 1P8LA 2KJ6A 1Y56A 4EZJA 1L6UA 4WJPA 3I4NH 3AEEB 1FNVA 5DAUA 2HTME 3GOEA 1C4CA 2IJ0A 2ZW1A 5IP4D 1OTCA 1JORA 3KK7A 2NVXH 2HIVA 4A3LH 2IGHA 5EE1A 5JEAG 2EDGA 2ASQA 1D5MC 4JI6L 2QDBA 4LNFA 1PXUA 4A3BG 3SK5A 3K8AA 2UXBQ 1SDFA 1IL2A 1I6HB 3PSEB 1ET9A 4DGZA 3R7RA 2B2WC 1RFAA 4B3RL 1PZJD 1V86A 3MFGA 4DUZQ 1BUVT 1F2MA 2HIXA 2XN9C 1R4MI 2KX0A 3RMHA 2ICEC 1OTRB 1C0AA 3K5NA 4PG3A 4IC7B 3NSWA 2UUBL 2WINB 4C3IG 4K3BA 4P2CB 3APDA 3E9SA 4C1NK 4MEMA 2ZNVB 5E6JA 3W9CB 2IT1A 1ZPSA 1EY5A 1CK1A 1QG7A 1OXTA 1Y8OB 3PIP3 2M8SA 2WDQB 2R7DA 1EQTA 2RA4A 5KNDA 1TYGB 2X38A 2N7JA 4ZQ3A 1ZXIA 2XVSA 4BAXA 4N9PA 4P72A 4LDTD 5JHAA 2Q2IA 2EXZA 3AB9A 4QIWB 4BY1G 4DN4M 1KABA 2EMTA 4HIKA 2VH2A 1SSOA 1WJJA 2K04A 2NVQB 2K05A 2D11A 4JI2Q 1SFOB 1KM7A 2F0TA 4WWMA 2EPBA 4KGRA 1SE9A 2XGTA 5GAHC 4ANWA
chains in the Genus database with same CATH topology
5ELCA 1FFUA 4KKJA 3V3XA 1Q1BA 3AE2B 2KVMA 2BA1A 4WQMA 2AQ1B 1FGBD 2Z8LA 1EM7A 3SR6A 4OHJA 4OGQC 1O78A 4BWGB 4EQNA 3K57A 1QOFA 5CGKA 2VNUD 2M56B 1ICWA 2QCPX 5JVG3 1I4XA 3T13A 5FOBB 1WRIA 4DF7A 1FRRA 3MZ5A 3NPPA 2YYZA 4DQOC 4A93B 3I4LA 2L0CA 1JALA 1GJXA 1II3A 3UI3A 4H0LC 1PRTB 2PCFB 1SMYD 1SSNA 2WXQA 1F2LA 1NEKB 4LK0M 4USAA 1Z47A 1T3QA 3PUZA 3SVMA 1LV9A 1YN3A 2JE6I 1ZEQX 1EU4A 1D1IA 3RZDB 4FF3A 2ONQA 3AH7A 1IUEA 4UAIA 1PFDA 3OWEB 4A3FB 2BB5A 2I46A 3T4AC 2B8GA 4J8QA 5LL6S 1N63A 3EFXD 1O7LA 1KRHA 1HHVA 1FXAA 1EWHA 2JU6X 5BMIA 1AP0A 5IGGA 1LTBD 1MPEA 3J81E 4RHSA 2E3TA 2NN6G 2BS2B 4N58A 1EU3A 3HGBA 1D6EC 2R7ZB 4F8MA 1Y8NB 3PUYA 1P7EA 3CQZB 2JEAI 4KHZA 2XRQD 5F2DA 2DY8A 3HP3A 4HEDA 2WXFA 4KX6B 4MT5A 4J3OD 5JAVA 4YTNB 2LJIA 2F4IA 1D1KA 3QOLA 1WD0A 1XF5L 4O42A 4KK7A 1QOGA 1BQQT 5I4DA 1LO5D 1TQOA 3MEHA 1I4RA 1G2TA 3EA6A 3RLFA 3A8IE 1M4VA 1VF5C 3S2DB 3LX0A 3OPOA 2RDGA 3VA7A 1GOZA 4H2AA 5C4JB 2I07B 2NB0A 4G7OC 2GRIA 2W3SA 2LHDA 4LTUA 1LACA 1SF0A 4J1MA 1SNMA 3S1NB 1YN4A 4KY6A 4OVZA 2WACA 3MP9A 1Q8IA 3BDCA 5BN4A 2H4OA 3AB5A 1GB1A 2M2LA 4DXGA 3HOXB 2DWQA 1UWXA 3RPFC 4OO1I 3HUIA 1TU2B 1CHPD 1RHPA 1TKGA 1EY4A 1L0YB 4R3DA 4IOIE 3J80E 4H7BA 3X3MA 3R2IA 1LT6D 4C3JB 4XQJA 3H91A 3HS0C 2D9UA 2F3VA 2HDMA 2K1BA 2WKCA 2MUYA 5J1ZA 4KGSA 4HCSA 2PYKA 3LB8C 1BOSA 3FILA 1S5BD 2AUKA 1I6VC 3HRZC 4WIPA 2BS4B 1KDBA 4IZ8A 4MN3A 1J7CA 4BBRB 2BE5C 4G7ZC 2E2IB 3MC0B 4YSZB 1EWYC 4US9A 5EPJA 1F2RI 1WWTA 1XCTL 3H94A 1OO9B 3I3CA 5ELDA 1ACCA 3AECB 4JWSC 2B2UA 1W6JA 4GZYC 2F0MA 1HRJA 1EZ6A 1K83B 3ERQA 4KY7A 2MPMA 4XQNA 2EYLA 4AQ7A 1Y1VB 4DU9A 3Q0AA 3GTQB 3HKZB 2A5HA 2C9OA 2I38A 4U673 3I4NB 1JWBD 4HSPA 1NAPA 1HZ6A 3NP8A 5JXVA 3GO5A 3P42A 1OXSC 4L8JA 3NUCA 1YN5A 5I2XA 4CGYB 4CBVA 1JOQA 2K3UA 1N5WA 2BDNA 3DMUA 3LXFA 1EIGA 1VMCA 2PTLA 1C78A 2KQ3A 1B4OA 1DOKA 4FXDA 4MIUA 2SAKA 4FNFA 2FINB 2GB1A 1LABA 1PFMA 1FIQA 2DNEA 5I9PA 2WXRA 3AE4B 2YEPF 1IKLA 1JE4A 3KLSA 2SOBA 1TIID 4HSVA 1NUCA 3FPPA 3JAML 5T1GA 2QIEB 1I4QA 3HVZA 3NE5B 3LWEA 5D3DA 2K5QA 3IAYA 2H88B 3E5SA 1GAQB 1PFNA 2F0NA 4PQXA 4HR7B 2JP1A 2DNCA 1JC7A 3K0YA 3O13A 3PO2B 2K5DA 2B2YA 3TEYA 2CW0D 2NN6H 5T1IA 1BR9A 1FCLA 3AMUA 1H9MA 2AWOA 5CR3A 5ELBA 4A3GB 4QCLA 5EBDA 2JEBI 4JPSA 4BBSB 1ESRA 1R9TB 4OZCA 2Y5CA 3JAME 4JE3B 4K5WA 3V2TA 2F0UA 5BMGA 1PRTC 1PZID 2PZUA 1FEHA 1V1OA 2GI9A 1PDQA 3NQIA 4K8JA 1XWEA 2KN4A 4CHTB 2IX3A 4A3MB 4KKIA 1E2WA 1S4ZA 1SMYC 1SYGA 1SE3A 2M19A 1PGBA 1Q90A 3F2UA 1UGJA 2JX5A 4XTCS 2BT6A 4KKUA 3HOYB 4IFDI 5IIFA 4FP5D 1FNUA 4LK1C 1HQRD 1BCPD 1SYFA 3TN2A 3AE6B 2WP8J 4OW0A 4CQNA 1C76A 1S5FD 3NVWA 2PZTA 2KEEA 1JR0D 3Q8FA 5IT9E 2N88A 2NMQA 4L23A 1ESFA 5C5MA 5FR3A 4HTHA 2KECA 4RWSC 1KTKA 2EY1A 3AEFB 2E75C 4KN4C 2MEKA 4HKQA 2KACA 1I4HA 3H0GB 5LHY1 1VZ8A 3PZ7A 2ZW0A 1MVKA 1H9RA 3BYYB 1I4GA 3S1QB 3DWMA 1EY0A 4RCNA 1KNAA 4KD3A 1D5ZC 5ELEA 3MVVA 4YXDB 4ZRZA 2CU3A 1RTOA 1BCPF 3A7LA 3U2SC 1WTQA 5BN3A 3P4QB 2A68C 3HEJA 3NK9A 3C1EA 2AQ3B 5HURA 1STBA 2VB2X 2OEDA 1B50A 1FMAD 3HRDD 1TWFB 2OEOA 2ZXOA 1JICA 1PGXA 1IKMA 1YJJA 2CQAA 2FMCA 3MHZA 3AMZA 3SFEB 1XLPA 2QILA 1W6KA 4KTAA 3C3LA 4OO1H 4IUVA 1F2RC 4A3BB 3QIAA 2ID0A 1XO3A 3AE9B 3HOZB 3EQLC 2IX0A 3KLSX 1V8QA 2A6HC 2GA4B 1ILPA 5LL6X 4QF4A 4B9WA 1OQRA 4H44C 2RMMA 2PPBC 1CQVA 3L7ZC 1B9MA 2D5GA 3BG3A 1O7ZA 3AE5B 3AE8B 2WV6D 4XDXA 2HCIA 5FO7B 4N9TA 3T53B 4YT0B 2WU5B 4FXCA 4YIJA 3SDZA 3IXSA 1J9OA 2EYFA 3NQTA 1STNA 3E0JA 5IGDA 4ZKBB 1JOOA 3B2GA 2N0SB 1H9SB 1G291 4WAFA 5KNCA 3DEOA 1Y1WB 4MACA 4ZRPA 1OXXK 5E3FA 4Q5VA 2EJFC 1K50A 2PW5A 3AE7B 3LWUA 2L12A 4DNTB 4TKOB 5IOCA 3Q6SA 2BE5D 3D6WA 4K6LA 2HUGA 3BYTB 3M7GA 1MSHA 3HG9A 1JCKB 2JXTA 3Q23A 3ND9A 2XNAC 1IBXB 3AEAB 1DXMA 2F0FA 3AEGB 3DXJC 1CJEA 2R61A 3T3NA 2BCOA 4JBWA 1NR4A 4EGVA 4V190 5HG2A 3AEBB 5FKAC 1C77A 3A8JE 2OHFA 3GTGB 1PTOF 1F77A 4A3EB 5H92C 4KJNA 3NRZA 4C56C 5I9OA 1DYQA 2G9HD 3FDTA 1X32A 5G5GA 5CV6A 2EYPA 4HMIA 1YMHE 3A56A 3W5UB 4CJ1B 1WSPA 4GDLB 2A6EC 3GV3A 4ZLTF 4M0WA 1GPXA 5FLXE 2JSOA 4BS9A 4XWTA 2JA5B 5DM63 2PIAA 3H09A 4UDUC 4DAVA 3QG1A 3D4WA 1S5ED 3TZUA 2X6GA 4DFAA 3W3AA 3MXUA 1Q10A 3CWIA 4L1BA 5G3LF 4XYOA 1UAPA 2F03A 1TZOA 3KBXA 1KH0A 4FF2A 4S3SA 2G1EA 1RODA 5M3FB 1CT1D 1K53A 2KCNA 5C0XH 1TS4A 3TMEA 2W3RA 5ISRA 3D4DA 4YSYB 1WTPA 2F0DA 5EKIA 1ENFA 2IW3A 2CJNA 4LLGM 4A9AA 4BA1I 3D31A 2NN6I 3OWFA 3X3NA 4K2LA 1A2TA 1AWDA 2Z4HA 3EVQA 3TBIB 5KYLA 5JJZA 5C0XJ 2F0JA 2EY6A 1AN8A 3ONAB 2INPE 3D6CA 3VR4A 4R8IA 1PUTA 2N9KA 3HOWB 1KLGD 5G3LD 4NDXA 2E2JB 1FCCC 3DWQA 3QOJA 2JYTA 1PRTD 3Q8CA 5CV7A 2F0QA 4KMUC 5H8YE 1SNDA 2XWJB 4X3UA 2EY2A 3QB3A 5J39A 4RFBA 2MP1A 4DAYA 1QNKA 1TKYA 1QOBA 5NUCA 1IYUA 1MSGA 3KF8A 1ZOYB 5JEAJ 3J7AF 1OQQA 1R4QB 1Z7TA 4KKTA 3R2TA 1XLQA 2DYMA 2L1AA 5BMHA 3ZQ4A 1STHA 1F9PA 2QF7A 1FR3A 5C3EB 5KRUA 1A15A 1L0VB 1MHXA 1FD7D 5E4XA 2FBWB 1A70A 4A90A 2JYEA 2N55A 1S5DD 2OT2A 4RAUC 4LAAA 2C5CA 4ZHPA 4ILWA 1TY0A 1VJKA 1HFGA 1TS3A 2NVYB 5M5XB 1KF6B 3W1SA 3U7ZA 3ND8A 3VYTA 4KGTA 3NWTA 2IL8A 4PMWA 1E0ZA 1HCZA 1STAA 1FFVA 4HMJA 2BYTA 2WLBA 4XT1B 4DK1A 1I7HA 4FXKC 1B3AA 3NVVA 3BVZA 3KBGA 2K9XA 1AZPA 4KD4A 1QB5D 1GXDC 2ON8A 4WURA 3R93A 1KNEA 2MJ3A 1T5EA 3MTSA 4XQQA 4HAEA 2M0AA 2O5JC 2L55A 5HHDG 1NCVA 4K14A 3MFYA 1LT4D 3SK8A 3N9YC 1QOAA 3G7LA 3I91A 3I4MB 1KAAA 5CBAE 3ZJTA 2ZXPA 5EJWA 5EPKA 3M4YA 4R9WA 3T56B 2FUG1 2EYMA 1ZXHA 1PTOB 4ZUIA 3QWNA 2XSCA 4IKGA 3PUVA 4MHEA 3RFZB 3MXPA 2LS01 5CMDA 1F9SA 1SYBA 2F3WA 2PW7A 3GS2A 4GLSC 3KLRA 3EGRA 2F0LA 4OIJA 2LMCB 3ETRA 4RCOA 1X3PA 1C4AA 3Q8BA 1QE6A 1Q1EA 4M1UB 1YNJD 3GD7A 1CZPA 4HJGE 4WH4A 3P20A 2JYOA 3DEPA 3NTHA 3FKIB 3IT6B 3PZ8A 3TP7A 3NZ3A 1AEXA 2J42A 3FPUB 1DONA 1SJHD 2PZWA 3DM1A 3VYSA 3HOVB 4FXGC 2Q8RE 4BY1B 1ZDVA 4IUQA 3OOCA 1LLRD 2FMMA 2XRSD 5FK9C 3Q24A 3BK1A 2EYOA 1C9FA 2EVBA 4L2YA 3WOFA 3NBIA 1X3QA 1QCBD 3TP8A 3QO2A 1EFID 1TWAB 4TMAB 2BOSA 1VF7A 1IL8A 4F88A 3V05A 3WDNA 1A3TA 2RDFA 4CKBA 2L83A 1B9RA 3BK2A 3PO3B 4TQ0A 4PMCA 4RGNA 2B76B 1DOYA 3DWAA 1A3UA 1VDVA 1TT2A 5CV4A 1U9RA 5BYSA 2IDYA 3S1MB 1UUPA 2LUMA 2J4XA 4XIGS 4Y7NB 3NVZA 3FVQA 1I4PA 1WXQA 2HDLA 3K5MA 2RSNA 2WXMA 1HA6A 1U4PA 1DGJA 1YNNC 5CYUA 1QT9A 1E2VA 1L0XB 4I65A 3Q8AA 1SB3C 2A69C 3M85A 2RBMA 3FAHA 1QLBB 4X3TA 1AW7A 3A54A 5IGEA 2KJXA 2Z4IA 1SAPA 2F0HA 4E6IA 1ET6A 3P4PB 3S1RB 4CJ0B 3OMCA 2BS3B 1NENB 5LNK1 4KY5A 1AYFA 1PTOH 1Q3LA 4Q2JA 4WFN3 3I70A 3A55A 3K7AB 2VZKB 4NKLA 2KWDA 3MXGA 2O5IC 2L32A 3S16B 4G7HC 2WXJA 3L3OC 4HEA1 2B2VA 4RA8A 2D5DA 2OF1A 3VYUA 1LTSD 3S2HB 3VR9B 2M9VA 1XLOA 3FC4A 4EE2A 3NTKA 4RNAA 3GTMB 4ABNA 1EY7A 2WNMA 5HFYA 1B44D 4KI0A 2D2CC 4WORA 1OXVA 4FF4A 4RKBA 2DLBA 2SDFA 4TQUS 1CZGA 1SBBB 1HUMA 4JK1C 2LFIA 3B9JA 3D3RA 2O4XA 5C0XI 2R92B 1SYCA 4RGMA 4P16A 3CIRB 4I7ZC 2HQEA 1A6XA 4XXEA 4C3IB 3KQ4A 3GQBA 4IUPA 1HXYD 2NWGA 3EROA 2NUCA 5AUKA 2L9HA 1HUNA 1AZQA 2R93B 3GTLB 4B9XA 4XWWA 3UI2A 4ARIA 2KOLA 2IGDA 2RDHA 3R3OA 4PMBA 3Q69A 1HTPA 2MHVA 3G6JB 3LNNA 5D3IB 1DOIA 1KDCA 4X3SA 3KWLA 5JPNC 1N5XA 3SK6A 1GUSA 5I2YA 3WCQA 1K8OA 1PZKD 1R4PB 2A6ED 3Q8EA 2IGGA 1MBYA 2QMTA 4MM3B 2SNMA 2F0KA 2J53A 5CV8A 1WTVA 3OIQA 2CW0C 2E74C 1EY8A 1U4MA 5DEHA 3AEDB 1QNUA 2LY7A 5D7GA 4HRSA 5BYRA 3DWGC 3GB1A 4X3KA 1XLNA 3I57A 2JZPA 2KHSA 1Y69U 1GUNA 3MA2B 1J7BA 4N6EB 4EQPA 2WS3B 5JOBA 1TKEA 2LFNA 4DA2A 4AS1A 2INNE 4B08A 3C1FA 1ENAA 2EOTA 1JOKA 4M8AA 4R8NA 5C3XA 1ZP0B 1B1ZA 3EUB2 3OW7A 3P1MA 4L63B 1K8MA 4TSSA 5M3MB 1WTOA 4YTPB 3BWUD 4G4KA 1U4RA 3S9WA 3NXWA 1G2SA 4QUCA 2KEDA 2PMZB 2WIIB 4XE0A 1TR5A 3HOUB 3AE3B 2E2HB 4B0EA 1C4PA 3VR2A 2LEKA 1AFPA 4C7ZA 4DK0A 2JA6B 1JWSD 3NHHA 3TZDA 4F7XA 1B2TA 1YJIA 2F0EA 4NP5A 2B2WA 2NTTA 1HPCA 4PNYA 3P1HA 3IT4B 3SK4A 2OXPA 1FM0D 2MJ8A 3GTPB 4YWGG 1D4BA 4YTMB 1EY6A 1EOTA 1O7YA 2XWBB 2BTEA 1F2YA 1LTTD 3H6MA 2VZKD 1V1PA 3BDLA 2BW2A 2W55A 1RTNA 1GHJA 2WXOA 2EZVA 3T3OA 2WP9B 1FO4A 1QILA 2D62A 1F9QA 1MI2A 4U68A 2NBFA 4HCEA 5BYQA 2L11A 4EQOA 2RKSA 3VR6A 2AQ2B 4PT5A 2DYOA 1XX8A 3OSOA 2A68D 4WJWA 1LT3D 1ONLA 3VR8B 1EQVA 1I50B 1H9KA 5C4ZA 4B0MA 1XXGA 1RJTA 5E1FA 3KUPA 4A55A 3PMFA 5GXGB 3MHBA 3U4EG 1EYCA 2QJLA 1EY9A 1E6EB 4RGTA 4KKSA 1UNSA 2PMVA 3NS1A 5EE9A 2Q5WD 1SNPA 2LGIA 1A3VA 3IAM1 1DOXA 4RF1A 4CJ2C 2NVTB 3QJYA 2O2LD 5JEAH 4XYQA 4ID6A 1FNWA 3AV8A 4P6VF 1EWCA 1JWAD 4QB4A 3M7NA 2NVXB 2LHEA 3K58A 3J80L 2KUMA 4IDIA 1ZYRD 5EPLA 2JXMB 2QEJC 1NYQA 5A2QE 4IFDG 2TSSA 5AUIA 3Q22A 1ML0D 3K59A 1ZE3D 1CHQD 1PYWD 3OHXC 2EKIA 4NAWB 5TSSA 1LTID 2BA0A 2WXGA 2B63B 3CRLC 2WU2B 1VCIA 3WOEA 1GHKA 4IFDJ 1PTOD 1SYDA 3AN1A 4A3JB 1IW7C 4RHRA 3NTIA 3URYA 3V96A 3N52A 1T5XD 3FRPB 2F0GA 1A2UA 1SNOA 3IFDA 3D8GA 1E2ZA 2KDMA 1TS2A 4OZBA 5JVH3 1OXUA 2K28A 3A7AB 1KFYB 3IFTA 1EZ8A 2PVGC 2WXLA 1WTWA 3C46A 4EVOA 1QOHA 3ZJUA 4RKLA 1JB3A 4C3JG 1XCQL 1E0BA 1IYVA 2FHTA 1ZXTA 1BF4A 2JA8B 4RF0A 4A6QA 5M9OA 5E4WC 1ROEA 1E10A 1BO0A 5K36G 1JMLA 2V3NA 2B2VC 4US8A 3H3VC 1NI3A 2EJMA 1CI3M 3B2FA 3FEWX 3IAS1 4RH6A 1Z6HA 4H13C 3AE1B 1E9MA 3NUHB 5C2TB 1G91A 4TRDA 3FMCA 3I73A 3U9SA 3TP6A 1N61A 5AFWA 1JWUD 1SE4A 2L4NA 3VQIA 3ZJVA 1XYIA 3TEWA 2Q8TA 2VUMB 3U9OA 4ZAIA 1FRDA 5MPOA 5I6WA 1V97A 1QWYA 1TWGB 3SR1A 1RDPD 1F9RA 4DXFA 5C4HA 4ODGA 5HGTA 5D65A 3DHQA 5EBCA 1NSNS 3I8ZA 3P75A 1ZUD2 2K0PA 5COYA 2KAJA 1DOMA 1WYGA 5KEEA 2RVLA 1LTAD 2V4DA 4K8IA 3I72A 4ZKCB 4IUUA 2PVOD 3RD4A 1YNJC 1KLUD 1HFNA 1EYDA 2BDOA 1DOLA 1JROA 3AM9A 3GP7A 3E56A 4NJCA 1JQYD 5K5PA 3J7AV 2WXPA 2IPKD 3BVGA 2MGSA 2BBCA 4FF1A 5CC4A 4IUTA 1K51A 1IGCA 5G5HA 1WVLA 4D2KA 3KWVA 1N62A 5EQ0A 3C8YA 2QKIC 2IX1A 2B8FA 5FO9B 1VLBA 3VA5A 4CKCA 1CM9A 1TVXA 5KYIA 1EEID 2HDEA 3K5OA 4MH8A 4L6TB 5EE3A 4XDCA 1CFMA 1SNCA 1Y8PB 2G9DA 1SXTA 4HROA 5CBEE 3TEXA 1LTGD 1DM0B 3SHLA 4OO1G 2K01A 4REZA 1RCVD 2PNRC 2IWHA 1PGAA 3HVDA 4J6HA 3AU7A 5IGBA 3VR5A 3TEZA 1OFFA 2JA7B 2B2UC 5C5LA 2E2DC 1BMLC 1STYA 1QF6A 1YNND 2PLPA 2JSVX 3I9V1 1WTRA 2K03A 4NZLB 3CU7A 2TMPA 4DAPA 4KN7C 1GUOA 2F1MA 1K52A 2N9LA 2Q8IB 4O1NA 3S15B 3NVYA 5DNFA 2MH7A 3P63A 2WQYB 5A35A 4CKEA 1ZDXA 2A74C 2FE8A 2RPVA 4IFDH 2L1BA 4XT3B 4FVMA 1FYCA 3GTOB 3VRAB 1GUGA 1GUWA 1VR9A 4NMZA 1D5XC 2B2YC 4A8XC 1GB4A 3GTKB 3FILB 1JWMD 2F0WA 1IW7D 2FJ2A 4K5XA 5I6YA 5CV9A 1HEZE 1VDZA 3S17B 4FO2A 2A6HD 3C2PA 5CV5A 1BDOA 5M5YB 4ARCA 1PTOC 2ACZB 2RSOA 2F0IA 2K5WA 1NR2A 1CA5A 4KJOA 2E76C 1TWCB 1PFBA 3OMGA 2PO4A 3GV6A 2AX5A 1BNZA 1TKWB 3MJ5A 4C7YA 5BN5A 2MJEA 2WXNA 1V1PB 2X6LA 5CORA 3BDOA 5C3WA 4ULLA 4KHVA 2Y3AA 2F0VA 5K36H 3H8HA 3A8KE 4JWUC 5EGTA 3M3YB 5C6AA 2NYZD 4ZUJA 1M8AA 2WB1B 2WDRB 3BIID 4IQZA 1SEBD 4OL7A 3L4PA 1L5PA 2WXIA 5FLXL 1TWHB 1XEEA 1EIHA 3DUZA 1XTCD 3SXHA 2AUJD 2FFKB 4K6DA 3GTJB 4K2KA 1MD2D 1UWMA 4OIKA 1PDXA 2ZT9C 1YQ3B 3BS1A 5FO8B 1BCPB 4IN3A 4ME5A 1STGA 3DWPA 3BVMA 3E6ZX 3HZXA 2DY7A 1VZ7A 1ENCA 2R3ZA 3LYYA 2DBYA 5IODA 5C4XB 3J7YW 1YNTE 2SNSA 1QKZA 2NTSA 1JW9D 2Z1CA 4BA2I 5C0XG 3PO0A 2LKVA 4IALA 2EJGC 4IUNA 1EL0A 1V43A 2HCCA 5EKKA 1FD6A 3P4SB 4A3DB 2B2TA 1C4QA 3L9AX 3VR3A 2K7VA 2A69D 4N59A 4PV1C 4V0BA 3MAQA 4C80A 1BUIC 3K6OA 1CQFA 2Y5PA 5IT9L 1LTRD 3CHBD 1P7FA 1R7SA 3PUWA 1DD2A 1MGSA 1CTMA 4KV6A 2EY5A 3S14B 4ZK9B 3T16A 1RD9D 1VRAB 4XDDA 1WTXA 2PKOA 2L52A 3VYRA 4ZHOA 3RUZA 1H9SA 5KIXA 4C3HG 2VB3X 2EYHA 4TQ1A 1O80A 1SNQA 5A2QL 4ITKA 4FYDA 1L6VA 1U4LA 3D4RA 1MI0A 2CVRA 5C44B 1RWSA 1PMRA 1GUTA 1WCMB 1BBXC 4C2MB 3P4RB 1B53A 4LJZC 1Q12A 2QSDA 2WXKA 2J7ZA 2PW9A 5EE0A 1F0ZA 3OIPA 2K33A 3ZGZA 3EJIA 1KDAA 1RFKA 3J9CA 5JPMC 4K5VA 2K22A 1F2ZA 4NW2A 1WGKA 5T8IA 4ZYSA 1VMPA 5ELFA 2B39A 1T6BX 3RZOB 2ZXRA 3I90A 2JQRB 5HI1A 2EYJA 1EYAA 4A3IB 2J0TD 4C3HB 2B2TC 4GDKB 4ZRQA 4OZAA 1S5CD 1LT5D 2ICIA 1HTLD 1SYEA 3VRBB 5J22A 2CJOA 2VXWA 1RYJA 5EKLA 1ILQA 2R6GA 4A3KB 1IHZA 2Y0SB 5D14A 2V0GA 3BZDB 4DNRB 1L4ZB 1TJEA 5DM73 5IGFA 2WXHA 4IURA 3IL8A 2YEPB 1BCPC 2SEBD 3CRKC 1PRTF 2A73B 3SEBA 2W82A 2YU9B 1IGDA 1I3QB 1G6ZA 2JWUA 3NWSA 4ZOHC 1RKNA 2EE1A 1J7AA 5M5WB 1C48A 2E6XA 1G8ZD 2DN8A 1HQMC 3SFDB 1L4DB 3M4OB 2K5PA 2H89B 2F0OA 3TDQA 3PUXA 5KGUA 4NAMA 1VZ6A 1CZWA 2W54A 1V8CA 4HKZE 4F87A 1DCZA 2NZ1D 2V3PA 1EEFD 2KQ4X 1ZYRC 1WD1A 2WKDA 2WAQB 3SE0A 1NYRA 3ABVB 5C3JB 5KNBA 4AYBB 2K32A 3NBHA 3MXNA 3TUOA 2M00A 4Q0FA 4YSXB 2KCCA 1E7PB 3W5VB 1IBXA 1HA5A 1H9JA 2CHBD 4LMQD 1MHHE 1SIJA 2H1EA 1UEAB 3MWYW 3ZYYX 3IKJA 1SJED 1TY2A 2L5TA 1C8CA 1B9NA 2I2YA 1DJRD 3P7JA 1TS5A 4C1NI 2PQEA 4HN7A 2XIWA 2V4IB 2KMMA 2F0SA 3T51B 2K6AA 2J52A 4JX1C 4WRDA 3CKIB 1STEA 3TP5A 5IGCA 3PIO3 4G57A 1RF2D 1QJOA 3PV0A 1N60A 2F0PA 3N6RA 1C79A 1NVID 1SE2A 1ZKOA 2MJDA 4Z9CB 4BY7B 3TSSA 2LMCA 2X69A 1DZ1A 1BXTA 3U52E 1FXIA 1J8IA 4QMGA 1D2BA 2AWNA 4QUFA 1QQRA 3K5LA 1JQ4A 3W2DA 1PLFA 3R8BA 4RGOS 2RQXA 2BB6A 2ENBA 1HZ5A 1CA6A 2KA7A 2EELA 2WDVB 3ITPA 1JRPA 1RM6C 3J81L 1YQ4B 1Y56A 1L6UA 3AEEB 1FNVA 5DAUA