4RCYA

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gtp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVAHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rcyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rcyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rcyA01
4FCTA 4HAXA 1NG9A 4HDOB 3W2FA 4LOAA 1PLKA 1QUEA 2NTYC 4DCNA 2JJ8A 1G3MA 3QF4A 4G0NA 1NY5A 4PZLA 3BB3A 1U99A 1Y3AA 4O2RA 5CIWA 3EPHA 1YZTA 3BORA 2VSOA 2IA5A 1X86B 4PC7A 1EK0A 4CEIB 1FX0B 2ZVQX 3CF2A 3W2IA 4B71A 4JT2A 3AKEA 2BMWA 1E9FA 1XCPA 1HE1C 4B3FX 2ZJ8A 3BH7A 3MWLA 4KAXA 1QFJA 3E2IA 1L7VC 4KXFB 2AL7A 1KZ7B 1QX4A 4BZPA 1KAOA 2GVDC 1NMXA 4ZCMA 1E1QA 2WJIA 3OIYA 4DHEA 2F55A 1U0JA 4JL8A 4HLCA 3OEHA 4HLQB 1J90A 2O8FA 3FFAA 4MQBA 3U7GA 5AUNB 1FNCA 3QXSA 4P32A 3THYB 2QAJA 2QPOA 4JJKA 5FUWA 2RGAA 5AR1A 4A2QA 4E07A 4B6EA 1JJ7A 1M7GA 4XD7A 3GJ4A 4M2LA 3AP3A 2IYTA 3H4MA 5GJVC 3AP2A 3THWB 2IEYA 2ZS7A 2VTKA 4OI4A 3GFOA 4K81B 2VQSA 2ZRCA 5C1BA 1VQNB 1Z6YA 2BBWA 5GV8A 3QKRA 4EPVA 1Q1ZA 2Q3MA 5F9FA 3VHLB 1UBCA 4PC2A 3K8YA 4MKHA 3V4RA 3KB2A 4MUBA 3L0PA 3CC2B 1Q7YD 1JEEA 2XZLA 1IXSB 1J70A 1QHNA 3VR5A 3I1FA 3RRZA 3WMFA 3BRWD 4QG7A 4NCJA 4OHVA 1OV4A 3SEAA 2FA9A 1II8A 3IQXA 4A6XA 5AK0A 4RFSA 1BMFA 1G3IA 1G16A 3U61B 5DGXA 1DO2A 4D0NA 5GVRA 3KJGA 1G4UR 2HLDA 1ZJ6A 3L8YA 2PJRA 1G21E 4W5HA 5FOWA 1A4RA 4LJ5A 1VG1A 2C04A 3D3QA 3GJ3A 4LJ9A 2GCNA 1W46A 1ELOA 3ZYCA 4TMTA 5LD2C 3W2GA 4NTZA 5FBWB 3H84A 2MSCB 5IT5A 3WY9A 3CX7A 2CDNA 3FPAA 2VP4A 4LJ7A 2O0HA 2W2XA 3MWYW 1KGDA 4Y0AA 4TLAA 1W0KA 3BWDD 4JKIA 1XEXA 2R6FA 2BEKA 1VHTA 4A0HA 5G41A 4FWIB 3ZBTA 1UBFA 1ZBDA 1T9HA 3PFIA 3QEJA 4KU4A 4O25A 4TSFA 3T61A 2X77A 3BFKA 4RKFA 3TSOA 1VCOA 3FMFA 4LY6A 3U3JA 1GP2A 4PZYA 1FDRA 2QA5A 5CM9C 4V0NA 1UFQA 1W35A 1QVRA 3TQFA 3S1AB 4BUJA 1RPZA 2O8BB 4TMVA 2HXSA 2ZE6A 4OQLA 5FFMA 5CK5A 1VIAA 2X1VA 4LGMA 4M1KA 1HY3A 2GQFA 4DDVA 1KYIA 1IB0A 4B35A 4BLRA 3T1QA 4GT1A 4IRUB 1AA9A 1YZUA 4Q21A 1PUIA 4DDTA 4CT5A 4Q7KA 1KNXA 3B9PA 1E2PA 3CXCB 2AK3A 1SVWA 4B32A 4BFXA 3JZAA 3T1OA 4LJYA 3K0AA 3B13B 3UMRA 4MDEA 2VL7A 4IDQA 3TJZA 4G5OA 3GPLA 3DKPA 1R8SA 3F0TA 2GK7A 2C95A 3TUIC 2ZROA 3CMAB 4DLXA 3CCLB 4LV5B 4BFYA 1G18A 3F8TA 4KLNA 4B2IA 2J0UA 3FMIA 4ZGQB 4URZR 4PHGA 1R7RA 1GOTA 1ZMXA 2I1QA 4ABYA 4TYYA 4Q4AB 1Z6AA 2ZJYA 1MABB 4RZUA 1XEFA 2DY1A 4QRHA 4XWAA 3SJCA 4PTLA 4NDZA 2ODEA 4JLMA 3JQPA 3ZVLA 4YMTA 2QMEA 4GL2A 3BE4A 1DVRA 2DFTA 3ZQ6A 3THXA 2ZYVX 4HE5A 3ZZTA 1BIFA 2B8WA 4TTQA 3T34A 3K0CC 3NC0C 2VBCA 2PMDA 3WNCA 1F3OA 5HE9A 2DBYA 1EFHA 2IYUA 1N0UA 4NONA 2IUUA 1AKYA 1KI4A 2D74A 1CR4A 2WWIA 4YHBA 3SQXA 2XSZD 4LJ4A 4NBSA 2ZS8A 1G19A 3WMEA 3NDBB 1EG7A 2PEZA 1N5KA 2DHRA 2ZTSA 4EPTA 3PQCA 1XF9A 3PCRB 4GOXA 3ADCA 4U7DA 1KDPA 1NIPA 2F1IA 4Q66C 3E1SA 2WBLC 4DLWA 1AKEA 2DETA 5FL3A 1ZM9A 2QT0A 4R98A 3QXCA 4IXNA 2XNSA 621PA 1XNJA 4EIWA 1NBMD 1XEWY 1YZQA 4MKFA 1E9CA 2IBMA 2EFCB 2ZE5A 2ERYA 4QC2A 5K8LA 2R9VA 1OIWA 2ZJBA 2OHFA 3AVPA 2J0SA 3FFBA 1QVAA 4BFSA 2VHCA 4OHZA 4QGHA 1B0UA 2IEZA 1JJVA 1E9AA 1I4DD 1JQLB 4A6PA 1UAAA 2CHGA 2JA1A 4ESHA 1D6JA 2ZJ2A 4LWZA 2V1UA 5BN4A 1OB2A 1IN7A 2YC2C 3DMNA 1PUJA 2WJYA 3PUVA 1GAJA 5JSZA 2NIPA 4Z8XA 1J99A 4QGFA 3I61A 2CLCX 4AKEA 4JLDA 4RD3A 4P3YA 3LFUA 4MRVA 2GKSA 1N6LA 1MV5A 3K0AB 2QROA 3SHFA 2XB2A 3SHWA 1P2TA 4Q1AA 1G41A 2LCFA 4DIEA 2ZJOA 2F1JA 3RS4A 4AIIA 1DPFA 1W4BA 5K8IA 2GCOB 1KDRA 3VU9A 2EYUA 3B5JA 5G3ZA 1Z06A 2Q21A 2IWHA 4BZXA 1PLLA 1ZW6A 3AF2A 3N70A 1GKUB 3AKCA 2UVQA 3OW2B 1P4SA 1CIPA 3O8CA 1FZQA 3IIKA 3GLGE 2ZRIA 1DAIA 3B8HA 1VCNA 1NLFA 4NYIQ 2REBA 4D4MA 4C0LA 3WHKA 3U4QB 3RC3A 2BCJQ 4DLZA 4XWKA 4BPRA 1YE8A 4YAWA 3EZ9A 1Z0IA 2G9NA 2ZSDA 2KJQA 1E69A 1ZNWA 2CNWA 2O8CA 2A7QA 1II0A 4MGIR 5L3SB 4OI1A 4Q9JA 1W2HA 1M34E 2ZI5A 1TQ2A 4DBLC 3VX4A 2NO6A 5KNCA 3MUFA 1JB1A 1GNQA 1NG1A 1Z0JA 3F5FA 3VHXA 4DLVA 1GNRA 3MGCA 1MO6A 1X8KA 3KTAB 3AB3A 3QFRA 1OXSC 1KDOA 2H92A 3K0FA 4TYPA 4CGZA 4BFZA 2E87A 5EE5B 1D2EA 4A8JA 4QBIA 2J1LA 1ZIPA 1DE0A 1CQXA 3KX2A 2CCKA 3CRW1 4PGOA 5JECA 4U00A 2X8AA 4Q47A 1NN3A 1LY1A 4QJ5A 1CR1A 4Q02A 4NP6A 2OILA 2JLVA 4IKEA 4O0MA 1QG0A 3PJRA 2F43B 1QHXA 1RRFA 4EJSC 1YHQB 1E2KA 5EE1A 4OJKA 4NU0A 1E32A 2R2AA 3NKVA 3DZDA 1QH0A 3TRFA 1UADA 4BPBA 4P4TA 2C8VA 3W8NA 2BJWA 1Z0FA 2HCJB 5KSZA 4TL9A 821PA 3QFCA 2VP2A 2CXXA 2NG1A 4AI6A 5AUOB 3V4FA 5DI9A 5JWRA 1US8B 2CVFA 3CCMB 2QZ4A 4B34A 3KXIA 1F2TA 4DIDA 2CBZA 2RB4A 3JZMA 3U6BA 4PC6A 3L2OB 3PUWA 1G8FA 1CP2A 1VECA 2OV2A 3D31A 4NMMA 2QTLA 5A5GA 4DCSA 1EFUA 1KK2A 2GPJA 4EUNA 2WWXA 1AJEA 2CNWD 4C0KA 1VG8A 3LNCA 2W00A 2FZ4A 4IVPA 1TQ4A 1W0JA 1OB5A 5B64A 3ADDA 2ODNA 3T06B 1NSFA 4TT3D 1XCGB 3IILA 4GPTA 1JXMA 4PQFA 2H18A 4CEIA 5J40A 5FOSA 1EP3B 1JJ2B 3I3SR 3NHAA 3HP1A 3K70C 1OXXK 4M9XA 5B30A 2IXEA 1AGRA 1HT1E 3MSXA 2CL0X 3L82B 1IAQA 3FKSA 4PSAA 4RZ2A 1S8FA 4HZUB 4Q9IA 3I55B 3EPLA 3C8UA 5KUTA 1KK3A 1IBRA 2OUKA 5TVKA 4IEEA 4O3MA 5HZKA 1VCMA 1YVDA 3C5HA 4JVNA 5K8TA 2IL1A 3K0EA 2X3UA 4I1OA 3LW8A 2QE7A 2XAUA 1Z63A 5JRJA 4NCHA 3I8XA 3LDAA 3GLHE 3X1ZA 2ZE8A 1KI1A 2JJ1D 3D6TB 5J4VA 2IHBA 1G7TA 2C77A 1UDWA 4DEXA 1N8RD 3AVTA 2G6BA 4POAA 3HPQA 5FR2A 2BSAA 2H8KA 1CBUA 3GLIB 1BYIA 3N2EA 3VR4A 4P31A 1VQ8B 1PV4A 3T1VA 5TDHA 2FPLA 1II8B 3OZUA 1U0HC 3TBKA 4E5UA 2OSBA 3OJXA 1VQ6B 2BCGY 4HAUA 4B3CA 4QBHA 4BRUA 4BZQA 3P32A 5KU1A 2V3CC 1V43A 2OT3B 1E2JA 1CULC 4O2LA 4A36A 4Q4AA 5FPTA 4TL8A 4LZZA 4DCVA 1ZAKA 2GCOA 2RMKA 4ZDKA 3QNUA 1EX7A 2ZU0C 2B7BA 3I4LA 3W5UA 2HJVA 4MITA 2DFKB 4LI0A 1FRNA 2YWHA 4ASUD 1G8YA 2ZI6A 4N0EA 5FTMA 4G5QA 2Z4SA 5HXBA 2G3YA 5EXSA 3RNLA 4IXMA 1TMKA 3PUXA 1Q57A 4B74A 1NLYA 1JR3D 4FINA 3HU1A 3W5VA 3K70D 1AN0A 2OXCA 4L9WA 1WDTA 4US0R 2XXAA 3W2HA 1S0UA 3VR1A 2ZAMA 3TAUA 3ZBUA 2QEXB 1U8YA 1TU4A 2B21A 1C1YA 3ETLA 1KMHB 4TLEA 1ZM2A 1E64A 2P3SA 1GUAA 1GO2A 2V7QA 2P67A 2R6GA 3JQRA 4PXAA 4WVFA 1DDIA 5HTKA 2F9MA 5HR5A 3UMSA 5JJKA 3K09A 1ZP6A 1NRJB 3QEOA 1K8AD 4M1WA 4B43A 1E9SA 1E96A 4C4PA 2RGGA 2A2ZA 1ZM7A 2O8EA 1VQ4B 1DOAA 2WSMA 3CIOA 3PXGA 3QI2A 2W6JD 4OQMA 4BLSA 4BGDA 5DNYB 1FW6A 2ZRMA 1QGAA 4NH0A 2ZRDA 4BLPA 1E9EA 1G4AE 1LF0A 1G291 4OHXA 1KO4A 2F3TA 5E7JA 3VTKA 4Y9UA 1G5PA 3NEYA 4TTRA 4PR0A 3E70C 4TYNA 4E03A 2O8BA 1W5SA 3ICEA 721PA 1NF3A 1WA5A 2QGZA 3GEEA 2FEMA 3LXXA 1TF7A 4Y0VA 1HEIA 1Z47A 2QPTA 1AMOA 4H1UA 4BE7B 5HZHA 1Q20A 3L8ZA 3CCEB 3UATA 3RSOA 4Z1MD 4V0OA 3AVVA 2IS1A 1VYVA 3KTAA 5EP2A 1P61B 2O0KA 5L3RA 2Q9CA 2IUSA 1CRQA 4BFTA 2GEUA 4MYUA 4YAUA 4Q03A 2WKRA 4PPFA 5CJPA 4YQFA 1CS4C 2WMNB 1GL7A 2WJJA 2GEDA 5GJBA 1OKKA 3X2SA 2OLJA 2P6RA 2BBOA 2VHQA 5CJ2A 2FFQA 4ESVA 2W6IA 5DHFA 4G1UC 2QEQA 2J41A 2J59A 4ZIRB 1DDGA 4D4KA 4C0QC 1IQPA 2ZRPA 1ZNXA 2VYQA 4GZLA 3RS5A 4Q1DA 5F9HA 1TTTA 2QP3A 3ZIAD 2GRJA 4Q7JB 3AF0A 5TARA 3CPWB 5KSYA 1QDEA 2V54A 1XTKA 4B2PA 3K0CA 1QHHA 2WICA 4Y7CA 3I8SA 4M53A 1NI3A 3UKDA 4BWYA 3G4SB 1YZLA 2HMAA 1UBEA 2Y8EA 2FH5B 3GQBA 1XXHE 1D2NA 1W2BB 4OQNA 2GXAA 4JVSB 1ZD8A 3G5UA 4CRWB 3KQHA 4LSGA 4R9UC 3V00A 1RVDA 4CEHA 4JS0A 1XMJA 5C4MA 4KFTA 2W6JA 1X1RA 4QJ4A 4B75A 1EP1B 4A1FA 2DYKA 1XFAA 4EFLA 2FFBA 4XSGA 1P9WA 2QG6A 1QGYA 3ONWA 5IRCD 4C2TA 3LO5A 4NYMQ 5EJEA 1FX0A 2GCPA 3MAAC 2G1KA 1WB9A 1R0XA 2IF2A 2V7QD 1FQKA 2UZIR 5C18A 4HLDA 1KJWA 4NYIR 5DYGA 5FH9A 3GEIA 3CC7B 1IJEA 3WYAA 1E2QA 4LYJA 3OZWA 3J81k 1JA0A 1KI2A 4AYXA 4NCNA 2P0EA 5FBQB 4A4DA 2CE7A 3TUZC 3GLFE 4LDJA 1GRRA 5BQ5A 2KWIA 1NNEA 4M8NE 4IOMA 3EX7C 1ZM4A 1N0VC 5JI2E 3G71B 1F6BA 4LJ8A 5FTNA 4M1TA 1OLOA 3B1ZA 4ON9A 3TR5A 4F92B 5KSOA 3L43A 2VNJA 3H2YA 4Q7LA 4DLTA 1R0WA 5FTLA 2ZSFA 3KKPA 3B6EA 5JCZA 4F4JA 2VH5R 4KFUA 4QNRA 2DPXA 2VSXA 3WBJA 3CKLA 1A8PA 4W7SA 3WHLA 3PEWA 4FWTA 1K9MD 2N42A 2QORA 1ZUNB 5FPSA 1OYWA 1FMJA 1AQYA 2O8DB 4ZV4A 3W8RA 3RABA 2BBSA 1EFCA 2D7CA 1GILA 1G7RA 4JLNA 1VQ5B 2GDJA 1KY2A 2V6JA 4QL3A 4IW3B 3HYRA 4KSCA 1GRQA 3QJYA 3PEYA 1XMSA 2QMUA 3CZPA 2O8EB 1E0AA 1NBMA 2FOLA 3IO3A 2YHSA 2XNJA 2JJ1A 2PLFA 1CJTC 2ZI3A 2GILA 1P72A 3BK7A 3VNUA 3N5CA 2LKDA 2PT5A 4C9BA 1OPXA 3MMPA 4RD6A 2QI9C 4WXRA 1D1NA 1LV7A 4XWOA 5SZIA 4B3GA 1JR3E 1OFTA 4UKDA 2HCBA 1Q12A 1SKYE 3V9PA 1KO8A 2NZ8A 2G88A 3SI7A 4D26A 4B33A 5AJYA 1QG4A 2YOHA 1FNBA 2FFHA 4WA7A 3VX3A 3OAAD 5LBIA 2IHYA 4KFRA 5J5CA 4C2UA 1E2HA 2JLWA 3TSWA 5ELXA 1S4QA 4A2PA 3EZ6A 2WWHA 1SKYB 1G7SA 1G8PA 1SVIA 2FGKA 1A7JA 5FA6A 1IN4A 1N5JA 4M9SA 1CNEA 1NN1A 3CD6B 1XD2A 1XXHB 4ITRC 4JLVA 2PH1A 3FDIA 4EDHA 4P0TA 3IBYA 4QXAA 1DBSA 2HXYA 2V9PA 1OW3B 1Z22A 2ZEJA 4WIAA 2ZR0A 4A8JC 2HT1A 4PAQA 1NLZA 2CL6X 3A36A 1IM2A 4RY2A 5KDLA 2ZRBA 4HAZA 2ONJA 1XJ0A 3ZH9B 1X8JA 4LBWA 2O52A 3LVQE 1G5TA 1OJLA 3DOEA 1QVFB 4MH0R 1DARA 5FUVA 3RSLA 5FOXA 1H42A 1VQ9B 4HUTA 4YMWA 2QRZA 2W6ID 3PG5A 2QAGC 5EE0A 2DCUA 2Q3FA 4ZPXA 1J7KA 4JLKA 4Q1BA 2VA8A 1T91A 2JLXA 2IS2A 2BMJA 3D7MA 2CHVA 4IFEA 4W5JA 4TZ0A 1SXJD 3OIUA 4Q4HB 2CHQA 4B2LA 1Z0AA 3CPJB 4U9UA 1NN5A 1W5TA 2EFDB 3EIQA 5EXPA 1B2RA 2VNHA 4FN5A 3GFTA 2HYDA 4MRPA 4HYYA 3AUXA 4D6PA 1K6MA 3A8TA 5EQTA 3NXSA 2IYQA 2VSFA 4HB3A 5IHPA 2IYXA 3KQUA 3DO6A 1A5TA 4LRWA 2FFAA 4DLRA 4V03A 1UEIA 4KCGA 3AEZA 3ZS9A 2EU8A 3NH9A 3W90A 1E2GA 3O8RA 1CJUC 2NPIA 3EIHA 2G0NA 2LKCA 4V02A 3WRXC 3W6OA 2YWGA 5AJXA 3UANA 1DAGA 2A3RA 2RCNA 3B85A 3AM1A 4CW7A 6Q21A 1B23P 2HJGA 4URVR 1WRBA 4ERNA 4LYHA 1G3QA 4P4UA 1V5WA 3OJWA 2IYVA 5JJIA 1OXVA 2OEPA 4OHYA 1XTQA 2BMDA 4GRAA 1J8MF 1VIYA 2ZYTX 5BN3A 4RZXA 1KZGB 2BDTA 2J3EA 1D2MA 2XB4A 2XX3A 1KQSB 1E2MA 3BJIC 2CE2X 1GL6A 2GWHA 2WJHA 4DLSA 4IDPA 4Q1CA 2AWNA 1HQYE 3QXHA 4LC1A 2IXFA 3RC8A 2F3RA 4OQFA 4US1R 2YINC 1U81A 3M6AA 5D3MA 2ZR7A 3AVXA 3KQKA 4OK3A 2BV3A 2MSDB 5K8UA 4Z8YA 2ZRNA 4GFDA 1SXJC 2XEXA 1F2UA 1XTRA 2DR3A 4WOPA 2VYFA 2IYWA 2ZR9A 3C5CA 2GZAA 3UIEA 4UNSA 1XRJA 1KTVA 4AYTA 4GI7A 3TW8B 4PHTA 5DN6A 2OO7A 4GSYA 4K8OA 2QMOA 2Z83A 4XD7D 2XITA 3CCRB 3BC1A 1P62B 1KSFX 5JWHA 3VO1A 2EFEB 3GJ0A 4ZIRA 2BMFA 2A5FA 5KDOA 3NVAA 4TLDA 3CLVA 1ZD1A 1RJ9B 2XNDA 5E7IA 4GMXA 3OF5A 1P7CA 1R0ZA 3LD9A 4AKIA 3OE7D 1KI8A 1O3YA 2QAGA 1DAKA 1RC8A 2BWJA 3HDTA 3H0KA 4KLZA 1TEVA 8OHMA 4TYWA 2CCJA 1OH7A 5KOYA 4AYWA 3KFXA 1E98A 4S2EA 1MOZA 2YZ2A 3ZGXA 4LCBA 1W4RA 1E79A 4TTPA 1P2SA 3G6EB 2FWRA 5FUYA 1XWIA 2A5GA 3MFYA 1SGWA 4Q01A 1EFTA 1LFDB 4AD8A 1H8HA 1YHNA 5FUXA 1UM8A 1P9RA 2VP9A 3TR0A 5LPNA 4HZIA 2MSEB 3H1TA 2QT1A 3A58B 2QMHA 4JMPA 2XSZA 3U4QA 1OIVA 3UWOA 5GJWC 4JL6A 1JI0A 2DWPA 3T12A 1M1YE 2ODBA 4MDFA 1W1WA 4MRRA 4B3BA 3KZ1E 5IDVA 2N46A 3KUCA 3TLXA 3PITA 1CTQA 3ND9A 5KPJA 2NQ2C 1LS6A 3M1IA 5AJVB 4Q1EA 3U3MA 4EH1A 2ZRAA 4KVAA 3NBYC 3X1XA 1OF1A 2H5EA 5HCNA 3VR2A 4I81A 4LC0A 3B7GA 5LB2A 1H8ED 4CEHB 1OXUA 4URUR 1RIFA 1KKMA 1UJ2A 4KSBA 3M4YA 4C0SA 2R65A 1KI6A 5KSWB 4P33A 2BJVA 4HDQB 3VKWA 4A82A 3IIJA 2JLSA 2FMXA 4LHWA 1AGPA 1SVLA 4PAMA 5CITA 2ANCA 1OYYA 3AGQA 1H8HD 2F43A 4D82A 3SFVA 1QHIA 5LDDC 3B78A 1LVGA 5DSZA 1U8AA 4LJAA 1F2TB 5H8WA 1IN6A 5EUMA 3OZVA 3DEFA 3GLGA 1U98A 3C16C 1W47A 3NBZC 1K5DA 3GMTA 1E0JA 3KKQA 3K9HA 4EKDA 1XZQA 5L3QB 4AF6A 2QPAA 1E2NA 3TE6A 4Q9LA 4DXAA 1XPOA 3CNLA 4AG5A 2P5TB 4GBMA 4JSTA 5DLQC 2IYSA 1YJ5A 4V0MA 2C98A 3L0OA 3AGPA 2ATVA 2XNDD 3RHFA 1IXRC 5DI3A 1EWYA 2F9LA 2VEDA 3GD7A 3HU2A 4JSYA 2QTFA 1TQDA 1UF9A 4ZKDA 1NMZA 3E5HA 5SZKB 4LHZA 1OH8A 1CEEA 3GLIE 2Q3HA 4PPNA 4CEJB 2WKPA 1YIJB 1MO3A 3GLFA 2FNAA 1UDXA 2WPDA 4LV6A 3NC1C 3I62A 2GAOA 3Q3JB 2ZSEA 4GNKA 5KPDA 4NL4H 2O8DA 4GP6A 2BIFA 4RKEA 3UPUA 4DT1A 1WCV1 3CCSB 1W0KD 5C4GB 1E2EA 1OT3A 1DAEA 3W34A 2BBTA 1SVKA 4OHWA 1KHTA 3CCQB 1LS1A 2BOVA 3VAAA 3QKUA 3DM9B 5FOTA 3BXZA 5B57C 4ACBA 2F1RA 4UNNA 5JCPA 4G1VA 2Z0MA 3CZQA 4CF7A 3VMFA 3THWA 3NIBA 1N6RA 2QSZA 1U9IC 1ESNA 1P6XA 4OKSA 4PSKA 2BKEA 1R10A 5JWOA 1YI2B 4M9QA 3W9YA 4A15A 1T5IA 1TQ6A 1JAIA 1JA1A 1W36C 2GF0A 1E9DA 1G17A 2ASEA 4AF7A 1R0YA 1XXHA 2P2LA 1XMIA 2V4ZA 5FI1B 3LVRE 1KKLA 1E4YA 3BH0A 3VFDA 4EPRA 2O8FB 3A1UA 2G83A 3Q7QA 1IOZA 2P6NA 2P65A 1EESA 1X6VA 4TQAA 3CCVB 3HPRA 2FDCA 3CNOA 1FPMA 2IX3A 1E1RA 5P21A 3EA5A 4A0GA 4HUQB 3U5ZB 2L0XA 1SVSA 5JBQA 3I73A 1OFUX 2IC5A 4PQRA 4TQ9A 1YU9A 2KB0A 4JLJA 4LK2A 2WWYA 1XEXB 4US2R 3CF0A 1WMSA 1QFZA 1KDTA 1OKKD 3KDSE 2IS6A 1D5CA 1E1QD 3DPUA 4GDFA 3QF7A 4DDWA 3R8FA 3R20A 3LBIA 2OE2A 4OK5A 2YYZA 4LHYA 5SZJA 1G6HA 2VIIA 4WXPA 4CEJA 3AF4A 1AS2A 3SFZA 2ZPTX 4N1AA 1VPLA 2WIAA 4OI0A 5JS8A 1E94E 5BN5A 3WBKA 2OCYC 1FQJA 4I1SA 3BAFA 2AKAB 2DERA 5EZ6B 1TEXA 1BS1A 4HB4A 1AZSC 1XBTA 1NVWQ 4Q18A 2YKGA 2I1VB 1TNDA 1UKEA 3AKDA 3F3YA 4R7ZA 5EP4A 4LBZA 1DG3A 1YKSA 2VPPA 4IDOA 1HT2E 5A4JA 2IF0A 4YC7A 4HSEA 1H8EA 3IEUA 1GVHA 3A4NA 4A2WA 3FB4A 1IY0A 5C46F 2BF4A 2F1HA 3AV0B 3LLUA 1CF4A 2ORVA 1ZNZA 2ZM5A 4QHSA 4JLPA 5JSZB 1Q0UA 2I4IA 3SJBA 1AIPA 3K09C 1ZINA 1VDZA 4YMUA 1OGJA 4G01B 4DSUA 1DADA 1GRNA 3QQ5A 4DUGD 2GJSA 4A9AA 3ZVMA 2GZDA 4DQKA 4M1MA 3O47A 2PBRA 1HE8B 2CEAA 5CYPA 5HE8A 1VQPB 4BLQA 1HYQA 3O8DA 3WMGA 3QUSA 1BH2A 2WIBA 3FKQA 3DMDA 4D0LB 1CJKC 4UXJA 421PA 3NBFA 1F48A 2GXSA 3PEUA 1WQ1R 4GMDA 4PANA 2WSSD 1JR3A 2B92A 4HB2A 3DKVA 4IVRA 4HLUC 5JJLA 4Q7MB 1E79D 2GJKA 4ACAA 2OBNA 1R5NA 4QBGB 1FMLA 4QJ3A 3KJIA 1S9DA 1DAMA 1W4CA 4C0AC 2J0VA 2AX4A 3GLHA 4E22A 4ZCLA 2KE5A 4UNQA 3TAHA 4F93B 5J4LA 5M04A 2HT6A 3EASA 4R2IA 4AY2A 5H59A 4LJ6A 4PSVA 4DDUA 1P2VA 1GKIA 1M7HA 3W6NA 2YNMA 1VQKB 1GSIA 4DT1B 2C9OA 1RRCA 4M9ZA 2PT7A 3C4JA 2FSFA 3HJNA 1BX1A 1YZKA 4GP7A 2DFLA 3TW4A 1N6OA 4M1OA 3CMEB 2EVWX 4FCVA 4A8JB 2HDNB 2PJZA 5J47A 3D8BA 3TVTA 3I92A 2FV8A 1IJFA 3QPVA 3AH8A 2QY9A 1E1RD 1PLJA 2BC9A 3REFA 3SU8A 1FFHA 5KNBA 2QTHA 2E1RA 5DYIA 3QFSA 4PO1A 1VMAA 2XTZA 4H9GA 4FMBB 4NCKA 3QF4B 4U02A 4PC1A 3ADBA 1NMYA 4JZKA 2D7DA 4YXWD 1Z6TA 1XE1A 1KO5A 2C2HA 3BGWA 1NIJA 3AQ4A 4JJZA 4HE6A 2H17A 4BLTA 4G5GA 3KQNA 2FSHA 3K53A 3IPYA 2NOAA 3CRVA 2GF9A 1U2RA 3EAQA 3FKSD 5EUQB 1KRHA 5G3YA 1YZNA 3U60B 1MR3F 1E0SA 4JVLA 4LHXA 2PIAA 3AKYA 1CRPA 4EPXA 5BW8A 1G1MA 3HR8A 4HUQA 1T0JB 1E4VA 3CB4A 1M74A 3C15C 2ZU6A 1RYHA 3THOA 3W3ZB 4LV8B 2PLRA 1ETUA 2FE4A 1F20A 4EQ6B 2FJUA 3FMOB 5EXTA 3SE0A 4IOKA 1GZSA 1ZNYA 4BLOA 4URXR 1QRAA 1C4OA 1KMHA 4U5XA 1XCMA 4IDHA 1PVOA 3W5HA 4I4LA 4JYBA 3SJAA 4M22A 1KNQA 1GAWA 1WE2A 3WNDA 2G77B 1E9BA 2DWOA 3GJXC 3CRZA 2ERXA 2C9YA 1QHHB 1U94A 4Q1FA 2GBLA 2JAQA 3B9QA 4TLBA 1KO7A 4CDGA 1E2FA 2J7PD 2ZQ5A 2J7KA 1VG0B 1NVXQ 4JIMA 5HKKA 3RS3A 3KFVA 3FWYA 1KSHA 2QP9X 3Q9LA 3U3KA 4PAOA 4P4SB 4TZ6A 1YR9A 2O5VA 2JIZA 2ZE7A 3SQWA 3KJHA 2IS4A 1NVVR 2VNKA 2Z5FA 4MYCA 1Y63A 3SYKA 2YV5A 3FOZA 3QG1A 3FVQA 4C7OA 5TV2A 3NHBA 4AK9A 5CB6A 4LYFA 1SVMA 3NWJA 3OIVA 5GV7A 2AD1A 1SKQA 2VZLA 1Q1BA 2REOA 2Z6VA 4JBYA 4QGAA 3RDPA 2A5JA 1N0WA 2H1LA 3JVVA 1WP9A 2JLZA 3CX8A 5BXQC 3N2IA 1Z8FA 1M90D 1SZPA 2P5SA 2RC6A 4D25A 2Q0HA 1UPTA 2E9SA 4BFWA 3KB1A 4ARZB 2QENA 2AXNA 2ZRFA 1Q3TA 4ZKEA 2WMOB 4UXHA 1HTWA 3I72A 4CYMA 1IN8A 1YQTA 1TF2A 3MJRA 3TUJC 1YR7A 4F91B 3OEEA 5DH9A 3R7WA 3DDCA 4PPGA 2JCSA 1RKBA 4RCYA 1NJID 4MUAA 4FK8A 2GZHA 3CUEF 4I1UA 4WBSA 2JASA 3LV8A 2OG2A 3V76A 3GLFB 1KC8D 2Q6TA 5IF9A 1ZIOA 3QVVA 1VYUA 4HAYA 1XPRA 1J2JA 2HF8A 3BB1A 1IXZA 5FL7D 3UK6A 5L3QA 3SJZA 1EWRA 3GFPA 1Z2CA 3OAAA 4TL7A 2QBYA 3QIAA 3AUYA 3QSYA 4HAVA 4PFSA 4UJ5A 1F2UB 4LPSA 2IWRA 4NPHA 1FUUA 3IEVA 2AR7A 2R62A 3ADKA 1XMVA 4TLCA 1LTQA 3T5DA 2K5UA 1MO5A 4A0FA 4BASA 4PHFA 3OHMA 2QN6A 1P5ZB 3AVWA 4LUCA 1Q44A 1CKEA 3RS0A 5JHGB 3IKJA 1RZ3A 4FXPA 2WV9A 1N5LA 1ZCBA 2RGNC 3EWAA 3B82A 2GA8A 1GVNB 4MKGA 2VP6A 3VKGA 3O8BA 2AFHE 5KTYA 1E99A 1ZRHA 1N6HA 1DEKA 3HWSA 4K1XA 1DELA 1GITA 3CH5A 5AUPB 2CLSA 3T5GA 1ZUIA 1G6OA 1KIMA 2MMCA 4D4JA 4KFSA 1P9NA 2NO7A 3OE7A 4YDHB 4JBWA 2JJ2A 1A82A 1X1SA 3ZJYA 1SXJB 4X8MA 4AG6A 3RWMB 1OSNA 2ZI4A 1KI3A 3OZXA 4QOSA 3QY0A 1OXTA 1Q1EA 1FL9A 2OAQ1 3KKOA 5F98A 4MRSA 4PZZA 4F7DA 2ONKA 1T8TA 2DEUA 2R44A 4XVRA 2OLKA 1W36D 1NKTA 2WJGA 1XB2A 3TSZA 1UMKA 1U9IA 4DSOA 1NL3A 1O87A 3PR1A 4F4CA 4C0JA 5J4HA 3QBTA 2QE7D 2W0SA 4OK6A 1E6CA 5FBLB 5DISB 5CDFA 3HYTA 1ZYUA 2Z4RA 1G9XA 1KOFA 3A37A 3MHPA 5JFGA 2OXRA 5JZVA 2GETA 1DAHA 2DB3A 4OI2A 3Q5EA 4JVMA 4FMCB 4K46A 3OIWA 5CYOA 3ZQJA 3CRQA 1HV8A 3LBHA 1TADA 3EA0A 4DB2A 1FUKA 2RGBA 4DLYA 2FGJA 1TPZA 1G64A 2VHTA 3PUZA 4DKXA 1E2LA 1FRQA 1IY2A 1Z29A 2GXUA 3CRRA 5CLQA 4EPYA 4Z54A 2OZEA 2H16A 4G3XA 4L8GA 1W87A 5G40A 1AK2A 4C7OB 5FPYA 1Q22A 1DO0A 1G8HA 3LH5A 1VQOB 4QHTA 5FBRB 1ZU5A 2ZREA 4DCTA 2OFXA 3GJ7A 3CF6R 4QM7A 1JECA 3RANA 1JNYA 4C30A 2I3BA 2EIXA 1CLUA 3CRMA 4B48A 2CJWB 2FPMA 1Q86D 2FZLA 1ANKA 3PIRA 1US8A 1QF9A 3EC2A 1OH6A 1I2MA 5FI0B 5EE9A 1NKSA 3P1JA 1LF5A 1MH1A 2PZEA 1XX6A 2RC5A 1D9ZA 4TMKA 4KVGA 4C0BA 5IK2D 1II9A 2RGEA 1U0LA 3CW2A 4B4DA 4IEIA 3VR6A 2C78A 2B5OA 1AM4D 1S9HA 1QUFA 3UG7A 1GJRA 4B47A 3W2EA 2D4HA 2FSGA 2BGJA 5H1YA 1HURA 2D06A 2RAPA 4ZDJA 2JLRA 1LW7A 2ZI7A 5KO2A 3T15A 3A4LA 4KV9A 2BKUA 3FHCB 2Q9BA 2A5YB 1L8QA 2WAYA 3GCGA 1SQ5A 4Z51A 2GHIA 1T3LA 4BQSA 1I4TD 5E3HA 1IY1A 3ZC3A 4QNMA 1WXQA 2IYZA 4MYHA 4TMXA 4XVUA 1CNFA 3EPJA 3KQLA 3ZZUA 2J5XA 1GL9B 4CVNA 4AKHA 1CR2A 3ZDQA 5H5JA 3P4XA 2SHKA 1E2DA 4EJSA 4RCZA 1Z6XA 3SDZA 3PENA 2BGIA 1YRBA 2EYQA 2ZSBA 3BFXA 1SULA 4B76A 3W5JA 2XTNA 2J45A 1F60A 4ZCIA 3U6KA 1CJMA 5E95A 3ZVNA 1SHZA 3LX5A 2OM2A 2WOJA 1AS3A 1XEWX 3U7EB 5DI3B 2WWGA 2EWVA 3LBNA 5KSPA 4L5BA 1RE0A 2ECKA 3G0HA 3SC3A 2VHUA 3Q5DA 2F6RA 2GESA 3Q8XB 2O8CB 1FOEB 2CCGA 2EW1A 3FHTA 1RRGA 1Q3HA 2J0UB 5BYJA 2OFOA 2JGNA 2VF8A 2ZVPX 1K8RA 3CM0A 4NHOA 4HLUA 2ZJZA 4N3NA 3QKSB 4ASUA 1ODFA 4ZDIA 1T5LA 221PA 2PCJA 3G82C 2PCLA 4JT4A 2BM0A 3LW7A 1R8QA 3SZRA 2OFWA 1KSGA 1PJRA 2CVHA 1GTVA 2ZSAA 1XD2B 1L4YA 3KUDA 5TB5A 3KJEA 3ZS8A 4D4LA 4WZAE 3IHLA 2PZFA 3OEED 2RH5A 3NH6A 3VU9B 4TYQA 4DWJA 1E63A 3OEHD 4ZO4A 4LYAA 3AVUA 4LX0A 4FMDF 1K73D 2HV8A 1OGIA 3CCUB 2HEIA 1GWNA 5D3QA 4MRNA 2OESA 4P4SA 4NYJR 1YJ9B 1KD1D 1XJQA 2ZRJA 2ZUCA 4PQYA 4TL6A 4URWR 1N25A 1DS6A 1JBKA 4WZ6A 3CNNA 3X1YA 3SS8A 4IOLA 5LB4A 4CZ2A 2YVUA 2EQBA 4PPQA 1GKYA 4X8OA 4EPWA 5JMTA 1JPNA 3QG5A 3TMKA 1VG9B 2H7VA 2CLDX 1R5OA 1U8ZA 1N3BA 2Q9AA 1E0KA 2ZJAA 2XZOA 2N1BA 4L9SA 2CL7X 1T0HB 4V0ME 4DEYA 2AFIE 1UEJA 5IK2A 5JI3E 4EFNA 1QBKC 3NDPA 2PX0A 1UBGA 3LQQA 5KNDA 1DAFA 2WTUA 3BBPA 3DVLA 3CCJB 1OHHD 4L16A 2GJ8A 3GLIA 5J4YA 1W48A 5HKKD 1G3RA 1ZUHA 5B2ZA 5F2EA 3ES9A 5CDFE 2ZRKA 1RW4A 4B44A 2IUTA 2R8RA 4MA4A 5CIQA 3TK1A 1N6IA 4G1BA 4EFMA 2B6HA 4RSGA 4F4IA 3IBGA 4MKIA 3IO5A 4AC9A 3U2QA 4YLGA 1XDBA 2YOGA 4ZGNB 3B2EA 3FGNA 3RWOA 3KXLA 1E3MA 2QAGB 4DJTA 3EZFA 1OE0A 2J46A 3R9XA 3ND8A 3CWZA 5THXA 3W5IA 2PEYA 1S72B 5C2JB 3BB4A 2V6IA 3LVBA 4Q00A 2ZXUA 3TH5A 1Z5ZA 5FPHA 1KAGA 2KI5A 4TMZA 4X8LA 2VP0A 4RD2A 1R4AA 4UAJA 2JATA 3FPKA 2R6HA 2W2TA 1OHHA 1WF3A 2G1JA 1FNMA 3K0SA 5FTJA 2IW3A 2XJ9A 2D3WA 1ZD9A 3ASYA 5DE3A 5TY0A 2BM1A 2REXB 1GR1A 1JAHA 1VKJA 2FPKA 2XZPA 2F7SA 3B60A 2HUPA 2QM8A 4YXWA 4H1VA 4RVCA 4BFVA 1ZU4A 4GOKA 2QDXA 4C3ZA 4D2IA 5BWMA 3P26A 4DLUA 521PA 3U3RA 1J9ZA 2VNIA 5EP3A 2V8OA 4AURA 3NEJA 2ANBA 1W34A 3LA6A 5TXGA 3CPHA 2W2VA 3T1TA 1G3UA 4Z1MA 1E2IA 2LWIA 2GEVA 1TUIA 1FNNA 3AF3A 2OCPA 3W3AA 3WRYC 1ZVQA 1N6KA 3GJ8A 4FIDA 1SHKA 3MWKA 2ZANA 3IUYA 2GBLC 3L0SA 2W58A 3LQRA 4QFMA 2WAXA 5CB8A 3TNFA 1L4UA 2ZRLA 3TKLA 4LBVA 2UZ3A 3OFNA 2JJ2D 1FP7A 4IFBA 4OJQA 3RVBA 3LRPA 1JB9A 4DSNA 1COWA 1N5IA 3PVSA 1VQ7B 3SN6A 1OFHA 1NVUQ 1QFYA 3IGFA 1XTJA 3RLFA 3B1WA 1CR0A 1Q1QA 3I32A 2FEOA 3S1AA 2GK6A 4AWXA 3BH6A 5EP1A 1ZCAA 4TQUS 4Q4LA 4RFVA 4YMSA 3WP1B 2GXQA 3RRYA 1DTSA 1JEDA 2JLYA 4XSHA 2GNOA 3QVUA 4CT4B 2J0QA 1Z83A 3VNVA 4KJZA 1VYTA 1GIAA 2A9KA 4RD0A 4JLAA 1CU1A 2D2FA 1YR8A 2B7CA 2C96A 3EIEA 4LPKA 1KY3A 2V55B 1SVOA 3LY5A 4EAQA 4YMVA 2BEJA 5AJZA 2ZAOA 2FN4A 3ASZA 4RD4A 4KO8A 5CM8B 5HCIA 3R7WB 3ZD6A 1EWQA 5JLJA 1QG2A 3GLHB 4WZBE 3DL0A 3SBDA 1KMQA 2NZJA 4IOJA 1T4GA 2RHMA 4QBFA 2YC4C 5FL7A 2GAAA 5ANRB 5CK4A 2EFHB 1FTSA 1BQEA 3A6PC 2QQEA 2VP5A 4RZ3A 4D0GA 3Q7PA 3HU3A 3CR7A 2QL6A 1NN0A 2GJAA 1M6NA 2OCBA 4KYUA 2ZRHA 4TWZA 2NPFA 2XNCA 1COWD 1OFIA 1QHYA 2QNRA 2P6UA 3T35A 3A1TA 2X2EA 3MJHA 2OTJB 3CR8A 4Q9HA 5JS7A 1ZM3A 2CNDA 1NBME 2BPOA 2NO1A 3CC4B 2KBEA 3FHOA 4ZI2A 4QHYA 5H70A 2KBFA 3HR7A 5EZ5A 4W9MC 1S3GA 5G53C 5JRZA 3UXMA 3MG9A 5KYKA 1AQUA 1SXJE 4QM6A 2C5LA 1E9RA 3BIFA 3IHWA 2WOOA 3P4YA 2J9RA 5H68A 2QA4B 3Q72A 2JLQA 1YR6A 2UKDA 3K1JA 1H85A 2NO9A 2OBMA 3QE0A 5E7MA 3QKTA 4WW0A 2R6CA 1Z28A 3U44B 1AS0A 5TMPA 1UKZA 4ILEA 1NJFA 3A1WA 2VO1A 2RHDA 2ZI9A 2XXAB 5EXXA 3NTUA 121PA 5JEDA 4HEJA 1Z0DA 1W49A 5BYKA 4YALA 1ZC3A 2JIZD 3I5XA 4DCUA 1U90A 1A1VA 1X3SA 2X19A 3WYFA 4G5RA 1MO4A 1HUQA 4DB4A 4UJ3A 1S3SA 3MCAA 4NKRA 4A0RA 1KJZA 1W44A 4W5WA 3CX6A 1TUEA 4TT3A 3TGPA 4S35A 2NMVA 4N3GA 2XOKD 5FOUA 3DM5A 3R9IA 4C0HA 1M8PA 4X8HA 4B6FA 1Q82D 1W0JD 4RD1A 4DSTA 3BD9A 4HAWA 1NP6A 1GAQA 3WXMA 3QPUA 1MRNA 1P60A 1XP8A 3X1WA 4B73A 3A1VA 1P75A 4G5SA 1N6NA 3GJ5A 1G8GA 3VKHA 1KK0A 4OL0A 1I4LD 4XVQA 1JQJC 3TIFA 4TMWA 1A2KC 1T3HA 3RS2A 4Q4JA 1EFRA 3GEHA 1T3SA 4NYMR 2MMGA 1CXZA 5AJWA 3LLMA 3VO2A 1JR6A 3CONA 1M7BA 2ZJ5A 2ZYWX 2QSYA 1YJWB 3IPXA 2JEOA 4JL5A 3LXRA 1GNPA 4KBFA 5L8VA 4GOJA 1NJGA 3U7HB 4M1YA 4RFSB 1W4AA 2AD5A 5E4FA 3KL4A 4DC9A 2ZYUX 5FOVA 5GADl 4Q19A 5D3MB 3SNHA 2AXPA 4UNRA 2KSQA 3FYHA 1D9XA 3I5YA 3K9GA 2OBLA 4DVGA 1HH4A 2BN4A 1G7CA 4ZDWA 1A2BA 4LHVA 3U44A 1KI9A 3EWSA 1Z08A 2WWWA 2ZUBA 4BEBA 4URYR 2WPDD 1MRSA 3C41J 1OH5A 3QKRB 2ZS9A 4QGGA 5L3VA 4JYCA 5FBVB 4FI3C 2ZIAA 3REGA 4R2HA 1T8UA 5CLLA 3QKSA 2RGNA 1YITB 3CWQA 2X2FA 4YAFA 2CJWA 1ESMA 4MYTA 2AK2A 4TSFD 4L4UA 1D8TA 3RRMA 1BYUA 3PV0A 3X1DA 1Z2AA 1KI6B 2OTLB 2JDIA 3BOSA 3NBXX 3THYA 1KSJA 4L15A 4JLOA 2FSIA 1XU4A 1TVCA 1YZGA 2BHRA 2OK8A 2HF9A 4F7WA 5EMNA 1ZC4A 4UQOA 1FP6A 3ZZ0A 1RRPA 3C14C 5DIFA 2VRWA 1KJYA 2VF7A 3GJ6A 3IDQA 4MGZR 4D80A 4OBEA 4OQXA 1BX0A 2HLDD 4Q4JB 2O0JA 3FJOA 1ONBA 1OIXA 2RGCA 3OESA 5GJCA 3QBVA 1KO1A 2WHXA 2ZRGA 4Q48A 2IYRA 1UKVY 5SZHB 2PZGA 1N2CE 2GJ9A 4BECA 4Y9RA 3DOFA 3AP1A 2WWFA 3SR0A 1LB1B 5J4KA 5KHOC 2PMKA 2ZITA 4YONB 3B1YA 5L3SA 2W83A 1M1KD 2ZETA 2VLIA 3EARA 3CPEA 4FMCF 1H65A 5F3WB 2DFNA 4PO9A 1RYFA 2XOKA 4BRWA 1CJVC 3EZ2A 2C99A 4IVQA 2OK7A 2IT1A 3IQWA 3K0FB 2D2EA 2OAP1 4V0LA 4TN1A 3FE2A 1PZNA 1W36B 3VR3A 2CK3A 1KI7A 1UKYA 1EGAA 1G20E 2CMKA 4KODA 3VQTA 4KITB 3EXAA 3ECCA 3P20A 5KDDA 4XTRA 3L0IB 3QPWA 2R6DA 4I1VA 2QGNA 5AWFC 1VCIA 1S1MA 5B58C 3R9WA 2GVZC 3LO8A 1EP2B 1R2QA 2YWEA 4BEJA 4E09A 1QHSA 3LX8A 3NG1A 4XJXA 4C43A 4FCWA 4YAOA 1TF5A 4NCIA 5DHAA 1FTNA 3AVOA 4ZI3A 2BMEA 2PL3A 3MD0A 3GLGB 2QP4A 3SYLA 4YDSA 2ZUDA 3UWKA 2BVNA 1VQLB 2ATXA 3WNBA 2IK8A 3MWJA 1R6BX 3RS7A 4PC3A 1LNZA 1J8YF 1P2UA 1S2MA 3DHWC 4I99A 2A5DA 1G5RA 4WAUA 5A0FA 3JQQA 1TU3A 1I7PA 2FG5A 3UG6A 3ZD7A 2W0MA 4AKGA 1VQMB 4Q9KA 2C03A 3CBQA 4EQ6A 1F5NA 3TQCA 1C9KA 3TVDA 3AVQA 3H86A 2G0TA 1BJKA 3LAWA 5HPYB 1P3JA 4HB0A 3EC1A 5AN9A 3AF1A 1IONA 2CK3D 3KXKA 3E20A 4CIDA 1Q21A 2EFGA 5DN6D 4PO8A 1W2GA 2J7PA 4M4SA 4RJLA 2ORIA 1DG1G 2QUZA 2GTPA 4F38A 5FPKA 3P27A 4NZYA 2JLUA 3BERA 3K70B 2AWOA 3K9NA 2WZQA 1L2TA 1XTIA 3SBEA 3SYNA 4J0QA 2WM9B 2ODWA 2YJTD 1YJNB 1BOFA 2QTVB 1XZPA 2VHJA 2XJ4A 1VHLA 3ZVRA 2C9CA 4Q4HA 5JEEA 1BKDR 2J87A 4NE2A 3W6PA 5UKDA 1S1CA 2EWWA 3SOPA 3B1XA 1QGZA 2QBYB 1XTSA 1TLLA 1JALA 1IHUA 3KKNA 1WBBA 4OYHA 4KHZA 1KK1A 3FTQA 2QRNA 3PEVA 3MLEA 2XGJA 5GVSA 2A30A 2QM7A 3EZ7A 4FD2A 5AUQA 3THXB 2CRVA 4D81A 4EJSB 3I56B 3QE2A 2QU8A 1JXOA 4KBGA 4XH9B 3U3OA 1Z6GA 2IXGA 3QXXA 2AKYA 1MABA 4JKYA 5TR9A 2A78A 4N0DA 2JDID 5JHHB 4BFUA 2RGXA 4HDCA 1AZTA 1RJ9A 3LWNA 2NGRA 3OFND 4GZMA 2Z43A 4HZUA 4KI0A 4M1SA 5DO9A 4JLBA 1XJCA 2NO0A 4ARZA 2AHOA 2TMKA 4M0LA 1NY6A 1X8LA 2WJVA 3QOFA 2D62A 2DWQA 3ZLJA 1E62A 1TX4B 2H57A 3DZ8A 3FMPB 4A92A 3ICQB 1EXMA 1N6PA 1XD8A 1Z07A 2R6AA 1RFLA 4UNPA 1XPUA 3K9LA 1Q81D 4KYIB 2QQ0A 4FW9A 1W7AA 1TAGA 4R71A 1S96A 4V0KA 4XOIA 1HA3A 2IYLD 3EG5A 1WBDA 1QZXA 1SXJA 4JBXA 3M0EA 4B3XA 3GP8A 3EPKA 2FX3A 4P6VF 4II7A 3RYTC 1GFIA 3Q85A 1M2OB 1GG2A 4MGYR 1Z0KA 1TL7C 2AN9A 1QVGB 2FU5C 2YWFA 4IHQA 4WQMA 2OCAA 3B1VA 3QENA 2HYIC 3A1SA 3QXJA 1NVVQ 1XD9A 4PX9A 3AVYA 3BS4A 2QTZA 1BO6A 3EW9A 4HATA 4DRZA 4DQLA 4NYJQ 1GM5A 3E1YE 3UMFA 4B3DA 1EFRD 2WSSA 1MKYA 1BMFD 2RKOA 1QHGA 4PHHA 4XTCS 2XTMA 1IN5A 3CH4B 4DZZA 1R5BA 2ORWA 1I2DA 2WVJA 1MT0A 4LBYA 2RGDA 1JPJA 4Q5IA 3KKMA 2FF7A 3R8CA 3A4MA 3ZIAA 3RAPR 3CO5A 3U7FB 1P73A 4DUGA 1YRAA 3JVUA 4IDNA 3WYGA 4MGKR 2B8TA 4UXIA 5EE3A 5FR1A 5FTKA 4FMDB 1FNDA 3C7KA 4HI0E 1HQCA 2PX3A 3IIMA 1VTKA 3PUYA 3WP0A 5LD2B 1SM4A 1Z3IX 4XIGS 3QFTA 4QKQA 1GDDA 1NDHA 1NSTA 2V1XA 3BFVA 1EX6A 4M21A 3RRNA 4IJMA 2IYYA 2WKQA 2YOFA 3MRSA 1K5GA 1T6NA
chains in the Genus database with same CATH superfamily
4FCTA 4IZHA 4ZI7B 4ZO8A 1NG9A 4C06A 4YQZA 4QEZA 3W2FA 1DIRA 2Y1GA 4D92A 1I7LA 2NTYC 2IPOA 2JJ8A 1M66A 4OB6A 5JDIA 2NVUA 3V4VB 1NY5A 4PZLA 1T0PA 3TLZA 2WD7B 3BB3A 3UXHA 1U99A 4FKMA 4G89A 1ADBA 2RE8A 3RAEC 5BWNA 4YB8A 4MIKA 1XRSB 2IA5A 3HSYA 1O1YA 1FX0B 3CF2A 1K7YA 5LM3A 4QSHA 3PYLA 3TSYA 4TS9A 5KKAA 4B71A 2CXRA 1MB0A 3WGNA 1E9FA 1BS9A 4RIGA 2ZTUA 2RCYA 3RYHA 3BH7A 4P3IA 2VR1A 5C7YA 4X7RA 5L51A 2AL7A 1KZ7B 1QX4A 1QYCA 3TBHA 1KAOA 2GVDC 2GPBA 2FK8A 3WFJA 2WJIA 3JYLA 3L7JA 3M6UA 2VJQA 4FE4A 4YP0A 5FPQA 4HLQB 3OEHA 4EB3A 1UFOA 3DFIA 2O8FA 1IM8A 2XHEA 3U7GA 3RLIA 3QXSA 5TNXA 3GGDA 5I9LA 4XYBA 1QNFA 1T3GA 1GNVA 2FPWA 4D4HA 4JJKA 4L8LA 5FUWA 2O20A 5ENDA 5AR1A 3PIIA 4PGGA 4X41A 4Y6LA 4B4OA 2H2AA 3NT4A 4OMCA 3PUNA 2OBBA 2PMWB 4XB2A 4EL0A 1IUKA 3ONEA 1RD4A 5CPFA 2ZS7A 4HX5A 4B9AA 3N0VA 1I7QB 2IKSA 1JYFA 3SM3A 3AI3A 3ZY6A 4V1CB 2Z6QA 4N39A 2BBWA 5JLAA 1Z39A 3DXYA 2O2DA 3RSSA 2CHEA 3HI6A 1RQ7A 1HOTA 4YWJA 1UBCA 3VHLB 2AYXA 4NSNA 3F6PA 3KB2A 2Z8YA 2AMLA 3CC2B 1PEKE 3SXPA 1JEEA 4EHNA 1IXSB 1J70A 1V45E 2FPUA 3VR5A 3I1FA 3WMFA 4TZTA 3BRWD 4OHVA 1UANA 1NVGA 1TZMA 2FA9A 3G6WA 1A9QA 3IQXA 4G0MA 5LMCA 1E2BA 1XQ6A 5AK0A 1BMFA 2VJKA 1G16A 4PZCA 3U61B 4D0NA 3GWGA 3ZXIA 2HLDA 1UQTA 3OFKA 3NHSA 3DEKA 1ZJ6A 3CVOA 1G21E 3AUTA 3BMQA 3MOIA 5FOWA 3HB7A 1J06A 3U3KA 3GJ3A 1EG2A 4KQEA 1AMNA 1EUDA 1WUTA 5LQMA 4X7DA 2OKCA 5EHQA 1C9YA 3ZYCA 5LD2C 1ZQ1A 1P7YA 5HF9A 4K03A 1L5GB 4A91A 4CL0A 1PD0A 2D8MA 5IT5A 1KERA 3WY9A 1KTIA 1KFEB 1DLJA 3FPAA 3JQAB 5L45A 4LJ7A 3O3MB 4R1QA 1W0KA 3BWDD 4OLFA 4A26A 2HSZA 3NZEA 3WKDA 1FP2A 1EVYA 4JKIA 5K6TA 3QKWA 2PUBA 3FM9A 1VHTA 4Y2JA 2A6PA 1O89A 2J67A 3MJSA 4FWIB 5G41A 4A0HA 5HIKA 5JAMA 3T61A 2C61A 3IOMA 1ULZA 3BFKA 4KDRA 4RKFA 3ROTA 4DBLE 3WDSA 3DAGA 4LQLA 1FDRA 1CUHA 3VYUB 1YFLA 3JQGB 1AUXA 4PLVA 4ZO7A 1V9CA 4O5AA 5CM9C 5EHZA 1GQQA 2XUIA 3OIFA 3ANXA 3AR7A 4BUJA 4TMVA 5JUWA 2ZE6A 4OQLA 4HQNA 5CK5A 1LJLA 5JVDA 3S55A 1Y80A 2PKWA 4HN4B 2VEOA 1MZPA 4LZPA 2XGSA 3EXHC 4YRDA 1D8AA 3T1QA 4FM9A 4QPJC 2H63A 5BWCA 3R75A 3S2GA 1GNTA 2AK3A 3HNRA 3KSMA 2AJDA 5J2TA 1Y8ZA 4N48A 1PU2A 4XX1A 4UDXX 3P9SA 1RXVA 3UMRA 3SG0A 4B6OA 4EW1A 3Q8MA 3JAWB 3S28A 2C95A 3N2GB 1SXPA 2BFFA 4DLXA 2GD6A 3CCLB 2WIFA 1TM1E 5JD4A 3GPBA 4BO7A 3HB4X 5E6TA 1G18A 3QLUC 1HE4A 2P1ZA 4KLNA 4J1NA 1M2NA 3H11A 2J0UA 1TK9A 5G4KB 4B2IA 3NHLA 4ZV7A 3F5SA 5K20A 3TFWA 3GFRA 3QA3E 3TQHA 4QREA 4ALIA 4KIUA 3NYQA 5BSKA 3OJFA 3JWHA 4Q3CA 1ZMXA 2WILA 2RHCA 4URZR 1TM2A 2Q4BA 4HX9A 3GGPA 5B37A 4TYYA 2NM0A 3I45A 4RZUA 5T57A 3UJ9A 2O48X 3PA8A 1XEFA 2DY1A 4OQZA 3G5MA 4QRHA 2EKDA 3DP7A 2ODEA 3ZVLA 3EXG1 2M6LA 2UYHA 1XTPA 3BE4A 1DVRA 3E8MA 1CVLA 4HE5A 2J9FA 3ZZTA 1BIFA 4HH3C 3G49A 1L8LA 4TTQA 4CDNA 3NC0C 4P22A 5HKAA 2VBCA 1MAAA 2DBYA 1MJ5A 1PNTA 1U2SA 2H2FA 2IYUA 3RU3A 2WWIA 3EGXB 4FJ0A 3K8OE 4YWHA 2OPBA 4BJ5A 2PSDA 1R3DA 4M76B 3AT1A 4WESA 1T9AA 2GBCA 3ZNNA 2OV1A 3S68A 4KPFC 1X1AA 1C3JA 2VHXA 2QMZA 2WFZA 4G09A 3TSCA 4E5YA 3WFIA 4NBSA 2ZS8A 1G19A 4EHHA 3NDBB 1EG7A 2C1XA 3OQ1A 1VMIA 3RF6A 2X9GA 4P3XA 2PU5A 3PQCA 1N2CA 3OPYA 1SXHA 3FPGA 4GOXA 4D79A 1T8WA 2BFMA 2QRMA 1NHGA 3E1SA 3I05A 4DLWA 1AKEA 2G9VA 4S3MA 2A57A 4R98A 3EB9A 3DDYA 1ECFA 3KHKA 621PA 2HK7A 2IYEA 1RYMA 1YZQA 1OI4A 4H6VA 2IBMA 2VF4X 5M3BA 1EMDA 3HBFA 1OIWA 2ZJBA 2OHFA 3D3KA 3WTCA 1QVAA 2NN3C 2X5XA 4ALKA 4E30A 1LBQA 2F8SA 1FX1A 1OVGA 4MZDA 3WGVA 1B0UA 3BXXA 1AO3A 1E9AA 1AOXA 1F8YA 1JQLB 3OCVA 3ROMA 1UAAA 4IRXA 2CHGA 4ESHA 5EZYA 5GGXA 1D6JA 1P0MA 1Z13A 2HIMA 2WYVA 4KWIA 4UC0A 1QP4A 1NLUA 3AIOA 1QRUA 3ZWVA 5HXAA 2VAXA 1ZH4A 2XF2A 3EUAA 3FYTA 4RO0A 4MUHA 1IMJA 1IN7A 3DMNA 4ZU1X 3QIVA 2BW0A 3ZI4A 1RXWA 1Z6QA 1PUJA 4HHEA 1GAJA 2PYZA 3Q6MA 1U2QA 3E18A 1J99A 4UBOA 5C80A 1OWPA 3LZDA 4I46A 4QGFA 5BQFA 3RARA 4RTNA 3QPDA 3R0IA 4JLDA 3LFUA 1L4FA 4MRVA 5DYTA 4YMIA 2YR0A 4J1TC 1EI9A 4ZOLF 3H19A 3FNEA 4BNMA 1ZSNA 2PWYA 1H2BA 4Q1AA 2X85A 3DB2A 3WQHA 4DIEA 1QF6A 2EP7A 4Q0MA 2WZNA 1HDOA 4QEDA 2F1JA 3HWWA 1AVTA 4JI5B 1KDRA 5F7JA 5CT6A 4BZXA 2IWHA 1Z06A 1N8NA 4CKCA 5BSMA 2JKZA 4J9UE 3STUA 1ZOLA 2P41A 3UYKA 1NW4A 5ED4A 1QXSA 2FMUA 4KDCA 3AKCA 3IS3A 5DSXA 5IYWA 3OW2B 1FY2A 3FZNA 3SXJA 4B6GA 4CDMA 4QGSA 1GYRA 2ALJA 2ZRIA 2J32A 4KB5A 2X7HA 4YAIA 3B8HA 3KZKA 1VCNA 3SAJA 3N76A 2P40A 2PK3A 2VK1A 1MXHA 2A9RA 2Y1XA 1L4NA 2REBA 4L4RA 4CMIA 5KOJA 2W2LA 1JILA 1F4PA 1AF4A 6AT1A 4LY0A 5E6SB 1W2WB 4O4HB 1RI4A 5ELLA 1MGOA 4R40A 5ES3A 5G2OA 3RC3A 3BJMA 4UE6A 1YE8A 1ZO8A 5JAIA 2G9NA 1UK9A 2XCLA 2QTGA 2KJQA 4ARBA 2CNWA 1L5QA 2ADFA 3LQFA 3WLQA 4ZJZA 1II0A 2V0GA 4CM4A 1WQ3A 4JBIA 4OI1A 1KOGA 1W2HA 3FXAA 4KXLA 3FCUB 4K3VA 1WHSA 3EDRA 2P7HA 3IAXA 1KMMA 1TQ2A 4O2BA 4DBLC 1SBZA 3NOVA 1JB1A 3O2SB 1G21A 1VE3A 1X70A 1Z0JA 3F5FA 4WUTA 3U7JA 2BKVA 4FFSA 1MO6A 1X8KA 3TOSA 3K4QA 2RHJA 3C8HA 4FILA 1VIDA 5A6VA 2WV7A 3EZXA 1D2EA 1IWPB 2HQRA 5CTAA 1GZ5A 5EE5B 1DE0A 1CQXA 4ES6A 2CCKA 3CRW1 4PGOA 2Q45A 4Q47A 3QPCA 4X1IA 3ZGLA 2RBEA 4YRFA 4L85A 5AW1A 3FNIA 4FR5A 3SZGA 1YX2A 4IKEA 1QG0A 3PNMA 5KJFA 3V4ZA 2QRHA 1RRFA 2W90A 1E2KA 3L1JA 1BMDA 4ZOLB 3UMMA 3I9LA 2I6FA 3DZDA 1QH0A 2QLJA 4QTUB 4RSMA 1UADA 5AVJA 3ZCPA 1DEAA 4NU5A 2Q49A 3N6RA 3L7LA 4OP7A 1L7MA 4P4TA 3W8NA 4DBVO 2PS9A 3KUKA 5K4HA 4PRKA 5KSZA 3R3JA 4TL9A 3VDXA 2MDTA 3RSFA 3AHEA 4B87A 4N76A 3OUZA 1ULAA 1PL8A 3LOQA 3PNVA 1ZK3A 5H3LA 4HAIA 4AMBA 5AUOB 3V4FA 7GPBA 4LDNA 3UH0A 3IH5A 4BFCA 1US8B 1WOYA 3A1CA 4GG1A 3PDUA 5KTTA 5C1PA 5LKRA 2X0NA 3CCMB 2QZ4A 2OCXA 4URHA 4H3KB 2YICA 4M88A 4JCOA 4X61A 4U1RA 2CBZA 2RB4A 4PC6A 1Y81A 2EL7A 2MIIA 4OQDA 2OV2A 3HZOA 2QTLA 3E9YA 4X64B 4WN9A 5A5GA 4DCSA 1EFUA 3A6JA 2AEFA 1RC1A 3GIDA 4KREA 3AEQA 1AJEA 1BH6A 1DEXA 1FMTA 4JUAA 3ASSA 2ZCVA 4UVEA 4C3UA 1L5LA 1VG8A 1FRVA 4C0KA 3O90A 3M89A 4IVPA 4MINA 1PWXA 1OZGA 2HNBA 3KR2A 1RJWA 4E2WA 1Z4OA 3AM4A 4ZVMA 2EARA 3DMHA 3ZDEA 5JW6A 1AMUA 1BVYF 2YWDA 4GPTA 4YRIA 4M9UA 2H18A 4MGHA 2DLNA 2V45A 4HNHA 5HBGA 1WUJS 3K70C 1V9SA 1OXXK 2BZSA 3D8SA 1JQ5A 5A88A 1T9BA 1H5NA 4K40A 1AGRA 1RWPA 2DFPA 1YASA 1Z0ZA 2AN3A 4IILA 1GTMA 2UZ1A 4RZ2A 3GFGA 1S8FA 4B4KA 2V4MA 1Y4DE 3I55B 2VZ8A 2JBAA 4OGWA 4L76A 4BWVA 3EPLA 3M49A 3CXRA 2OUKA 3NRJA 5TVKA 1YVDA 2LDBA 2VT3A 2IL1A 1Q6YA 2FFRA 2P1RA 2WDZA 4KQXA 1SPBS 3WTBA 4I1OA 5T67A 4FTWA 1ODSA 1RAFA 2XAUA 1XALA 4YP5A 4KLRA 4F5YA 4NCHA 3CCFA 3LDAA 5L7YA 5JRJA 2PE3A 3L9XA 1EK2A 3D6TB 3LQ1A 5J4VA 2M6KA 2PRJA 1UZAA 4U7TB 1GQSA 3HPQA 1QANA 2BSAA 2PSJA 2RG7A 1BYIA 2FFJA 2E5FA 3PFNA 5BSYA 1DBRA 3AL0C 2JIQA 3U9TA 1WCIB 2I76A 1I6KA 4OJTA 2VWQA 3OJXA 1VLYA 1DIAA 2OWEA 2V03A 1E3WB 2FJ0A 1RCTE 4D1YA 3PFBA 4NE7A 3ROZA 4TQGA 4CCYB 3ME5A 4L73A 4AJ9A 3FWZA 2V3CC 1E2JA 3I9OA 4O2LA 1T9ZA 1IPFA 4H18A 4NS1A 2FX2A 4QLAA 3ZJUA 1EX7A 3LHDA 2ZU0C 4XW2A 2B7BA 3PXUA 3M34A 4UVDA 2YW2A 4LI0A 4H35A 1FRNA 1LSJA 4MS1B 1FFSA 1BDMA 1G8YA 4WFKA 5FTMA 2JJQA 4EDFA 5FA5A 2G3YA 1EAMA 4IXMA 5EXDA 2PBFA 2H1WA 2Q7XA 3IQDB 3PUXA 4B40A 4B74A 1JIXA 1NLYA 3EF3A 4NENB 3W5VA 1AN0A 2WF9A 2MSWA 3GRZA 3LVFO 4PZEA 3TLEA 1H1DA 3GCWA 4QO8A 3TI7A 1MB3A 1Q77A 2YV4A 1CJCA 3TAUA 4MJXA 2QEXB 1T13A 1U8YA 1K9SA 2B21A 1R4NA 4MWGA 4XB6B 4B34A 2C1EA 1E64A 1GZ7A 1QCCA 2P3SA 2P2NA 2YZNA 2Q41A 3B6MA 2YUTA 3BWYA 3FCSB 5HTKA 3U4DA 4R0MA 5CR9A 1QDLB 4V2UA 4FQ5A 4QZVA 3UMSA 4FYWA 3HFRA 2OHJA 1ZP6A 3QEOA 4UU8A 1OBOA 2EZUA 1E9SA 1E96A 1RQ2A 1U5CA 3DKIA 4QYXA 1YS2X 2D2IA 1Z2OX 2Z57A 4DSZA 5ENZA 3UXEA 2P11A 2WSMA 3PXGA 5K05A 2OZLB 2W6JD 3ZQ4A 3H5WA 3PVCA 1S2OA 6LDHA 5L4NA 1H94A 1QGAA 3K4PA 1NOKA 3MB5A 3R5XA 5EI5A 4BLPA 1HG0A 1KBQA 1ORIA 1E9EA 3FSJX 4R0VA 1CX9B 1ID1A 1PHPA 2F67A 2MT9A 1TOAA 1SB8A 4Y9UA 3VTKA 1NW5A 5JZBA 3NEYA 1ZUNA 3A8IA 5C8ZA 4HPWA 2IP1A 4V0SA 4OL9A 1C0PA 4AUEA 4XQ0A 3V42A 2CVQA 5IMBA 4PYIA 3ABIA 3QX9A 4CQLB 1K89A 4DV0B 1CS0B 2V9ZA 1N2SA 5IEBA 1ZIYA 1FLAA 1I18A 2C0QA 4BE7B 4RVOA 3PT5A 1KQOA 1JFLA 1QX3A 1NXVA 3JARB 5LFAA 3CS3A 4JX9A 4RF4A 5JSKA 3ZHOA 3K2EA 3VGJA 3DLTA 3D0KA 3I2FA 3AVVA 1HPLA 3KTAA 5EQFA 5F3RA 2Q6LA 1QR2A 2A86A 3HVIA 4HXEB 2AGVA 2GEUA 4YAUA 4Q03A 3ZOKA 2BFCB 2QK4A 3CQ9A 3F4KA 3GCXA 2WMNB 4R41A 2OORA 1KR5A 2VDVE 2GEDA 2YJNA 3HBJA 3BKXA 3BXPA 4ZYLA 4JOBA 3TJRA 3N8IA 1E6UA 2FFQA 2K2WA 4YP9A 3UV6A 3ZTWA 4ESVA 2VAWA 2QN1A 2GPTA 2FWBA 4Z4SA 4UEJA 1B0ZA 4ZT5A 4ZIRB 1GGVA 2G63A 4D4KA 1BEEA 4HOYA 1ZNXA 3AOEA 4PFJA 2VH2A 2VYQA 2I9KA 4GZLA 1G59A 1I2BA 2Z9BA 2VTVA 4J6EA 3RS5A 1TTTA 4KG7A 4CN8A 3SEZA 1ML3A 3CPWB 2DMRA 1XTKA 3P9YA 2P9FA 4RV4A 3O9MA 3URKA 4AICA 3TW6A 2XDQB 4Y7CA 2B99A 3UKDA 1NI3A 2H6EA 3G4SB 4GBED 1SCKA 2Y8EA 1XU7A 2AT1A 3V1UA 1PNQA 1QCYA 2WSLA 5K6RA 1ZD8A 2GF2A 4MR7B 4RA9A 4PFKA 1C7IA 4RHTA 3QBJA 2YH2A 3V00A 5IAAA 5KJ6A 3Q8KA 3B5IA 4KNVA 4HL6A 4X3CA 3OU7A 4KFTA 3TRIA 4EGJA 3AEYA 1JHXA 1SUCA 1CCWA 4W99A 1KJIA 3RU9A 3X0DA 2A58A 4B75A 5CDHA 4DPMA 1EP1B 3CMMA 2ZB8A 4EFLA 1ZXXA 5FF9A 1I7SB 3FCXA 4PY2A 3GEPA 2O3JA 2HMSA 2QG6A 3LUGA 3OCCA 3DT8A 1PJTA 1N1MA 1ZH2A 3OPYI 4RJ2A 4F71A 1CQJA 5IRCD 3A2KA 4F2DA 3I2KA 1WB9A 3G9XA 2G1KA 1R0XA 3O26A 1FLDA 4JYAB 1YWGO 1TYBE 2CFCA 4NYIR 4WACA 2VDMB 5E1MA 5FH9A 4AT1A 1IJEA 2WKSA 5IG2A 4E6PA 3OZWA 3TZ6A 2VAMA 2IHNA 2OGUA 4FB5A 2P0EA 3B48A 2HU7A 3CLHA 5A89A 3TUZC 4LDJA 1J2RA 3HCCA 3VYVA 4M8NE 5AXCA 1XNGA 3EX7C 1AUVA 1ZM4A 5JI2E 4UVIA 2X9LA 3G71B 1N4AA 4LJ8A 5FTNA 3SSOA 4RXTA 1OLOA 3TR5A 4BIIA 3L43A 1XRQA 3AZPA 1VB3A 5GM2A 2XUGA 3IBTA 4Q7LA 4DLTA 2D6FA 3KQYA 5FTLA 1J25A 1YAHA 1NYTA 2ZSFA 1EEXB 4KR3A 4N8DA 3B6EA 3KEWA 2QTRA 3FWNA 5ERYA 4IJUA 4QNRA 4L07A 3ZLVA 1CETA 3SHVA 1BVHA 2Z9CA 2QQFA 1A8PA 3P9ZA 4RIFA 1JH8A 2A9VA 3F9RA 3SF8B 3T3DA 1OY1A 4CIBA 5EJ2A 1P1JA 1ZUNB 2J6HA 1FMJA 4MV0A 2ZWIA 5IP5A 2O8DB 1YNSA 3W8RA 3TLYA 1P31A 3NNNA 1H2YA 3MTAA 5CDUA 1JEYB 1GILA 4NBRA 3ZCRA 4L9AA 1VQ5B 5FBZA 1QV7A 4A6EA 2PM8A 3CG0A 4Z4QA 10MHA 4OQYA 1XROA 3HYRA 4EYOA 1XMSA 4FDAA 3CBGA 1E0AA 4KXUA 3O84A 2PLFA 5G0SA 5BSHA 2GILA 5A5VA 4G4SO 1P72A 3R41A 1G2IA 2OR3A 4LWQA 2VCHA 4N9QA 1T0BA 4ROTA 3OTQA 4DG8A 4C9BA 4IVNA 3BK1A 4RD6A 3ICWA 3BCHA 3N28A 2EX1A 4CLRB 4TVOA 4JB8A 3OT1A 3B3AA 4Q3LA 1PWZA 3BHNA 3ENQA 3R3SA 1SKYE 4GOLD 4R6XA 5G1OA 4OP3A 2DQ4A 1QH1A 1WOSA 3I76A 1WCWA 2Q8QA 1XIVA 3PNLA 4H6PA 5D6NA 5CXSA 3SI7A 5AJYA 5BW6B 5F12A 5FULA 2YOHA 1SY7A 2EAUA 4WA7A 4GEGA 2XPCA 2PLWA 1WP6A 2IHYA 4XYLA 4FYJA 3DVSX 4MS1A 4YFYA 3ZX5A 3FWKA 3VU0A 3Q88A 3GH1A 3EZ6A 3SSNA 4DDMA 1FXWA 1G8PA 1SVIA 2W98A 4N5LA 1B26A 1A7JA 5FA6A 1N5JA 3C1TA 4YUVA 1L5YA 3RAGA 1XVAA 2H48A 1VJ5A 1XVTA 3FDIA 4UTRA 4B3SB 4W6QA 4A10A 1FE8A 4C6RA 5CX1B 4RL6A 3T9AA 4QXAA 4OLBA 3VI3B 2V9PA 5JV5A 5F78A 4HH4A 1PJSA 1RWQA 1JXQA 4A8JC 5E9WA 2JGDB 5CFLA 2HB6A 3RW9A 4B8ZA 2R1UA 1XJ0A 3ZH9B 3DUFB 4INOA 3LVQE 4LZWA 4ZICA 1DKLA 1JDPA 5LQCA 4ZHQF 5LQKA 5AM3A 3LUDA 3EFBA 3WI7A 2LV8A 3AOEC 3SS9X 4QVJA 1VIMA 4GMHA 5FOXA 1Z8DA 4R1MA 5IXYA 4W5OA 4KN8A 2HSWA 3DOJA 3ZH2A 1OVMA 3V7AA 5JZOA 3A06A 4EJ6A 5LL6P 4MCHA 3QITA 3CA8A 3L07A 3ZHUA 4X05A 2JLXA 2IS2A 4YRAA 3HKEA 3P2IA 1L4BA 1SXJD 1JTEA 2CHQA 2A33A 3PCTA 4ZGWA 3GA0A 2JRLA 2BL4A 3HJUA 2QD3A 3EIQA 5EXPA 1VSBA 4WNAB 1B2RA 3GFTA 4IHJA 1K6MA 3A8TA 3NTOA 3NXSA 4HB3A 1EFDN 2Y0CA 2BYTA 1Y5NA 1FTYA 1C2YA 3F98A 3SLNA 3QU2A 5GQSA 1XZKA 4NFYA 3R7NA 3KQUA 4NEHB 1H23A 2OGWA 4EVQA 4KCGA 3E15A 3CLUC 1AHNA 2MR6A 3KT8A 5J63A 3G79A 3G0BA 2YDXA 3NH9A 4TV9B 5AKEA 1JFSA 3C4VA 5LXTA 1D2GA 2G0NA 4XQGA 3I6ZA 3N2NA 3OMLA 3PQ5A 2DY0A 1QRRA 3W6OA 5IANA 1NDUA 1QPGA 2A3RA 2G5GX 4D74A 7MDHA 1BGXT 4CI9A 1DRUA 4OA8A 1X9HA 3PC2A 4IIJF 1VHQA 2WWTA 4ZARA 1B23P 3DBOB 4P6YA 3TPZA 4P4UA 2Z5LA 1V5WA 3OJWA 2IYVA 1VKHA 2OEPA 4OHYA 2B6NA 2CMDA 4GRAA 3N07A 3WRWA 3J80A 2AZXA 1J8MF 1DRJA 3ZHXA 2W22A 5B4TA 5BN3A 1Q0LA 3HACA 1KZGB 1UM9B 4Q93A 4Y2UA 2J3EA 1D2MA 4CF5A 3F73A 5FT9A 4DMHA 4ZVUA 3B3QA 1SNYA 1N2ZA 4RLZA 4II3A 1XO1A 2CFIA 1D04A 3ISTA 3MRXA 3PUJA 3CGWA 4HDKA 2GWHA 4I4TB 4IV5A 4IZOA 1QVVA 4QT4A 3TIXB 2F3RA 2R00C 2XF8A 4OQFA 4N8SA 2I22A 1U81A 4YRPA 4IJQA 3W7BA 1Y7IA 5D3MA 2NTEA 4X6YA 3AVXA 4YS6A 2Y4OA 3DZFA 3DOUA 4L4ZA 3E2MA 1QRTA 3BDIA 4GFDA 4PG6A 4QODA 2XEXA 4XR6A 5NULA 1KH3A 3C5CA 1B8UA 3C98A 1XR3A 4JU9A 4YP7A 4X9XA 3RU2A 4Z7NB 2NXJA 5CFMA 1KVTA 4UNSA 2R751 4GI7A 1EYZA 3TW8B 1L5HA 1KETA 1F17A 5D1NA 4CFZA 2CV1A 3LUPA 4GSYA 4OHUA 1DQZA 2PA3A 1O8CA 2XITA 3AR2A 4F5DA 1P62B 5JWHA 4RDJA 3GJ0A 3FOBA 4YH1A 2BMFA 2A5FA 2LGJA 4I1YA 1DKUA 3G8AA 1PT9A 1G21B 3CLVA 5KNLA 4RX1A 3VTFA 3ROQA 1ADCA 1RJ9B 1BMQA 2BLNA 3BEOA 3IEIA 5E7IA 4YK7A 1RAGA 5LA6B 5BNTA 1QKIA 1ABBA 2B0JA 4AQ7A 3Q11A 1QP7A 1V4BA 3RRJA 4AKIA 1KI8A 2Q8PA 3QPBA 4LCJA 1VOTA 1RC8A 3H0KA 4L78A 4QYTA 2QTWB 4XE5A 4DUZB 4IUDS 6GPBA 3LC2O 2A0WA 5JALA 1F2DA 5KOYA 1J0AA 2XBMA 1NMSA 4FI3F 4AJ4A 4S2EA 3W3AH 5CBPA 3L0CA 4JBHA 2OZPA 5EJ7A 5K8CA 1UC9A 2ZPUA 4BU1A 1CPYA 3PQ7A 3IMEA 1XI2A 1V9LA 3RGGA 3UO8B 3K5WA 1SGWA 3KAQA 1EFTA 4Q01A 3TB6A 2MSNA 4AD8A 3AI2A 5IBQA 3UW1A 1ZK0A 4OYRA 5TT1A 2Z5VA 4EY7A 1D4AA 2HDOA 2ZSHA 4PF1A 1EWVA 3UTCA 2KYRA 3PD7A 3WAKA 4BE9A 3GV0A 4HS4A 3VR5H 2IH4A 4G5HA 4Z0PA 4ZQEA 5CCDA 3STHA 3UWOA 5ERXA 3T12A 1YDHA 3V5NA 4B3BA 1RQGA 4UDYX 2N46A 4C4TA 1A5BB 4UTZA 4ENWA 3DE2X 2V5VA 1CTQA 3M5DA 2PKRA 4MVJE 2Y99A 4N5MA 4PYLA 3U3MA 1FMFA 3SHOA 5GIOE 5DNCA 2C82A 3X1XA 5HCNA 4CEHB 3MAGA 3ZU5A 4LC0A 2W2MA 3G8BA 1H8ED 5LB2A 2UZ4A 1NBEA 4L0QA 4L2IB 5EMMA 4B5LA 4BO2A 3ITKA 4YJ2A 4MGEA 3EODA 2C2BA 1FFXA 1ODIA 3M4YA 2WMYA 1FB5A 2OENG 4FJ2A 4X7FA 5KSWB 1QORA 4UMVA 4JITA 4WZAB 4Z6KA 4IM7A 4JI2B 5PGMA 2FWIA 3S70A 5CITA 2AEMA 2BDEA 2Z09A 3ORHA 4PAMA 4OLJA 5JH7B 1TJNA 3MJEA 4BV8A 5BVHA 1QHIA 3ASRA 4P5EA 1ZCZA 4L51A 4OGKA 1F2TB 3PC3A 4KAFA 2XE7A 2PYDA 3ND6A 3ZCUA 5H8WA 2I3ZA 3DEFA 5A7GA 3GLGA 1U98A 1ZESA 1K5DA 2L2QA 2YBDA 3UHAA 1H0SA 1GQFA 3K9HA 3ER8A 1YB2A 4EKDA 1XZQA 4AF6A 1RWNA 2P5UA 5FNVB 3RRFA 3ILYA 4Y1RB 3MUOA 4Q9LA 4DXAA 1XA3A 3IE1A 4AG5A 2VDLB 2P5TB 2H5JA 1PX0A 2ZIGA 3BL6A 1D2HA 3GNLA 3KU4A 5TVGA 2G76A 3AR5A 5DLQC 1MVNA 1COZA 2EERA 2IUEA 3A6DA 3DW1X 3H6KA 3P4UA 4B0OA 3L0OA 2ATVA 3UHPA 2ZTNA 1EFVA 1QFMA 1IXRC 2PMFA 3I8OA 3HVHA 2QJWA 1EWYA 2F9LA 3CLTD 3HU2A 1LI4A 3M1AA 5LYJB 5I7UA 2UUCB 1TT5A 1YRWA 4WXHA 1UF9A 4L02A 4XEHA 3D4PA 4DADA 1V16A 2PSHA 5EJIA 3HFSA 4JA0A 1GPBA 3UWMA 1J5XA 1U7UA 4AF8A 4LYYA 1YIJB 5FWYA 2EKZA 1BN6A 1MD9A 1XELA 5JU6A 2PVCA 1THZA 2YMQA 3NC1C 3I62A 2GAOA 5KPDA 3SQNA 1A88A 1TVKB 4RKEA 4MDYA 1OQAA 1K0UA 3UPUA 3HMQA 5LKAA 1E2EA 1OT3A 1DAEA 2FSVA 2VFAA 1RRMA 3A6LA 3CCQB 1LS1A 1QNLA 1P80A 3B8EA 4FHZA 3OCWA 3OJEA 3QKUA 1WXHA 1GXSB 4GR5A 4N7JA 1ZH0A 2GDZA 2F1RA 3BGIA 1CYDA 3DLIA 4LMBA 1IHYA 1NUPA 4U7PB 2DUWA 2Z0MA 3CZQA 5ALYA 3I0MA 4CF7A 3VSEA 5IDWA 4BQIA 4ABTA 1N2XA 2GD0A 5CB0A 1ESNA 3LPLA 4JHXA 2KLHA 4LKRA 4TXJA 2UV8A 4BKRA 5I01A 2LPMA 1R10A 1WXIA 1YI2B 1EX1A 1NU6A 1X2EA 3HKBA 4M9QA 3CN9A 1TQ6A 4MQFA 3W9YA 4RCVA 4RA6A 2Q2NA 2O5CA 2QDKA 4Q6BA 3K15A 1YA4A 3O9VA 3BRWA 2HA4A 4NFHA 3UH1A 3E3OA 3CVYA 2R8ZA 3OY7A 3LGAA 3GUYA 1T1IA 1W1IA 2P2LA 2V4ZA 3B6JA 3DOIA 2BAGA 1E4YA 3BH0A 4I6JA 3RBXA 5AOVA 3A1UA 3RPEA 4CF3A 1N5RA 4E3WA 2FN8A 4Y2QA 1TA0A 2P65A 1UJNA 1EESA 1DJNA 4M8LA 3CCVB 3HPRA 3Q6RA 1AKTA 3UQZA 1BPLA 5MDHA 1CZOA 1YQDA 1POWA 3KV1A 5K9ZA 1FPMA 4TKZA 3WLSA 2IX3A 2B4TO 3PNOA 1E1RA 1RQPA 4G65A 2HHAA 2PMCA 4NAUA 1LNQA 5KYWB 1NV8A 2LBPA 4Y2YA 5AK6A 2L0XA 1SVSA 5JBQA 3E05A 3I73A 3WGIA 3AFNA 4PQRA 1YHZA 1YU9A 3ETJA 3BTVA 4R51A 5ALRA 4B7ZA 2PS0A 2OORC 1MA0A 1S02A 1LQUA 3OLVA 4US2R 1Y3IA 5FLXA 1UBOS 4XGQA 1MLDA 2EJCA 1OKKD 4JEHA 1D5CA 1Y9AA 2HHCA 1T35A 1XYYA 2IOFK 4CR7A 3QF7A 1L7QA 1HRDA 5DB4A 3I5MA 1GA1A 1R15A 3AIKA 2KLBA 1YS6A 4LHYA 1J8VA 1ZQ9A 5G0UA 1NT2A 4ZU3A 4OUKX 1ES9A 3C45A 4C78A 5DP1A 5DM0A 1J0EA 1AS2A 5DHPA 4OMFG 4W1PA 3SFZA 2FCAA 5B55A 3R5HA 1NR7A 2WIAA 3R2JA 1CDEA 2VWHA 2D1SA 1AQJA 2Z08A 3HN2A 5BN5A 5K0ZA 1WHTB 3L46A 2Q4DA 5EKSA 2R6R1 3UOWA 3ANMA 4KYVA 1TEXA 5COAA 4LDAA 4M7OA 2SBTA 1M2VA 4DCCA 5THKA 2LP4Y 1E3SA 3GRYA 3OTGA 5DP2A 1TNDA 3V7UA 3F3YA 5CIYA 2ZUUA 4LBZA 4IDOA 2I6XA 4TS4A 4Z49A 3PXDA 3AUJB 2IF0A 9LDTA 4NJEB 3ZKAA 3A4NA 4A2WA 4C5BA 3Q6NA 3FB4A 3ENVA 5EC8A 5C46F 1YR2A 2Q4EA 1ZNZA 3CJTA 3U48A 2ZZEA 1GT91 1X42A 3F8WA 4JLPA 4D6XA 5ITZA 3MERA 3K09C 4YMUA 1RXSA 1VDZA 5HRCA 3O8QB 1NJ5A 1ZONA 4N40A 3HGTA 1GUDA 2Z6BD 1GYQA 2I6QA 3D6VA 3QQ5A 2GZDA 4OXQA 5F7OA 3ZVMA 2A1IA 4O4IB 1C1XA 3NT5A 2ZSJA 3DMRA 4WECA 5JY6A 1FBNA 1VSQA 3F7TA 4KQIA 5HE8A 3O8DA 4X60A 3WMGA 4Z4TA 3QMMA 2WIBA