4RCYA

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gtp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVAHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rcyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rcyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rcyA01
1RVDA 5DI3B 4NDZA 1O3YA 3FHTA 4EQ6B 1RFLA 3GLFB 1OT3A 3EIHA 3OAAD 3C14C 1HE8B 2O0KA 5HXBA 1YRBA 4NZYA 3TH5A 3UANA 4A8JA 4PPNA 3KQLA 3OZVA 1KO7A 4UNQA 4IRUB 1FP7A 2Q9AA 2P3SA 1JQLB 2ZQ5A 4G3XA 3GFTA 5DO9A 4EH1A 2F1RA 3CPWB 4TZ6A 1U81A 1QGAA 5FBRB 4KSCA 2NZ8A 2IK8A 3MAAC 1A4RA 4XD7A 4AI6A 2A5FA 2C03A 1EWYA 1OGJA 1N6OA 1SHZA 3QNUA 4AK9A 4CDGA 2NO9A 1G18A 4B6FA 3THXB 4RD2A 3IKJA 2QROA 1E1RA 3I4LA 4NYJQ 4OK6A 2GVZC 3W90A 1N2CE 1KI6B 4GMXA 4N0DA 1E79A 2QDXA 1L4YA 3DOEA 2BJVA 1CQXA 3B60A 1XEXB 4MYHA 1P7CA 2QM7A 4G5OA 2XTMA 2JLUA 1A82A 2QTLA 5EP1A 1KO4A 3VR4A 1E2FA 1QH0A 2MMGA 2VPPA 4XH9B 2J9RA 4LV8B 3K9NA 3THWA 1Q57A 4M1OA 1KNQA 1FNBA 2CNWD 4MA4A 1M74A 2IEYA 1XJCA 2NO1A 2QQ0A 4UXIA 4EPRA 1EGAA 3CCQB 3QKSA 4LPSA 4Q01A 3OIUA 1GAQA 2G1KA 1S1CA 1DAEA 2F3RA 2VL7A 2KE5A 2IYYA 2ZUDA 4CEIA 4HAWA 3P4YA 4G5SA 1R8SA 1YZTA 4B3GA 1S3GA 4IOLA 5A4JA 1N5LA 5L8VA 2LCFA 3WYGA 2UVQA 3B6EA 1ZNWA 3SQXA 4TYQA 1FTSA 2OO7A 3L82B 3GLIA 2KWIA 1S9DA 4BEBA 3AVXA 2XEXA 1WA5A 1TQ4A 2GXUA 2OHFA 2X1VA 4Q1CA 3ZD7A 2XZLA 2CCGA 2W6IA 2D3WA 5CLQA 4NE2A 3HDTA 3WNBA 3CZPA 2E1RA 1VG9B 5FPKA 1T6NA 4TMTA 3JZAA 3LLMA 1NN3A 5CJ2A 2DWPA 2FZLA 1JI0A 2WICA 1W87A 4EFNA 4HDOB 2CDNA 1XEWX 1Q22A 4KAXA 4BZPA 3LA6A 5FTMA 3U7GA 2W2VA 3TVTA 1KYIA 5IHPA 1X8LA 1UEIA 4LV5B 3R7WB 1M6NA 3JZMA 2B21A 3CBQA 3ASYA 3W2IA 2IYLD 2RHMA 4PC1A 2HJGA 3PUXA 2X3UA 2X2FA 2ZJZA 1ZAKA 2QENA 1U90A 1MO6A 3RABA 3CNOA 2JDID 3K1JA 2YJTD 1R5BA 3VMFA 1EG7A 3RAPR 2CHVA 5THXA 3LW8A 4BUJA 4DVGA 4IOMA 1YU9A 4D0LB 2FSHA 4R9UC 4RD0A 1AS2A 5EE0A 1QHHB 2ZSEA 3IHLA 5IK2A 2FEOA 5SZKB 2DY1A 1E2PA 1W2BB 4NMMA 3K09A 3SZRA 4TL7A 3TRFA 4JBYA 2FN4A 2OG2A 3K53A 2VZLA 2RGNC 3BWDD 1OH6A 1NG1A 3R9IA 1LTQA 2ZS7A 3FKQA 2AHOA 4G1BA 1IN6A 2PMKA 3FVQA 1II8A 2A7QA 3NWJA 1Y3AA 1TL7C 1G8FA 1SVKA 3VHXA 1XBTA 1GL9B 4MYTA 2GWHA 5C1BA 1TQ2A 4URXR 2WTUA 3PJRA 2FSFA 3CRW1 1DVRA 1N0VC 3ADCA 4GZLA 3C5HA 3AQ4A 2YWHA 3S1AA 1Z0IA 1IM2A 4PZLA 1QDEA 2WSSD 1ONBA 3TBKA 3EPLA 2VNKA 1NKSA 5FOTA 1IY0A 3CX7A 2DHRA 1S72B 2FJUA 2GILA 2WJGA 1OB5A 4QBFA 4I4LA 4BLOA 4CZ2A 4DCTA 4BFSA 3RSLA 1IXSB 1KI2A 4BRWA 4RCZA 2ZUBA 5JZVA 3BRWD 4JBWA 4LYJA 5JCZA 1GL6A 1KK3A 3E1YE 2B8WA 3W34A 1CBUA 1PLLA 4KFUA 2R6GA 2J46A 3TE6A 1XZPA 2AWNA 4QBIA 2CHGA 1M8PA 4QJ4A 2F9LA 2ZSBA 3KL4A 1NL3A 2Z0MA 4AKIA 1K6MA 1QF9A 4IDHA 3U44A 1TVCA 3TUZC 1CULC 2HJVA 1Z6AA 4ZO4A 4HAZA 1F3OA 4Q02A 3TKLA 1KIMA 4MGKR 1FPMA 4G1VA 1N6NA 5JCPA 3T61A 1VCIA 4Z51A 1GVHA 4ZCIA 1G20E 2NPFA 1LFDB 4HB0A 2F6RA 2J59A 3DKVA 4JMPA 1W4CA 4HZUB 1U98A 2ZRFA 3Q5DA 3THYB 1E2GA 5C4MA 4DIEA 1BKDR 2RC5A 5B64A 1H8HA 3T1VA 2CEAA 4CYMA 4Q18A 121PA 1GRQA 1KJYA 3K8YA 4KFTA 1Q12A 4KLZA 2E87A 5EMNA 2CK3D 1W0KD 2G1JA 3PQCA 1AIPA 1MO4A 2BMFA 4PAQA 4UJ5A 2OBNA 4AF6A 1VMAA 1DAIA 3A36A 3CF2A 3D7MA 3NHBA 1KMHA 4GT1A 4LJYA 4PPQA 3BOSA 1KGDA 2XB2A 1ZCBA 3TR5A 2AFHE 1ZUNB 1G7RA 2ECKA 1PVOA 3A6PC 5FUWA 3LO8A 5EP3A 5KNCA 1Z29A 3CCUB 1OIXA 1YI2B 2AK3A 4A9AA 3IIMA 1YJWB 2NTYC 2B7CA 2BBTA 2YOHA 2YWEA 1CR4A 3I92A 1WXQA 4TYPA 1Q7YD 4G1UC 1E63A 4JKIA 2Z83A 4TMWA 2V9PA 1XXHB 3W8RA 5GJVC 1FL9A 5FBVB 2UKDA 2G3YA 3ZIAA 1IN7A 1VYUA 4Q7LA 3EC1A 2Q6TA 1GTVA 2CL6X 5JHHB 4OHYA 5B57C 3DZDA 2FEMA 1E2KA 2HXSA 4X8LA 1GG2A 4TL8A 3BC1A 4HAVA 4D4JA 1G4UR 1P9NA 2KSQA 2OLKA 1R8QA 2CHQA 2MSDB 4BFZA 4HI0E 5JJIA 2JA1A 1ZRHA 1TNDA 1KAGA 2GCOA 2P5SA 1ZM4A 3KFVA 5SZIA 1K5DA 3TSOA 3OZWA 4QG7A 4DSNA 1AKEA 2HUPA 2QBYB 2D2EA 2BKEA 1VCNA 5EXSA 5KOYA 3AKCA 4H1UA 4WZ6A 2CJWA 2NPIA 1U99A 2JEOA 1OSNA 4UJ3A 2DBYA 4JLPA 3SBDA 2CXXA 4JBXA 3ND9A 3GP8A 3CCEB 1E2LA 1FW6A 1R5NA 5FUYA 4KFRA 3LW7A 1YIJB 1G4AE 2QSZA 3SQWA 1ZINA 1Y63A 3OEHA 4EPTA 1E2QA 4CEJB 2FX3A 2AWOA 1LF5A 1ELOA 5CITA 2YC2C 2C9YA 1YJ9B 2QMHA 1WQ1R 3LBIA 1N6PA 3ZZTA 4HDQB 3BK7A 3AUYA 3ONWA 3W5VA 4R2IA 1SVOA 3BERA 3EWAA 3GLGB 3VU9A 2ZRMA 2ZVPX 4UNNA 3L0SA 1RE0A 1YZGA 4ZI3A 5H1YA 3W2FA 3O8RA 4IOKA 2QL6A 1SXJD 2A2ZA 4YDHB 4WXPA 2XTNA 2FFQA 1SVMA 2VO1A 3KDSE 1XE1A 3C4JA 2GVDC 2CLCX 4YXWD 4FMCF 1ZU5A 4D4KA 3AKEA 2I4IA 2D7DA 3A4NA 2JLWA 4YAOA 5FBQB 4ON9A 1QHGA 5B30A 3M1IA 1T3LA 1S1MA 3UMSA 2EWWA 2DETA 2X2EA 4GZMA 4C0HA 1OE0A 1WBDA 1P9RA 1KSFX 3K70D 4LRWA 3FHOA 2CCKA 3P1JA 5KU1A 5D3MA 3NH9A 2GJSA 2D4HA 1O87A 5BW8A 4R7ZA 1XTRA 1IB0A 2AD1A 1SXJB 3U3JA 5B2ZA 3V9PA 2QPOA 2RHDA 1JA1A 1G3UA 1P60A 4Q1DA 5KO2A 2ZJYA 5HZHA 3ZS8A 4YAUA 3AB3A 4TLBA 2JGNA 2ZRKA 5KNBA 1OXSC 1D9ZA 2A5JA 3CPEA 2XJ9A 1KDPA 1IQPA 1W0JD 3B7GA 3CRVA 4GI7A 1G8GA 4LUCA 4LYFA 3RS3A 3VHLB 1GWNA 3VR2A 1J90A 2RGDA 5FR2A 4ZDIA 5L3SA 3X1WA 1G7CA 3ZZ0A 1Z0AA 4PANA 1XZQA 3K70C 3VQTA 2PJZA 4PPGA 2BDTA 4LHYA 4BGDA 1WB9A 3LVQE 2WAYA 3K70B 3EPHA 2CVHA 4TWZA 2CBZA 4DLZA 4P4SA 2NO6A 1DEKA 4PQFA 4IDQA 2ZRHA 1Z2AA 2KBEA 1EFRD 2H8KA 4JYBA 2PZGA 2ZI7A 1CKEA 821PA 3A8TA 4JJKA 5EXPA 3WYAA 2ZS8A 1TUIA 3FPAA 4AD8A 5TMPA 1YHNA 4BEJA 2AXNA 4JLVA 4S2EA 3NHAA 4ABYA 4U5XA 3HU1A 4Z1MA 1E9FA 3I1FA 1E2IA 1G64A 3DL0A 2W83A 5CLLA 1G3QA 3CC4B 4JZKA 2GHIA 2A30A 3FB4A 1N6HA 2X8AA 5CB6A 1K73D 2DFLA 4AYTA 1Q1EA 2IXEA 4F4CA 3ZDQA 1VCMA 1GP2A 1KK0A 2ZYUX 3GLHB 4JLAA 1TU3A 4HE5A 4DHEA 4EJSB 4E07A 2JJ2A 4DUGD 3JQRA 1FX0B 4TMVA 4FI3C 1JEDA 5LB4A 1E2NA 3ZC3A 2IF0A 3KXKA 3BGWA 4HLDA 1MOZA 5FL3A 3WXMA 1YR7A 1CTQA 1XCPA 1MO5A 3TGPA 1NMYA 1OH8A 1DAKA 3RNLA 1I2MA 3UIEA 2JLRA 4MGIR 2VHUA 4NHOA 3W5HA 2OCYC 1DAGA 1NN0A 1QRAA 1TF7A 5EZ5A 1P2SA 4ILEA 2VNIA 2C95A 2J0SA 2OBLA 3U3RA 1S4QA 4LBYA 4HB3A 4RD1A 3DMDA 3KTAA 3EG5A 2GJAA 4Q9JA 3R9WA 3QFSA 4LBZA 4OI2A 3BXZA 2ZRGA 4Y0VA 4Q9IA 4OHVA 4OHZA 4O0MA 1E2EA 2BMEA 4P0TA 1C9KA 4JJZA 4FMDB 2XOKD 3SHFA 1PUIA 1WMSA 2QSYA 3QKUA 3CD6B 3UK6A 2P6UA 4F93B 4LJ4A 4Z8XA 3H2YA 4GP7A 3IQXA 4FK8A 5KDOA 1KI1A 4ZV4A 5FTJA 4HE6A 2FU5C 3CC2B 2RCNA 2I1VB 2V7QA 2Z4RA 5FL7D 3PR1A 4DLWA 5F9FA 2C9CA 4A0FA 1AS0A 4KVGA 1B23P 1EP2B 4I81A 4O2RA 1IOZA 1TQ6A 4EQ6A 5HE9A 1SVLA 2BOVA 2GF0A 2IEZA 4RFSB 5KPJA 4MITA 3QXHA 4PZYA 4B34A 3OHMA 5EXXA 3I8SA 4OQLA 3VNVA 4Q9KA 2FE4A 1KSGA 3CRMA 1XFAA 1P73A 1OXVA 5J4KA 3L0IB 1FRQA 2OK7A 4MRPA 4DCVA 5KDLA 1FUKA 1ZP6A 1P61B 1VQ8B 1W46A 1DAFA 3BIFA 4AURA 3NDPA 4B2IA 3U4QA 1H85A 1GNQA 1VPLA 4B35A 3CKLA 4DJTA 5JSZB 2VQSA 4MYUA 3GJ5A 3M4YA 5TB5A 1COWD 3K0CC 4PO1A 4W5WA 4A6PA 3GLGE 1UEJA 3VAAA 4AC9A 4RD3A 1DO2A 3CC7B 3QQ5A 1ZCAA 1NP6A 3OZUA 5FTKA 5JRJA 3K9HA 2YHSA 2C96A 1AA9A 1KI6A 4E09A 5TARA 3OE7A 4KVAA 4XIGS 1XEXA 3LVBA 2Z5FA 5TV2A 4P4UA 5EE9A 1AM4D 1M7BA 4FCTA 3KJGA 3AVPA 1Z63A 2ZI9A 1VIYA 3M0EA 3QY0A 4I1VA 5CM9C 3T35A 2P2LA 1Z8FA 2RH5A 3KKMA 2QE7A 4YMSA 2ZRCA 4DCSA 5H5JA 3T5DA 1YVDA 3VR1A 4TMZA 1JNYA 3QKTA 1D2EA 3K0AA 4K46A 4OKSA 3HJNA 1R0ZA 3BORA 2GJ8A 4N3NA 4BE7B 3BB3A 1QG4A 3EPKA 4E5UA 1AJEA 2YWFA 8OHMA 5KTYA 4ESVA 1EFCA 3CNLA 1SXJE 2GA8A 4PSKA 5E4FA 5E7MA 2YYZA 3GEIA 3PEUA 4DLUA 3BD9A 2QAJA 5E3HA 1E4YA 1Q44A 1Z6XA 3TR0A 5F3WB 3AP3A 2QA4B 3AVQA 3ZLJA 1OH7A 3TMKA 2CNWA 1GRNA 4DWJA 3GJ7A 1UBCA 4Y0AA 2W58A 4M1KA 2FPMA 3SDZA 4A92A 4DB2A 1YHQB 1GO2A 2BM0A 1OJLA 1G6HA 1MR3F 1T3HA 1K5GA 1ZC3A 1E9SA 2ZR0A 3CPHA 4M4SA 3LWNA 1UADA 2Z4SA 4N3GA 4KLNA 2EU8A 3RS4A 4F4IA 3CWQA 4E22A 1E2MA 2FGJA 1Z5ZA 4Q9LA 3CLVA 3VO2A 4Q19A 2L0XA 4HLUA 1Q21A 1KI8A 2IF2A 4PTLA 4EDHA 3H84A 1J8YF 4HUTA 2ZSDA 3UXMA 4JT4A 4TL9A 2EYQA 4UNPA 4LHZA 5KPDA 2GXSA 4MKGA 3GFPA 3EZ6A 4HEJA 1RRCA 1CP2A 3B82A 1ZNYA 1OHHD 2YNMA 4GL2A 4D4LA 3I32A 1W5TA 4Y7CA 4Q03A 4YONB 1NLYA 3QXXA 3P27A 2PZEA 1YZQA 4NKRA 1W1WA 3KXIA 4EUNA 1KO8A 1B2RA 1LS1A 1NVXQ 2FV8A 1EWQA 2OESA 5FOVA 2VSXA 3C5CA 2QEQA 4RFVA 1VHTA 2WJJA 1VQLB 3T06B 2HLDA 2CE2X 4X8OA 1HQCA 3EZ2A 4PFSA 4MH0R 3EPJA 2IUSA 4MGZR 1HV8A 1I4LD 2EFDB 2OTJB 3WHLA 1KDRA 3GLHE 2XXAB 4MKFA 4PC7A 4PR0A 2J7KA 3EA0A 3ZQ6A 4TTPA 1JPNA 2QTFA 2VHJA 2VIIA 4YC7A 1IJEA 2OK8A 4M0LA 1ZUIA 2GZHA 1P2UA 3QKRB 2OSBA 3CR7A 5E7JA 4LI0A 5BXQC 3SNHA 3LAWA 5G3ZA 4PX9A 2J7PD 5HCIA 3AKYA 2OXRA 4Q4LA 5AR1A 3BAFA 4TT3D 3GJ6A 2O8EA 3LX5A 1RPZA 3WBKA 2BSAA 2G83A 2HEIA 3NKVA 3GJ0A 1XJQA 4IDNA 1XEFA 2V55B 2C8VA 2CL7X 5AUQA 5K8TA 2D06A 1G291 3LBHA 3FE2A 4FN5A 5KSWB 1GZSA 2CMKA 4H1VA 4Q4HB 1U2RA 1NLZA 2FZ4A 3KJEA 1ZM2A 1UKEA 3QXCA 4ZGNB 1OW3B 2P6RA 5AK0A 3V76A 3R20A 3BH0A 4XVRA 3EW9A 5AJZA 1F2UB 2WM9B 1XP8A 2G0TA 1G3MA 4R71A 1E9EA 1VKJA 2MSCB 1QHIA 2D7CA 1Z2CA 1V5WA 5FOXA 4DLSA 3QFCA 1UMKA 3GPLA 1N8RD 3H4MA 1M2OB 4XSHA 5DYGA 2GXAA 3TQFA 2ZTSA 3IEVA 2J0VA 4OQFA 2O8BB 2OFOA 2ERYA 4M9XA 1Q0UA 3OESA 4HZUA 2ZETA 2ZJ5A 1KI7A 3CH4B 4BFVA 3W9YA 1NJGA 2F43A 1DOAA 3VTKA 3R9XA 3QFRA 4A36A 3CX6A 2HMAA 2NMVA 1SVWA 1HT1E 1DDGA 1KJWA 2HF8A 5J4YA 1QGZA 4O3MA 2OLJA 4WW0A 2V1XA 1GM5A 1NRJB 2N1BA 4UXHA 3GFOA 1GAWA 1GOTA 1D2MA 3QJYA 4TN1A 2JATA 1FNNA 5DGXA 2G88A 1QX4A 5ANRB 1MKYA 5DNYB 4NH0A 1NSFA 5EXTA 1OKKA 2XNSA 3L0PA 4TMKA 1D6JA 4NCKA 3W5IA 1AMOA 2YVUA 4II7A 3MUFA 5FPTA 4DB4A 4ZIRB 5AJVB 2GEUA 2ODNA 1XPRA 2QI9C 5UKDA 3RANA 3H0KA 2ANCA 3THOA 3ZD6A 3BB4A 3VFDA 2QMUA 3HP1A 1HQYE 4PC6A 1Q1ZA 5BYKA 5A0FA 5TXGA 3LRPA 4PQYA 2PLFA 5KSOA 3KB1A 5EJEA 4B74A 3FFAA 5FBWB 4KCGA 3BB1A 4RJLA 4YAWA 4M53A 3X1YA 1E9DA 2PEZA 2W00A 4YDSA 5KHOC 1D5CA 4D4MA 1G21E 4L15A 1OV4A 1A1VA 1DTSA 2B7BA 2JLQA 4CGZA 2ORIA 3D31A 1Q1QA 4MQBA 1VQ6B 3T12A 4M9SA 3W3AA 1MRNA 3LXRA 1WDTA 3ZBUA 4WIAA 2QBYA 2JAQA 1XD2B 3AP1A 1EX7A 4DSTA 5FTLA 3TSWA 4A0HA 3TQCA 1BX0A 4KITB 2IBMA 4B2LA 2JIZA 4DCNA 2CRVA 4WQMA 5LD2C 4YAFA 3FMOB 4UQOA 4DC9A 3OW2B 4FCWA 5HR5A 1S2MA 1R0XA 2J3EA 3KJHA 2XX3A 2HCJB 1XX6A 1Z0JA 5LD2B 1E2HA 1US8B 1WCV1 2V8OA 2BN4A 1LNZA 1R4AA 2VYFA 1MH1A 1T91A 3F5FA 4CEJA 1KI4A 1P6XA 4V0NA 3PITA 2ZAMA 1PV4A 3KUCA 3RSOA 1X1RA 5KYKA 1HA3A 4B48A 2H1LA 1E3MA 3RLFA 4M1TA 4ARZA 2O8DB 3GLGA 2QTHA 2FNAA 4X8HA 1E2JA 1N5KA 2OFWA 1WRBA 4PPFA 3RRMA 2DEUA 3N5CA 1GILA 4Q66C 1GSIA 2Z6VA 4OHXA 1G7SA 3B85A 4AIIA 1T4GA 3MJHA 5HE8A 1DDIA 2QP4A 4F38A 1Z08A 4D81A 3KQNA 1IN4A 1YZNA 4KYUA 2ZE5A 2ZI4A 3GCGA 5JRZA 3OFND 4D26A 4QGAA 2FFBA 5EZ6B 1XTKA 4A1FA 4A8JC 2D74A 2ZRIA 3W6PA 1IXRC 1NVVR 2W0SA 3RRNA 1W35A 4A8JB 1JECA 3Q72A 1TU4A 1ZU4A 1R0WA 1MABB 1P4SA 1CU1A 3CUEF 5TY0A 1VQ7B 2WWHA 1YR8A 2WJYA 4US1R 621PA 2VP6A 1OFTA 2BBWA 3U6BA 1KK1A 3V4FA 2GTPA 3E70C 2PH1A 4XOIA 4C0QC 1EP3B 1SXJA 4LCBA 1BIFA 2GZDA 1WP9A 5KUTA 1II9A 1LW7A 1CIPA 3SFVA 4F91B 1QG0A 3HR8A 2C2HA 4U9UA 1W49A 1ZC4A 3NC1C 2N42A 2ZI6A 4C9BA 3VR6A 3GLFE 2OE2A 4YXWA 3KFXA 3ZVMA 2JJ8A 1N6KA 4KODA 4QNMA 1B0UA 1JJVA 3QG5A 3O8CA 1E0AA 1AGRA 3CB4A 2AKYA 2HYDA 3KKQA 1EX6A 3MJRA 4TYYA 3OF5A 2QPAA 3TW8B 1G5TA 4LC1A 1VG8A 3X1DA 2R6HA 3CM0A 3NTUA 1SQ5A 2ZROA 2E9SA 5EQTA 2W6ID 4OQMA 4FMBB 1J99A 2HXYA 1FZQA 3KKNA 1UPTA 4M9ZA 4P31A 2BCJQ 3VKHA 4HZIA 5J47A 3CW2A 3UWOA 5JMTA 3UPUA 4ASUD 1BYUA 2ZRNA 3DEFA 3DPUA 4QGHA 3KQHA 4PGOA 2DFTA 4PQRA 3SU8A 2QTVB 2DFKB 3NG1A 2YC4C 3GJ4A 3K9LA 4DEXA 1OLOA 3UKDA 4DSUA 4FMDF 3SC3A 3ZVLA 4JL8A 1P3JA 2AK2A 5KSZA 1GVNB 3ETLA 3WNDA 4B4DA 4POAA 1MRSA 2IT1A 1BS1A 2R6CA 1EFTA 2WSMA 3I61A 1Z0KA 1W2HA 4Q1BA 4MDFA 4PHGA 3AVTA 2BCGY 2FDCA 1JBKA 1UDXA 1Z47A 1RW4A 2WIAA 4JIMA 2DPXA 5G40A 4DLVA 3K0FB 2F1HA 2ZRAA 4JVNA 3GLHA 3QXJA 1DADA 3E2IA 4GOJA 4HSEA 4K81B 1A2KC 3MWYW 3IGFA 1VCOA 4EJSA 4U7DA 2YINC 4L16A 2XITA 1E0JA 3UG6A 2WKPA 1YITB 1FX0A 1HT2E 3O47A 4TLAA 4DCUA 3A37A 4BFWA 1K8RA 1S96A 2J0QA 2SHKA 2G9NA 3TW4A 1EESA 3IO3A 2IYUA 4KBFA 1IN8A 1KO1A 1Z83A 2REBA 3NC0C 1JXOA 5JS7A 2ATVA 1UBFA 5F98A 4G5QA 2AXPA 4D6PA 2BF4A 3CRRA 1J2JA 3T15A 5ELXA 1HUQA 3ZS9A 3IEUA 4P32A 4URVR 1JEEA 5P21A 3K09C 2IXFA 2QAGA 1DPFA 3IILA 3R8CA 1OIVA 4XWAA 4DDUA 2J0UA 1BH2A 3REGA 4CEHA 1XRJA 1Q3TA 2XNDA 4KO8A 1VQ9B 2OILA 5BQ5A 5CB8A 1QVFB 2R65A 4Q5IA 4HDCA 5DHFA 3NVAA 1XMJA 4FW9A 4DIDA 3AH8A 2C5LA 1OH5A 2YZ2A 4BFUA 3OIYA 5TVKA 4NPHA 4DEYA 1NBMD 4XVUA 3D3QA 1QUEA 4W5JA 2WOOA 4LK2A 2ZJBA 3S1AB 2ZSFA 4M1MA 2AKAB 3ICQB 4AY2A 1QHNA 2BBOA 3W2EA 3LXXA 4ZDJA 1YZUA 3NDBB 1QHYA 5SZJA 3FTQA 4MDEA 4NYIQ 1BMFD 5H59A 2WWWA 1JQJC 2JASA 4NYIR 3HYTA 4F4JA 3B1WA 2P0EA 4XJXA 4RCYA 3SS8A 2XOKA 2PCLA 4Q00A 3FOZA 1GDDA 1CEEA 2XGJA 1F2TA 2ONKA 3LFUA 5FOSA 2BM1A 2FFAA 2VA8A 1XJ0A 4D82A 2HT1A 4TQ9A 1H8HD 2F1JA 3PEVA 1SZPA 1VG1A 4GFDA 5M04A 4Y9RA 4XWKA 5JSZA 4GNKA 1H8ED 2YOFA 4JVSB 4V0OA 1E99A 1KZGB 4HAYA 4GPTA 2EFCB 2ZE8A 4RD4A 1KHTA 3EX7C 4LHVA 5CIWA 4MRNA 2PT7A 2OAQ1 4RKEA 5G41A 2XNJA 3X2SA 3U3KA 2BC9A 2QZ4A 1WBBA 4NBSA 1VQOB 3WRYC 5HTKA 2OBMA 1QFJA 3CMEB 4DQKA 4KI0A 3G0HA 4RVCA 4ACAA 2GRJA 2ODEA 4DZZA 4OK3A 2BGIA 2PL3A 3FMFA 4IXMA 5LPNA 3L2OB 4TLDA 2VSFA 2QEXB 3RS2A 2ZRBA 5L3QB 3W6NA 3GEEA 5H68A 3HPRA 2AD5A 1F6BA 3CZQA 2UZIR 3C7KA 3P20A 1E98A 1N0WA 4GBMA 4JT2A 1N6LA 1OXTA 2NQ2C 1I4TD 3ZIAD 1IONA 1SVSA 4DRZA 5G3YA 5FI0B 2HF9A 1FRNA 2QQEA 5DN6D 5EP4A 2N46A 2V4ZA 3BFKA 4KYIB 3PUWA 3HU2A 3W5UA 5G53C 5J4LA 2W6JA 1AK2A 4I1OA 4B47A 5F2EA 2D2FA 3I5YA 1E0KA 2IXGA 3SBEA 2V6IA 4DT1A 4R2HA 4LWZA 3WRXC 4OL0A 2C99A 4BLQA 4QJ5A 4FCVA 3OJXA 1KMQA 1M90D 4IVPA 4LOAA 5GADl 2WAXA 2WJVA 2R8RA 3U61B 4URUR 5BN3A 1UF9A 2CNDA 4CT5A 3T1OA 4V02A 2IW3A 4G0NA 4JLNA 4PAOA 2WWXA 2VYQA 4OI1A 3U5ZB 3SYKA 2H92A 5DISB 3AF3A 1NLFA 3RWOA 1YRAA 3CCJB 4QXAA 1KDTA 2GCNA 2ASEA 2RMKA 2ZU6A 4NL4H 2HT6A 1BJKA 2HV8A 3BJIC 4QC2A 4A2WA 1T0JB 2ZXUA 1ZNZA 2JJ1D 4LSGA 4Z8YA 2HYIC 3QF4A 2GCOB 1XXHE 4LJ9A 2BKUA 4XTCS 2IHYA 2GAOA 3FKSA 3TAUA 4YQFA 4OQXA 5C4GB 4A6XA 2BIFA 1ZIOA 1G8PA 1L7VC 2WIBA 1DO0A 2QU8A 1KRHA 4LJ6A 5BN5A 3HR7A 4RZXA 3SHWA 2JLVA 1UKYA 3MD0A 3OEEA 2BBSA 5AWFC 4AKGA 3G6EB 1HTWA 1NY5A 1T3SA 5JS8A 4ZDWA 2YWGA 3MCAA 3CCVB 3SI7A 4YLGA 1IHUA 2PCJA 3QBVA 2QAGC 1RKBA 5HKKD 4DBLC 1W36C 1OHHA 3B9PA 4LV6A 3Q7PA 1T0HB 1FOEB 5DI3A 1DG1G 3QVUA 1CR2A 3GLFA 5GV7A 2PT5A 3I62A 1R5OA 2ZS9A 5TR9A 2B8TA 4YHBA 4GSYA 1Q3HA 4JL6A 5CM8B 2J1LA 4L4UA 1IJFA 1OB2A 1CF4A 2IYSA 2WV9A 4BASA 1LF0A 4DXAA 3O8BA 3KJIA 2VP2A 3EZ9A 1VQMB 4GDFA 3KQUA 2WKQA 4GMDA 4C0BA 5CK4A 3QPVA 1SGWA 2FA9A 4Q4HA 1JPJA 3QFTA 4HUQB 4DDTA 5AN9A 3DHWC 5CDFE 3NIBA 3U7EB 1ETUA 3THXA 5FI1B 3A58B 3ADDA 2OTLB 2EYUA 3ZVNA 5JBQA 3C8UA 4C3ZA 1EK0A 4DDVA 4OBEA 2WPDD 3LLUA 4JVMA 2VTKA 4OJKA 5GJCA 4BPBA 1ANKA 2DWQA 2VHCA 4NYMQ 2NOAA 3QE0A 4PAMA 3ZGXA 1XB2A 3WMEA 1W48A 3OAAA 4NYMR 2QMEA 3A4LA 1OYWA 3ICEA 2RKOA 1N5IA 3SE0A 3GJXC 4Y9UA 4B3DA 2JLSA 4BLTA 1RYHA 4AKHA 1PLJA 2R6AA 4TT3A 1NY6A 2GCPA 3SFZA 2O8BA 1E9RA 1U94A 4Q4JB 3KB2A 4LZZA 2VHTA 5JJLA 2R6DA 3FGNA 1NNEA 3LO5A 2AL7A 1UM8A 1CJUC 2A3RA 3UMFA 2VP4A 2OXCA 3UWKA 4IJMA 1KJZA 1G3RA 4NCIA 2CL0X 1DS6A 4NU0A 1II0A 1CR1A 3N2EA 1WE2A 2ZE6A 1VECA 2VH5R 5L3SB 4BLPA 2HCBA 3HWSA 2ZREA 2YKGA 1RIFA 3AP2A 5GVRA 5KSYA 4KV9A 3WYFA 1KKMA 2Q9BA 1FFHA 1XTJA 1NBME 4P4SB 3QG1A 2QT0A 3TNFA 4GRAA 1E1QD 2Q0HA 1OXUA 4GOKA 3QSYA 1FNDA 1HEIA 3NBZC 5IT5A 2LKDA 1KY2A 3NBFA 4R98A 2IHBA 4ZIRA 5JECA 1HH4A 2GJKA 3G4SB 2BJWA 4D0GA 3W2GA 3R8FA 4URWR 1G3IA 2GXQA 3I8XA 5EUQB 1XF9A 2CLDX 2GPJA 4Q47A 4YALA 4IFEA 5IDVA 3AVYA 2ODBA 2UZ3A 3DM5A 3L43A 1HE1C 1FMJA 3CF6R 1W44A 3R7WA 5L3RA 3E5HA 4XSGA 2FH5B 1EFUA 5FH9A 5GJBA 4LX0A 5CYOA 1VQKB 3Q5EA 4RZUA 3MHPA 4BECA 1U0JA 2ZYWX 3B78A 3EAQA 3KQKA 3DVLA 4C0LA 4JLBA 3LDAA 1A8PA 3EIQA 4KSBA 3V4RA 1A7JA 4UKDA 2KB0A 2O8FB 2G0NA 4N0EA 1JB9A 1XEWY 1F48A 2IYXA 4WBSA 4DDWA 1QHHA 2BMDA 1G9XA 5CYPA 4Q4AB 3P26A 4TTRA 3KKPA 3PFIA 5AUPB 1H65A 3EIEA 4P33A 2PX3A 2CCJA 2VF8A 1XD2A 2XSZD 2IA5A 2GQFA 3I55B 1X3SA 2QNRA 2IC5A 1FNMA 3PV0A 1MV5A 4QBHA 2BMWA 1YR9A 4HLQB 4JSTA 2RGNA 1DAHA 2WWFA 2I3BA 4B43A 3FJOA 1C4OA 3K9GA 4Q7JB 2G77B 2V7QD 4LHXA 4Q9HA 2FMXA 3FDIA 4Q1EA 2JDIA 2PBRA 4S35A 5J4HA 2XAUA 1KSJA 1RRPA 1QVGB 1Z0FA 3NBYC 3MWLA 1US8A 3K0EA 2P6NA 1CJTC 4PSVA 5JWRA 4FINA 2GEVA 3AVUA 4RY2A 3VR3A 1LVGA 3KTAB 1G19A 4AWXA 1FDRA 1XMIA 1KI9A 1FTNA 3E20A 2O8DA 2ZEJA 2J87A 3LVRE 2EWVA 1ZM9A 4LJAA 1JR3D 3MSXA 5EUMA 3NEJA 1CRPA 3WNCA 1KY3A 2ATXA 3B13B 3KXLA 1DBSA 1KSHA 2WZQA 5KDDA 2O8CB 1BOFA 4C43A 3RS7A 2YOGA 4I99A 5JWHA 1X8JA 5FFMA 5JJKA 4LJ8A 1Q20A 1OXXK 1XMSA 1NIJA 3Q8XB 4Q1FA 4EAQA 5BN4A 1PLKA 2Y8EA 2IYWA 5EP2A 2ZR7A 3PIRA 2GK6A 3TLXA 4ERNA 1N25A 1OPXA 1ZW6A 1RRGA 3RVBA 3VKGA 5FBLB 5E95A 2WSSA 4C0AC 3Q7QA 3OE7D 3OZXA 2EFGA 1MABA 2JCSA 2Q3HA 1JR6A 3G71B 1P62B 1E9BA 4H9GA 5B58C 2IS6A 3WP0A 4X8MA 4KBGA 1UFQA 3IO5A 3QOFA 1KO5A 4TTQA 3UMRA 1W2GA 3CIOA 1YJ5A 3RYTC 4E03A 1ESMA 2QE7D 1EP1B 3U4QB 3JQPA 4K8OA 1EWRA 1W47A 2ANBA 3MGCA 3RC8A 4M21A 3SYLA 3SEAA 3THYA 1W4BA 3AUXA 2RGGA 1ESNA 3O8DA 4FIDA 4IXNA 2FSGA 4QRHA 3EZFA 4TSFD 4WZAE 5FTNA 2F1IA 4A82A 3C15C 3OFNA 4RD6A 2GKSA 2XB4A 5CK5A 1XD9A 4BRUA 1DG3A 3A1WA 4NYJR 1RJ9B 3AGQA 3CWZA 2ZJAA 1X86B 2OCPA 4C0SA 4B3BA 4NTZA 1Z6YA 2P67A 1UJ2A 1K8AD 2ZVQX 2DWOA 2OT3B 1GR1A 1KNXA 1S8FA 3QF7A 4QGGA 3VR5A 4P4TA 2G6BA 4F92B 2CLSA 3VO1A 2HDNB 4DLRA 1IY2A 4F7WA 3H1TA 4P3YA 3GJ8A 3IUYA 3BE4A 3ND8A 1TMKA 4M1YA 2WJHA 3EXAA 3D8BA 3L8ZA 3TK1A 4QOSA 1GUAA 1NG9A 3LNCA 2QMOA 3JVVA 2ORWA 1ZNXA 3LV8A 5E7IA 4CT4B 3TAHA 2GNOA 1UKZA 3K0AB 2DB3A 2FG5A 4TYWA 3DMNA 2IYQA 3BBPA 3LD9A 1G1MA 1W4RA 3AVWA 1XXHA 2CK3A 4C7OB 3WY9A 3QPUA 1W0KA 4B3CA 4M1SA 1ODFA 4IEEA 3CXCB 2AX4A 1KAOA 3QIAA 5EE5B 2RC6A 1CR0A 1KI3A 3WMGA 1OFIA 1P75A 2F7SA 4LY6A 1GKIA 1U0HC 4L9WA 1SULA 1Z22A 1DAMA 2ZUCA 3A4MA 2IX3A 2IS4A 3K0FA 4AYWA 3TSZA 1XWIA 4MUAA 4TL6A 5AUOB 1CRQA 2NO0A 1QGYA 4ASUA 4BFXA 4W5HA 3BH7A 4LBWA 4QHTA 2ZRJA 5F9HA 2A9KA 2Q3MA 3ES9A 1GITA 2HLDD 1E9CA 4HLUC 5HZKA 2FPKA 1ZIPA 2EVWX 1C1YA 3X1XA 1YZLA 2O0HA 4L9SA 2OZEA 3PEWA 1CS4C 1FNCA 4OYHA 5K8UA 4JLMA 1OGIA 1TF5A 4QBGB 4LC0A 4NCHA 4MKHA 4B71A 4FXPA 3CO5A 2EFEB 3A1VA 4JS0A 2FPLA 1LS6A 3IHWA 3SJBA 2ZU0C 4ZGQB 2D62A 1ZMXA 4NONA 2C9OA 3F0TA 1XDBA 2PMDA 2QGNA 4B33A 1RRFA 5JEEA 2ZR9A 1CNFA 3CCSB 5CDFA 2FFHA 3CNNA 2BMJA 2O0JA 1IAQA 3BS4A 3IIKA 1QFZA 2O52A 4QFMA 3CONA 2PX0A 1Z6GA 3GEHA 2IS1A 1Q81D 4FD2A 5CIQA 2ZRPA 5DI9A 1E94E 4MRRA 5DYIA 1QZXA 4XD7D 1E2DA 1G17A 2NG1A 3RHFA 2FF7A 1ZD9A 4QM6A 3LBNA 2R9VA 5SZHB 4YMWA 5CJPA 1VQ5B 2RGEA 3HU3A 4AG6A 4BZQA 5K8LA 3FFBA 1E1RD 3QEJA 1U8YA 2DR3A 2QY9A 3V00A 1X1SA 2VP0A 4U00A 1N5JA 4EFLA 5DE3A 3SJAA 1OFUX 1NVVQ 3MRSA 1QBKC 1AN0A 2ZANA 1ZM3A 3MWKA 1W7AA 1NVUQ 3I5XA 1BO6A 2C04A 3P32A 1E79D 3KUDA 4HB4A 3DO6A 3ZQJA 2GBLA 3U3MA 2DYKA 5L3VA 2V1UA 2Z43A 4XTRA 1KKLA 4D80A 4NP6A 2O8EB 5DLQC 3Q9LA 1DELA 1VG0B 4ACBA 1ZUHA 5JWOA 4KJZA 3L0OA 4GOXA 1JALA 1IY1A 2IL1A 3N70A 1R6BX 1Q1BA 2B6HA 5GJWC 1PUJA 1NBMA 2REOA 1H42A 4KFSA 1WF3A 3GJ3A 4HATA 5FPSA 2OCBA 5AJWA 2V54A 4CRWB 4B2PA 2QPTA 1QFYA 4ITRC 1KDOA 3T5GA 5AUNB 4O2LA 4YMUA 3IPXA 1BMFA 1TQDA 3ADBA 1PJRA 2WWIA 4IDPA 3ZH9B 4BQSA 2NO7A 4DQLA 1XPOA 1OF1A 1ZVQA 3JVUA 1N6IA 4DKXA 1OKKD 1LY1A 5EE3A 5HCNA 4ZCMA 4JKYA 1Z6TA 4LYAA 4EPYA 2F43B 5C2JB 2O5VA 5DHAA 3THWB 4M2LA 2ZYVX 2ZE7A 5L3QA 1G5PA 2XJ4A 3GQBA 1KC8D 3QKSB 3QPWA 1H8EA 2GK7A 2X77A 3VX3A 1E32A 4OI0A 1T5LA 2J41A 4B6EA 4CEIB 1JR3E 4ZPXA 3RRYA 3QBTA 1EFHA 1W0JA 1W4AA 2VP5A 4BLRA 2IUUA 1DARA 2GETA 3FWYA 1AQUA 3F8TA 721PA 1JB1A 3GLIB 3AVOA 1KTVA 1JJ7A 3I56B 4IKEA 2F55A 4LJ7A 1BX1A 4KHZA 1YE8A 3U7FB 3EARA 3E1SA 3OIWA 1ZD8A 4MYCA 4DLXA 4DLYA 3TJZA 3SOPA 1EFRA 3N2IA 4TYNA 5IK2D 1UBGA 1UKVY 3Q85A 2ZYTX 4ESHA 4PO8A 3NH6A 2IYRA 4JVLA 2AR7A 3IBYA 2JLXA 4B3XA 4ZKEA 1FMLA 1NJFA 4OI4A 1OFHA 1NF3A 3NXSA 2LKCA 5DN6A 2CE7A 3QXSA 4JLOA 4PZZA 1I2DA 1AS3A 2BVNA 1TAGA 4K1XA 2MMCA 1NKTA 3DDCA 3AVVA 5FOWA 2JIZD 4US2R 4C0KA 1P9WA 1XNJA 3AKDA 3RC3A 4HLCA 4JLKA 4UAJA 3OJWA 1E0SA 1U8AA 1Z28A 5JI2E 1XMVA 1XPUA 5FPYA 1CJMA 2R62A 4Q1AA 4A15A 1QHXA 1JXMA 3UG7A 4P6VF 4M9QA 3BFXA 3H86A 1M7GA 2KBFA 4WVFA 3B5JA 1R7RA 2DFNA 2ZJ8A 4MKIA 4ZDKA 3T1TA 4XWOA 2OFXA 2H18A 4EKDA 1Z0DA 3AF1A 4B32A 1HYQA 4QHYA 2V6JA 2ZRDA 3PG5A 5LBIA 2BEKA 4IOJA 4DUGA 2RGBA 1VYTA 3M6AA 4LPKA 1TX4B 4AKEA 4BPRA 1G8YA 4V0LA 3KX2A 1II8B 4A4DA 2QT1A 4O25A 1S0UA 1ZM7A 5KNDA 3EZ7A 4F7DA 3D6TB 3QEOA 3CCLB 2IYVA 1I7PA 1F5NA 2W2XA 1T9HA 3MMPA 2BV3A 2JJ1A 4JLJA 3U7HB 3PEYA 4GP6A 4LHWA 2RGAA 5A5GA 2ZM5A 4IEIA 2IUTA 2OCAA 4D25A 3DOFA 1D9XA 2WVJA 4QM7A 2I1QA 2VHQA 2IWRA 4Z54A 1T5IA 3F3YA 4RFSA 2CVFA 2QM8A 4ARZB 3WHKA 1UDWA 2H5EA 4URYR 3LQQA 1CJVC 2ONJA 2QUZA 4BFTA 4TZ0A 2WKRA 2WMNB 2GESA 1BQEA 4W9MC 2BEJA 3B9QA 1YR6A 2QGZA 3FYHA 4WA7A 3VX4A 3X1ZA 1PZNA 5AJXA 1I4DD 4QGFA 1KOFA 2VP9A 3CR8A 3WBJA 4IW3B 2WOJA 3AF2A 4BLSA 1JAHA 2QG6A 3CH5A 1YJNB 4QKQA 3SJCA 1FUUA 4HAUA 4KU4A 4HUQA 3SYNA 3GD7A 2R6FA 1U9IA 3CPJB 4OQNA 3EASA 5FL7A 4A2QA 3CF0A 3C16C 1FP6A 3TVDA 3FHCB 5HKKA 4TLEA 4FWIB 1GJRA 2V3CC 2BGJA 3K0CA 4PXAA 2GBLC 4TQAA 4V03A 5FUXA 4AF7A 3U44B 4MRSA 5JEDA 2PIAA 4LGMA 3NEYA 1RC8A 3AV0B 521PA 4G01B 5FPHA 3DKPA 1SXJC 1QHSA 2EW1A 5LDDC 3QE2A 1SVIA 2EIXA 1P72A 1QVAA 1E6CA 3PUYA 2A78A 4Q4JA 2OAP1 3EC2A 4V0ME 2PLRA 2WMOB 1SKYB 4QNRA 3ZYCA 1T8UA 3B2EA 1G41A 3CX8A 3QENA 3GMTA 4MRVA 5DIFA 2JLZA 1XCGB 4B73A 4FWTA 1COWA 3VNUA 3I73A 2OV2A 2WPDA 4URZR 1G6OA 1N3BA 5FA6A 2J45A 3OIVA 1G7TA 1A5TA 3ECCA 4ZKDA 1G5RA 1U0LA 3PENA 5DSZA 2GF9A 4G5GA 1KMHB 4PHFA 4CW7A 1Q82D 2AN9A 2F3TA 2GEDA 3W3ZB 3CCRB 4A2PA 2ODWA 2QN6A 3AGPA 1AQYA 2H7VA 1QVRA 2RB4A 3PUVA 3RS5A 3W6OA 1CJKC 3L8YA 4B44A 1D2NA 3LY5A 1GKUB 2AFIE 2IYTA 4WZBE 1VIAA 1F60A 3W2HA 1X6VA 2BWJA 1TADA 3P4XA 3WMFA 1JJ2B 1IN5A 4C30A 2IS2A 2K5UA 4D0NA 2PEYA 4NCJA 2EQBA 5FOUA 5GV8A 3A1SA 5TDHA 5D3QA 4OHWA 4B75A 1YQTA 4JLDA 4U02A 2NZJA 1MT0A 2R2AA 2VBCA 3BFVA 1J7KA 3KZ1E 2VLIA 4RKFA 2KJQA 3EWSA 4UNSA 4L5BA 4M22A 2VSOA 1LV7A 3MFYA 3U2QA 4Q7KA 3WP1B 1GFIA 1NI3A 2ZIAA 1J9ZA 3DM9B 1S3SA 1E1QA 4YMTA 2VRWA 1L8QA 3OEHD 4WXRA 2R44A 3NBXX 2O8FA 3REFA 2W0MA 1A2BA 4EJSC 1NN1A 1ZYUA 2C78A 4IHQA 1W34A 3SJZA 4PC3A 1Z3IX 4LJ5A 1W36D 1P2VA 4IDOA 4Q4AA 2RAPA 2XNDD 1KQSB 4BFYA 1QG2A 3T34A 2OM2A 2REXB 3C41J 1UBEA 3SR0A 5JI3E 1IBRA 3DZ8A 3GLIE 4UNRA 1IXZA 4TLCA 1CXZA 4WAUA 5GVSA 2C77A 2P5TB 2ERXA 1VYVA 3HPQA 1GL7A 2CJWB 5DH9A 1GNRA 2ZJ2A 3KKOA 4G5RA 2XTZA 4W7SA 3U60B 2DERA 4QL3A 1HY3A 2F9MA 3IQWA 4V0KA 421PA 1JA0A 2XXAA 4CF7A 2ZJOA 3CRZA 2H57A 2VNJA 1E9AA 3IPYA 3FPKA 3B1XA 3K0SA 3BH6A 3B1YA 3I3SR 3QVVA 2QAGB 1HURA 1FQKA 4CEHB 2J0UB 1W36B 3QKRA 2WBLC 1KK2A 4ZCLA 3CRQA 3EA5A 3PXGA 1ZJ6A 4JL5A 1J70A 2XNCA 1OIWA 1GRRA 2XSZA 3VU9B 2JLYA 1W5SA 2O8CA 4KXFB 3U6KA 3VKWA 2GAAA 3I72A 2B92A 2XZOA 1GAJA 4C2TA 1M7HA 4JSYA 2GJ9A 4EIWA 2ZRLA 1M1YE 4TQUS 4B76A 5FR1A 3MG9A 4DSOA 2A5YB 1E4VA 2FOLA 4PHHA 1NMZA 1U8ZA 5IRCD 1SKQA 1XU4A 3CMAB 4MUBA 4J0QA 2WWGA 1GIAA 221PA 3LX8A 4BZXA 1VQNB 3QUSA 3RRZA 1F2UA 3U3OA 1NMXA 2NGRA 4HYYA 1XTSA 5J4VA 2QORA 1JR3A 1RZ3A 4EFMA 1TEXA 2J7PA 1NJID 5J40A 1F2TB 1V43A 5JFGA 2IWHA 1ZD1A 2Q3FA 5D3MB 2WJIA 1U9IC 4PC2A 1UAAA 1GKYA 4PO9A 1TPZA 2RGXA 2VNHA 1TEVA 1JAIA 1XD8A 1TLLA 1MO3A 2VF7A 3AM1A 1Q86D 2PJRA 3B1VA 3RS0A 3CCMB 5K8IA 1RYFA 1L2TA 2ZSAA 4NCNA 3IIJA 1BYIA 4JYCA 3UATA 4QJ3A 1RJ9A 2Q21A 4M1WA 2LWIA 1M34E 4IVQA 4QHSA 3ZVRA 4Z1MD 2PZFA 2W6JD 5KSPA 2MSEB 1D1NA 2C98A 2ZI5A 4HAXA 3RDPA 1X8KA 1VQ4B 1E69A 4OJQA 5FUVA 3T1QA 4BWYA 3LH5A 1NIPA 2Q9CA 2RGCA 1AZTA 4OK5A 1NVWQ 1G16A 5HPYB 1NN5A 5IF9A 4US0R 4TSFA 3TUJC 4C2UA 4HB2A 4FMCB 4LYHA 2BHRA 4UXJA 1OYYA 1P2TA 1YKSA 2JJ2D 3AF0A 3ADKA 2WWYA 4RZ3A 3A1TA 4C7OA 1R10A 1J8MF 2H17A 2OUKA 5AJYA 2ORVA 1KZ7B 1LB1B 1CLUA 2FSIA 3ZBTA 4RZ2A 4LBVA 5LB2A 4I1SA 2ZPTX 1SKYE 3PUZA 3TIFA 4L8GA 4EPVA 3PVSA 3W8NA 1S9HA 1FQJA 1VHLA 2EFHB 4Q7MB 3Q3JB 3FMPB 2W2TA 4ZI2A 6Q21A 4A0GA 4DT1B 3B8HA 4MGYR 1VTKA 4B3FX 3IDQA 2QP3A 4PSAA 3FMIA 2X19A 1L4UA 2XZPA 3FKSD 1SM4A 2YV5A 3LQRA 4YMVA 1GNPA 1CNEA 1AKYA 2GZAA 1EXMA 3AF4A 5H8WA 3JQQA 1K9MD 4EPWA 1N6RA 2FGKA 2QRZA 3OEED 1TTTA 4C4PA 2P65A 1XCMA 2H16A 2BPOA 3ZZUA 2OEPA 2DCUA 2QP9X 3G82C 3HYRA 4A0RA 4C0JA 4Q48A 4RSGA 4CVNA 2NIPA 3IBGA 1ZBDA 3B1ZA 1E96A 1D8TA 1SHKA 1XTQA 4WOPA 1DE0A 2TMKA 4AG5A 1E64A 4IVRA 3MWJA 1VDZA 3ASZA 2FWRA 1T8TA 3RWMB 1N0UA 5BWMA 2J5XA 2B5OA 4DLTA 4I1UA 5C46F 3PCRB 4LDJA 4PHTA 1KD1D 3QF4B 2VEDA 1YZKA 4AYXA 4CIDA 4D2IA 2WHXA 4EPXA 4XVQA 2IYZA 1TF2A 1G8HA 3QI2A 1Z07A 2ZAOA 1AZSC 1R0YA 1F20A 1QUFA 3W5JA 4TMXA 3MLEA 5J5CA 5BYJA 1M1KD 1P5ZB 2QRNA 4M8NE 1R2QA 3AEZA 1TUEA 1Z06A 2ZITA 1E62A 3TUIC 2QTZA 3G5UA 1NDHA 3ZJYA 5H70A 1XTIA 2GDJA 2A5GA 5JLJA 3J81k 4IFBA 2QA5A 3SN6A 3A1UA 5EE1A 1AGPA 4N1AA 4V0MA 5C18A 1VQPB 1NSTA 2A5DA 4Q21A 2KI5A 5JHGB 2ZI3A
chains in the Genus database with same CATH superfamily
1RVDA 1JSRA 2IIQA 3E9RA 2Z58A 1RFLA 4FD3A 3GLFB 3TH5A 4EVSA 4NZYA 4A8JA 3INTA 4XQCA 3UANA 3UJ3X 1J24A 4QU5A 3OZVA 2VJAA 3LRXA 5JNLA 1ZUD1 5AVZA 1N7GA 2ZQ5A 1UKBA 2F62A 3AUKA 1PFKA 3JQBA 4G3XA 2ACWA 5DO9A 3QKIA 1V2HE 1ECFA 4N5NA 4UE3S 3MTAA 5JO9A 4EBBA 1QGAA 5FBRB 4KSCA 2XCLA 5WRFA 2BHTA 3MAAC 2BFFB 2W93A 5C81A 4L02A 4UU1A 4X90A 4AI6A 3BZUA 2HXGA 2TSYB 4NF2A 2FE1A 1UIMA 3HSSA 1XXLA 2NO9A 3OJOA 3QNUA 4LISA 2H0QA 1JHVA 2I4RA 2PZLA 4NAUA 4IH1A 4KR9A 3W06A 1CUBA 4RD2A 4B6FA 3IKJA 4D92A 3D4BA 3GBSA 2PLAA 3I4LA 4NK4A 5IZCC 2PDAA 4BIMA 2EJUA 4ARCA 1U2GC 4NYJQ 4OK6A 3LQ2A 3U7JA 5JVDF 5I7SA 1XELA 4OOEA 1TLTA 3EFEA 1EBBA 4G85A 1QK4A 4EITA 1EX1A 3GFQA 5IYZB 5C8VA 4ZYVA 5J9FA 4MTLA 5CG1A 1E79A 3TW8A 1L4YA 2ZJ1A 3DOEA 4IG4A 1GXSA 4MYHA 1P74A 3IBSA 2N0SA 3N7TA 2DUJA 1ZW1A 3WLMA 2I0FA 1YAHA 2JFWA 4YUYA 2QTLA 2PJDA 3JD0A 1KO4A 3PP8A 4J07A 1T9CA 1QH0A 1USUA 4IQ4A 2VPPA 2WU4A 3ZE1B 3GC6A 4UDXX 4GWGA 3DFZA 4ONEA 3VPGA 5C31A 1Q57A 1KNQA 1FNBA 2CNWD 2QQ0A 5K8JB 3QW4B 1EGAA 4PYOA 3EVBA 1VPTA 3IAAA 2G1KA 4MZDA 1S1CA 1TCVA 2HAEA 2PIDA 4QZVA 2XCSB 1ZKMA 2CBXA 2F3RA 3WLRA 2IYYA 3K0HA 4KYVA 1ONPA 2QRKA 2NUAB 3VYSB 5C1OA 3TW0A 4P2NA 1WO8A 1Z7EA 2OGUA 3OE1A 3Q11A 1R8SA 1TM3E 4XB6B 4KGVA 4OREX 5AXBA 3W9SA 1S3GA 5L8VA 3WYGA 3HB4X 4NOJA 4PBTA 4JMLA 1KIFA 4UVEA 4DDHA 2HBZA 3L82B 2KWIA 5K7SA 3GLIA 4ZJYA 5H83A 1DJLA 1NLMA 3K8ZA 5EYPA 2OHFA 1ZGAA 4KPUB 1EVZA 3LKDA 4S05A 2CZCA 2D3WA 2CF5A 5DBFA 3HDTA 5A4AA 2E1RA 1ZI9A 3SZLA 4EO4A 5FPKA 3RIGA 1AQJA 1T6NA 2HFKA 4KWEA 3FOEC 3LLMA 5D6OA 1NN3A 3D54D 4Z9BA 2DWPA 2FZLA 4U6SA 4PZAA 3NM4A 1TJ5A 1A04A 2X41A 2Q41A 2O7NA 4KAXA 4TV9A 2XUJA 5H82A 1QVVA 3F5MA 4BZPA 3U7GA 4G4SP 1Y4ZA 4DTIA 1KYIA 1JEQB 1UEIA 2MDTA 1WX1A 4ME6A 4DF3A 5AW2A 4PYLA 2JK0A 5FFFA 3QPCA 3VM6A 4EY6A 3JZMA 2PGNA 1N3LA 3PVZA 4IF4A 8ABPA 3H1FA 2HJGA 4G0XA 2X3UA 2X2FA 2ZJZA 2LVBA 1U90A 3PUJA 3CNOA 1GCGA 2JDID 1AF7A 2YFYA 1UMCA 1XJWA 1W76A 4AW9A 1CVRA 1ZH4A 3WADA 5THXA 3OX3A 4RH0A 1I6KA 3JYOA 4D0LB 3W8EA 2FSHA 1N7HA 3C3WA 4RD0A 1UFVA 3VR3D 1AS2A 1QHHB 5IK2A 1NVBA 3ORQA 4H7FA 4AY5A 5JASA 4NMMA 4NFHA 2QVXX 4HEQA 4TL7A 3TRFA 4RTQA 2GRUA 4P6YA 2VZLA 3QWAA 3T94A 1YFZA 2RGNC 4G2NA 5LM3A 1NG1A 1DQRA 2HSZA 2WSBA 3DMTC 3IV9A 2XRMA 5MGBA 1U9ZA 2A7QA 3DEJA 3NWJA 4J43A 1VIMA 1WHSB 1K7EB 5K0GA 1NPTO 4DKJA 5C1BA 4MYTA 1I6LA 2FPXA 1OAAA 1UQUA 4KGDA 3SMVA 1N0VC 3F9RA 2AN3A 4MR7A 4GZLA 3O6VA 3AINA 2JK1A 3GFBA 3H5RA 3QLUA 3S1AA 3GRYA 4G5XA 2WSSD 4F0JA 1MRZA 2AJBA 1IYZA 2QN7A 3SS7X 1U8FO 1IY0A 2FJUA 3LQKA 3R5SA 4RH3A 1OREA 3A6FA 1PP4A 1KAQA 5CX1A 3ZWPA 1Q6ZA 4P98A 3VJKA 5KYUB 1TZBA 2P5YA 3FMVA 4N7BA 5B1SA 3UA4A 1IXSB 2J5KA 1K1EA 2EZUA 3LE8A 3T3DA 4BFSA 5KS2A 3IAM6 4UDOA 4HUJA 4EUSA 4JBWA 4LYJA 4OAPA 3E1YE 4W7SA 2LGJA 1T3GA 3W34A 2CF4A 1OAKA 1Z5GA 2CDCA 4E11A 1FY2A 4E15A 1TIKA 1GGJA 3KYBA 4INZA 3EZLA 1XZPA 3KL9A 4X05A 1NVMB 1ZJYA 1JQ3A 2CHGA 1KPHA 1ML3A 3FZEA 3OTGA 2R85A 3AEQA 4HHEA 3QU4A 3ISXA 4QJ4A 4Y1RA 4AKSA 5TJHA 3WK9A 3KL4A 2IQIA 2G76A 3G02A 4H0NA 4AKIA 1D2GA 3RBZA 2ZW9A 2JEYA 2NU8A 3AO0B 2ZL6A 2F8LA 1CULC 2HJVA 2CLLB 4ZO4A 3GDWA 3TLGA 5B12A 1F3OA 3ZIDA 1C2TA 3TKLA 4ER0A 4MGKR 4AZWA 4OH1A 4Z51A 4ZCIA 1LVUA 1UC8A 2BGGA 1G20E 2JPDA 4XGKA 4HB0A 1QZ3A 2J59A 3JWGA 4FHGA 5FADA 3WRYA 4ALMA 4D9EA 2XR1A 2OXTA 5HIAA 1GTSA 4G89A 1S2IA 1ZXBA 2BONA 2ZRFA 3TRKA 2PUEA 4B3JA 3EQZA 2RC5A 5THQA 2HMTA 3O83A 4IAOA 4OHKA 2PSJA 2CEAA 3E05A 3FKJA 5EUCA 3T1VA 1J00A 4DAOA 3MJDA 3IV6A 1U2QA 5EMNA 5TX7A 3QU9A 2PX6A 3P9YA 1PZXA 2B8JA 2HA7A 2YXLA 3PQCA 2GARA 2PK3A 1KC3A 4MEJA 1X94A 4DJJA 1O5IA 4L4ZA 3LI2A 4K9NA 4PAQA 4H3SA 5LQRA 2ZYAA 1PKXA 5COAA 4PLPA 2C94A 5KTNA 1OPRA 4GWKA 1QE0A 2JRCA 2VPZA 5HUHA 1E3EA 3O75A 4E3ZA 2AG6A 5BOSA 1QGED 1VP9A 3ZDCA 1WKVA 2GHTA 2IZ5A 3FYUC 4MR8A 4ZQCB 4DR5B 3A6PC 5YASA 3LO8A 5KNCA 1AU9A 5SY6A 4JP1A 5A6SB 1OIXA 5JPCA 1ACMA 1EBUA 3WRXA 1JG4A 4PGFA 4A9AA 3ZY3A 4EUEA 4E7OA 2YOHA 4TYPA 4JC5A 4MWTA 3DLIA 3VSDA 2PU7A 2HQRA 4YQZA 3A3KA 2OAEA 4RGYA 1PWEA 3A1DA 1UFKA 2WKWA 2OFPA 1IN7A 5BW4A 5CA1B 3UBTA 1NE7A 4R1PA 1GQYA 5JHHB 3LBYA 2BH9A 1Z5UA 4WZKA 5IS2A 1C8LA 3E18A 3E3AA 1Q3KA 4HMQA 4XQEA 3KYDA 4X8LA 5FB3A 3KV3O 2BRUA 4MAAA 1JFFB 5JMWA 3PGKA 5C5EA 4WRRA 1YU6A 1SBTA 3KSZO 1V0EA 4Q7EA 4XDGA 2WQ7A 3WICA 2R84A 3MAJA 3RF7A 4M6WB 4N5HX 4E4TA 4B8WA 1YVRA 1EGMB 2WM3A 3LLVA 3OCJA 2X6TA 4O4IB 2IU0A 1XO1A 5SZIA 4RELA 1CQJB 2WSLA 1YJQA 3UC5A 4EFKA 2WTMA 5FORA 4RENA 5JSKA 3NV9A 2HUPA 4UEQA 2QBYB 1LSSA 2XA2A 3BTSA 3HCCA 1ZIXA 3IT2A 3Q2IA 4XYEA 3FFXA 4KLAA 4CTJA 1ULAA 1ISMA 5F7OA 3QMPA 3PR2B 3IR5A 4H1UA 4BATA 4WZ6A 2SKCA 5ES3A 2O3JA 4HNTA 1JKFA 2JEOA 1OSNA 4UJ3A 1ZESA 2DBYA 4NBTA 4JBXA 2C97A 4XWTA 1Q1NA 3VSBA 3HZOA 4IRXA 5MDHA 3KZNA 2XXBA 5SYNA 1G4AE 4F5ZA 1K97A 1ZINA 4UQPA 3OEHA 1ESZA 1RAIA 2P2NA 2R96A 1C7RA 2Q0XA 2REQA 3JS5A 4UARA 4UMVA 4ZOCA 3SZ3A 4B7XA 3WSVA 3U3XA 2YC2C 4F12A 1YJ9B 2B78A 1UJMA 4IILA 4V0QA 4XYGA 5A3VA 3LBIA 1N6PA 2HHLA 5IC6A 4KOEC 4JI0B 3BK7A 3PT9A 4FIZA 3AUYA 2PH7A 4BKOA 4EEZA 2DUNA 2ZWIA 2Y4OA 4R2IA 2B4KA 3EWAA 3OTHA 3TMYA 2D5BA 2DFDA 4UNNA 2ZVPX 1N2CA 2FCRA 3I83A 2XGMA 2QRLA 5H1YA 3W2FA 1PGNA 1P8JA 4LDPA 1RJWA 4CIBA 3DZHA 4ECAA 5KNDH 2PYZA 2WHPA 3ML1A 4WXPA 5I9TA 4OOFA 4KO3S 4NBUA 1VBNA 1SVMA 2FFQA 2IGBA 4DLBA 3N0RA 5EIWA 3QVSA 2G07A 4FMCF 5GZ1A 1X15A 4I08A 5DTMA 3T7CA 5JR3A 4HNAB 3IP8A 1QPGA 3H2JA 4GR5A 5KYNA 1XK7A 2Z5GA 4LF8B 4LWQA 4PICA 3F71A 2D7JA 3VOTA 1ZGJA 4CUJA 1T3LA 4YI5A 3UMSA 3TECE 1DXHA 2OKCA 2X2EA 4XGRA 1OE0A 5MF6A 1HDEA 1P9RA 3E9EA 1O5TA 3GPCA 3SQMA 2QSUA 1SUSA 4LRWA 5IH7A 4TRRA 1IZ7A 1VQ1A 1XNHA 4W8HA 5KU1A 3DB2A 3NH9A 1F7VA 4F5WA 3HWWA 4RHEA 4TUYF 2CHFA 1N5MA 2IPXA 5F3RA 4P08A 2CB9A 4MQMA 2C4MA 3A9WA 4Q05A 1FLDA 2BFDB 5JARA 2C5FA 1Y5RA 4FFRA 4Q4DA 2JC3A 3BG5A 1ONOA 1D9ZA 3KVOA 5KNBA 5EMMA 4C1NA 4KPGA 5CNJA 4KRFA 3ETGA 3C8ZA 4IUDS 1KDPA 2HDWA 3DXFA 4LYFA 4CKWB 2UUBB 4RDXA 3UHAA 1J90A 2RGDA 4TTSA 4ZDIA 2X5XA 3X1WA 1G7CA 1P3DA 1Z0AA 3FSRA 2LP4Y 4DWWA 1LW6E 3GVKA 4K0KB 4DJEC 1PK9A 3LVQE 3K70B 5EMJA 3EPHA 2YS6A 4TWZA 5DGHA 2O59A 4DLZA 4G1CA 4G56A 1YS2X 3LF2A 3Q7RA 4P34A 2ZRHA 2AXQA 1FBNA 1QOPB 1TTPB 1VJCA 1VLJA 2PZGA 3GQBB 2ZI7A 4CIXA 3T8YA 2YRXA 1K8XB 1OMOA 3I1YA 1P0MA 4L72A 3A8TA 3W6ZA 3WTBA 5BSTA 4EELA 3R8XA 1WCYA 2NO4A 1TUIA 3AZOA 2DJIA 3FPAA 3KG2A 2ETVA 4WECA 5TMPA 1C9DB 4FC7A 2QG9A 4TXLA 4JLVA 3B70A 4BV8A 1O58A 5HKAA 2XT9A 1N9ZA 4ZVOA 1PX2A 3D7LA 4XLHA 1G64A 2JFHA 4CM9A 2W83A 5CLLA 4JZKA 3SZOA 1DDOA 4UM9D 4DIUA 4ZO8A 2LRHA 5TVGA 5GGYA 3D0OA 2JH3A 1L7OA 1Z39A 2X8AA 3IC5A 3RSQA 5A9RA 2FI1A 2WAMA 5H80A 1Q1EA 3LC1O 2IITA 4ZZ3A 2HK8A 3A1PA 1DQNA 1RBZA 2OVFA 2FX5A 3GGJA 2ZYUX 3GLHB 5EI5A 3H5LA 1NT4A 3AR9A 2BF7A 3KJZA 1YB7A 4F2HA 1G60A 2XE8A 4FFPA 4INJA 3P7MA 3T3EA 4PG4A 3UMBA 1YZ3A 1WR8A 2NV6A 5LZ5A 1Y3HA 1HRKA 2C92A 4GEKA 1JEDA 1ZGGA 2QD5A 3A6GA 5DRTA 5LNK6 3KXKA 4B80A 2OZPA 2EZ9A 3MILA 4TT8A 5FL3A 1W5EA 3C5WP 5EFOA 1T5OA 3ET5A 4PO3X 4TV8A 1MO5A 1Q9SA 3RNLA 3P19A 3H9EO 3OT5A 5C1IA 4EGQA 4AUMA 5LNK1 1ZH8A 2ZYHA 2ZBUA 1D1PA 4QELA 3EQ8A 1DAGA 1YRQA 1K6EA 5ULLA 2FSVC 4ILEA 3ZWWA 1CD5A 5KJEA 2C95A 4HDKB 4ERXA 3LQEA 1E43A 3HA5A 2YZNA 2OCXA 2Z2XA 4GNRA 3ZWMA 3IJPA 4RD1A 3DMDA 3TQTA 3HTXA 3AI3A 2GJAA 4Q9JA 1PGJA 3BXZA 2ZRGA 4URHA 4X7MA 4Y9DA 4FEYA 1B15A 1XJ5A 1T6XA 3GDFA 3BF8A 4JJZA 3LC0A 1SWVA 2OMEA 5REQA 2VATA 2ILVA 3CSDA 4BCDA 4D74A 3IE1A 4RPGA 4X61A 1EJ0A 1I18A 4FNOA 4Z8XA 3IQDB 4JU8A 1A96A 4GP7A 2P79A 3EODA 4IIHA 4ZV4A 2MR5A 2J5RA 1GPJA 2RCNA 1M5UA 1NNLA 2Z4RA 5F9FA 3PR1A 4DLWA 2C9CA 1KQPA 2V03A 3O0DA 3AYZB 3OCZA 5HOQA 2V45A 4P58A 1T2FA 1K8ZB 1B23P 4I81A 5F4OA 3E7FA 1O95A 1C2YA 4EQ6A 2C20A 2QLNA 1P6UA 1KBQA 1SCDA 2JFVA 5HE9A 1EK6A 1ZGBA 2PXAA 1Z16A 4MITA 5KPJA 3LMKA 4BUZA 3IYLW 3OHMA 2X6WA 1OTXA 2QKYA 3M5DA 4Q9KA 2NAFA 3BXXA 4P38A 1CY4A 2HIMA 3V2HA 4KFCA 1P73A 2V5AA 4GUDA 4FQ8A 4MRPA 3HFGA 4NBLA 2QJOA 3O3CA 5KDLA 2HN9A 3ENQA 5E1BA 3BIFA 1P61B 1DAFA 4RF2A 2B8NA 1MC4A 4KQ6A 1P31A 2MIIA 1H85A 4B2IA 2P30A 4MKZA 1RC1A 2UVDA 3KHUA 3LL7A 4NU5A 3T7JA 2AFHA 3DQQA 1JTEA 4I4TB 3HDJA 4B35A 1A95A 4YJ2F 5JSZB 2JAHA 2VQSA 3ZDFA 3TFWA 1Y7IA 5TB5A 1ZCJA 5JQGF 3K0CC 3HCFA 4O4JF 3DHNA 3A3OA 2EBHX 1HNZB 4IIUA 1UEJA 1ZK0A 4AC9A 1DO2A 2DQYA 3QQ5A 3KVRA 1G2QA 5FTKA 3VAAA 5JRJA 3K9HA 2C96A 1AA9A 1KI6A 4BDSA 5HW0A 4X06A 3L1VA 5IWCA 1Z4NA 2XUDA 3ETNA 2VYVD 3NJ4A 4CUZA 2BDEA 1XEXA 2PSDA 4N40A 5TV2A 4AO8A 5KBYA 4LXQA 3N07A 1HLDA 3VV2A 3WB2A 1AM4D 1QO0D 1QIMA 3WSWA 2ZI9A 1P7YA 3WWCA 2EBFX 4YV7A 1NDQA 3E23A 3QV1A 1FRFS 2BAGA 4I1VA 5BSXA 5CM9C 3L6DA 5KVQA 5B3AA 5EJ5A 3O4HA 2IHJA 1RNLA 1BXGA 2PZMA 2RH5A 4FC6A 5IULC 5JATA 3G9QA 4FFBA 4YMSA 4PZUA 4DCSA 2D2IA 3H2HA 5H5JA 3JTMA 3QTTA 3T5DA 3QEKA 5EJ9A 1Z36A 1RZRA 1SIUA 2NX2A 4TMZA 1Z3CA 1LJUA 4JLSA 1T0BA 3QKTA 4HTFB 2GFIA 2WZCA 3HNRA 3K0AA 4K46A 5EINA 4QWMA 1CWUA 2RH4A 3Q8KA 1IHYA 5J2TA 3H2BA 4HQFA 1KRXA 3BMXA 1F9EA 1SBNE 3BB3A 4BE7B 1GR0A 3F3SA 1F06A 4P9NA 2V6FA 2BP7B 3PWKA 2I6GA 4NOMA 3T1NA 5KTYA 3WGHA 3NDRA 3G1TA 4GOND 2MOKA 1LPBB 3D2CA 1FSSA 2FFRA 5GONB 5E7MA 2YYZA 4IXWA 4DLUA 1B26A 3BD9A 4CF6A 2QAJA 3LUBA 4D8WA 3RARA 5IARA 3AP3A 1J0BA 3AVQA 4E14A 2VXOA 5AD1A 5HA5A 3ZLJA 3D6AA 4NR0A 4Z49A 3QK7A 4LOKA 4DWJA 3MCWA 2K4MA 1I7LA 3GJ7A 1UBCA 1XQWA 3OZCA 2W58A 4OHOA 1ZR2A 2BM0A 5JBIA 1OJLA 1G6HA 3B53X 3KPUA 5H0IA 5FOQA 4ZCPA 3T7KA 4MMZB 2GAIA 3NT4A 4M4SA 4MICA 4UUNA 4WCFB 4N3GA 2AJDA 2EU8A 4F4IA 1WB5A 3DOCA 1FVFA 2DUMA 2ZB2A 4X54A 2FGJA 2AI2A 1B16A 4Q9LA 1LUAA 1RCTE 1L8OA 1ZSYA 2M98A 2YJ5A 2L0XA 5A3QA 4Z53A 3GLRA 2B5VA 1YR2A 1OBVA 3PCXA 3H84A 1C1DB 1J8YF 3H11A 2RK6A 4PTLA 1SXPA 2RBKA 1XQYA 2A9VA 1RTKA 1T2VA 3FF1A 3T5CA 4EG8A 5K4HA 3EZXA 3F90A 4JT4A 2DQ4A 2EYQA 1P18A 1UBOS 1XIVA 2JFUA 3GYGA 4Z0TA 3L4JA 3LY8A 4I36A 2GXSA 3RU3A 3H1PA 2AS0A 4F5YA 3TG8A 1RRCA 1ZNYA 3FH0A 2YNMA 3OM1A 4GL2A 3I32A 1H5UA 1KVRA 1W5TA 2F1OA 3ET4A 4Q03A 1WUYA 1RAAA 3QXXA 4XIYA 1YZQA 4JCOA 1W1WA 3MW8A 4D3YA 2XDQA 1M66A 1LS1A 1C3OB 4IEFB 4WLVA 3SLDA 5LA6A 4R81A 3C5CA 3NXKA 2QEQA 3O03A 1VHTA 4AECA 3GDHA 3T06B 2FSSA 4X8OA 5D3ZA 3BVPA 5IXYA 3BREA 3JD3A 2EKZA 4KNVA 2ATCA 5CRIA 4PFSA 4WVLA 5EN4A 1WZ2A 1FFYA 4XUCA 5DNUA 2CYBA 3FWZA 3RK4A 4K1LA 5FNVA 3M34A 5EXDA 3VUFA 4F96A 4AQ7A 1WDMA 3GLHE 4UU7A 4MKFA 4PC7A 3AFIA 5CFZA 4JUIA 3COJA 4FE3A 1JPNA 4XUEA 3M4JA 4OSOA 1PFUA 2BE9A 2J3MA 4BVBA 1IJEA 1QYCA 2OK8A 5ED0A 3ZH2A 1XG5A 1P2GA 4GPZA 2FPGA 5CW1A 4LTNA 5CFQA 4WZTA 2VNAA 5I4IA 3O93A 4AJLA 4BV3A 4CNQA 4YJHA 4H6VA 4ZVQA 4LI0A 5BXQC 1ZHHA 1NI4B 5G3ZA 4RJTA 1CC1S 2CT8A 3PFKA 4KR0A 4YMHA 4RQTA 4OP7A 5AR1A 5F76A 3SIRA 1NU8A 2FXIA 5E2AA 3CBGA 3LX5A 1RPZA 3WBKA 3D8NA 2BSAA 3I9V6 4V38A 5K3CA 5TQ2A 3MBIA 3NWBA 4K6OA 3NKVA 3KR0A 1XJQA 5EFZA 2CL7X 5AUQA 3WIDA 4TYMA 2DC1A 2HQOA 3F8SA 5KSWB 4RUKA 3DBRA 3KZKA 4WNCA 3H87A 1NLZA 1FQOA 1G55A 4ZOQI 1CEXA 2FJ0A 4ZV7A 3OA0A 4IO0A 4Y1EA 3MHTA 3I9V1 3MBKA 4MV7A 1OW3B 4X0CA 2X14A 4XZ3A 5AK0A 4YFVA 4BGUA 2FUG6 2V5UA 4YVFA 4ZO6A 2ZWVA 3KQSA 5AJZA 5HDQA 5U4XA 3UJAA 3GVIA 2GFQA 4U7WA 3B48A 3IKVA 2MSCB 4PNPA 1QHIA 3B8EA 3E9ZA 5FOXA 3BD6A 1B00A 2QN8A 1RWWA 1WKBA 4MWBA 3TQIA 3KQOA 4LMAA 4XSHA 2GXAA 1W9HA 2ZTSA 1E4EB 2J0VA 4OQFA 4DILA 5HKOA 3ZHVA 1KI7A 1LK0A 4CLXA 3CH4B 5KMGA 4A6DA 1NJGA 1DOAA 2H4ZA 3QFRA 1U1GA 3ESDA 2HMAA 2ZCUA 1AT1A 3KT8A 4BQEA 2NMVA 3HRIA 1TDJA 1RQPA 5BWNA 4HXYA 1G8KA 1TM2A 2I55A 2A92A 3T7SA 3OW7A 4O3MA 3GAFA 2FZWA 2DLCX 4DR6B 2C00A 1C41A 1ZVKA 5ECGC 3FR8A 2N1BA 4AJ2A 2WD7B 1LTHR 5KJFA 3HA2A 1GOTA 2XHZA 3QJYA 4JQOA 4UTRA 1UBMS 1GPUA 3TIIA 5B6PA 4WPGA 2X6YA 1OXBB 3AIOA 4JUFA 3LUDA 2G88A 2ZT7A 4QXPA 5L4NA 5JUWA 1OLUA 5FYDA 2YV4A 3GK3A 4HZGA 2E48A 2VUTA 1OKKA 5ESWA 1YB6A 4CHGA 2CFSA 1GQRA 1D6JA 3MVEA 1D1QA 2CXRA 4KVFA 1E7WA 4WBNB 1YVEI 3C6BA 4II7A 1IFXA 2YVUA 4MR9B 5FPTA 5HBRA 5T57A 1N05A 4ZIRB 1AF4A 2UYHA 4KE8A 1W93A 1HRDA 2QI9C 4L57A 3SEQA 1L5KA 2LCIA 1QIFA 2CLOB 2WA2A 2YW2A 3PXCX 4LCEA 5FD8A 2XTAA 1U3FA 2DQKA 2NVUA 2EGUA 5DEOA 1AKWA 3IR7A 3PC7A 1UMDB 3VFDA 4E5MA 3EIWA 3O91A 5TT0A 4ZMSA 1WSAA 3SKVA 2OHVA 4EF4A 5A5EA 5BYKA 3OTWA 4OIFA 2YRFA 4PYIA 5TXGA 4AJEA 4MA0A 4U9IS 2PLFA 1YQ9A 3CEJA 5EIOA 4X1YA 1YF3A 4P3KA 1UH5A 1SURA 4IRMA 4OOVA 3R5FA 1SBZA 3EAFA 3EZNA 2V97A 1VSTA 3FFAA 5FBWB 1P0FA 1W85A 1S8OA 4RJLA 2YJZA 1ZVJA 1FYDA 4R1LA 4BHTA 4M53A 3X1YA 2DFVA 4Q24A 1DL5A 1OV4A 1WQ3A 3LQYA 1A1VA 2H0RA 1M1NA 3D31A 3R0XA 3JAMA 2WSYB 1DO8A 2XUIA 3PXXA 1VP3A 4P3OA 3T12A 2DPLA 4M9SA 3EF1A 1WDTA 3ZTTA 1IQ0A 2X8WA 1RLIA 4ZANA 2JAQA 3WK7A 4ENTA 1EAYA 1BJTA 4FYVA 4A0HA 5FTLA 1TRKA 1F5SA 3TQCA 4YYEA 4ALJA 4C5CA 1O9BA 2CJXA 1HYBA 3F3MA 2IBMA 4PXYA 1J21A 2JIZA 4DCNA 4WQMA 2QVZX 2PQ6A 3EBLA 1XDDA 2FZGA 1M73E 2OY0A 1KAHA 2VT2A 2BGNA 3OW2B 3CJRA 4LOIA 4X7RA 1S2MA 3ZCXA 4A8HA 4DANA 1QG6A 2HCJB 1XX6A 1Z0JA 3ZGLA 1J0AA 4PVCA 3SJUA 3I53A 3PFBA 2V8OA 2Y2UA 4GLJA 2BN4A 1R4AA 2VYFA 4IJKA 4QICA 1T91A 3RY8A 1BDMA 5JXJA 1P6XA 4YJDA 5A3SA 4JHLA 2V7TA 2DHEA 1EGHA 2DLNA 5D87A 1EQ2A 3JR3A 3C6XA 4MW5A 4RVSA 5KYKA 1PWYE 2DKFA 2XQIA 2Y71A 1H1DA 3AHEA 3JAKA 4ARZA 4DY4A 5IKXA 3GLGA 4OVKA 2GYVA 3JCZA 2C7RA 1QF6A 4PPFA 3ICWA 1I33A 1O08A 2JGLA 2DEUA 3E27A 3OPQA 2CDBA 3I0NA 2Z6VA 1G7SA 3AY7A 1T4GA 3FOCA 4D9BA 2QP4A 4HGRA 4P8RA 3UCFA 5ADVA 3KQNA 3IKTA 4OY3A 4CLOA 5HKBA 1QGUA 4KYUA 4I3HA 3KSBC 5JRZA 4OPOA 4F8JA 2Q1TA 3H94A 2YIMA 3KLNA 4D79A 4DWOA 1RCUA 1Y8RA 2QD4A 1NXOA 1TYEB 1XTKA 3EDCA 3UK7A 3BPSA 4A1FA 2I62A 2ZRIA 3HJTA 1E92A 1NVVR 2W0SA 4YA6A 3RRNA 2PBLA 1JECA 1K0UA 1R0WA 1MABB 1E3JA 1P4SA 5CA0B 4KW7A 4US1R 621PA 4P7FA 2O2SA 1OFTA 2O06A 4XKVA 3K31A 4S1PA 1HPLA 1T4CA 1CHNA 1KK1A 1U9YA 2H31A 1EB8A 2OC4A 3HCEA 3HY4A 4FHEA 3V1LA 3PVCA 1AG9A 5E2BA 3PJDA 3RTDA 1EP3B 1SXJA 4K6HA 1BIFA 2I99A 2R1UA 3FYTA 1II9A 1LW7A 4MS3B 1QG0A 1VPDA 4FN4A 3HR8A 2YN2A 4JJ8A 3WYEA 5AQ1A 4U9UA 4MULA 2R25B 1C3LA 3NC1C 4D43A 4XOUA 1LC3A 1J2RA 4YRJA 4J75A 2RGRA 3KFXA 4HIZA 2VBIA 2VQ3A 1E0AA 3F6BX 2JVJA 3RSGA 3O8CA 1G1AA 1OZFA 3ESBA 1IHPA 1V4BA 2AKYA 2HYDA 3R5JA 2QWXA 3TNDA 1AKTA 3MJRA 3X1MA 1NMEA 2VXYA 3IP6A 4L75A 3BSFA 5I7HA 3FWPA 2QPAA 2ZWOA 5IJ9B 4LC1A 1CIVA 3IR6A 4XQGA 2IV7A 4UHEA 2R6HA 3X1DA 1ODKA 3CM0A 4EZEA 4U7PB 1QK5A 2E9SA 1PR6A 5EQTA 4HF7A 2WTXA 3IURA 3GRCA 3A31A 1VMIA 4FMBB 3VC7A 3BGSA 2HXYA 2YY6A 3TFQA 2PSFA 1UPTA 2H1WA 4E12A 2G71A 4P31A 1NC1A 4HZIA 3CW2A 3RT9A 5B7GA 3QRWA 4UTVA 4ASUD 1BYUA 3W5DA 3JV7A 4QGHA 2PBZA 5BNZA 1KYWA 4OXNA 2YC4C 3AT1A 3GJ4A 3K9LA 3OF2A 4JI6B 3OCYA 1OLOA 3UJ7A 4DSUA 2AKEA 2P1DA 4L22A 3FETA 3VAZA 3SF8A 4QBKA 3ZVLA 2AK2A 1PJ3A 2VDWA 3LPCA 4POAA 3SR4A 3ST7A 1MRSA 1X1AA 3DTVA 2BEUA 2R6CA 4Q1BA 2K2QB 5FKJA 1K27A 3AY3A 3UYLA 3FOAA 2WG0A 2Z3VA 4I1YA 2R11A 5KU7A 4XXHA 3RKUA 3IT3A 1T6BY 4P83A 4RK0A 4UHJA 1JBKA 1UDXA 2QYOA 3SIPA 3UHPA 7ABPA 5KQSA 4MPDA 2NZWA 2WIAA 1PR5A 2OD2A 2ONZA 2F1HA 4Q12A 8GPBA 3I2FA 4JVNA 4JBIA 3E2PA 4KZKA 4U7DA 1TK2A 4K81B 3HUFA 1QIJA 1MTZA 2GSDA 2W2KB 5LP6F 1QFXA 3QMVA 4GOOD 4MV9A 1VGVA 2WKPA 3AL0C 4BDTA 4M49A 1DKMA 4P53A 4DCUA 4NENA 1J1IA 1S96A 1C0PA 2O6LA 2IVZA 2J0QA 2AQIA 3PE3A 3IP3A 4QOHA 5BN1A 1ORHA 1R64A 2RI1A 5LQSA 5AMXA 3AB7A 4EWLA 1EESA 1KO1A 4RLZA 3HUUA 2VPXA 5M2QA 4DV0B 1BW9A 1UBFA 2DUUA 4G5QA 2JW5A 4XE5A 3PT5A 3ZY5A 2J3DA 1LFAA 1ZJ4A 4S3MA 5CDTA 2FMFA 1J2JA 1AZWA 1L5SA 3PGXA 4HRVA 1V37A 5CGQB 3RFFA 3U40A 1JDSA 3IEUA 4E88A 5KAMA 4J1SA 4URVR 2NPOA 3H7AA 4UAVA 3M3HA 1SXIA 3ZBQA 3B7WA 3ACDA 2I9PA 1CRWG 3IILA 4CIAA 1ZR4A 3FPBA 5T7BA 3REGA 1X1DA 2XNDA 1MDFA 3KUKA 4L74A 2R65A 3BSWA 1SO8A 3IXLA 4MYRA 2BW0A 3EGCA 4HDCA 1W88B 2GN6A 3MJFA 3NVAA 5HIMA 5JE8A 1XMJA 2ST1A 4FQ5A 4FYJA 5HQTA 5CH3A 4FW9A 3WB0A 4TKOB 1H94A 3I28A 2X53S 1RXVA 4OBBA 2C5LA 3VHXB 2C0CA 1OH5A 2N47A 4RVFA 3FYDA 3A2KA 2EHJA 2NSYA 4I50A 3RROA 4DEYA 1D2AA 4DUPA 2GLTA 4XVUA 4W5JA 1BEUB 2IZ7A 2WOOA 2L17A 4LK2A 1TUGA 4OMUA 4QVKA 4CLRA 3TF5A 4KR2A 2PGXA 1WOYA 2ZSFA 1Z38A 2G80A 3DXXA 4X20A 1WD5A 4OJMX 1I4WA 1T3TA 2AKAB 2PTGA 2R8YA 4GW3A 4ZDJA 1WVMA 4M0FA 1VPEA 3L8FA 4NYIQ 4X7CA 4X1IA 7GPBA 4EZBA 1BMQA 1UOPA 1TZKA 3DG9A 3LUGA 4JX9A 5ADWA 2UXDB 1EM8B 2P0EA 1ST3A 3N0VA 3IOBA 4RL6A 2E5LB 3DEZA 3NTOA 4OCZA 4RCYA 3BY1A 1NKVA 2XOKA 3FOZA 2G6TA 3ENWA 2ZTVA 1ZQ9A 1F2TA 3DHEA 3FW1A 4JOBA 1JV2B 2CF6A 1CUHA 1IN1A 5DLDA 2CHUA 3OCUA 2FTKE 2RHRA 2V6GA 3C3EA 2F1JA 2I7DA 4PYQA 4HNHA 4PRLA 1UEXC 1FFEA 4Y9RA 3Q0TA 3CVOA 3VPXA 5M04A 1IOWA