4RCOA

1.9 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
192
Chain Sequence
NPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9 Angstrom Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus, in Complex with Sialyl-LewisX.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Putative uncharacterized protein
total genus 51
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rcoA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rcoA01
5D3DA 4OHJA 1TY0A 1D5MC 2RDHA 1FNWA 4RFBA 1TS2A 3KLSX 1CQVA 1SJHD 1LTTD 4L63B 2AQ1B 1CHPD 2XRSD 5TSSA 1PTOH 2WV6D 1S5BD 3BVGA 1ET9A 1FNVA 1EU3A 2TSSA 1V1PB 1RCVD 5FK9C 2J4XA 1MD2D 1LTSD 1PZID 1SBBB 1LLRD 1FGBD 2Z8LA 1B1ZA 5FKAC 1DYQA 2XN9C 1I4RA 5ELCA 1DJRD 1SE2A 1EWCA 1EEID 1B44D 1PTOD 3BYYB 3EA6A 4TSSA 3SEBA 3V05A 1PRTB 2NTSA 1CHQD 3R2IA 1JR0D 3DWQA 1T5XD 1PZKD 1BCPF 1RD9D 4L6TB 3OWEB 1EFID 1SE4A 3MFGA 5ELBA 4ZYSA 4UDUC 1PYWD 3MC0B 1D5XC 1ENFA 1HTLD 1UNSA 3BVMA 4RGOS 4RGMA 1PRTC 1D5ZC 1JWSD 1SXTA 2IPKD 4BWGB 3TSSA 1L0YB 2ICIA 3GP7A 1HA5A 1PRTF 1S5DD 2XNAC 1EEFD 3DWAA 1BXTA 1AW7A 1CT1D 1JWUD 1KLGD 4RH6A 1BCPB 1YN4A 1V1PA 1I4QA 1XTCD 1I4GA 2XRQD 1FNUA 3URYA 1F77A 1TY2A 1JWMD 1YN3A 1LO5D 1LTGD 2G9HD 1RDPD 3R8BA 1HXYD 3DWPA 5ELEA 2O2LD 1TS4A 1PTOC 5ELDA 1JCKB 1LTID 1XXGA 4C56C 1PZJD 1BCPC 4DXGA 4RGTA 1YN5A 1KTKA 1I4HA 1LT5D 1FD7D 1STEA 1S5FD 3R2TA 5I4DA 1LTBD 1SE3A 1I4XA 3BVZA 2AQ3B 4RHSA 1SJED 3CHBD 4DXFA 1KLUD 5D3IB 1PTOB 1QILA 1HQRD 4Z9CB 1AN8A 3BZDB 1G8ZD 1ET6A 1PRTD 1LT4D 3BYTB 1ESFA 1EU4A 1TS5A 2SEBD 3O13A 1CK1A 1TS3A 1JQYD 1UUPA 1SEBD 3W2DA 1LT3D 2R61A 4O1NA 4RCOA 1RF2D 1PTOF 4K6LA 1LT6D 4RHRA 2QEJC 1I4PA 2RDGA 3EFXD 2QILA 2IJ0A 1V1OA 1L0XB 5ELFA 1LTRD 2NTTA 1BCPD 1LTAD 1S5CD 1M4VA 1GOZA 1S5ED 4RGNA 4NZLB 1D6EC 2CHBD 2AQ2B
chains in the Genus database with same CATH superfamily
3A9JB 2K5HA 4A3MH 3MXNB 3HRZC 2L1AA 2EIFA 3NTHA 1C9OA 2K6QA 3VUWA 1B70B 1N34Q 3AE3B 3PO3H 1ZEQX 2DUDA 2F0LA 2D62A 2BYTA 1QG7A 3ZNID 1Q90A 4DV5Q 1M1KC 3D4RA 1JICA 5C5MA 1V1PB 4EEWA 3VR8B 1YJNA 1B9MA 2EYOA 5C4XB 3PO2G 2EYFA 4A3LH 1ZYRD 4XDXA 3B2GA 3CIRB 4DR2L 2VUMG 2QEXA 5G5GA 3FDTA 1XNQQ 4KN7C 1FYCA 3QWZB 1N36Q 1WSPA 2LVPA 4OGQC 3HKSA 4A3EG 1ZKOA 3CMAA 4FJZA 2WWZA 1CHQD 4M00A 5CV5A 3ULPA 1VQLA 1D3ZA 1PYSB 4Q0FA 1VQHA 2K7VA 4OIJA 4NMZA 4JL9A 5E6PA 5AZGA 1F9SA 1SE4A 3HHMA 2VY3A 5GXGB 2L52A 2HE7A 1PH9A 4J6HA 1VQFA 3G71A 1HHVA 1YQBA 1K3RA 1ILQA 3OHXC 4ME5A 5IT9L 2XBBC 2ZNVC 5CORA 3T9LA 1CI3M 4OO1H 4TQUS 2J0JA 1Q8KA 2N9LA 5K36G 2EJGC 4K3BA 1BCPB 4ZAIA 1NENB 1V49A 4MNOA 1KAWA 5G3LF 1WTOA 2ASQA 5D2MB 2RCNA 4LTUA 4H7BA 2Q2HA 1YN3A 2WLBA 2EOTA 4HEDA 3SK5A 2KAJA 4C3JH 3L10B 1F0ZA 4B9KA 2BBCA 2AHOB 2VUMH 5IYBG 1Z5SB 3ZJYC 2FCMA 5AZHA 1MJDA 1WTRA 2ZJPA 1UE7A 2BF8B 1W3SA 2UXCQ 2WS3B 1XO3A 4WWPA 1QKZA 5C2TB 2C5LC 4XZ4A 2KC2A 2D2CC 1OGWA 3DBHI 4LJPB 5C0XI 3ERQA 3JAML 3J7AV 2QCZA 3ZNGC 3LXFA 4BBRH 2Y5BB 4IOIE 1HFNA 2JT4B 2V0GA 4KHVA 1QNUA 2LRWA 3IT6B 4NQKE 1VQ8A 3AEDB 2L0CA 2B8GA 3KOJA 5FLMG 4ZHOA 3PLUA 2KJHB 1Y1VB 5J3BA 1AEXA 2XGTA 2EXZA 5C0XJ 2BWES 1TWCH 4BBSG 4LUVA 4JI3Q 1P3QU 2G45B 3LX0A 2KQ4X 3ZNHB 4AP4C 3U2SC 3GTLB 1F2YA 3AEGB 4G7HC 3CPWA 1HNXL 4O1NA 4KV6A 4BKGA 3RZOB 1WE7A 1N32Q 4DGZA 4EQOA 1WVLA 2UU7A 2VH1A 2NN6I 1LUZA 3OMGA 2MP2B 4A3KH 1TJEA 4BY1G 1N32L 4IUVA 4IW0A 4DV7Q 3GZNI 5IT9E 2AQ2B 5D3DA 2VB2X 2WXHA 4LFBL 4C2MH 4B3RQ 1NVID 4IFDG 2WXQA 3U9OA 1FNWA 4JI0Q 4EZJA 3MA2B 1QOGA 3BK2A 2MHVA 4JX1C 4F87A 1B53A 4DAMA 4BS9A 1E2WA 4G11A 1I42A 5TSSA 4DFAA 2DWQA 1FM0D 4J1MA 2F0NA 3KWLA 3Q3MC 4OIKA 3AE6B 4WWNA 3J7YW 4JV5Q 2TSSA 5FK9C 3U4ZA 4L5RC 4KK7A 3GTJB 1LTSD 2YTYA 1WZ3A 5LMNW 5IAAC 2R93G 3MC8A 2NS5A 3FC4A 4IG7B 2WXMA 4ASWC 4IPHA 2BDOA 5LMUQ 4Y52H 3IFTA 4A9AA 1P7EA 3OG5A 3BYYB 3GTPB 4WAFA 1SNCA 1B9RA 1B50A 5KHQA 3VHTC 2Q2IA 3HGBA 3FP9A 3CCSA 1PHJA 1N62A 2J0MA 4WQMA 3JAMi 2CHXA 2AL6A 2JA5B 2MP2A 2KBNA 2ENBA 3I7FA 4JI4Q 3HOWB 4A3BH 3DBRB 3DEOA 3OWEB 2Y0SG 4H13C 3NENA 4ALPA 2F0VA 4UDUC 2KMMA 3NRZA 4CKCA 1R7SA 1OXTA 1ENFA 4IURA 1A2TA 4LF8Q 3GTOB 4GB9A 1QUQB 3HEJA 4R8IA 2NPTB 3BZCA 3CMEA 5DM73 3K59A 1YHBA 2IGDA 4M8NA 1FVIA 4B3SL 1L0YB 2KYWA 2CCZA 4QUFA 4MJSA 2RPVA 1HA5A 1E7UA 2KVMA 2XNAC 3PUWA 4NPNA 2BE5D 3MXUA 3HKZG 3NJTA 4C3JG 2UXDQ 3Q0AA 1GM5A 1K50A 4U673 1XJVA 1V97A 2K33A 3KDFB 2O6VB 2KANA 1KNEA 2N8NA 3J81E 2WU5B 4LFCQ 2N55A 4X64L 1FXTB 3HOYG 3SD5A 2CH4W 4EQ5A 4LF6Q 1SNQA 2VW9A 4A3IB 3IL8A 1VLBA 2M0AA 2KQ3A 2OCEA 3CC2A 2JXXA 3J80c 1I4HA 2JZZA 2M4NA 1FD7D 4DR3L 3PV0A 2Y0SE 2NVYH 4K5XA 4LF9Q 3Q8AA 1JWAD 4GGQA 3R3OA 4IM2A 4BKSD 1VQNA 2LI5A 3RZFA 1VQEA 2B2VA 4YHHQ 3Q6BA 1W6KA 5J1ZA 2OJRA 1FFUA 1BDOA 1O7IA 2IO1B 2F4VL 4ZDVA 2A19A 3HOUG 1A6XA 1V8CA 1LT4D 2MQHA 2KTRA 1E10A 4EOYA 1YNXA 2JA6G 1TGZB 2Y5PA 4DAVA 1TR5A 3S24A 3MXGA 4DR5L 4LF8L 2BS4B 5JPMC 1J19A 2LJ5A 4MHEA 5FO7B 2A6ED 2QSDA 4DNIA 2R61A 4JPBW 3K5NA 2JSOA 2Q8TA 1KJTA 3AEAB 1B9NA 1H9RA 1L0XB 1NTGA 1G2SA 1LTRD 4REZA 5IYDH 2KEDA 1NMGA 4IALA 3T1YL 1LTAD 4YIJA 5I9OA 3MEHA 2CQAA 3Q2AC 5JEAG 1H4RA 4YWGG 4BKTA 3MVVA 3W1SA 3TJPA 2MCNB 1QJOA 1AFPA 4OHJA 1LYLA 1WXVA 2BH8A 2Z4IA 5CBEE 2DN8A 4A3KB 1WRDB 2CU1A 5H8YE 5MPOA 4DR4L 2REXA 4KTAA 1DOYA 4DUZL 4DWFA 1UBQA 3ZJUA 2JN4A 3KLSA 1PTOH 1YJIA 3NTKA 1ET9A 3M4YA 1GUOA 3TBLD 2PJHA 1RCVD 4JI5L 1GUSA 4CKEA 3VR9B 5C4XG 4LUZA 3S1QH 5HKHA 1R9TH 5E6JA 4XQJA 1IYUA 2VUMB 1VQ7A 1LM8B 4RNAA 1Q7YC 1DJRD 2K5DA 4DV2L 3DMUA 4HDOA 1C3TA 4QMGA 2H5XA 4K81A 2HDEA 5A35A 3VFKA 3E0EA 1SGHA 4OZCA 1X65A 1GUTA 2UUBQ 4HN7A 4R9WA 1QVGA 3QOLA 2JA5G 1J8CA 2A74C 2Z6KC 1ENAA 1P0RA 3UQBA 1RTNA 3PHXB 3S1MH 1C77A 2JZ3B 4P75A 3JYUA 3MEFA 4DAYA 4NB3A 1C4QA 1K28A 3PT2B 1HUNA 2LFIA 1JOQA 3DOWA 1ESRA 4WIPA 2JQRB 4RF0A 3DVGY 1JOKA 1VF5C 1VQ9A 2EYHA 4UHVA 1JT8A 4JI1Q 3GTOH 2I46A 4E74A 2VQEL 5CMDA 2BWFA 1GVPA 2JYTA 4MZ9A 3ABVB 2EYPA 1PH7A 3HOYH 4IWQA 5JHAA 1VF7A 4FF4A 2ZTCA 2F3WA 4CJ0B 3U9SA 1JOOA 3LWUA 3N9YC 2RBMA 1IKMA 1MSGA 4M0WA 3GTMH 2C60A 1KDBA 1WCMH 1JE4A 5IGGA 4BKSA 2PI2E 4WJWA 4LK0M 3UIOB 3IKJA 1I3QH 1DM0B 4UP9A 2IO2B 4K2KA 2IO3B 1H9SB 1JMLA 1NEKB 1U4PA 2EYMA 3B1LX 3IBEA 4GDLA 5EE1A 5EDSA 2MBBB 2K50A 2TMPA 3DVNV 2L0FA 4GLVB 3OMCA 5EGTA 2A68D 4X64Q 1EQRA 1SJED 2NBUA 3P63A 2F0MA 4JCVE 1KLUD 3NUHB 1IBKL 4W9JA 3VTVA 2LZ6A 1QILA 2J42A 2ZW1A 3PO2B 4DDID 1L6UA 1G8ZD 3NHHA 2KENA 2KZRA 2JK8A 2K52A 4HIOA 1VQKA 4IOAA 4WRDA 2BB6A 1LACA 5E1FA 4ZRPA 3W2DA 2NYZD 2MH7A 1CFMA 3VA7A 4IUMB 1KOTA 4GSWA 1LGRA 2QEJC 4JBKA 3IAM1 3AFQA 1Q1EA 1RFKA 2JU6X 1C4PA 5BR8L 3L7ZC 2X69A 2DJGC 4GKJQ 3I70A 1BCPD 5M9OA 3RD2A 3L9AX 3EBEA 1KLVA 4BY1B 3T3NA 4A3MB 1LXDA 4CHTB 1IBML 2WXLA 5CR3A 5EPLA 1E3PA 3TCAA 3AE9B 2K03A 1G6JA 4LF5Q 1VQJA 1HJPA 2L5TA 1J6QA 2NVYB 4A3KG 3E9HA 3B2FA 3AB9A 3KLRA 5DPTA 3SFEB 3TS0A 2I5HA 5KIXA 3HOVG 3GTJH 1F2RI 4CYEA 4DR6Q 2E5LL 1FR3A 3M3YB 3D8GA 4QY7A 1X3EA 1P1AA 2HHHQ 2AWTA 3ZKJC 3SU8X 2PYKA 1PZID 2R93B 2K39A 1LLRD 5C3XA 5IYCH 1U4LA 2Z8LA 1V9PA 4ZCKA 3V2TA 1X3QA 3KYDD 3MTNB 3ZXRA 4C4VA 5M5YB 3V62A 4NXML 2ZEQA 3CD6A 3TIXA 4OO1I 2OF1A 1C1YB 2N9EB 1YX5B 4K0KL 4RG1A 3W3AA 5JJIA 3CPFA 5FOBB 5M3FB 1WJ6A 4XQQA 5C1ZA 3BWUD 2FHTA 1CZGA 5DCNA 4ZRJA 3N32A 1A5RA 5FO8B 1MSHA 5IOCA 1PGAA 1X3GA 1WMHB 4HVBA 2B29A 4LMQD 1HNZQ 3S16H 4ICUA 1A3TA 1TIFA 1PYWD 1WIAA 1DD2A 4QIWB 1BOSA 1S72A 1KF6B 2M17A 1EY8A 5BR8Q 4GKJL 1A3UA 2DHZA 3GB1A 4ZRKA 4PG3A 1PV4A 1D1KA 4NKLA 2DNFA 4URKA 1QVFA 2IT1A 4PMBA 4GXBA 3UE1A 4QAYA 1SYDA 3RNFC 1SSNA 1JWUD 1Y1VH 3C2PA 5DLQE 1EOTA 1XLQA 1XTCD 4RMFA 2CR5A 3PUZA 2JX5A 2MJ8A 3VR3A 2KLCA 4MACA 3V3XA 4A3DH 3PUYA 2D0PA 3V6EB 2UU9L 2KX3A 3SK8A 4FF1A 4J3OD 2WXIA 1W2BA 1NDDA 3D6WA 2R7ZB 3GE8C 4XC2A 4C4VB 4BBNC 1SDFA 1C4AA 1FRDA 1T0QC 1ROEA 4A6QA 4KV2A 1RAXA 3PS6A 3S1NH 4J8QA 4G7OC 1ZYRC 2RVLA 4DV4L 4I65A 1CKMA 3BINA 2L55A 4JI2Q 2WXGA 3EVQA 3PRMB 2F0QA 2LUEA 4EGVA 1VQIA 4A3FH 3DM3A 1WY8A 3LWEA 3GTMB 5IE8A 1TTNA 1STEA 4B0MA 1X1MA 2G4SA 5E3FA 2PO4A 3VR2A 3A8IE 1ACCA 1HZAA 1VRAB 2RCFA 2M9VA 1N33Q 2DZJA 3BU2A 2M8SA 3OLMD 5GAHC 1TWFH 1JMCA 2K1FA 1PTOB 4R4CA 4KKSA 2VL6A 2O2VB 4BY1H 4JI4L 2IGHA 5LXIB 1AN8A 3HOUB 3RLOA 1PH6A 1MG8A 2MX2A 1ET6A 3APFA 1FD6A 4K6DA 1HUMA 1QE6A 3LNNA 1K53A 4LJOB 3NE5B 4C1NK 3OTOL 1B2TA 4LNFA 2JYOA 1YEZA 2B3AA 3HOZH 4BY7H 3U7ZA 1SMYC 2MLBA 1FEHA 2PCFB 4FA6A 4HCPB 3I8ZA 1K8AC 1ZGUB 4DU9A 4HTHA 4HPPA 1DONA 4UPAA 1P98A 5IYBH 4ZQ3A 2Y0SB 4JVZA 5IT9c 1OXVA 3ECIA 2MSED 1HNWL 2BYEA 1GOZA 1I3QB 4A3MG 3BJUA 3GTQH 4LNIA 3TP5A 1CKNB 5KNBA 1VCBA 3LGJA 2RSNA 4RM8A 4XYOA 5DPWA 3PF4A 2JA6H 3RUIB 1YJ9A 1PFSA 4NAMA 3RLNA 3JC66 3J80L 1KABA 4L63B 4C3JB 3ZW3A 1XEEA 4DNTB 4L2YA 1TU2B 2HIXA 3NUCA 2KHSA 1N6ZA 3ULLA 1L6VA 1QZEA 1U9RA 3K0YA 1DZ1A 3ML9A 2EY5A 1STNA 3DWGC 4A76A 5HFYA 3T53B 2BA1A 1WTPA 4X66L 1FGBD 3ICEA 2KQ7A 2M19A 5HGTA 3AEBB 4BA1I 2M2LA 3KF6B 3TEHB 4EVOA 5I6WA 2I0QA 1Y56A 1UELA 4JV5L 5HG2A 4DAYB 2WB1B 2A1AA 2K4KA 3OIQA 2ZM6L 3F2BA 1DOXA 4JI3L 3STBC 1SMYD 4RKLA 5BN5A 1TWHH 1Y8OB 2GB1A 3E0JA 5JVH3 2R2QA 2VRRB 5M5WB 3L2PA 4ARCA 2WP8J 2W55A 3CSTA 1XYIA 1XPUA 1D5ZC 4HCSA 1FJGL 1EWYC 2NBFA 2KTFA 3DXJC 3T51B 1NSNS 3GV3A 1VQ6A 3NBIA 2X6LA 1GC7A 2ICIA 2C9WB 3C0RB 1L4ZB 4PV1C 3TEWA 4KGSA 1YN4A 4YL8A 4LJZC 3ND9A 1EFWA 3HZXA 1I4QA 3D4WA 1WTVA 2INDC 2J0KA 3N3KB 2LEKA 1F77A 2M1MA 3UQAA 1LTGD 3GTGB 2OEDA 1U4MA 4R4OA 2K9XA 2LHEA 2K05A 2WIIB 3KUPA 3KF6A 3P4SB 1VD2A 1OTRB 2F0SA 4C3HH 3CCLA 4OZBA 5IP4D 4DV1Q 3IRBA 2NVQH 2FCSA 3PRZA 4LDTD 4HMIA 3NPPA 4L8JA 4XWTA 1PZJD 4XE0A 1L4DB 2V3NA 2WAQE 3PCOB 4DNRB 3A4SC 4BOZB 2LY7A 1HRJA 4Y7NB 2BQQA 4ME3A 3R2TA 1MVKA 1B8AA 1LTBD 1CA6A 2NVUI 4OZAA 2WX1A 3BVZA 1UE1A 2INNE 3ZGZA 3J81L 3CCEA 2D2QA 5C4JH 4GOPA 4DXFA 5D3IB 4FP5D 4YSXB 1JRUA 2LJIA 4A3CG 1F9QA 4HLEA 3W5VB 1QOBA 3OPOA 1VQPA 4I6LB 3ZO5B 2K5WA 4JOIC 1B7YB 1TWHB 2HQLA 3O13A 1V2YA 3DDCB 3Q8EA 4CDCC 1ZP0B 3DHIC 1UEAB 2ZCCA 2WGSA 3H1UA 5H1SE 4MELA 1RF2D 3FKIH 2I07B 2EYJA 2OQ0A 4K6LA 3AE2B 2WDVB 4A4IA 2O4XA 3G4SA 1QT9A 2HIVA 1YD8U 5DEHA 4BFRA 1C4CA 3TZUA 3EN2A 5C3EG 3VYUA 4W9HA 2F0EA 4BXXG 1G291 1IL8A 5IP7H 1HNXQ 2FAZA 2KWUB 2VZAA 4WORA 3RNUA 3N20C 5IGEA 3N1ZC 3Q8FA 4AQ7A 1D6EC 4HEA1 1L2NA 3KF8B 2EXDA 1SYCA 3V96A 3B6YA 3CC7A 4HROA 1D5MC 1L1OA 1WX8A 1RLFA 4DV6Q 3S17B 3I4NH 1UWXA 3NVVA 5J39A 4UP8A 4IOCA 2Y3AA 2N4FA 2V3SA 3AEFB 1J0GA 4GDKA 1EY5A 2KECA 3HKZE 3DBSA 2INPE 1VDVA 1GG3A 4OL7A 2K1BA 1CZPA 1EIGA 2VNUD 1E6EB 2KCTA 3A7AB 2DZIA 2MJ3A 3CQZH 1A3VA 4ZK9B 2Y5CA 4OONA 3S2DB 4HR7B 1YITA 1WTWA 1WZ0A 4JE3B 4H02A 1MJCA 3X23A 2UUAQ 3D4DA 3A8JE 2SNMA 4ZHPA 2NR2A 1SNDA 3QWNA 4JOIA 3SEBA 1TKGA 1WGYA 3WALA 4FADA 2LASA 3VXWA 4PS8A 4ID6A 2HTME 1E22A 4FNFA 3S16B 2NTSA 2NN6G 3RCZA 5IGCA 2AWOA 3SFDB 1MG4A 4HK2A 3M4OH 2QF7A 2R92G 3NS1A 5IYDG 4HSVA 1NBFC 2B63B 3QX1A 1V86A 1QCBD 4A3JG 4US8A 4ZYSA 4DR7Q 1YVCA 2L32A 2GBKA 2M56B 2W3RA 4X62L 2LXCA 2ZTEA 1HA6A 3TSSA 1QNKA 2FMMA 5GROA 4HJ8A 4M01A 3P4QB 3S9WA 1QUQA 3V6CB 1AW7A 2K14A 3KYCD 4LNOA 1I4GA 1UE5A 1OO9B 3U50C 2A69D 2F52A 2JA8G 2SDFA 2CS4A 4YSYB 2BA0A 1TY2A 4X3TA 1ZE3D 5GMVA 1HFGA 2OEOA 2NVTB 3A5UA 4A75A 3LB8C 2CKHB 3S1MB 1QF6A 2WAQB 3E5SA 4II2B 2GI9A 2KQSA 2XTIA 4DV0L 3DBLI 3P4PB 1XLNA 4DV6L 3D0FA 2Q2TA 3KDFA 4K5VA 4PMCA 2KC1A 5CHWA 4A3DG 2EY2A 4ANWA 4RA8A 2FCNA 4ULLA 4RGTA 2JP1A 1EY6A 3TBIB 4G7ZC 2E74C 2YTXA 1WXAA 1YN5A 3TEXA 4DV0Q 1BR9A 4AYBG 2HUGA 1RODA 4K14A 5L37A 1QLBB 5BYQA 2MO1A 1AARA 3DHGC 1LABA 1R9TB 4X66Q 2JA5H 1O78A 3IHPC 1YNJC 1JE5A 3CCUA 4NAWA 2G1EA 3VR5A 1XQQA 1I6VC 3VH3B 2KT7A 1V8QA 1CMXB 3CCRA 2PMVA 2BGFA 4G50A 4ZRZA 3I4MH 4R4TA 3M4OB 5IGDA 2D0OA 4HKZE 4D2KA 3H0GG 2GLSA 2R93H 4WURA 4YCUA 1YHAA 4LF9L 4OX9Q 3I4LA 4JI5Q 1D8LA 4G57A 3RLFA 2R7FA 1ZDXA 2IX3A 5M3FG 3H6NA 4LF7L 2BKFA 4KZCA 3PSEB 2IY5B 2RSOA 2IJ0A 1RFAA 2LGDA 2F03A 2MGSA 4US9A 4YTNB 5C3EB 4JIOU 2FNJB 2B39A 5COYA 4A3PA 4CJ1B 4KDLB 2N9XA 4ANVA 3CQZB 5IKCM 2WDTB 2WYQA 3IG3A 4DR5Q 1WXQA 4NZLB 3EGRA 5D6JB 4DXAB 2AKWB 2IO0B 2DZKA 2L8JA 4XIGS 4GU2A 4UAIA 4B6WA 4IQZA 2GVBA 2PW9A 1I50H 2UXBL 2WXFA 1H9KA 3KLSX 5I2YA 3NVYA 2PIAA 1O7YA 2BT6A 5NUCA 1E9MA 2LMCA 1Q46A 4O0AA 3MXNA 4P73A 4A3EH 1HE8A 2BB5A 1XTDA 4TQ0A 5L95C 2L15A 1SR3A 3E9SA 4C1NI 2KN4A 2BTEA 5JH5C 2J4XA 3R66C 3B08A 1R4NI 1KD1C 4BVUC 2PQAA 2QKIC 2R7ZG 3CMMB 2KEEA 2N1WA 4JI6L 3HFZB 2FCQA 4H2AA 2DAJA 1JORA 4DR4Q 1SYGA 3K5OA 5M3FH 2F4IA 1EEID 3WIMA 2C35B 2XWJB 4V0BA 4YY3Q 4AJYB 3HG9A 1KQSA 2RD0A 3Q6SA 2PZTA 3GTLH 3S1NB 5M5WH 4DKAC 2K5PA 3DWQA 1M8AA 1BCPF 4YWLA 4PZ6A 5GQOA 1HZCA 3J9CA 5GAGC 2YU9H 3A1QB 3PIP3 4XT3B 2E8GA 3D32A 2K6AA 5HHDG 5CGKA 4RGOS 3OIPA 2WXRA 4K3CA 1UD7A 3UI2A 2JA7H 1NUCA 4YTMB 3AE8B 4LF7Q 3FEWX 3Q3OC 4NNJB 3P1HA 2XK5B 3AULA 1PRTF 2QW7A 3VVWB 3DWAA 1CT1D 4A3FG 1RWSA 4YTPB 4F88A 1GJXA 4LNQA 3MHSD 1T0YA 4QB4A 2LSSA 5EAYA 5EE0A 1VS0A 1CJEA 2JVCA 3M7GA 5JOBA 2ZPNA 1TQOA 2KCNA 3FVQA 1WWTA 4WWMA 2X8XX 4IUQA 4IC7B 2L9HA 4JI1L 4B3SQ 2NBWB 1LM0A 3JVZX 2HTHA 4MEMA 3LDZE 4AOFA 1VQCA 3TS2A 2Z0EB 1R4NB 2I1JA 1SNOA 2F0WA 2D11A 5G55A 1EY7A 4MT5A 1X9NA 1QB5D 4AQYL 1EO6A 3L13A 2MJDA 4KZ0A 3KLWA 3SDZA 4QUCA 3SDLC 1I4XA 4F8MA 1LV9A 1EIYB 1NYQA 2IZVB 4LNNA 3A5ZB 4OELB 1RHPA 4PNYA 3W1GA 2WDRB 3RZWC 1XWEA 2IX0A 4OX9L 1C0AA 4WAAA 1GHJA 4TRDA 2LD9A 4GOPC 1A63A 3OJ3A 2AUKA 1HTPA 3N52A 3NWSA 1KC8C 3ULJA 3K6OA 3H7PB 3NXWA 4HSPA 1HNZL 5BYSA 2K0PA 3J7AF 2SEBD 2PKOA 5KYIA 1JQYD 1UUPA 2HHHL 4HJ7A 2PW5A 1R4MI 2WB1G 4RCOA 3CCMA 3KWVA 2OHFA 4BZAA 2H89B 3H8HA 1HTQA 1NR2A 4FLHA 2JWZA 4W9FA 3HOWG 3PGEA 4KJOA 3P20A 1WJJA 4R3DA 1N61A 3QB3A 1GC6A 3VDYA 4KKUA 2LXJA 3I55A 5LLIA 1PGXA 2KKCA 1VQ4A 1TWFB 3RYTA 1Y1WH 5EKIA 2CJOA 5ELNA 3KUCB 4XTCS 4EQNA 3ZUNA 3SR6A 3TEZA 3I91A 2ZVOA 4HMJA 3NQIA 1WXMA 2QC8A 1F9RA 1S4ZA 4OWXB 3DVNU 4ZUJA 4IN3A 4XWWA 4RKBA 2XRSD 2EELA 1MHWC 1I6HH 3DLLA 4HJKA 2FIDA 3L0WB 1EU3A 1QVCA 4AYBE 4N8FA 4DPGA 1MD2D 4QQBX 1PMRA 5IN7A 1ZXTA 2B2TA 3VH4B 3MJ5A 3MP9A 3CCVA 3QJYA 4A3LG 1UAPA 2PVGC 3PGZA 2VQFQ 4B3MQ 2C7HA 5BMIA 1WF9A 1JJGA 4A3IG 2Q8IB 3KUDB 4DHJB 3C1EA 3H7SA 2ZNVB 2HDLA 2BOSA 1CSPA 2V1YA 3KH0A 1CKOA 1RIPA 3AMUA 1AE2A 2E2HH 4I6PA 4A3JB 2Z6KA 3E3XA 3HVZA 4G3XB 3RMKC 3OSOA 4E71A 1HTLD 3U4VA 1EL0A 2FIFA 1WFYA 2ZCBA 2CQOA 4KD3A 2X6GA 3EJIA 1XMQL 4X3UA 1GKHA 1BKBA 2EE1A 4JYAQ 1S1QB 3NZUA 2QJLA 4J6IA 4DV5L 3AFPA 2CH4A 5C0XH 4MIUA 4A3FB 1IBLQ 4IFDH 4PZ8A 1FJGQ 4NPSA 4HIMA 1YX6B 4YXDB 3A56A 3ZVVA 5C4HA 1U4AA 3H6MA 3I3CA 5KYLA 1RDPD 4HJAA 1EY4A 3SK6A 2IX1A 2KXJA 4DF7A 2XVSA 2Z0DB 5ELEA 3OYYA 4EFOA 3NSWA 1D1IA 2CW0C 1EYGA 3VYRA 1YBYA 1HR0L 4A8XC 3JAMc 4TV3A 4DXGA 1EUJA 4HJ5A 1WRIA 2L00B 3L0OA 1ZPSA 1IBMQ 4H0LC 4AYBB 2YTVA 2ZXRA 3PZ8A 4A93H 4GNXA 3EECA 3I72A 3H94A 2PZWA 4P72A 2UU9Q 4KKIA 2OTLA 4EX5A 1RTOA 3VUYA 3AU7A 3VR6A 1F2ZA 1FPYA 1WX9A 4CGYB 3FPPA 2KDIA 2L05A 2B2WC 2V4DA 4LFBQ 2UXDL 1V9JA 5K5PA 4JI8L 2KCCA 5J22A 3UE0A 3OWFA 4NJ7A 4FVMA 1HH2P 1QZHA 4OWWB 4MH0E 4W9GA 4IPDA 3MHBA 1BBUA 3BYTB 1K8MA 1TS5A 4N9F4 3A9JA 1E5WA 1CK1A 3PMFA 1UE6A 5IYCG 4JPSA 3MFYA 3OW2A 1GUWA 4CKBA 2Z9HA 3IXSA 1LTLA 3RZOH 4WJNA 2Z1CA 5LMNQ 4OEMB 2C7NB 5D14A 1K8RB 2XSCA 1STYA 5CV9A 4APVA 2WP9B 2KJ6A 3AE5B 3KUZA 4C3IB 4W9LA 4WQOB 1K83H 2INCC 1R4QB 1K8OA 1ASYA 1CSQA 2ASBA 2KDBA 4C00A 3CF5A 2BPSA 1AZPA 3BS1A 5M3MG 2O6VD 1T0SC 3R7QA 4X6AH 1GJZA 4XDDA 2PQAB 2XIWA 4NXNQ 3N6RA 5EBCA 2WXNA 2RDFA 2L12A 3UI3A 2AQ1B 3T3OA 1KH0A 1DCZA 4IFDI 3O65B 2JA8B 1EYAA 2MA9B 1Q10A 4B08A 1WTXA 2EKEC 3KF8A 4P16A 1WTHA 5EJWA 4YCVA 2GBRA 2K25A 3HM3A 1GB1A 1STAA 1UWVA 2OQKA 3QOJA 2ZJRA 2F0FA 3DBHB 2K75A 3CRKC 1GNUA 2FE8A 2WXPA 3KVFB 4DR1Q 2ZPYA 1B44D 1FGUA 5LHY1 5FLXE 1QWYA 2N78A 1XPRA 5C4JB 1WD1A 2E5LQ 2RF4A 1AWDA 2W54A 4CO7A 2F0UA 2ZJQA 3C46A 4KIKB 4DK6C 2M0XA 4L5TA 3X3NA 1ZXHA 4AUQC 1KAAA 4RMAA 1PZKD 1NBWA 1RD9D 1G2TA 3QJZA 3SXHA 1STGA 1U0LA 3TRZA 2N49A 2DYMA 4AH6A 1J7CA 3MTSA 3NVZA 2FXQA 3PREA 5CHVC 1UNSA 3T8MA 3MJWA 3GTQB 1NYRA 4E6IA 3M3JA 4DR6L 5JEAH 2H88B 3VAWA 4HKQA 3VQIA 4RM9A 3ENEA 2KN5A 2LGXA 1UWMA 4BWGB 3JAME 3UINB 2FINB 5LL6X 1Y14B 3GP7A 4W9DA 2FJ2A 1WMHA 5AJ3L 2WINB 4IPGA 1DOMA 1C76A 2L83A 1C79A 1S3OA 4Y7NH 2ZJDA 3QQ8B 2HDMA 5FLMH 1UF0A 1GUNA 2A5HA 2F4VQ 4O2DA 1BMLC 4ANXA 5DPSA 1JWMD 1EQQA 3HOXB 3W1YA 3G48A 1V6EA 2B2UA 3PIPA 3RNGC 2AL3A 1EYCA 3BK1A 5IWAQ 4R8NA 2L4NA 2QHOA 1D4BA 1CZWA 2B2YA 2EY6A 4JYAL 3S2HB 3K81C 4NXNL 3QO2A 3FMCA 1CA5A 2MJEA 2VQEQ 4DUYL 3PRPB 2YEPB 4PYUA 2HJ8A 1L0WA 4C56C 1BCPC 1VJKA 2GBJA 1X54A 3DM1A 3BY4B 4JGHB 3TP7A 1RJTA 1FRRA 4M0WB 2LMCB 1XD3B 4BAXA 3ERSX 2E75C 1S5FD 4P7IA 1ZXIA 5IOIA 2PW7A 3TDQA 2A8VA 3S2DH 1SYFA 1SE3A 2K5QA 2KCMA 3NBHB 1QZGA 2AQ3B 3TQYA 1E7VA 4GIVA 1F9PA 3AB5A 4LW1A 2MUYA 1OEYJ 1YIWA 4A3CH 1SSOA 2DYOA 3A4RA 2M00A 1K51A 5HURA 3I63C 2DENB 1Z6HA 1ZUD2 3EROA 3PZ7A 3M9BA 1YNTE 1IBXA 4JW0A 4DAPA 2CJNA 3L08A 3B0AA 1Z47A 2UWQA 4GDLB 5C5LA 1WE6A 5FR3A 4RWSC 2HJ1A 1Z9FA 1NCVA 1IYVA 2DX5B 1VQDA 1EF1A 1ML0D 3C1FA 1I4PA 2UXCL 3NOBA 4TQ1A 3TEYA 1F9JA 5I6YA 3CRLC 2BKRB 3PVLA 4ICVA 4XGAB 4FBJB 5CBAE 4NXMQ 1O80A 1T6BX 1M4VA 2CHBD 4QJFA 5BN4A 5C44B 2L7RA 3IVFA 3RZDB 3ZDTA 2I2YA 1DGSA 4FYDA 2JJQA 1C7YA 1N33L 2R7DA 1EF5A 4TUUA 3QCAA 1TY0A 4WJ3M 2EYLA 2CU3A 4RFBA 4C3IH 2CKZB 3QARA 4FXGC 1TS2A 1KNAA 2GA4B 3UDFA 1FCLA 1SJHD 1L5PA 4IWPA 2WKCA 1LTTD 4ZRQA 2B2TC 4DV3Q 3E56A 1V80A 1FXIA 2WV6D 3KK7A 2F0KA 1CKNA 3HOZG 3NZ3A 1SNMA 3K7UC 4POFA 1Q1BA 1TIID 1XPOA 5AUIA 4KKJA 1EY0A 1YI2A 4DBGA 5M5YH 5D7GA 5LXHA 1SMXA 1E1OA 2HCCA 2ACZB 4FHJA 1N9WA 3DHQA 5IODA 1TWAB 4QIWE 2JA7G 5IA7A 2KHWB 2NZOA 3DQVA 3P75A 1SE2A 1ICFB 1Y1WG 5AFWA 1G6ZA 3V05A 2IDYA 2N7JA 1WR1A 3AH7A 3WANA 2J7QB 5T1GA 1XNRL 4DV7L 1GUGA 5KNDA 3F2CA 3AE1B 1E1TA 2B2VC 4NJCA 5K36H 5ISRA 3AU5A 1EIHA 2JUOA 2KO3A 3TL5A 4ZOHC 3PUXA 1QOFA 3MFGA 5ELBA 1TVXA 1F2RC 3H91A 3NWTA 2ID0A 1VZ7A 1D5XC 1BUVT 2RHQB 2O2VA 1Y8NB 1BQQT 1BF4A 1WJ4A 4GOPB 1JWSD 4ZYNA 1FO4A 1SE8A 1YZ6A 2KHJA 4KX6B 5A2QE 1MKHA 4PK1A 4DUZQ 2V9HA 3VRAB 2DY7A 5GAEC 3AEEB 3CKIB 4A3BB 4PS3A 2WDQB 4Q2JA 1EEFD 5IWAL 1YNND 1XLOA 1V1PA 4B9XA 2LVOA 3DCGA 3J80E 3CC4A 3URYA 2CWPA 3T13A 4A3GB 3OTOQ 1TZOA 2G9HD 2KACA 2KWVB 1WGGA 1K73C 3WAOA 4HIKA 2O2LD 3ZXVA 2D5GA 2W82A 4BBRG 3AV8A 5T1IA 3IFWB 3E9IA 2QMTA 2K32A 2GMIC 2KHIA 3P42A 2KDMA 1IYFA 1XXGA 1KXLA 1RYJA 2MO0A 2W3SA 3HUIA 4BBNF 4XYQA 2NZHA 2PMZE 1KL9A 3WDNA 1F2LA 3S2HH 1VMPA 3MWYW 1IKLA 5KGUA 1MIUA 2K04A 4P71A 2JY6A 1P16A 4GZYC 3EFUA 4IPCA 1F1HA 1ZDVA 2MHJA 4JI2L 2PMZB 1IW7D 4K1RB 2NMQA 1OQQA 2LGIA 1SIJA 5IP9G 1VQMA 2J53A 3RZDH 1XX8A 2A6HC 1HZ9A 3M4PA 2ZZPB 3S15B 3H3VH 1PRTD 2HD3A 4K5WA 1TWCB 4PMWA 1MPEA 1IW7C 1ESFA 5FJ8G 2RGFA 1EZ6A 4YT0B 4CBVA 2A73B 1IBKQ 4P74A 1SEBD 2E3TA 4CHKA 1WR6E 3C8YA 3K58A 4MN3A 5LMUL 2NBVB 1DXMA 4RHRA 1XMOL 4DQOC 2QILA 2GN5A 4OVVA 5CHFA 4OVUA 5HGQA 2KD0A 2E2IB 2F0TA 3NVWA 2F0HA 1GHKA 1XMOQ 4ACFA 2VS1A 2CW0D 4QGUA 1SYEA 2EJFC 4DV3L 3RN5A 2K22A 2DZMA 1PH4A 2NVQB 1WJUA 3VUXA 3FILA 4K7UA 4ZKCB 4LLGM 1JJ2A 2KDFB 1CQVA 3AYHB 3FPUB 1PDXA 4N58A 1SLJA 2IY0B 1T5EA 1YNJD 2IYDB 2YV5A 5J2RA 2I38A 2KX0A 2ZW0A 3EC8A 2EPBA 3NHEB 2F0PA 4DUYQ 2JF5A 1MI2A 1SNPA 1HTOA 1TXYA 1K9MC 3CSFA 5FKAC 5JPNC 3BIID 4X3SA 4FN2A 1I4RA 4CJ2C 1L1OB 1II3A 1ZKHA 4GMVA 1WM2A 2UXBQ 2JA7B 1ASZA 4K7WA 4II3B 3SE0A 1PTOD 1TKWB 2F3VA 4JI8Q 4TSSA 2Z59B 4H44C 1CM9A 3MC9A 3I2ZA 3PO0A 2BYVE 1C9FA 5C4ZA 1YHQA 2G4DB 3G6EA 4LAAA 2K01A 1VQOA 3WOFA 3K80C 1UGJA 4JI0L 2I5LX 1PVOA 3ZRCA 5JVG3 2AUJD 1EFID 3DWMA 3G7LA 4FULA 2MFIA 3M85A 3CCJA 3ZNZB 1A8VA 1U5KA 3BVMA 1AYFA 1FMAD 2JXTA 2VH2A 4U68A 3P7JA 4YWMA 2A6HD 4YY3L 3PF5A 1MJEA 4CDFC 1HZ5A 3VYTA 2O5IC 1Q0WB 1NJIC 4PS7A 4C3HG 4M02A 3W1SC 4P1CC 2UUBL 4FXCA 3W9CB 2VXWA 5EQ0A 1EYDA 1X55A 5C4XH 4WH4A 1SYBA 3QHTA 2DBYA 4GN3B 3HOXG 4DV2Q 3IAYA 1KDCA 4A3GG 3MXPA 4JK1C 1N8RC 4K7SA 2LS01 2SOBA 1A15A 4OVZA 2B2UC 1JB3A 2J0TD 4C3IG 1KM7A 1Q12A 4P6VF 5JAVA 3RN2A 1H9SA 4YCWA 2Q2UA 3NG0A 1XCTL 4BA2I 4A3IH 4A3OA 5M3MB 5FLXL 2AX5A 1KRSA 5HY6A 4DR7L 1SF0A 2F1MA 2OWOA 3RD4A 4R1JA 2B76B 2PE6B 3UDGA 1DOLA 3ITPA 1YJJA 2MRPA 4W9IA 3FKYA 1WYWB 2BE5C 1E7ZA 4JI7L 2WNMA 3CHBD 3B9JA 3AM9A 1WH3A 4X65Q 3BZKA 3PUVA 3RR5A 3BG3A 3J81j 3HOVH 1EOVA 2BYFA 5JXVA 5IP7G 1HEZE 4QCLA 3P1MA 4NAWB 3J80i 1E8XA 4WJPA 3OW7A 3UIPB 1V5TA 1WGDA 4M8MA 3GTKH 5H92C 2J7ZA 4LK1C 1Q3LA 1WGHA 1XMQQ 2XEWA 4IJHA 1PTOF 5LNK1 2C9OA 4DR2Q 2JEAI 2VQFL 4B3ML 2R92B 2RKSA 4ZLTF 2QDFA 4IM0A 4HPMB 3C3LA 4EE2A 2AYOB 3M62B 5G2NA 4IJLA 3BDLA 1WX7A 3T16A 3GO5A 2KK8A 2L1BA 1YJWA 4L6TB 1L1OC 1EM7A 1GB4A 4IUPA 1MFWA 3GDEA 3IAS1 4KSKC 4N9PA 4EUTA 2B63H 1PFBA 4XYCA 5IO9A 1HR0Q 3R93A 2GBMA 2F3IA 2XK5A 4K0KQ 4XX5A 4C7YA 3PPAA 2JA9A 3WAPA 1DOKA 3Q3JA 4KN4C 1J5EL 1KIXA 3X3MA 3EFCA 4GS3A 2YU9B 2WAQG 1RKNA 1IBLL 2D3AA 2PPHA 1W6JA 1K3BC 3I9V1 2NPTA 4M1UB 5KNCA 2NVTH 1PA6A 3A8KE 1RRBA 4HJ9A 3F2UA 2KOXA 3WAMA 5BMHA 1XLPA 4RF1A 2I1KA 4S3SA 3R2IA 2RSUA 1WYDA 1T5XD 4LF5L 1UGMA 4KHPQ 4DK3C 1NI2A 1Q82C 1M94A 3GV6A 4AQYQ 4KY7A 4KGRA 1ONLA 4AWJA 1IZ6A 2Z4HA 1N63A 1X6OA 2Z0SA 4WJ4A 3G6JB 4RGMA 2KA7A 2NUCA 1PRTC 2E2DC 3QG1A 4GLXA 3CW2C 3H9DA 1VQAA 1I7HA 1NNXA 2R7ZH 1Z2MA 2AEHA 2KVRA 3H7PA 3Q8DA 3H0GB 1PH5A 3SHQA 4KJNA 1UBIA 3N1XC 1LFDA 3Q3NC 5JEAJ 2D07B 1SRUA 2WFWA 1WM3A 3I56A 3QR8A 1RM6C 1I6HB 3AN1A 5EE3A 3D31A 2CWAA 4P2CB 2ONQA 1J8IA 2KFKA 4BBSH 4BBRB 5JZEB 4HXDA 1WXSA 5ELDA 2BVCA 5C44G 2E2JB 3IT4B 1JCKB 3RPFC 1JB7A 1C8CA 1BBXC 5HI1A 2E6XA 1TWGH 2VZKB 1E24A 2N9PC 3PIO3 1EUVB 5CV8A 1SB3C 2F0GA 3ETRA 4IO9A 4GDKB 2SAKA 4X62Q 5CTRC 3H0GH 2G9DA 3WA0A 5LL6S 2R6GA 5L83A 5CYUA 2FMCA 5DPRA 5ELOA 1TKYA 4B3TL 2MW5A 3UDXA 2NZ1D 3U4EG 3K5MA 1WJNA 4CDEC 5IY0A 3Q8BA 2JRHA 3ZIMA 1I35A 1X3FA 3GE3C 5IIFA 2PQEA 3RUZA 3QIJA 3ONAB 4YWKA 4IM3A 4F8CB 4DHZE 1PYBA 1OTCA 1R4PB 1EU4A 5E7NA 2IW3A 1X56A 1K0SA 1TS3A 3HKZB 4FDBA 3M4QA 3I90A 3H15A 1P8LA 1I94Q 1LQBA 2FFKB 2LKVA 4MH8A 3U58A 4XT1B 3PTFC 1PGBA 2SNSA 4WWOA 2ZXOA 1A62A 1GD7A 3I4OA 2J52A 4ZKBB 5C3EH 4LF6L 1J7AA 1SN8A 2WXKA 3WCQA 3HK0A 3K9OB 1E90A 1NR4A 3A9KA 1S5ED 5IGFA 5IP9H 2EZVA 5M3MH 2PZUA 1Q81C 3AXCA 2V1CC 2PVOD 1NI3A 3S2AA 2DLBA 3K7AB 4HJGE 2DY8A 3NQTA 3NZSA 4JLCA 4IZ8A 3Q24A 1YQ4B 5CX3A 4A3BG 2JSVX 2L11A 1H9MA 2LXKA 3A74A 4KD4A 4BXXH 3RNBC 4C80A 2KMAA 1N36L 3KBXA 1Q5WB 3GTGH 4UP7A 3GD7A 3A55A 2OOBB 4F1SA 4MTNA 1PH2A 2K8BA 2RQXA 4J15A 2L3ZA 5AJ3Q 1SFOH 2RPQA 1JWBD 2WACA 2AMCB 2PEAA 1WGRA 4F7ZA 3HOWH 3I4NG 3KFUA 1DYQA 2JQOA 2XN9C 3GS2A 5EBDA 2JA6B 2OJWA 2B3GA 1PFDA 4WJOA 1R4MB 4PYZA 2NWGA 1ICWA 3EA6A 5AUKA 2ES2A 2JPHA 4EZLA 4F7XA 5BMGA 3V60A 1PRTB 4X65L 2ATWA 3TREA 1L2FA 2RDBC 2O5JC 2CFMA 4PZ7A 3P4RB 4A93G 2W9NA 4KIKA 3ZJVA 1RL2A 3Q8CA 1YNNC 3HP3A 5EKKA 3ER0A 3MC0B 4L1BA 1A70A 2NCNA 5CV7A 2DYBA 1SXTA 1X32A 3DVGX 1I94L 3CAMA 2D3CA 2ZXPA 3WOEA 4C3HB 3HRDD 4IFDJ 5G5HA 1BT0A 1S5DD 1L0VB 3S1RH 4HWIB 4AJWA 2A68C 3VRBB 3HVDA 1WOCA 2HQEA 1WTQA 1DOIA 4FXDA 1XNQL 2JA8H 2R3ZA 3MZ5A 1LO5D 4X3KA 2WX0A 3EIVA 2ZT9C 2X38A 1PFNA 4HAEA 1QQRA 1BVSA 1TS4A 1STBA 3K9PB 5BYRA 4LDTB 2G5DA 4CDDC 1VCIA 1LTID 3DPDA 3HOXH 2FUHB 5FO9B 2YLMA 1NY4A 4N9TA 5F2DA 2PTLA 1B4OA 3T1YQ 2KFJA 4S17A 4N6EB 3DEPA 2V3PA 3FHWA 3PO3G 3A0JA 3RI7C 1L7YA 2KTRB 2CVRA 5D65A 2K28A 1E8YA 3TZDA 3FILB 1Z7TA 4WJQA 4A3GH 1G6PA 4IUNA 1G51A 4IUTA 1BO0A 1BBWA 3SR1A 2JXMB 4GLAC 1MGSA 2PNRC 4Z9CB 4DHJD 1KHIA 1K83B 4GKKL 4MJSB 3BZDB 1PUTA 4NW2A 3I4MB 4AS1A 1U4RA 3AMZA 2UUCL 3JSVA 4TMAB 4JBWA 1O7ZA 1FIQA 2RR9A 3TMPB 3ZLZA 3L4PA 2NVXH 3Q22A 1F52A 3EUB2 4FF3A 3CP0A 1B3QA 2D5DA 3QIAA 3A1QA 4TKOB 4JI6Q 1WCMB 5D94A 1V1OA 5ELFA 2PPBC 3ALBA 1EQVA 2OXPA 2NTTA 3BDOA 1PH1A 4L23A 4W9EA 3ZQ4A 4I6NB 4R4QA 1Q86C 1K8GA 5GADC 4EKUA 1VMCA 2MP1A 4MTKA 3T56B 2CHZA 2MWSB 2YVCA 4OW0A 1MBYA 3T4AC 1KRHA 2F0OA 3RNEC 1XF5L 4RCNA 4E3CA 1CTMA 4K8JA 2DNCA 4MGYE 1TT2A 3C19A 1S5BD 2LGYA 1YQ3B 5C6AA 1XCQL 3M3YH 4JWSC 2KUMA 4R4IA 4NP5A 2YEPF 4W9KA 1OXSC 4HRSA 4K2LA 1CUKA 2MPMA 5DNFA 5LMNL 2IHEA 1GO3E 2EMSA 1UZXB 2KDEB 5C3JB 3SVMA 1ISNA 4C2MB 3PQIA 3N1YC 3RNCC 4MGKE 1EWCA 3F8TA 3KBGA 4KHZA 3I73A 3NELA 3VYSA 4OXPA 4QL5A 2MNAA 1HNWQ 1TBEA 3RN9C 4DN4M 3S14B 3KYHC 3KW5B 1PH3A 2WU2B 2F0JA 1JR0D 1VZ8A 5C0XG 2K5VA 1FL0A 2LWPA 1ILPA 2H1EA 3S15H 2D3GA 1VZ6A 2V4IB 3S1QB 2DGYA 2RHSB 3J7A5 4BOSC 1JRPA 5C3WA 2HD5B 4PT5A 3TMEA 3IFDA 1YIJA 1PH8A 2KWDA 1EQTA 4PQXA 4HPLB 2HCIA 2F0IA 1M90C 1V5OA 2D9UA 3JSVB 4CQNA 5CV4A 2GVAA 2OT2A 3RNAC 3VTWA 1AE3A 3K0XA 4P1BC 2ZTDA 1TZ1A 3GZNB 3HOVB 5DAUA 4XDCA 1N5XA 1GUAB 4JQWC 3S14H 4A90A 2XRQD 3Q69A 1FNUA 4LF4L 5CC4A 2ICEC 4KKTA 1FFVA 3AU4A 2A5UA 3L17A 4EZKA 3NP8A 2E2JH 3T1HL 2K6DB 1STHA 1P9DU 3PSIA 2IBIB 4B3RL 1PTOC 5TR5A 1IYJB 2NN6H 4USAA 1XT9B 1V1QA 3TP6A 4B0EA 3PZDA 1KDAA 3HS0C 3BDCA 1FXAA 2KOLA 4BY7B 4LCDE 1J5EQ 3GQBA 5T8IA 2A4ZA 4FJYA 3M95A 4GNXC 3NEMA 2I5MX 1KTKA 2DAFA 2YYZA 1J7BA 2O6VA 1PXUA 4HCEA 2E76C 3J7ZC 1MHHE 2WHIA 2V4LA 4RHSA 1S40A 1AP0A 3M63B 1HPCA 3JW0X 4KY5A 1HQRD 3F2DA 3APDA 2LRUA 5C44H 4IDIA 5FJ8H 4LWCA 4B9WA 2WXJA 3AEVA 4C7ZA 3NBHA 5M5XH 2PLPA 4GN5A 1HZBA 3UDIA 1TYGB 5BO4B 3ONSA 3E6ZX 2N7EA 2KWCA 2EQSA 2KVZA 1MI0A 4HIDA 4JBMA 2RDGA 4DK0A 1IL2A 4KDIC 4MGIE 1C48A 2L0TA 1WCMG 2QA4A 1MHXA 2WB1E 3RULA 5I9PA 4GKKQ 4K8IA 2A6EC 2IGGA 1IBXB 4KGTA 2LUMA 4W9CA 3KQ4A 2K5NA 1EZ8A 1JC7A 3LJ3A 1AZQA 4JG2A 1HR0W 1SAPA 4YSZB 3DBLB 3L16A 2KMCA 3W1BA 1JQ4A 2ALYB 3S17H 2FBWB 1V43A 2DJFC 2JWUA 1PFMA 1SFOB 2K3UA 2VZKD 1CHPD 2JEBI 1D7QA 1K52A 3X0WA 1EY9A 3BVGA 2EY1A 4NQLB 1NE3A 2EVBA 1NAPA 1OFFA 1TKEA 3A9KB 2N88A 2NB0A 1OQRA 3D3RA 1I50B 2R92H 4HCNB 3OOCA 4OO1G 3Q23A 1N60A 3HM6X 4NY0A 5FLXc 4IWOA 4MGZE 4DHZB 4KY6A 3QK0A 1T9HA 1TT5B 2MBQA 4ZRIA 5FR6A 2JYEA 4B95A 2NVXB 1HZ6A 1WGKA 4WFN3 4YHHL 4A3EB 3U7DA 4L5QA 1I5FA 3ZYYX 4A55A 2D3BA 1OXUA 4MM3A 2JRIB 5JHBA 1IGCA 2LXAA 3TP8A 3ZTCA 4TVAB 3A33B 4KSLC 3RFZB 5JJLA 3AQQA 3K8AA 5A2QL 2ZVNA 3Q14C 1Q8IA 1ZOYB 2N7DA 2IHFA 2IPKD 1G91A 1IXRA 2BDNA 5EPJA 4HDQA 3PHWB 2QDLA 1BXTA 2GBNA 3U52E 2N0SB 3VR4A 2RA4A 1O7LA 2MBHA 4DV1L 4LFAQ 2KJRA 3CWIA 1IGDA 1S3SG 4DK1A 3RMHA 2C5CA 1WYGA 4I7ZC 3R8BA 1N34L 1E0ZA 1HXYD 4A20A 1PLFA 5C23A 3NTIA 5I2XA 4GNXB 1E8WA 4M8AA 2JE6I 3FRPB 4ZUIA 2MBOA 3OJ4B 1H9JA 4DR3Q 1HCZA 4LFAL 4N59A 2LFNA 4X57B 1VR9A 3FKIB 5E4WC 5EPKA 4BY7G 5G3LD 1YOVB 3KJOA 5E6NA 5J17A 2BW2A 4POGA 1KFYB 3GTKB 2MQJA 1B3AA 1SIFA 2B2WA 3PO3B 4ARIA 1IP9A 2KFKB 3EHVA 4FXKC 2K8HA 3SK4A 3M7NA 1OXXK 4MSMB 3UGBB 4KLKA 1EIFA 1OQYA 2BS3B 4KVGB 1ENCA 3HOZB 1UEBA 2B8FA 1QOAA 1ZW7A 5E6OA 2RMMA 1SE9A 2XWBB 1Y1VG 3I57A 2Z6BA 4FHKA 3I4MG 3WWVA 3CCQA 3I4NB 1CQFA 2FUG1 2LVQA 1IHZA 1VQBA 4BBSB 1VQ5A 4FF2A 2QGQA 3ML8A 1E0BA 1Y1WB 2LGSA 5E4XA 1LT3D 1Y8RC 3R3MA 3KJPA 1C78A 4RAUC 5KRUA 3EFXD 4MM3B 2JZPA 4A3JH 5KHOA 2HT1A 1AH9A 2AWNA 2PI2A 3F1ZA 2PE9A 2CHWA 1S5CD 3ZDMC 2IL8A 4G0NB 4A93B 3H09A 3HOYB 1IPGA 3P2BA 2EMTA 3K7AH 1EWIA 1FCCC 1XNRQ 4RH6A 1J9OA 4N8X1 4Q5VA 1VDZA 3K5LA 3Q3FA 3ND8A 2P5ZX 4GOCA 1X3PA 2RDHA 4L5SA 2LHDA 2E2IH 3DHHC 4XXEA 3V61A 2PNHA 2IWHA 4GN4B 2VB3X 4EQPA 3H3VC 1WI5A 3PIOA 1T0RC 4ABNA 2ZM6Q 2UUAL 3PLVA 3PV1A 2Q5WD 1FNVA 3HIZA 1TWGB 3L3OC 4OWTB 3CXCA 3AE7B 1E8ZA 3J81c 4XQNA 1SBBB 2KLGA 3LYYA 1TWAH 2GRIA 5M5XB 1B1ZA 2QDBA 3T1HQ 1JROA 1A2UA 2MEKA 3ZJTA 1H8CA 5ELCA 1Y8PB 4FO2A 1WD0A 1DGJA 3W5UB 3CF6E 1Q1OA 4DDGD 4JI7Q 4ODGA 4KI0A 3SHLA 4GN1A 4TKNA 3D6CA 2WQYB 1IUEA 2Q8RE 1GXDC 4DR1L 3UF8A 4V190 1Y69U 4LUOA 2EKIA 3QAQA 3A7LA 3FAHA 1BUIC 3TN2A 5EKLA 2EDGA 4DA2A 5JJZA 1E7PB 1N5WA 1A0IA 3K57A 4KHPL 1OEYA 5J18A 3S1RB 3ZRFA 3NY5A 4IKGA 3ZTDA 3VTUA 2E2HB 2EJMA 1V81A 4GLSC 4ITKA 1KLGD 4DV4Q 1KRTA 3VDZA 3J81i 1JALA 2OTJA 2B2YC 2BCOA 2KJXA 3AI5A 1E2ZA 3DUZA 2UYZB 4NJ6A 1JJCB 2KNBA 3DWPA 1QOHA 5AZFA 4MSQB 3A54A 4O42A 5DM63 5AEKB 2MBEA 1SROA 2DNEA 3TUOA 4G4KA 4LF4Q 4DK5A 1P7FA 3H3VI 3FKIG 2N3SA 4ILWA 1WFQA 3I5JC 1EWHA 4JBJA 1LT5D 4ANUA 3OAWA 4IUUA 2N9KA 1WI0A 5I4DA 2C7MB 4NDXA 2F0DA 2A69C 3HOUH 3SGIA 1UH6A 2B63G 2L76A 4FJVB 2ON8A 3APCA 3U30A 3NK9A 2WXOA 1YMHE 4S0RA 1K0RA 2G3QB 2D10A 3U8ZA 3EQLC 1F2MA 4KMUC 4LNKA 3QC8B 4B3TQ 1NMFA 3I3TB 1H95A 5IGBA 1T3QA 2BS2B 2N1VA 3AE4B 3MHZA 3N30A 1JW9D 4JC0A 3PO2H 1VQGA 4QF4A 5JJKA 1E2VA 3MAQA 1HQMC 3QA8A 3RT3B 1GAQB 3CU7A 1YJ1A 3GTPH 1LT6D 4I7AA 2QCPX 3STBD 2BH2A 2QIEB 4AIMA 3R7RA 2UUCQ 5CV6A 5KEEA 3L54A 4LFCL 3NS8A 1GPXA 1D2BA 4MDKE 2K8CA 2IY1B 3VA5A 3W5OA 5BN3A 1PQSA 2GOWA 3AECB 2H4OA 2R2OA 3DBRI 4JWUC 5EE9A 1PDQA 1BNZA 4RGNA 4UY8C 4A3DB 2WKDA 3GOEA
chains in the Genus database with same CATH topology
2L1AA 3HRZC 3NTHA 3AE3B 1ZEQX 2F0LA 2D62A 2BYTA 1QG7A 1Q90A 3D4RA 1JICA 5C5MA 1V1PB 3VR8B 5C4XB 1B9MA 2EYOA 2EYFA 3B2GA 1ZYRD 4XDXA 3CIRB 5G5GA 3FDTA 4KN7C 1FYCA 1WSPA 4OGQC 1ZKOA 1CHQD 5CV5A 4Q0FA 2K7VA 4OIJA 4NMZA 5GXGB 1F9SA 1SE4A 2L52A 4J6HA 1HHVA 3OHXC 1ILQA 4ME5A 5IT9L 5CORA 1CI3M 4OO1H 4TQUS 2N9LA 5K36G 2EJGC 1BCPB 4ZAIA 1NENB 5G3LF 1WTOA 4LTUA 4H7BA 1YN3A 2WLBA 2EOTA 4HEDA 3SK5A 2KAJA 1F0ZA 2BBCA 1WTRA 2WS3B 1XO3A 1QKZA 5C2TB 2D2CC 5C0XI 3ERQA 3JAML 3J7AV 3LXFA 4IOIE 1HFNA 2V0GA 4KHVA 1QNUA 3IT6B 3AEDB 2L0CA 2B8GA 4ZHOA 1Y1VB 1AEXA 2EXZA 5C0XJ 3LX0A 2KQ4X 3U2SC 3GTLB 1F2YA 3AEGB 4G7HC 4O1NA 4KV6A 3RZOB 4DGZA 4EQOA 1WVLA 2NN6I 3OMGA 1TJEA 4IUVA 5IT9E 2AQ2B 5D3DA 2VB2X 2WXHA 1NVID 4IFDG 2WXQA 3U9OA 1FNWA 3MA2B 1QOGA 3BK2A 2MHVA 4JX1C 4F87A 1B53A 4BS9A 1E2WA 5TSSA 4DFAA 2DWQA 1FM0D 4J1MA 2F0NA 3KWLA 4OIKA 3AE6B 3J7YW 2TSSA 5FK9C 4KK7A 3GTJB 1LTSD 3FC4A 2WXMA 2BDOA 3IFTA 4A9AA 1P7EA 4WAFA 3BYYB 3GTPB 1B9RA 1SNCA 1B50A 3HGBA 1N62A 4WQMA 2JA5B 2ENBA 3HOWB 3DEOA 3OWEB 4H13C 2F0VA 4UDUC 2KMMA 3NRZA 4CKCA 1R7SA 1ENFA 1OXTA 4IURA 1A2TA 3GTOB 3HEJA 4R8IA 5DM73 3K59A 2IGDA 1L0YB 4QUFA 2RPVA 1HA5A 2KVMA 2XNAC 3PUWA 2BE5D 3MXUA 4C3JG 3Q0AA 1K50A 4U673 1V97A 2K33A 1KNEA 3J81E 2WU5B 2N55A 1SNQA 4A3IB 3IL8A 1VLBA 2M0AA 2KQ3A 1I4HA 1FD7D 3PV0A 4K5XA 3Q8AA 1JWAD 3R3OA 2B2VA 1W6KA 5J1ZA 1FFUA 1BDOA 1A6XA 1V8CA 1LT4D 1E10A 2Y5PA 4DAVA 1TR5A 2BS4B 3MXGA 5JPMC 4MHEA 5FO7B 2A6ED 2QSDA 2R61A 3K5NA 2JSOA 2Q8TA 3AEAB 1B9NA 1H9RA 1L0XB 1G2SA 1LTRD 4REZA 2KEDA 4IALA 1LTAD 4YIJA 5I9OA 3MEHA 2CQAA 5JEAG 4YWGG 3MVVA 3W1SA 1QJOA 1AFPA 4OHJA 2Z4IA 5CBEE 5H8YE 2DN8A 4A3KB 5MPOA 4KTAA 1DOYA 3ZJUA 3KLSA 1PTOH 1YJIA 3NTKA 1ET9A 3M4YA 1GUOA 1RCVD 1GUSA 4CKEA 3VR9B 5E6JA 4XQJA 1IYUA 2VUMB 4RNAA 1DJRD 2K5DA 3DMUA 4QMGA 2HDEA 5A35A 4OZCA 1GUTA 4HN7A 4R9WA 3QOLA 2A74C 1ENAA 1RTNA 1C77A 4DAYA 1C4QA 1HUNA 2LFIA 1JOQA 1ESRA 4WIPA 2JQRB 4RF0A 1JOKA 1VF5C 2EYHA 2I46A 5CMDA 2JYTA 3ABVB 2EYPA 1VF7A 4FF4A 2F3WA 4CJ0B 3U9SA 1JOOA 3LWUA 3N9YC 2RBMA 1IKMA 1MSGA 4M0WA 1KDBA 1JE4A 5IGGA 4WJWA 4LK0M 3IKJA 1DM0B 4K2KA 1H9SB 1JMLA 1NEKB 1U4PA 2EYMA 5EE1A 2TMPA 3OMCA 5EGTA 2A68D 1SJED 3P63A 2F0MA 3NUHB 1KLUD 1QILA 2J42A 2ZW1A 3PO2B 1L6UA 1G8ZD 3NHHA 2BB6A 4WRDA 1LACA 5E1FA 4ZRPA 3W2DA 2NYZD 2MH7A 1CFMA 3VA7A 2QEJC 3IAM1 1Q1EA 1RFKA 2JU6X 1C4PA 3L7ZC 2X69A 3I70A 1BCPD 5M9OA 3L9AX 4BY1B 3T3NA 4A3MB 4CHTB 2WXLA 5CR3A 5EPLA 3AE9B 2K03A 2L5TA 2NVYB 3B2FA 3AB9A 3KLRA 3SFEB 5KIXA 1F2RI 3M3YB 1FR3A 3D8GA 2PYKA 1PZID 2R93B 1LLRD 5C3XA 1U4LA 2Z8LA 3V2TA 1X3QA 5M5YB 4OO1I 2OF1A 3W3AA 5FOBB 5M3FB 4XQQA 3BWUD 2FHTA 1CZGA 5FO8B 1MSHA 5IOCA 1PGAA 4LMQD 1A3TA 1PYWD 1DD2A 4QIWB 1BOSA 1KF6B 1EY8A 1A3UA 3GB1A 1D1KA 4NKLA 2IT1A 4PMBA 1SYDA 1SSNA 1JWUD 3C2PA 1EOTA 1XLQA 1XTCD 4MACA 2JX5A 3PUZA 2MJ8A 3VR3A 3V3XA 3PUYA 3SK8A 4FF1A 4J3OD 2WXIA 3D6WA 2R7ZB 1SDFA 1C4AA 1FRDA 4A6QA 1ROEA 4J8QA 4G7OC 1ZYRC 2RVLA 4I65A 2L55A 2WXGA 3EVQA 2F0QA 4EGVA 3LWEA 3GTMB 4B0MA 1STEA 5E3FA 2PO4A 3VR2A 3A8IE 1VRAB 2M9VA 1PTOB 4KKSA 2IGHA 1AN8A 3HOUB 1ET6A 1FD6A 4K6DA 1HUMA 1QE6A 3LNNA 1K53A 3NE5B 4C1NK 1B2TA 2JYOA 3U7ZA 1SMYC 1FEHA 2PCFB 3I8ZA 4DU9A 4HTHA 1DONA 4ZQ3A 2Y0SB 1OXVA 1GOZA 1I3QB 3TP5A 5KNBA 2RSNA 4XYOA 4NAMA 3J80L 1KABA 4L63B 4C3JB 1XEEA 4DNTB 4L2YA 1TU2B 3NUCA 2KHSA 1L6VA 1U9RA 3K0YA 1DZ1A 2EY5A 1STNA 3DWGC 5HFYA 3T53B 2BA1A 1WTPA 3AEBB 1FGBD 2M19A 5HGTA 4BA1I 2M2LA 4EVOA 5I6WA 1Y56A 5HG2A 2WB1B 3OIQA 1DOXA 1SMYD 4RKLA 5BN5A 1Y8OB 2GB1A 3E0JA 5JVH3 5M5WB 4ARCA 2WP8J 2W55A 1XYIA 1D5ZC 4HCSA 1EWYC 2NBFA 3DXJC 3T51B 1NSNS 3GV3A 3NBIA 2X6LA 2ICIA 1L4ZB 4PV1C 3TEWA 4KGSA 1YN4A 4LJZC 3ND9A 3HZXA 1I4QA 3D4WA 1WTVA 2LEKA 1F77A 1LTGD 3GTGB 2OEDA 1U4MA 2K9XA 2LHEA 2K05A 2WIIB 3KUPA 3P4SB 2F0SA 4OZBA 4XWTA 4XE0A 4HMIA 3NPPA 4L8JA 1PZJD 1L4DB 2V3NA 4DNRB 2LY7A 1HRJA 4Y7NB 3R2TA 1MVKA 1LTBD 1CA6A 4OZAA 3BVZA 2INNE 3ZGZA 3J81L 4DXFA 5D3IB 4FP5D 4YSXB 2LJIA 1F9QA 3W5VB 1QOBA 3OPOA 2K5WA 1TWHB 3O13A 3Q8EA 1ZP0B 1UEAB 1RF2D 4K6LA 2I07B 2EYJA 3AE2B 2WDVB 2O4XA 1QT9A 5DEHA 1C4CA 3TZUA 3VYUA 2F0EA 1G291 1IL8A 4WORA 4AQ7A 5IGEA 3Q8FA 1D6EC 4HEA1 1SYCA 3V96A 4HROA 1D5MC 3S17B 1UWXA 3NVVA 5J39A 2Y3AA 3AEFB 1EY5A 2KECA 2INPE 1VDVA 4OL7A 2K1BA 1CZPA 1EIGA 2VNUD 1E6EB 3A7AB 2MJ3A 1A3VA 4ZK9B 2Y5CA 3S2DB 4HR7B 1WTWA 4JE3B 3D4DA 3A8JE 2SNMA 4ZHPA 1SNDA 3QWNA 3SEBA 1TKGA 4ID6A 2HTME 4FNFA 3S16B 2NTSA 2NN6G 3SFDB 5IGCA 2AWOA 2QF7A 3NS1A 4HSVA 2B63B 1QCBD 4US8A 4ZYSA 2L32A 2M56B 2W3RA 1HA6A 3TSSA 1QNKA 2FMMA 3P4QB 3S9WA 1AW7A 1I4GA 1OO9B 2A69D 2SDFA 4YSYB 2BA0A 1TY2A 4X3TA 1ZE3D 1HFGA 2OEOA 2NVTB 3LB8C 1QF6A 3S1MB 2WAQB 3E5SA 2GI9A 3P4PB 1XLNA 4PMCA 4K5VA 2EY2A 4RA8A 4ULLA 4RGTA 2JP1A 1EY6A 3TBIB 4G7ZC 2E74C 1YN5A 3TEXA 1QLBB 1BR9A 2HUGA 1RODA 4K14A 5BYQA 1LABA 1R9TB 1O78A 1YNJC 2G1EA 3VR5A 1I6VC 1V8QA 2PMVA 4ZRZA 3M4OB 5IGDA 4HKZE 4D2KA 4WURA 3I4LA 4G57A 3RLFA 1ZDXA 2IX3A 2RSOA 2IJ0A 2F03A 2MGSA 4US9A 4YTNB 5C3EB 2B39A 5COYA 4CJ1B 3CQZB 1WXQA 4NZLB 3EGRA 4XIGS 4UAIA 4IQZA 2PW9A 2WXFA 1H9KA 3KLSX 5I2YA 3NVYA 2PIAA 1O7YA 2BT6A 5NUCA 1E9MA 2LMCA 4TQ0A 3MXNA 2BB5A 3E9SA 4C1NI 2KN4A 2BTEA 2J4XA 2QKIC 2KEEA 4H2AA 1JORA 1SYGA 3K5OA 2F4IA 1EEID 2XWJB 4V0BA 3HG9A 3Q6SA 2PZTA 3S1NB 2K5PA 3DWQA 1M8AA 1BCPF 3J9CA 3PIP3 4XT3B 2K6AA 5HHDG 5CGKA 4RGOS 3OIPA 2WXRA 3UI2A 1NUCA 4YTMB 3AE8B 3FEWX 3P1HA 1PRTF 3DWAA 1CT1D 1RWSA 4YTPB 4F88A 1GJXA 4QB4A 5EE0A 1CJEA 3M7GA 5JOBA 1TQOA 2KCNA 3FVQA 1WWTA 4WWMA 4IUQA 2L9HA 1SNOA 2F0WA 1EY7A 4MT5A 1QB5D 2MJDA 3SDZA 4QUCA 1I4XA 4F8MA 1LV9A 1NYQA 4PNYA 2WDRB 1RHPA 1XWEA 2IX0A 1GHJA 4TRDA 2AUKA 1HTPA 3N52A 3NWSA 3K6OA 3NXWA 4HSPA 5BYSA 2K0PA 3J7AF 2SEBD 2PKOA 5KYIA 1JQYD 1UUPA 2PW5A 4RCOA 3KWVA 2OHFA 2H89B 3H8HA 1NR2A 4KJOA 3P20A 4R3DA 1N61A 3QB3A 4KKUA 1PGXA 1TWFB 5EKIA 2CJOA 4XTCS 4EQNA 3SR6A 3TEZA 3I91A 4HMJA 3NQIA 1F9RA 1S4ZA 4ZUJA 4IN3A 4XWWA 4RKBA 2XRSD 2EELA 1EU3A 1MD2D 1PMRA 1ZXTA 2B2TA 3MJ5A 3MP9A 3QJYA 1UAPA 2PVGC 5BMIA 2Q8IB 3C1EA 2HDLA 2BOSA 3AMUA 4A3JB 3HVZA 3OSOA 1HTLD 1EL0A 4KD3A 2X6GA 3EJIA 4X3UA 2EE1A 2QJLA 5C0XH 4MIUA 4A3FB 4IFDH 4YXDB 3A56A 5C4HA 3H6MA 3I3CA 5KYLA 1RDPD 1EY4A 3SK6A 2IX1A 4DF7A 2XVSA 5ELEA 3NSWA 1D1IA 2CW0C 3VYRA 4A8XC 4DXGA 1WRIA 1ZPSA 4H0LC 4AYBB 2ZXRA 3PZ8A 3I72A 3H94A 2PZWA 4KKIA 1RTOA 3AU7A 3VR6A 1F2ZA 4CGYB 3FPPA 2B2WC 2V4DA 5K5PA 5J22A 2KCCA 3OWFA 4FVMA 3MHBA 3BYTB 1K8MA 1TS5A 1CK1A 3PMFA 4JPSA 3MFYA 1GUWA 4CKBA 3IXSA 2Z1CA 5D14A 2XSCA 1STYA 5CV9A 2WP9B 3AE5B 4C3IB 1R4QB 1K8OA 1AZPA 3BS1A 4XDDA 2XIWA 3N6RA 5EBCA 2WXNA 2RDFA 2L12A 3UI3A 2AQ1B 3T3OA 1KH0A 1DCZA 4IFDI 2JA8B 1EYAA 1Q10A 4B08A 1WTXA 4P16A 3KF8A 1GB1A 5EJWA 1STAA 3QOJA 2F0FA 3CRKC 2FE8A 2WXPA 1B44D 5LHY1 5FLXE 1QWYA 5C4JB 1WD1A 1AWDA 2W54A 2F0UA 3C46A 1ZXHA 3X3NA 1KAAA 1PZKD 1RD9D 1G2TA 3SXHA 1STGA 2DYMA 3NVZA 1J7CA 3MTSA 1UNSA 3GTQB 1NYRA 4E6IA 2H88B 5JEAH 4HKQA 3VQIA 1UWMA 4BWGB 3JAME 2FINB 5LL6X 3GP7A 2FJ2A 2WINB 1DOMA 1C76A 2L83A 1C79A 2HDMA 1GUNA 2A5HA 1BMLC 1JWMD 3HOXB 2B2UA 3BK1A 1EYCA 4R8NA 2L4NA 1D4BA 1CZWA 2B2YA 2EY6A 3S2HB 3QO2A 3FMCA 1CA5A 2MJEA 2YEPB 4C56C 1BCPC 1VJKA 3DM1A 3TP7A 1RJTA 1FRRA 2LMCB 2E75C 1S5FD 1ZXIA 2PW7A 3TDQA 1ACCA 1SYFA 1SE3A 2K5QA 2AQ3B 1F9PA 3AB5A 2MUYA 2DYOA 1SSOA 2M00A 1K51A 5HURA 1Z6HA 1ZUD2 3EROA 3PZ7A 1YNTE 1IBXA 4DAPA 2CJNA 1Z47A 4GDLB 5C5LA 5FR3A 4RWSC 1NCVA 1IYVA 1ML0D 3C1FA 1I4PA 4TQ1A 3TEYA 5I6YA 3CRLC 5CBAE 1O80A 1T6BX 1M4VA 5BN4A 5C44B 2CHBD 2I2YA 3RZDB 4FYDA 1TY0A 2EYLA 2CU3A 4RFBA 4FXGC 1TS2A 1KNAA 2GA4B 1FCLA 1SJHD 1L5PA 2WKCA 1LTTD 4ZRQA 2B2TC 3E56A 1FXIA 2WV6D 3KK7A 2F0KA 3NZ3A 1SNMA 1Q1BA 1TIID 5AUIA 4KKJA 1EY0A 5D7GA 2HCCA 2ACZB 3DHQA 5IODA 1TWAB 3P75A 1SE2A 2N7JA 5AFWA 1G6ZA 3V05A 2IDYA 3AH7A 5T1GA 1GUGA 5KNDA 3AE1B 4NJCA 2B2VC 5K36H 5ISRA 1EIHA 4ZOHC 3PUXA 1QOFA 3MFGA 5ELBA 1TVXA 1F2RC 3H91A 3NWTA 2ID0A 1VZ7A 1D5XC 1BUVT 1Y8NB 1BQQT 1BF4A 1FO4A 1JWSD 4KX6B 5A2QE 3VRAB 2DY7A 3AEEB 3CKIB 4A3BB 2WDQB 4Q2JA 1EEFD 1YNND 1XLOA 1V1PA 4B9XA 3J80E 3URYA 3T13A 4A3GB 1TZOA 2G9HD 2KACA 2O2LD 2D5GA 2W82A 3AV8A 5T1IA 2QMTA 2K32A 3P42A 2KDMA 1XXGA 1RYJA 2W3SA 3HUIA 4XYQA 3WDNA 1F2LA 1VMPA 3MWYW 1IKLA 5KGUA 2K04A 4GZYC 1ZDVA 2PMZB 1IW7D 2NMQA 1OQQA 2LGIA 1SIJA 2J53A 1XX8A 2A6HC 3S15B 1PRTD 4K5WA 1MPEA 1TWCB 4PMWA 4YT0B 1IW7C 1ESFA 1EZ6A 4CBVA 2A73B 2E3TA 1SEBD 3C8YA 3K58A 4MN3A 1DXMA 4RHRA 4DQOC 2QILA 2E2IB 2F0TA 3NVWA 2F0HA 1GHKA 2CW0D 1SYEA 2EJFC 2K22A 2NVQB 3FILA 4ZKCB 4LLGM 4N58A 1CQVA 3FPUB 1PDXA 1T5EA 1YNJD 2I38A 2ZW0A 2EPBA 2F0PA 1MI2A 1SNPA 5FKAC 5JPNC 3BIID 4X3SA 1I4RA 4CJ2C 1II3A 2JA7B 3SE0A 1PTOD 1TKWB 2F3VA 3PO0A 4TSSA 4H44C 1CM9A 1C9FA 5C4ZA 4LAAA 2K01A 3WOFA 1UGJA 5JVG3 2AUJD 1EFID 3DWMA 3G7LA 3M85A 3BVMA 1FMAD 1AYFA 2JXTA 4U68A 3P7JA 2A6HD 1HZ5A 3VYTA 2O5IC 4C3HG 4FXCA 3W9CB 2VXWA 5EQ0A 1EYDA 4WH4A 1SYBA 2DBYA 3IAYA 1KDCA 3MXPA 4JK1C 2LS01 2SOBA 1A15A 4OVZA 2B2UC 1JB3A 2J0TD 4C3IG 1Q12A 4P6VF 5JAVA 1H9SA 1XCTL 4BA2I 5M3MB 5FLXL 2AX5A 1SF0A 2F1MA 3RD4A 2B76B 1DOLA 3ITPA 1YJJA 2BE5C 2WNMA 3CHBD 3B9JA 3AM9A 3PUVA 3BG3A 5JXVA 1HEZE 4QCLA 3P1MA 4NAWB 3OW7A 5H92C 2J7ZA 4LK1C 1Q3LA 1PTOF 5LNK1 2C9OA 2JEAI 2R92B 2RKSA 4ZLTF 3C3LA 4EE2A 3BDLA 3T16A 3GO5A 2L1BA 4L6TB 1EM7A 1GB4A 4IUPA 3IAS1 4N9PA 1PFBA 3R93A 4C7YA 1DOKA 4KN4C 3X3MA 2YU9B 1RKNA 1W6JA 3I9V1 4M1UB 5KNCA 3A8KE 3F2UA 5BMHA 1XLPA 4RF1A 4S3SA 3R2IA 1T5XD 3GV6A 4KY7A 4KGRA 1ONLA 2Z4HA 1N63A 3G6JB 4RGMA 2KA7A 2NUCA 1PRTC 2E2DC 3QG1A 1I7HA 3H0GB 4KJNA 5JEAJ 1RM6C 3AN1A 5EE3A 1I6HB 3D31A 4P2CB 2ONQA 1J8IA 4BBRB 5ELDA 2E2JB 3IT4B 1JCKB 3RPFC 1C8CA 1BBXC 5HI1A 2E6XA 2VZKB 3PIO3 1SB3C 5CV8A 3ETRA 2F0GA 4GDKB 2SAKA 2G9DA 5LL6S 2R6GA 5CYUA 2FMCA 1TKYA 2NZ1D 3U4EG 3K5MA 3Q8BA 5IIFA 2PQEA 3RUZA 3ONAB 1R4PB 1EU4A 2IW3A 1TS3A 3HKZB 3I90A 2FFKB 2LKVA 4MH8A 4XT1B 1PGBA 2SNSA 2ZXOA 2J52A 4ZKBB 1J7AA 2WXKA 3WCQA 1NR4A 1S5ED 5IGFA 2EZVA 2PZUA 2PVOD 1NI3A 2DLBA 3K7AB 4HJGE 2DY8A 3NQTA 4IZ8A 3Q24A 1YQ4B 2JSVX 2L11A 1H9MA 4C80A 4KD4A 3KBXA 3GD7A 3A55A 2RQXA 1JWBD 2WACA 3GS2A 1DYQA 2XN9C 5EBDA 2JA6B 1PFDA 2NWGA 1ICWA 3EA6A 5AUKA 4F7XA 5BMGA 1PRTB 2O5JC 3P4RB 3ZJVA 3Q8CA 1YNNC 3HP3A 5EKKA 3MC0B 4L1BA 1A70A 5CV7A 1SXTA 1X32A 2ZXPA 3WOEA 4C3HB 3HRDD 4IFDJ 5G5HA 1S5DD 1L0VB 2A68C 3VRBB 3HVDA 2HQEA 1WTQA 1DOIA 4FXDA 2R3ZA 3MZ5A 1LO5D 4X3KA 2ZT9C 2X38A 1PFNA 4HAEA 1QQRA 1TS4A 1STBA 5BYRA 1VCIA 1LTID 5FO9B 5F2DA 4N9TA 2PTLA 1B4OA 4N6EB 3DEPA 2V3PA 2CVRA 5D65A 2K28A 3FILB 3TZDA 1Z7TA 4IUNA 4IUTA 1BO0A 3SR1A 2JXMB 1MGSA 2PNRC 4Z9CB 1K83B 3BZDB 1PUTA 4NW2A 3I4MB 4AS1A 1U4RA 3AMZA 4TMAB 4JBWA 1O7ZA 1FIQA 3L4PA 3Q22A 3EUB2 4FF3A 3QIAA 2D5DA 4TKOB 1WCMB 1V1OA 5ELFA 2PPBC 1EQVA 2OXPA 2NTTA 3BDOA 4L23A 3ZQ4A 1VMCA 2MP1A 3T56B 4OW0A 1MBYA 3T4AC 1KRHA 2F0OA 1XF5L 4RCNA 1CTMA 4K8JA 2DNCA 1TT2A 1S5BD 1YQ3B 5C6AA 1XCQL 4JWSC 2KUMA 4NP5A 2YEPF 1OXSC 4HRSA 4K2LA 2MPMA 5DNFA 5C3JB 3SVMA 4C2MB 1EWCA 3KBGA 3VYSA 4KHZA 3I73A 4DN4M 3S14B 2WU2B 2F0JA 1JR0D 1VZ8A 5C0XG 1ILPA 2H1EA 1VZ6A 2V4IB 3S1QB 1JRPA 5C3WA 4PT5A 3TMEA 3IFDA 2KWDA 1EQTA 4PQXA 2HCIA 2F0IA 2D9UA 4CQNA 5CV4A 2OT2A 3HOVB 5DAUA 4XDCA 1N5XA 4A90A 2XRQD 3Q69A 1FNUA 5CC4A 2ICEC 4KKTA 1FFVA 3NP8A 1STHA 1PTOC 2NN6H 4USAA 3TP6A 4B0EA 1KDAA 3HS0C 3BDCA 1FXAA 2KOLA 4BY7B 3GQBA 5T8IA 1KTKA 2YYZA 1J7BA 1PXUA 4HCEA 2E76C 1MHHE 4RHSA 1AP0A 1HPCA 4KY5A 1HQRD 4IDIA 4B9WA 2WXJA 4C7ZA 3NBHA 2PLPA 1TYGB 3E6ZX 1MI0A 2RDGA 4DK0A 1C48A 1MHXA 5I9PA 4K8IA 2A6EC 2IGGA 4KGTA 2LUMA 3KQ4A 1EZ8A 1JC7A 1AZQA 1SAPA 4YSZB 1JQ4A 2FBWB 1V43A 2JWUA 1PFMA 1SFOB 2K3UA 2VZKD 1CHPD 2JEBI 1K52A 1EY9A 3BVGA 2EY1A 2EVBA 1NAPA 1OFFA 1TKEA 2N88A 2NB0A 1OQRA 3D3RA 1I50B 3OOCA 4OO1G 3Q23A 1N60A 4KY6A 2JYEA 2NVXB 1HZ6A 1WGKA 4WFN3 4A3EB 3ZYYX 4A55A 1OXUA 1IGCA 3TP8A 3RFZB 5A2QL 1Q8IA 1ZOYB 2IPKD 1G91A 2BDNA 5EPJA 1BXTA 3U52E 2N0SB 3VR4A 2RA4A 1O7LA 3CWIA 1IGDA 4DK1A 3RMHA 2C5CA 1WYGA 4I7ZC 3R8BA 1E0ZA 1HXYD 1PLFA 5I2XA 3NTIA 4M8AA 2JE6I 3FRPB 4ZUIA 1H9JA 1HCZA 4N59A 2LFNA 1VR9A 3FKIB 5E4WC 5EPKA 5G3LD 2BW2A 1KFYB 3GTKB 1B3AA 2B2WA 3PO3B 4ARIA 4FXKC 3SK4A 3M7NA 1OXXK 2BS3B 1ENCA 3HOZB 2B8FA 1QOAA 2RMMA 2XWBB 3I57A 3I4NB 2FUG1 1CQFA 1IHZA 4BBSB 4FF2A 1E0BA 1Y1WB 5E4XA 1LT3D 1C78A 4RAUC 5KRUA 3EFXD 4MM3B 2JZPA 2AWNA 1S5CD 2IL8A 4A93B 3H09A 3HOYB 1FCCC 4RH6A 1J9OA 4Q5VA 3K5LA 1VDZA 3ND8A 1X3PA 2RDHA 2LHDA 4XXEA 2IWHA 2VB3X 4EQPA 3H3VC 4ABNA 2Q5WD 1FNVA 1TWGB 3L3OC 3AE7B 4XQNA 1SBBB 3LYYA 2GRIA 5M5XB 1B1ZA 2QDBA 1JROA 1A2UA 2MEKA 3ZJTA 5ELCA 1Y8PB 4FO2A 1WD0A 1DGJA 3W5UB 4ODGA 4KI0A 3SHLA 3D6CA 2WQYB 1IUEA 2Q8RE 1GXDC 4V190 1Y69U 2EKIA 3A7LA 3FAHA 1BUIC 3TN2A 5EKLA 2EDGA 4DA2A 5JJZA 1E7PB 1N5WA 3K57A 3S1RB