4RCYA

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gtp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVAHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rcyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rcyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rcyA01
1IOZA 1G5RA 1XEXB 4GMDA 4GOJA 4PAMA 1DBSA 1IBRA 3I8SA 2HMAA 4PO8A 4QBGB 2XXAB 1IAQA 4X8LA 3VFDA 3PUVA 1W36C 4EQ6B 4RD0A 1Q22A 3ZS9A 3K0AB 4WZAE 3RC3A 4UJ3A 2GDJA 3OJWA 1W0JD 4QNMA 3EIEA 3ADCA 3VMFA 4F7DA 3EG5A 3HR8A 3UK6A 1CKEA 4Q9LA 3TSWA 3W5VA 1QGYA 1KKMA 1KZGB 4LBWA 1ZNXA 3DMNA 1XJCA 1YZKA 1LS6A 1DO0A 2XSZA 3FMPB 3OIWA 4KVGA 4U7DA 3THWA 1US8A 3AKYA 2YKGA 3ZH9B 2VP4A 2X1VA 1S2MA 4YXWA 3OE7D 1OH8A 1MV5A 1JR3E 3Q5EA 3QUSA 4XSHA 3JQQA 1JR3A 1E9SA 1CR0A 4WQMA 3U2QA 1W46A 4D4MA 3EIQA 4CDGA 4DEXA 4ACBA 2ASEA 4L15A 2W2TA 2J0UB 4PO9A 3VHLB 3T1TA 4TZ0A 1VQPB 4W5HA 1ZJ6A 2OESA 3MHPA 4LI0A 3PEWA 1QHXA 2E1RA 2A7QA 2J0VA 2CLCX 3ADBA 3O47A 1CJUC 4WW0A 2DEUA 1G41A 4OQNA 4FN5A 2F43A 3B78A 1DTSA 4CEHA 4M1TA 3OEHD 4N1AA 1XFAA 1NN0A 3CX8A 3EZ2A 4GPTA 4KYIB 1E1RA 4DT1A 1F2TB 3Q8XB 4YONB 4UXIA 4MGIR 1VQNB 2FU5C 4Q7JB 3F0TA 4OK5A 3LVBA 2AK2A 4IDOA 4C4PA 3GEIA 3AVXA 2G83A 3C4JA 1WE2A 2XZOA 3S1AA 1N5JA 2GK7A 2ZYWX 4B74A 4L4UA 1OHHA 2WKPA 1KAOA 2B92A 3CF0A 1E9DA 1VQ9B 3U3MA 2AKAB 2BF4A 3AVVA 2OSBA 4A6PA 2C5LA 1ZCAA 4AY2A 2PH1A 1YJNB 3HP1A 4H1VA 4B3FX 5GADl 4NDZA 4OQXA 2BVNA 3B9QA 2O8EA 1ZP6A 2PZGA 2ONJA 1YIJB 4NHOA 2I3BA 3U5ZB 1IXRC 1SVKA 1BOFA 1Z6YA 2IXFA 2CCKA 4ZPXA 4HZUA 3BOSA 3TVTA 3MAAC 2EIXA 3ZZUA 4RD6A 4I1OA 1N6OA 2F6RA 4YMSA 2JLQA 2P6RA 1XD9A 2A3RA 2N42A 4RY2A 3G82C 1RFLA 4CF7A 2VSOA 3PV0A 4A0FA 1YHQB 4N0EA 3KQUA 1F5NA 2Z6VA 1NBMA 1X1SA 3VR1A 4LJAA 1YZNA 3LXRA 2C95A 1GAWA 4X8OA 2HXSA 5HE9A 3THXB 3DZ8A 2DY1A 5B58C 1NI3A 2NO0A 2ZSFA 1KYIA 1NN3A 2IYTA 2RHMA 3SBDA 4H9GA 3KFXA 3KQHA 1MO4A 1IN5A 2CJWB 2VPPA 2IHBA 5DLQC 5FPHA 4URUR 2BBSA 4FCTA 2ZTSA 3T61A 2NPIA 4BWYA 3EPKA 1H8HD 3IQXA 2ZI6A 2WBLC 3OEED 5EUQB 3QFTA 1OB2A 2HT1A 1XTQA 1ZM4A 3GFOA 3AKCA 1GIAA 1KNQA 2WAXA 1TX4B 2GF9A 4PZZA 2A5FA 1UFQA 3EASA 3CM0A 2OBLA 5AUOB 4LGMA 1JNYA 5KO2A 4UXJA 1M90D 3H2YA 2GAAA 2GILA 3B2EA 2ZIAA 3WBJA 1JQLB 4Q5IA 2WJHA 1NG9A 1KO7A 4CEJA 1NJGA 4NYJQ 2FPLA 1P9NA 4CT5A 2O8DA 2HT6A 1G8YA 5JCZA 3AP2A 3K0FA 1QHHB 4QXAA 3RS3A 5G53C 3FTQA 1PLJA 4TSFA 1XPUA 3LX8A 4JS0A 3B5JA 5FPSA 1N5IA 3BH6A 4BRUA 1ZD9A 1E96A 1KGDA 2G0NA 5DE3A 3BD9A 3ES9A 4IDPA 4Z8XA 1P60A 2IW3A 3ZBUA 1CBUA 4A1FA 2CNWD 4IXNA 4MGZR 5L3QA 3H1TA 4CGZA 4FCVA 4PHFA 4D0LB 1PZNA 5J4VA 3IEVA 1YITB 3CRZA 5GJCA 4BFWA 3GFPA 4GFDA 5DHAA 4C0QC 2P3SA 4XVUA 5LDDC 2R6GA 3WRYC 2KB0A 1GAJA 2ZSEA 2ZM5A 2ODBA 5TR9A 3ASZA 2JIZD 3Q5DA 4YQFA 4A2WA 2YWEA 2XB2A 1I2DA 4WBSA 4TT3D 5FL3A 4FI3C 5KPJA 4JLNA 1SHZA 3VHXA 4G5RA 5EZ6B 3D6TB 1KI7A 5EE3A 2EU8A 2BM0A 1E9FA 2QM7A 2RH5A 4D4KA 2L0XA 1QHNA 1JPNA 4AKIA 3SHFA 1EP2B 5CM9C 1YZUA 4HAVA 3LDAA 1TQ4A 4DLWA 4MRVA 3O8CA 2O8BB 1D2NA 1TPZA 4OHWA 5TVKA 4OHZA 3PEVA 4JYCA 3PJRA 3R9WA 1FRQA 1FP6A 1YJWB 5G41A 1IM2A 5JLJA 5AUPB 2WPDD 4QKQA 4AD8A 1E69A 2ZI3A 2XEXA 1T8UA 2QE7D 4RZXA 2JLVA 5DO9A 5ANRB 2NPFA 1UKVY 4R71A 1Q1EA 1W87A 2NGRA 4ZKDA 2CK3D 1SVOA 2LKCA 2OV2A 1OYYA 2FA9A 1ZRHA 4KFTA 3VAAA 4YAOA 3IO3A 1XD2B 4LPSA 2GETA 1P5ZB 5FOSA 2GQFA 3ND8A 1UBFA 1JEDA 4V0ME 2BGIA 1HY3A 1FFHA 3BB1A 4V0MA 1W5SA 4FMCB 4QOSA 2C04A 2X3UA 2W0SA 2LWIA 3RSLA 1GKYA 4B35A 2H57A 3EPJA 2GHIA 3GJ5A 1K8RA 3PQCA 1FNNA 2IF0A 3SI7A 721PA 1NP6A 4BFVA 1EG7A 3GFTA 4PFSA 2ORIA 2YOGA 3WYFA 1VQ8B 1CU1A 1IJFA 2W0MA 4QGGA 1T91A 2FNAA 2OT3B 2J7PA 2ZVPX 5IK2D 4LBZA 1YZQA 2BOVA 2NG1A 3IGFA 4CYMA 5BN4A 1WB9A 4YMWA 4YAWA 3VKGA 4MITA 4PC6A 1RW4A 4BEBA 3ADKA 2F1IA 4NYJR 2WWIA 2D2FA 3PEUA 2HV8A 4AYTA 1T6NA 4UNRA 1U8AA 3A1TA 4LHZA 1W0KA 1E2FA 3SYNA 2R6DA 4C0SA 2C2HA 1KSFX 3R20A 3BORA 2NO6A 3A36A 4AF6A 1HA3A 4ZCLA 1AM4D 5DI3B 3TSZA 3VQTA 1PLKA 4TLAA 4WAUA 5H8WA 5EMNA 4OBEA 1W34A 4ASUA 4MKHA 3AP3A 1CRQA 1XJQA 1GL7A 2WZQA 1ZD8A 4IDNA 2A78A 1XTKA 5E95A 2YWFA 2H92A 3IKJA 4MGYR 3SZRA 2W6IA 1K5DA 3X1ZA 1E0AA 5JFGA 3VR4A 2O8FB 1XXHB 4ACAA 1EFRD 3W34A 3AF1A 2PBRA 3WHLA 3TR5A 4KFSA 2V55B 4YLGA 3SC3A 4U02A 2KE5A 2J0QA 4LWZA 3QVVA 2DFNA 4BECA 4EPWA 4GI7A 5HZHA 2XGJA 1F60A 1XNJA 5L8VA 2O8CA 1E9CA 3A1UA 3NC1C 1UADA 5FUWA 5CJPA 1L4UA 1G7SA 3QSYA 2JA1A 3R8CA 1O87A 5AJVB 4F4IA 3SJCA 2GRJA 4EFLA 5FL7A 3KQNA 1FQKA 2XSZD 2XITA 5SZJA 4LJ5A 5P21A 3L0PA 4HLCA 2N46A 3B82A 2CE2X 4QFMA 2ZREA 2VHCA 4LHXA 4XH9B 4AKHA 2BBTA 1JR3D 4ZDIA 1KOFA 1OE0A 1ESMA 4G1BA 1CP2A 3W2IA 1XX6A 2PMKA 2V9PA 3Q7QA 3ZC3A 3CRMA 3QG5A 3ZS8A 5DNYB 2WHXA 1G9XA 1XCPA 1S1MA 1ZNWA 1ELOA 1I4LD 2F1RA 4GSYA 5JEEA 3KTAA 4EPTA 1OV4A 4AKGA 1Z63A 1DDIA 1Q7YD 3UPUA 1E9EA 1GSIA 3CCMB 2D7CA 2ZANA 3GMTA 3OIYA 4QNRA 1UKYA 2IWHA 4NCKA 3R7WB 1DDGA 2VZLA 1Y3AA 2CVHA 4BZPA 5M04A 3E1YE 1EK0A 1FUKA 3NBFA 1GL6A 2YNMA 1E1RD 1E2LA 3A4MA 3GJ8A 5FUYA 4RFVA 2HJVA 3G0HA 421PA 5KDOA 2ZAMA 2IK8A 2GXSA 4HYYA 1EGAA 2CL7X 4PPGA 4BUJA 1C9KA 1VYTA 1ZIOA 3EX7C 4JJKA 3LVRE 1G21E 1R8SA 3CCRB 4DCVA 3L82B 2WIBA 4GT1A 5J5CA 3O8RA 4DDTA 4JBXA 2VNIA 1DAIA 3CCVB 2XNJA 3B60A 4KCGA 4DSOA 2Q9BA 1BYUA 1OXTA 3E2IA 3VX4A 1QHIA 4AIIA 3H4MA 1RJ9A 4RKFA 4DEYA 2BJVA 3I32A 5KSWB 1OXXK 4KXFB 4EPRA 4QBIA 2IL1A 4XWKA 3V4FA 3CH4B 2VBCA 3B13B 3SFZA 2GXUA 1SKYE 1Z0AA 2D06A 1DAFA 2AKYA 3IEUA 1OH5A 3CCEB 1XZPA 2FSGA 3B1YA 3QIAA 3BH0A 3NBZC 1CF4A 1BX1A 3MRSA 3C14C 4US1R 2E9SA 2LKDA 4X8MA 5AJZA 3AM1A 4NTZA 4LHYA 4Y0VA 2V1XA 3UWOA 1NBMD 3CRRA 5FUXA 5J4KA 3BC1A 2QRNA 4TYNA 4JL5A 3KDSE 3I5YA 3MCAA 1KO4A 1MRNA 1SVWA 2EWVA 2GJSA 3IO5A 4BLPA 3ZYCA 4KI0A 1E2KA 2ERYA 5KNCA 4LPKA 2BBWA 2Q3HA 1EFUA 5FR1A 1ZNZA 5J4YA 3P1JA 2BCJQ 5DYIA 4P4SB 3SOPA 3ZLJA 2FJUA 2AD5A 3AQ4A 3CUEF 1L2TA 2QENA 1O3YA 1T3SA 2PT5A 3U7FB 1FX0B 4M1KA 1VECA 1OW3B 2FMXA 1DELA 3IIMA 3ICEA 3IQWA 1OXUA 1NVWQ 1MO3A 1KI3A 3ZQJA 1NMXA 1KI2A 1ZBDA 2PMDA 3GLHB 2IUSA 5JBQA 2JDID 4QJ3A 1YRAA 4Q00A 3W2EA 1N6PA 1SVLA 2JLZA 5JSZB 1N2CE 1QG2A 1BS1A 3PXGA 3VO2A 3K09A 4HLUA 2QORA 4P3YA 3W2HA 1IHUA 1Q3TA 1UDXA 2FH5B 1LFDB 4PC7A 1KK2A 5IDVA 1G18A 1RIFA 1UMKA 4D82A 3UATA 1M7GA 1FRNA 1JEEA 4FMCF 5KSOA 2BGJA 3QNUA 2AD1A 3I1FA 3EC2A 3CWZA 2IS2A 3TJZA 3QFRA 3EIHA 2PZFA 5JHGB 3L43A 2IS1A 1TL7C 3TUJC 1TU4A 1GFIA 5SZHB 1KO1A 4WA7A 1AZTA 2ECKA 4UAJA 4K8OA 3VKWA 3MG9A 4YALA 3WMGA 1I4TD 1GZSA 2G1KA 3BH7A 1P75A 4XOIA 4C0BA 5HTKA 3BB4A 1R5OA 1T4GA 4DLSA 4EKDA 4ZI2A 2GTPA 3SN6A 2EYUA 1VCIA 3DEFA 4TQAA 1R0ZA 4HDOB 5D3MB 4FMDF 2FPKA 1D9XA 3EZ7A 5L3VA 2AWOA 1IB0A 5F9FA 2VHJA 2FG5A 3GJ7A 4OYHA 1AIPA 3M4YA 3Q3JB 4LV6A 2WMNB 2JJ1D 1F6BA 2V7QA 3CRQA 2CCJA 1P6XA 2FF7A 1VCOA 3C5CA 5CJ2A 1SQ5A 2ZU6A 1Q86D 3K1JA 1TADA 3UWKA 3VO1A 1XZQA 5DGXA 1Q82D 1TQ2A 1E9RA 1Z0DA 4WIAA 1OGJA 4TYWA 1XMIA 2FOLA 5C4GB 4F7WA 4HB2A 2RGCA 4AKEA 1F2TA 5JEDA 3IUYA 4Q48A 4DSTA 2H5EA 1ETUA 2HUPA 3D8BA 2HJGA 2DFKB 3NDBB 5LD2B 1KTVA 3ETLA 2XNCA 3GCGA 3KUDA 3FGNA 4HAZA 4Z51A 4BE7B 4TTQA 1ZYUA 4HI0E 4LBYA 1KDPA 4NBSA 1VG1A 1WP9A 3GQBA 3QFCA 2P5SA 4LV8B 1K73D 4M22A 1YE8A 3P4YA 1F3OA 4YMTA 2F9MA 1QHGA 2OFWA 2PT7A 3KXKA 4LJYA 1M1YE 2D4HA 2GAOA 3CBQA 2J7KA 2PEZA 4G5SA 1N3BA 2UKDA 1S3SA 2REOA 5F3WB 3DHWC 2F7SA 4MYCA 4C0AC 1YZTA 3A58B 4C2TA 4MUBA 5F98A 5LB2A 1PVOA 2Z0MA 3THYA 5AR1A 4TMZA 1NLYA 1Z83A 2FEMA 3RS4A 4AK9A 1CR4A 3WRXC 1GRQA 4A2QA 1DAKA 4HB4A 2GXQA 1DO2A 1FUUA 3R8FA 2DCUA 2ZRJA 4EJSA 1XJ0A 5LPNA 1F2UB 3W6OA 3LY5A 2IA5A 4B71A 2KSQA 1AK2A 3JZAA 1ZAKA 4US2R 1XB2A 1J9ZA 4ERNA 3RS0A 5JJLA 3MJHA 4C0JA 1HV8A 4O0MA 2QL6A 5JWHA 4B6EA 1W4CA 1M7HA 3K53A 2OO7A 3NVAA 1TQDA 2XZPA 3FKSA 1JBKA 5DIFA 4LJ8A 1PJRA 2DHRA 1FTSA 2VA8A 1UPTA 5FPKA 1OIVA 1N25A 2DWQA 4F91B 4Q1CA 4Q4JB 3GLFE 2QBYB 5G3YA 4JVLA 1K9MD 3GLFA 2WWXA 3QXSA 2CL6X 2H17A 4UKDA 2AXNA 5EE5B 1KJYA 1YKSA 4Q4AB 5LB4A 2DR3A 5CLLA 1W4AA 1J70A 3X1DA 5HKKA 2BMWA 121PA 1II8B 1NDHA 2ZRPA 3QE0A 4QRHA 5IHPA 1CR2A 3IBYA 4A8JB 4E07A 2OTLB 4RZ2A 3Q72A 2DB3A 1RZ3A 4AI6A 1N0VC 1JALA 1HT1E 1KJWA 2EW1A 4E03A 1Q1ZA 221PA 3O8DA 4LK2A 4AF7A 4PSKA 2GBLC 2GKSA 3NBXX 1FQJA 3RS2A 4BASA 2QT1A 2XTNA 3W6PA 3O8BA 1J90A 2ZRHA 3I72A 2RGNC 3I92A 4Q4LA 4DVGA 4TLCA 1COWA 2CLDX 3GJXC 2IYVA 1F48A 2GJ9A 2QPAA 3WMFA 4DLUA 4R98A 3HU1A 3IPXA 4RD1A 1T9HA 3K70D 4Z8YA 2YINC 3TR0A 5GJVC 4UNPA 5IF9A 4A2PA 4PAOA 2NMVA 5AUNB 1S9HA 4JVMA 1XBTA 2JJ2D 4P32A 2K5UA 2IWRA 3TE6A 4MDEA 2OILA 1P72A 4B4DA 1G8GA 1XEWY 1NMYA 2QAGB 1KO5A 3A1VA 4KV9A 4RD3A 1C4OA 5FTLA 4LOAA 2G0TA 3OJXA 5AN9A 1FP7A 3BERA 2VF7A 2OE2A 2ATVA 4LC0A 2C99A 4LHWA 1ZM7A 4LYJA 1XMVA 2R6CA 3ASYA 2IT1A 5BXQC 4RD2A 2BCGY 1KI8A 1YR8A 2A9KA 4R2HA 4M0LA 3KKMA 2V3CC 2WWGA 4HB3A 3N70A 1D5CA 2G88A 2OCAA 5K8LA 3LO5A 3LO8A 1ZINA 1D2MA 2XJ9A 3W5JA 1ONBA 2OLKA 1ZIPA 2OXCA 2W2VA 4FK8A 5HXBA 4M21A 1TLLA 1IQPA 4Q7MB 2IEYA 4ITRC 3BBPA 3LBIA 2ZXUA 3CIOA 1KDOA 2VYQA 2HYDA 2ZRBA 4DCUA 3IBGA 1KI6B 1KI9A 4IDHA 4N0DA 4MYHA 4CEIA 2PX3A 3FFAA 1FMJA 3H84A 1G64A 2WICA 3RANA 2W6JA 3HWSA 2JAQA 4RFSA 2Q3MA 4BZXA 3KKNA 3U7GA 3AGQA 1MABA 3QOFA 2DWOA 1NF3A 5KNDA 1W2BB 2IS6A 5L3SB 4QM7A 4DLTA 1ZC4A 4Q7LA 1P2TA 2IYUA 1BIFA 1L7VC 1KMHA 4TL6A 3WHKA 2ZSBA 2H1LA 1VCMA 1A82A 4A0RA 2QDXA 4Y9RA 2OK7A 1XD2A 3RVBA 4A4DA 2OTJB 2J5XA 4XD7A 4E09A 3QEOA 2HDNB 2F9LA 2G77B 2RCNA 4PZYA 5FOTA 4MRRA 2OAQ1 3SEAA 3ZVMA 2YOFA 3Q9LA 4LUCA 3GP8A 1KAGA 3CZPA 4TQUS 4MGKR 1L8QA 4C3ZA 3OZXA 4RSGA 3U44A 4V0NA 5D3QA 2EYQA 1N0UA 4ESHA 4I4LA 1E94E 3WP1B 1IY1A 4MH0R 1QVAA 4K1XA 4NL4H 5FOVA 1GR1A 2ZI9A 2IHYA 3PUYA 2FZ4A 3BK7A 3RSOA 2ZJ2A 3QQ5A 2QPOA 2ZUBA 1CNEA 3SJZA 2VF8A 2Y8EA 5DSZA 1AKEA 1BYIA 1G7TA 2PLRA 4V03A 3PITA 3PVSA 4D26A 3TAUA 1AJEA 5BW8A 3VR2A 1Z47A 3U61B 1E2HA 1GWNA 4AWXA 1H8EA 4PPQA 2FX3A 2FPMA 2D3WA 1GOTA 1KSJA 4IEEA 2IYWA 4NYMR 4Q66C 3U3KA 2J3EA 5EP3A 1E9BA 3U3RA 2ZJ8A 5KNBA 1AQUA 2Q3FA 2XOKD 1JA1A 1II9A 2Z83A 5AJXA 1G6HA 5KU1A 1CULC 3DOEA 2Z5FA 2QN6A 1E62A 2WKRA 4KLNA 1QFZA 2YYZA 5BYKA 2BM1A 2ODWA 1N5LA 2PL3A 4PHGA 2WV9A 2QM8A 4L9SA 4YAUA 4TN1A 4KFUA 2MMGA 3N2IA 4WXRA 3THOA 2EFGA 1N6KA 5JCPA 1TMKA 1XXHE 3C16C 2O8FA 1UBGA 1PLLA 1XXHA 3IDQA 3QKRB 3VNUA 3K9GA 4R7ZA 3TIFA 1K6MA 2OAP1 4ZIRA 1UKEA 1NY6A 2X8AA 4C0KA 1LV7A 1W7AA 1J2JA 1IN7A 2RGGA 4I81A 3W5HA 4S2EA 1G20E 1QFJA 2RGDA 3I4LA 2VEDA 1SXJB 1W44A 5LD2C 3AVQA 4JLOA 4H1UA 3RHFA 4YDHB 3SR0A 1VIAA 1Z06A 4ZV4A 4GNKA 3K0CA 2P67A 3DKVA 3LXXA 4KFRA 1R5NA 3LLUA 2P0EA 5FI0B 1U8ZA 4BPRA 2ZYTX 5HE8A 1CJMA 2WM9B 2X2FA 3LLMA 4AG5A 4OK6A 1E4YA 5FBWB 4BGDA 3PENA 1R5BA 4IVPA 4Q01A 3UG7A 5JWOA 3C41J 2QP9X 3G5UA 3MWJA 2B7BA 1XTRA 2H16A 3QXHA 5C2JB 1HURA 1M2OB 3OFND 4A9AA 1GAQA 2WWYA 3JVVA 3ZD6A 4IJMA 3TVDA 2WIAA 1OFUX 1EP1B 2ORWA 4UXHA 1LF5A 2QMUA 2CVFA 1RC8A 4U9UA 4KVAA 2EFEB 1IY2A 2GZDA 4JKYA 3ZBTA 621PA 1Z2CA 3KKPA 1W35A 4CZ2A 5FH9A 2WMOB 1QVRA 4Q9KA 4A0HA 2HYIC 4TTPA 5F2EA 3WYGA 4ILEA 2Q6TA 2WSSD 4XSGA 3TH5A 3THWB 1E9AA 3CPWB 2RHDA 1OYWA 3NDPA 5FBRB 4HAUA 2IS4A 2ZUCA 4LYFA 1CS4C 3H86A 4MRSA 1X8KA 2CL0X 4LCBA 5EP1A 3TLXA 2XNDA 4OQLA 3CW2A 3UMRA 4EFNA 2XJ4A 1ZM2A 1Z2AA 5DN6A 1OKKD 5E4FA 3I61A 1KI1A 5C1BA 2HCJB 1S8FA 4DLYA 3X2SA 4F4JA 1HUQA 2KBEA 4XWAA 1VMAA 3DM9B 1SVIA 2QMOA 4V0LA 3VTKA 3QBVA 1E79D 5H5JA 1JXMA 3WYAA 4P33A 2OLJA 2F43B 4CEHB 2AFIE 3WBKA 2EQBA 3IPYA 1ZU4A 1OLOA 1QF9A 3WNDA 4L8GA 3UMFA 1DOAA 4DT1B 4LYAA 4A8JC 2KBFA 2C9YA 4DLRA 1BMFA 5IT5A 5C18A 2DPXA 4NCJA 4TMVA 3CRVA 1U9IC 4LJ6A 4PTLA 1XD8A 2FGKA 5H1YA 3HPRA 3OAAD 1T5IA 1VQ4B 1N5KA 3CPEA 2ZVQX 2LCFA 4Q1EA 3S1AB 1VPLA 2RC5A 1EWQA 2Q0HA 3BFVA 3HDTA 4V0KA 4HAWA 1ZM9A 4IW3B 1FW6A 1ODFA 1CXZA 2A2ZA 1B2RA 1S3GA 2O8EB 4A36A 4P31A 1KSGA 1G5PA 1A1VA 5FPYA 3CNNA 4HZUB 2RGBA 1J8YF 1TUIA 1XRJA 3CH5A 4TMKA 2R9VA 1F20A 2ORVA 1X86B 1VQ5B 2YHSA 2QAGC 4FMDB 3RLFA 5CB8A 3QPUA 1SKQA 1GKIA 3KUCA 3FKSD 4CW7A 3CCQB 2JCSA 1KRHA 3HYRA 2JJ8A 2BWJA 4KAXA 2YOHA 2R44A 2ZE5A 2J59A 3GEHA 2W58A 3FPAA 4QM6A 3RYTC 2ZSAA 5KTYA 3T1QA 3W2GA 4OL0A 4ARZB 1JPJA 1NSFA 5GJWC 4YMVA 4ZGQB 2IYLD 1DAGA 2VTKA 2H8KA 1Z0FA 3KXIA 4HAYA 2P2LA 2CDNA 3UMSA 5EJEA 1AZSC 3NH6A 1M34E 4PC3A 2FE4A 3SBEA 5HKKD 2GZHA 2C8VA 4FWIB 3D3QA 3H0KA 4HE5A 4PPNA 1XU4A 1RRGA 4TMXA 1OIXA 1Q21A 1SXJD 3G6EB 4Q02A 3I8XA 4MYUA 1OXSC 3EAQA 3KJIA 3KKQA 2IYSA 4Q1AA 1T3HA 1U90A 1E2IA 2UZ3A 1HQCA 1R7RA 4B3CA 1ZUHA 1G8FA 4JLMA 4Q4HA 1P73A 2QPTA 3C7KA 1XE1A 2G6BA 2Z43A 5AJYA 1W1WA 3MGCA 4Q9HA 1N6RA 3FMOB 4RCZA 1W47A 1COWD 2HCBA 3BRWD 2WVJA 4IHQA 5DISB 2NIPA 2KJQA 3TW8B 4JLDA 2WOJA 4NCNA 3NC0C 3QVUA 4V02A 1S0UA 5CYOA 2YVUA 4JLBA 4JLKA 3KZ1E 3LFUA 1JA0A 2P5TB 2ZRGA 3ZDQA 3CNOA 1DAMA 1RE0A 3C15C 4CEJB 2C9CA 2XAUA 4B3XA 5GJBA 1WF3A 1SGWA 4IOKA 3K0FB 4O3MA 3SYLA 2D62A 3OF5A 3GLGE 2OCPA 3GLGA 4DB2A 4YXWD 2P6UA 3QKSA 3I55B 1OFTA 5CIWA 5B2ZA 3LWNA 1A5TA 3EC1A 3V76A 5E7MA 1AS3A 1A2KC 2ZJ5A 1TF2A 1TF5A 5L3QB 2OK8A 2PCJA 1QRAA 2DFTA 4C7OA 4B47A 1FPMA 3G71B 4LJ7A 1KI4A 3D31A 4HUQA 1XMSA 1XEWX 3CNLA 3TNFA 2GVDC 1RRCA 1U8YA 3CR8A 4PGOA 4DQLA 1M1KD 1HEIA 4NH0A 4G5QA 4S35A 1P7CA 1VIYA 4UNNA 2ONKA 1NRJB 3ZJYA 4UNQA 2VHUA 4B2LA 3LQRA 1U0JA 2OG2A 1YRBA 2ZJOA 5L3RA 2QTFA 4BLSA 4J0QA 3AVUA 2ZJZA 2JLUA 1CNFA 4C43A 1VKJA 4B2PA 1YU9A 4LC1A 3UKDA 1L4YA 1Z22A 1W5TA 1UM8A 4B33A 1B23P 2QEXB 4FD2A 1WQ1R 2YZ2A 5JI3E 2B5OA 3BAFA 1ZM3A 4ZDWA 2GESA 4HEJA 3GLIE 3GLIA 1QBKC 8OHMA 3X1WA 2TMKA 3OEHA 3OZVA 5EXPA 3F3YA 3RAPR 4B48A 2OCYC 1OHHD 5A0FA 3LD9A 3RNLA 3GJ6A 4D4LA 4BFSA 4OI0A 3OZUA 2ZR9A 5G40A 4CT4B 2ZJBA 3PFIA 4YAFA 2ZJAA 2OZEA 3FDIA 3M1IA 4OJQA 3SU8A 2CCGA 4NU0A 2PZEA 2WJVA 2ZI4A 4MA4A 1EWRA 5KUTA 3QF4B 5LBIA 5UKDA 2PLFA 1U81A 2X77A 3AUYA 4MUAA 4B3GA 1CEEA 2B7CA 1Z8FA 2RGXA 3LNCA 5J4HA 5KSYA 3CCUB 3THXA 1ZC3A 2AK3A 1XPRA 1SXJC 4R2IA 3VR3A 2NTYC 4QBFA 4B3DA 2FWRA 2J1LA 3REFA 2GVZC 2R2AA 1JAHA 1R0XA 4NCHA 4MDFA 2V6JA 1Z6GA 3AF4A 3D7MA 3GPLA 3I73A 2G9NA 2A5JA 4NMMA 4TMWA 2MSEB 2H7VA 1LF0A 3ZZTA 5FBVB 4F4CA 2BN4A 4QJ4A 1SULA 5J40A 1Y63A 3M6AA 1DPFA 4G1VA 1M74A 2GA8A 1YJ9B 1AGRA 2ZRKA 1H8ED 1KKLA 2GCOA 3N5CA 1RPZA 1KHTA 4GRAA 1OPXA 2VQSA 2R62A 5JHHB 4RJLA 2FFHA 3T34A 4Q4JA 3RWOA 1GILA 4UQOA 1H65A 1X1RA 5FBQB 2GXAA 4BLTA 1FL9A 3CMAB 1TEVA 4M2LA 2WKQA 1SVSA 2QGNA 1E3MA 2QI9C 2BBOA 4M9XA 1CJKC 1P61B 4JLAA 1B0UA 3DO6A 3LW7A 3QKTA 2JLWA 5KSPA 1W2HA 2CXXA 1YR6A 1XPOA 1FNDA 2OUKA 3WMEA 1G3UA 3C5HA 1E64A 5EZ5A 4LX0A 2VP5A 4BFXA 2Q9CA 2WTUA 2EVWX 4M9ZA 4Q47A 5JZVA 3LBHA 2QA4B 1EX6A 4OK3A 1IJEA 2ZE8A 2I1VB 5FTMA 5JRJA 3TGPA 2YJTD 1H8HA 1HQYE 3DM5A 3OEEA 2ANCA 1ZCBA 3DOFA 1XEXA 1OXVA 3U4QA 2XXAA 2ATXA 1FMLA 1EXMA 1JXOA 5GVSA 3FMFA 4EQ6A 5CK5A 1AN0A 3K0AA 4TSFD 1J99A 1R6BX 2WJGA 1QGZA 3JQRA 1P3JA 3GJ0A 4Q21A 3NBYC 1GRNA 1IXZA 2ZROA 4DCSA 2D2EA 3CLVA 3ZIAA 4PXAA 4URWR 3KXLA 5K8UA 3K70B 1MOZA 3T5GA 1NVVQ 2HF9A 3JVUA 3WP0A 4EPYA 1R10A 5BWMA 3EZFA 3I3SR 1NJID 4PZLA 2O8CB 2GWHA 2CNWA 1K5GA 3TUZC 4XVRA 2QZ4A 4KO8A 1CQXA 2J0UA 1ZNYA 2BKEA 4Q9JA 4ABYA 1Z0IA 2OXRA 4HUTA 2F3TA 1VTKA 1E2EA 2JLSA 1CLUA 1OFIA 1WA5A 2DFLA 3PUXA 3BIFA 4LJ4A 3Q85A 2VL7A 3NTUA 4LHVA 3DL0A 2FZLA 2C98A 5JJIA 4HE6A 2GJ8A 3GJ3A 4FWTA 2QA5A 2XX3A 2ZRAA 4US0R 1TQ6A 1CIPA 4TT3A 2FDCA 2ZS9A 3X1XA 2J9RA 1ZMXA 4PC1A 3HR7A 1QG0A 2RGAA 2O0HA 3JQPA 4IVRA 1E0JA 3GD7A 2ZR0A 1UEIA 4RZUA 4DWJA 1V43A 1HYQA 2E87A 2OEPA 3QG1A 4JBWA 3B8HA 3KTAB 2X2EA 1E2QA 1PV4A 1H85A 2GZAA 2YC4C 2W83A 3AUXA 2VH5R 4XVQA 1DAHA 4B34A 4C0HA 4IXMA 5H59A 2ZJYA 2ZRNA 4AYXA 3NWJA 1NLFA 3FHCB 1TU3A 1NVXQ 1U2RA 1QDEA 2AL7A 3VX3A 1DVRA 1NIPA 2WPDA 3CXCB 2AWNA 4M9QA 1BMFD 2QRZA 4DCNA 3VNVA 2QE7A 1LVGA 3W3AA 4D6PA 4R9UC 4URYR 1EESA 5THXA 2SHKA 1GTVA 4TLBA 1HT2E 3K8YA 2CK3A 3K0EA 2QP4A 3VU9B 1NNEA 4CVNA 1FNCA 3U6KA 4OI1A 4Q9IA 1WBDA 3P4XA 1W2GA 2R8RA 2IYQA 2XTMA 2ODNA 1YZLA 2QQ0A 2ZETA 3MWLA 3SQXA 3W6NA 3DVLA 1VG0B 3FKQA 4D4JA 4OI4A 2DWPA 1KK1A 4OI2A 2QTVB 4BQSA 4PHHA 3T35A 5JRZA 1D2EA 3V4RA 1Q44A 4DDWA 4ESVA 4A6XA 2J7PD 3F8TA 3UXMA 1VQKB 1RJ9B 1N0WA 3CX6A 4DQKA 2J41A 1MO5A 3CWQA 2IYXA 3EA5A 4WVFA 4AG6A 4TLDA 1FNBA 2OBNA 2BMFA 2ZITA 4MYTA 4GOXA 3RC8A 2ERXA 4ZI3A 3F5FA 4ZCIA 3NG1A 3R9XA 2F3RA 1G7CA 3PR1A 4M8NE 5BN5A 4DHEA 3W5UA 3PIRA 2O52A 1W0KD 1S72B 2A5YB 2CJWA 2IYZA 2CEAA 2RB4A 2O5VA 1E63A 2REXB 5IK2A 3A4LA 1RKBA 5DI9A 3AV0B 5CIQA 5EUMA 1CTQA 4QGAA 1Q3HA 2ZS7A 3WNBA 2RGEA 4ASUD 1XCMA 1LW7A 2ODEA 1GVNB 3LV8A 3CC4B 3NEYA 3NIBA 2A5DA 2VP9A 3AF0A 4M1YA 2D7DA 4GDFA 1G6OA 3NEJA 1KJZA 1NVVR 1VG8A 4B44A 2PX0A 2W6ID 1E2PA 1WXQA 1KZ7B 4Q1DA 1DADA 2AX4A 1G17A 3VKHA 1P62B 2WOOA 3CONA 5GVRA 1KSHA 1OT3A 3QKRA 4KBGA 2FN4A 4KU4A 4YMUA 2ZE7A 2FFQA 1HE1C 3EXAA 4TYQA 3RS7A 5K8IA 2VIIA 4JZKA 2ZQ5A 1QHHA 4NYMQ 5HCNA 2FEOA 4JLJA 1XMJA 1UF9A 2JATA 3J81k 2IUTA 4LJ9A 3TRFA 3RRMA 4RKEA 4IDQA 1GNQA 4QC2A 2ZYUX 4WZ6A 5JMTA 2F55A 5HPYB 5EE0A 2F1HA 1M8PA 2NQ2C 3L2OB 3L0IB 1EFRA 3EWSA 1T3LA 1P9RA 3MLEA 5FTKA 5H70A 5C4MA 4WOPA 1JJVA 3UG6A 4D2IA 1KMQA 2P6NA 5EXXA 2ZE6A 2ZRMA 1OH6A 2VSFA 4IFBA 2V1UA 1H42A 2QAJA 2IX3A 3LW8A 1RYFA 1NMZA 2WWHA 5FL7D 4L5BA 3RWMB 5BN3A 2IYYA 1A2BA 3AP1A 4Q03A 1MRSA 2GPJA 1E4VA 4DSUA 3E70C 4G3XA 1KQSB 1IXSB 1LNZA 4PPFA 1KK3A 5FTNA 4HZIA 3IIJA 2WAYA 5KDDA 1KY3A 2D74A 1JR6A 4DRZA 2PJRA 2ZRFA 1JB9A 5TB5A 4PQRA 1ANKA 1VQ7B 4EFMA 3BFKA 1S1CA 1GG2A 3NHAA 2V8OA 4JJZA 1UEJA 1JJ7A 4UJ5A 1OSNA 1JB1A 4W7SA 1CJVC 4FINA 1GVHA 3T12A 4DDVA 3SHWA 2OM2A 2O8BA 1OJLA 2IYRA 4Q7KA 1VYUA 4N3GA 5GV8A 2WSMA 3AKDA 3CKLA 3U7HB 4KHZA 3FB4A 2QMEA 2DYKA 4KYUA 3KJGA 3P26A 3KJEA 1OF1A 4IOJA 4TLEA 3EPLA 4KJZA 2R6AA 1QVGB 2QUZA 3ZQ6A 4A82A 2GK6A 1G7RA 3TQCA 4JVNA 2ZAOA 3QEJA 3B1VA 4BZQA 5CYPA 2FSHA 3P32A 3A37A 4NZYA 1TAGA 3U3JA 4B43A 4MKGA 4B73A 3REGA 3IHWA 4LZZA 3RRZA 2HXYA 3K9LA 3K0SA 2R65A 2HLDA 3CRW1 4HDQB 4ZO4A 1YR9A 3ICQB 1IONA 4FCWA 4BLOA 3EWAA 2MMCA 4PR0A 3ZD7A 4BFZA 3A1WA 1WCV1 1VYVA 4TQ9A 4TZ6A 4QJ5A 4M53A 2IXEA 5DHFA 1AS2A 2RAPA 3MWKA 1JI0A 1R0WA 2BMJA 2F1JA 1G4UR 3AGPA 4JLPA 2CLSA 4DLVA 4RVCA 4NKRA 5EP4A 3ADDA 2NOAA 3THYB 2QT0A 1G3IA 1TUEA 2ZI5A 1NVUQ 4G5OA 3SE0A 1I7PA 4B2IA 3K70C 3A8TA 1HTWA 3SFVA 1JJ2B 1W4BA 1G4AE 1X6VA 4OJKA 4EIWA 5KSZA 1W4RA 4EJSB 5FOWA 2QTHA 2XB4A 4D0GA 4LDJA 2JEOA 1NBME 1NLZA 4BEJA 4TMTA 3FYHA 5DI3A 1LB1B 2BKUA 3NXSA 3T1VA 1S4QA 4ARZA 3KL4A 4B32A 3B85A 3U7EB 1FNMA 2RC6A 1RVDA 3FVQA 3MFYA 5B64A 1BQEA 1GM5A 2XZLA 3B7GA 4I1VA 2PEYA 4DB4A 1KC8D 2BJWA 1GITA 2Z4RA 4U5XA 3E20A 5KDLA 3CPJB 4ZCMA 5FI1B 4M9SA 1XCGB 4BFUA 1V5WA 3GLFB 2VLIA 4GZLA 1Z08A 3RRNA 4PX9A 5TY0A 3E5HA 4W9MC 1XF9A 1ESNA 4O25A 4NE2A 4P6VF 4DLZA 1QUEA 3OIUA 3Q7PA 4JLVA 1KD1D 1XTJA 2JDIA 1RYHA 2BHRA 1AS0A 4MKIA 4ZDKA 3AVOA 3TQFA 4BLQA 3RABA 3MWYW 1QX4A 4Q1FA 3AB3A 1Z6AA 1ZD1A 2QNRA 3SYKA 1QH0A 2NO7A 2VP6A 1Q81D 1QG4A 1YR7A 1E2JA 1MKYA 3MJRA 3MMPA 3QJYA 3QXXA 3ZIAD 4BLRA 2MSCB 4OQMA 4Q18A 2B8TA 5AJWA 5CITA 3GJ4A 4Y7CA 3DZDA 4O2LA 4ON9A 4W5WA 5FR2A 2IXGA 1DAEA 4GBMA 2GCPA 1KO8A 3EZ6A 3CZQA 3L0SA 2NZ8A 1MT0A 2QG6A 2X19A 2A5GA 3AVPA 1NN1A 5KPDA 3V00A 2UVQA 2VHTA 3AF3A 4IVQA 1MR3F 5KYKA 4TL9A 1E1QA 3DMDA 1US8B 4M1WA 3QENA 1PUIA 4QGFA 4NP6A 2V7QD 4DXAA 4FMBB 3I62A 1U99A 1GDDA 4I1UA 2AHOA 1P9WA 3CR7A 4Z54A 3NHBA 5TV2A 2GBLA 2ZSDA 4TTRA 4DUGA 5SZKB 1VQMB 3QPVA 4HSEA 3R7WA 4Y0AA 2RGNA 1G8HA 2FSIA 4DLXA 4EPVA 2JJ1A 1SVMA 3CMEB 3CC7B 3TK1A 4Q19A 3KQLA 3B9PA 4F93B 1FZQA 5HR5A 4PSVA 2OCBA 521PA 3TW4A 5H68A 1XTSA 4E22A 1AMOA 1N6IA 5E3HA 1A7JA 2AN9A 2BSAA 4C0LA 3V9PA 1X3SA 4Q1BA 4QHSA 2C77A 1LS1A 3HPQA 1TTTA 4K81B 4RZ3A 3BWDD 3T5DA 2CMKA 4FXPA 3A6PC 2BV3A 3WY9A 1NJFA 1G16A 3FWYA 4CEIB 4L16A 2VNKA 5J47A 1Q1BA 2ZU0C 1EFCA 3HYTA 5BQ5A 3W8RA 1XEFA 3DPUA 3MSXA 2QY9A 4RFSB 1W48A 1S96A 1NKSA 1MABB 4Z1MA 1E2GA 1VHLA 4C30A 4B76A 5FOXA 2XTZA 2I4IA 1U0HC 3CX7A 1IN8A 3QF4A 3CCSB 2ZRLA 1KMHB 2YC2C 3SJBA 2CHVA 2OBMA 5K8TA 1Q0UA 3TBKA 3QFSA 2J46A 3PEYA 4PANA 4W5JA 3P20A 2NZJA 3K09C 1XDBA 3DDCA 4HLUC 4NCIA 1QFYA 3QE2A 1G19A 2HF8A 2WJIA 3CF2A 2KWIA 1E99A 3IHLA 5JS8A 2NO1A 2BMDA 5CK4A 1WMSA 3QBTA 3U44B 1G3QA 2V6IA 4EH1A 3UIEA 5FPTA 1NSTA 2FFAA 3LVQE 1R4AA 3FHOA 5JWRA 2JLYA 4YDSA 1OB5A 4GOKA 3ZGXA 4P4SA 4DC9A 1CRPA 1VQLB 2CBZA 1Z0KA 1VCNA 2FFBA 2VYFA 3AEZA 5AK0A 3I56B 3MUFA 5EXTA 1DEKA 1T0HB 821PA 4AYWA 3BXZA 1FX0A 1UJ2A 2Q9AA 2ZPTX 1KDTA 2ZRDA 2GJKA 4F92B 3K9NA 3PG5A 2WWWA 4TYYA 4XTCS 5HZKA 3GLHE 3GLHA 1TNDA 2BEJA 4IFEA 2QMHA 4XJXA 4M4SA 5JSZA 2CHQA 3EA0A 4AURA 3ECCA 4GP6A 4WXPA 4JKIA 2I1QA 5ELXA 1E98A 2P65A 4KBFA 4D0NA 4ZGNB 3W5IA 3I5XA 2RMKA 3BFXA 3U3OA 4ZDJA 4GMXA 3HU3A 2IUUA 1OIWA 1XTIA 1P2UA 3WNCA 4TL8A 1R0YA 5TDHA 2QU8A 4FIDA 1EX7A 1P4SA 1T8TA 4OKSA 3BS4A 1UAAA 3TSOA 2B6HA 2V54A 2O8DB 2XNSA 4ZIRB 1FDRA 3QF7A 3RDPA 6Q21A 1QVFB 3SDZA 1DARA 1OH7A 1GRRA 2FSFA 4DDUA 3LX5A 1E2DA 2ZS8A 4EAQA 2EWWA 5D3MA 3UANA 1W0JA 1PUJA 1AQYA 2ZI7A 1D6JA 4DKXA 4HDCA 1SM4A 1GNRA 1LTQA 2AR7A 2JJ2A 5E7IA 2JLXA 4D25A 1FTNA 5KHOC 2DETA 2DBYA 4WZBE 4D81A 3CC2B 3X1YA 2EFDB 4HAXA 3A1SA 1EFTA 4NPHA 3OE7A 4DSNA 2BPOA 3KX2A 4TWZA 1A4RA 2UZIR 5G3ZA 1KDRA 3QXCA 4NYIQ 3EPHA 1OGIA 2BIFA 1W49A 4B3BA 2GEUA 1YJ5A 3SQWA 2AFHE 5FUVA 3T1OA 1QHSA 3AKEA 4BRWA 3PCRB 4DIDA 5F9HA 4CIDA 1G3RA 3TAHA 2QQEA 1VDZA 2IF2A 1DS6A 1ZUNB 5HCIA 3L8ZA 1E0SA 4EJSC 2OFOA 4OHYA 3K9HA 4PC2A 5EXSA 5AUQA 1UDWA 2W6JD 2ZUDA 3T06B 1U94A 3ZVNA 2CE7A 4U00A 3U6BA 2JGNA 5J4LA 4POAA 4AC9A 2WJJA 3ND9A 3PUWA 5CLQA 3HJNA 2Z4SA 2ZEJA 4G1UC 4P4UA 5GV7A 4C2UA 4O2RA 1AA9A 2KI5A 4YC7A 3LBNA 2BDTA 2QGZA 1LY1A 1MO6A 4DIEA 2ZR7A 3W9YA 3R9IA 1W36B 1GO2A 4JYBA 1Q1QA 4YHBA 1R2QA 2WWFA 3LRPA 1SZPA 2CHGA 2QTZA 4HLDA 1UKZA 2AXPA 3HU2A 2GF0A 2HLDD 4XD7D 3A4NA 4JVSB 5EE9A 3W90A 5TXGA 2H18A 3VU9A 4XWOA 1WRBA 4A15A 1II0A 3P27A 5FBLB 3FFBA 3EARA 1T0JB 1TEXA 3FE2A 4LV5B 4URXR 1NG1A 3FHTA 2GJAA 1F2UA 1N6NA 1Z29A 2EFHB 4JT2A 5B57C 1D8TA 1E2NA 4GP7A 3OESA 4II7A 4F38A 1GNPA 2CRVA 1QZXA 3CF6R 4JBYA 1VG9B 4JIMA 4TL7A 4B6FA 1NIJA 2Q21A 5SZIA 1A8PA 1Q12A 2PIAA 1GL9B 5DH9A 2J0SA 1CJTC 1DE0A 5IRCD 3CPHA 4PQYA 4B75A 2QBYA 4LBVA 3KB2A 2C78A 4M1MA 3VR5A 4Q4AA 1G3MA 4QL3A 1GKUB 2FGJA 1J8MF 1II8A 1BO6A 4JMPA 2GEDA 2V4ZA 1HH4A 1GP2A 2G3YA 4A92A 4A8JA 2QSYA 3EZ9A 4LRWA 4DBLC 1Q20A 1U9IA 3M0EA 5EE1A 2QROA 4M1OA 4EDHA 5EQTA 1IN6A 2B8WA 2XOKA 1RRFA 1Z07A 4KSBA 4DCTA 4PO1A 3AVWA 1EFHA 4DJTA 3U60B 1AKYA 1BKDR 3SNHA 2VO1A 1T5LA 4I1SA 1YQTA 2NO9A 4HLQB 4URZR 3B1WA 3C8UA 1YZGA 1UBCA 4NYIR 3AH8A 3QPWA 1ZW6A 1GJRA 1DG3A 1P2SA 4Q4HB 3ZVRA 2REBA 1D9ZA 1TVCA 4RCYA 1WDTA 3OW2B 5B30A 3QY0A 3ZZ0A 1R8QA 2QAGA 5CDFE 2PCLA 3L0OA 5CDFA 5CB6A 2A30A 1BJKA 1C1YA 5KOYA 2O0JA 3G4SB 3JZMA 4EUNA 3L8YA 1NL3A 4XTRA 4JSTA 5FFMA 2RKOA 3QXJA 2CNDA 1Z0JA 2N1BA 2ZRIA 1E6CA 4OHXA 4MRNA 2BMEA 4G5GA 1YI2B 1U98A 4X8HA 4BPBA 4MKFA 4QHTA 1QUFA 1CR1A 2PJZA 3OFNA 1E1QD 4I99A 3TUIC 4PAQA 2JIZA 3AF2A 5AWFC 3GLGB 4QG7A 1AGPA 1Z3IX 3QKSB 2GNOA 5C46F 1JAIA 3FMIA 3PUZA 4KODA 3WXMA 4FW9A 2VSXA 1N6HA 4DUGD 2XNDD 5BYJA 4G01B 2QSZA 2W00A 4PSAA 3OIVA 4MRPA 4EPXA 3U4QB 1KI6A 1S9DA 2WSSA 4C7OB 4DZZA 2ANBA 1I4DD 1SHKA 4D80A 4HUQB 1M6NA 3BE4A 2EFCB 5DN6D 3ZVLA 4V0OA 3CCLB 4TYPA 4HB0A 1NKTA 1ZVQA 2VP2A 3NH9A 3LAWA 3W8NA 4OQFA 5JI2E 1W36D 3AVTA 5JJKA 1P2VA 2JASA 4KLZA 3AVYA 4IOLA 1IY0A 4GL2A 3CCJB 3SJAA 2QP3A 3BB3A 2OFXA 5L3SA 5FOUA 3B1XA 3DKPA 1I2MA 1OKKA 5EP2A 3LA6A 2R6HA 1EP3B 1KNXA 3KQKA 3FOZA 4UNSA 1G8PA 3RRYA 1Z6XA 4M1SA 4K46A 4JSYA 1ZUIA 2BC9A 4C9BA 3QI2A 1E79A 1X8LA 1KIMA 2O0KA 1KK0A 3KFVA 4JT4A 3TMKA 1ZU5A 2VP0A 2GCNA 3KJHA 4JL6A 4NONA 3GLIB 4GZMA 3BJIC 2C96A 4Z1MD 1N6LA 5JECA 1GUAA 4IEIA 3EW9A 3LQQA 1VQOB 2IC5A 1VQ6B 2ZRCA 4IOMA 1EWYA 3CB4A 1HE8B 2C03A 3VR6A 4QBHA 4QHYA 1DG1G 2VNHA 1BX0A 3OAAA 3KB1A 4N3NA 5A5GA 2J87A 2JLRA 1E32A 1MH1A 4OHVA 2YWGA 2WJYA 2QTLA 3CO5A 4RD4A 1NN5A 5CM8B 3NKVA 4JL8A 4PHTA 3RS5A 1Z6TA 4URVR 3BGWA 4Y9UA 1YHNA 1IN4A 1M7BA 5FA6A 1KY2A 4L9WA 3FJOA 1JECA 2BEKA 4XIGS 2GEVA 2R6FA 1G5TA 5TARA 1SKYB 3B6EA 1Z5ZA 1G291 2VNJA 3B1ZA 4MQBA 2HEIA 2ZYVX 4G0NA 2J45A 3LH5A 1E2MA 1NY5A 3IIKA 3K0CC 3MD0A 3TKLA 1FOEB 4CRWB 1QHYA 1Q57A 5TMPA 3T15A 1Z28A 1K8AD 4BFTA 4LSGA 3SS8A 1OFHA 1J7KA 5E7JA 2DERA 1N8RD 1RRPA 2MSDB 4LY6A 4BFYA 1XWIA 5JS7A 2VHQA 2GCOB 1BH2A 3E1SA 4QGHA 2W2XA 5A4JA 1G1MA 3CD6B 4IKEA 4HATA 1WBBA 3W2FA 1YVDA 2B21A 2OHFA 1UBEA 1D1NA 1VHTA 4P0TA 5FTJA 3W3ZB 3GEEA 4P4TA 1TF7A 2VRWA 5DYGA 3IILA 2IBMA 2YWHA 3OZWA 3OHMA 3KKOA 3N2EA 1SXJE 4E5UA 3FPKA 4KSCA 1SXJA 1E0KA 4KITB 1JQJC 1XP8A 2QEQA 1U0LA 4PQFA 2YV5A 3QKUA 2C9OA 4IRUB 4ZKEA 2G1JA 1X8JA 2FV8A 2IEZA 3ONWA 4A0GA 4LYHA 1QGAA
chains in the Genus database with same CATH superfamily
1IOZA 1XEXB 2ZKLA 3OJCA 1WVMA 3KS9A 4MR7B 5T3YA 4GLOA 3U3DA 1NB0A 3ZV6A 3G9ZA 2XTAA 3K1YA 4K1LA 1W36C 3A6EA 1M2OA 2J3KA 3K0AB 1Q83A 2HJSA 3ZWCA 4X94A 3U5TA 3PUJA 4UJ3A 4AWBA 4G1FA 4CU5A 4ZOAA 4I4CA 4WWVA 4F7DA 1PKXA 1TUGA 1BE0A 2PFGA 3LY9A 4BKRA 1ISRA 2EAUA 3HR8A 1XAHA 3PXUA 4QU8A 2YJ6A 3SXUA 5BNZA 1ETHA 4P5PA 1QGYA 2Z04A 1C1DA 4LBWA 4FXUA 1YZKA 2B20A 2O50A 2XSZA 3AUTA 3OCCA 1TU0A 3LYHA 3S2ZA 3THWA 3H94A 3ZH9B 1XEAA 2B4TO 4YA6A 1OH8A 3F9RA 1H0KA 3FCCA 3AIIA 3OJFA 3QUSA 5EA2A 1Z5UA 2FSVC 1E9SA 1Z82A 1CR0A 3OUZA 1W46A 3PHBE 5F1OA 4F96A 3BSFA 4D4MA 4ZQBA 1H66A 4R4JA 3LHSA 1EE2A 2J0UB 3DOIA 3F49S 2FSPA 4QX6A 3T7JA 1UC5B 2BKXA 1E9VA 1AXGA 3UXHA 3PEWA 5K0BA 3G89A 3I37X 2GYYA 1ZGZA 2JIBA 3LL7A 2D54A 3O47A 2N75A 3DP7A 1Z2EA 1RBYA 4TXLA 4RH1A 4EFDA 1DGQA 4M1TA 5GGXA 2DRIA 3C74A 3OEHD 4BO2A 1RYNA 1RXUA 1XFAA 4KYIB 1JRLA 3EZ2A 3I42A 4GC9A 1O94D 5TF0A 2VAXA 3QKWA 3N7UA 5LOVB 4YONB 5CCXA 1H0RA 2FU5C 5IAJA 4NLLA 3GZNA 4J2HA 1HYEA 1QTIA 1RAIA 3PQ2A 3GELA 2YV3A 2E89A 3GPIA 4HNAA 3GEIA 3AVXA 2G83A 3C4JA 1WE2A 3UAXA 2FEXA 2BFAA 5KW9A 4XDGA 1E3JA 4ZVLA 3TI7A 4RTQA 1BE1A 2WMDA 1I8TA 1TTHA 1XKXA 1Y5LA 1JS1X 3NWPA 5J3JA 1OHHA 1IHPA 2AZMA 2B92A 4M36A 3DBIA 4TV8F 3AVVA 4CM6A 1TK3A 2PH1A 3DXFA 1QQBA 2OVFA 4J4HA 4NDZA 1ISHA 4OQXA 2BVNA 1EGVB 2WHQA 3I53A 3USCS 1ZP6A 1YRQA 1UZUA 2PZGA 4QARA 1IXRC 1NNLA 3ILVA 5CG1A 1Z6YA 2CLHB 3EWIA 1ZCJA 4IIEA 1YJ8A 4D74A 3ON5A 1LBQA 1ONNA 2Q4TA 3NTXA 4NC9A 3MAAC 3RU2A 4PNEA 1WZ2A 4BJHB 1C0IA 2EIXA 5JO9A 3IELA 3U62A 1YIOA 2FWAA 3EXIA 4J2OA 2F6RA 2UUCB 3U4IA 1NFRA 5FLKA 3WNQA 1RFLA 3K7EA 2Y66A 1T6XA 3HWRA 1JZQA 5CYFA 3WQZA 3RF6A 3SF8B 4Z1OA 5LQMA 3KQUA 1TOAA 4J0EA 4EI8A 4G1EB 1NMQA 2WZPP 4HTFA 4D4GA 3LXRA 5LNK6 1BAPA 2CW5A 3PRHA 4REOA 1JBEA 1OCEA 3SJUA 1NHGA 2XVXA 3MN1A 1NI3A 5HF5A 1BJRE 4IXDA 2P9JA 2Y2UA 3R9XB 5BVHA 4YRIA 5F4MA 1NUAA 3GVKA 1GUYA 1KH2A 1MO4A 2E49A 2FZGA 3NTOA 3RHSA 4GOMD 3FF1A 2NUAB 2VBUA 2BR5A 4JJIA 2ZTSA 4PIVA 1AU9A 3GT4A 1GPBA 5GZ1A 4EKIA 1JKIA 1YCHA 3CLHA 2QUBA 2WBLC 2O5CA 3QFTA 5AVQA 2H1SA 2H4YA 4L1KA 4Q4HA 3UGQA 1PJ6A 4PS0A 3AINA 1W76A 1GIAA 1U0EA 1ZHHA 1QO9A 2WZBA 4K40A 1QYWA 3K5WA 2GF9A 2LIVA 3T7TA 3K2BA 2BRUC 5F1KA 2JF0A 1UBLS 1UFQA 2B6NA 4D0RA 4ZOBA 2XD9A 3T0GA 4UXJA 1G1AA 2C2OA 3KPYA 3C4QA 4KIUA 2C7QA 4XYLA 3COZA 1J9EA 1Z4KA 3DMHA 3D7RA 2CBXA 3KR1A 2K7ZA 3HJBA 1WOOA 4M83A 3RVSA 4F5YA 4Z6KA 1F1BA 4HJRA 5E1OA 4GG1A 1W581 4L9AA 1QHHB 4M3NA 5BSMA 2CXQA 3RS3A 3TIGA 4C88A 3FTQA 1QP4A 1XPUA 3SIWA 2H7CA 2BTQB 5BPFA 5FAXA 4PLHA 1N5IA 3P7MA 5FPSA 1EKXA 2FZWA 4Y6OA 1XAJA 2R751 5L7YA 3PQEA 4YHHB 2H0AA 3M34A 1P60A 1OJ7A 3ZBUA 2NZYA 4ENSA 5A3JA 3K4HA 1NUSA 2Z2JA 4MGZR 5HRAA 1U8FO 2ZQYA 4BL5A 3GFRA 3JV7A 5ADUS 5J9FA 1QOQB 5EJ4A 1YITB 1PKEA 1Y5MA 1N34B 3CRZA 1XTTA 4QBTA 3I2YX 5F3DA 1NBWB 3M89A 2IPOA 3BDVA 5KYXB 3ZLUA 4F85A 3JQ8B 4XVUA 3DV2A 3PHLA 4LG1A 2VUSA 3LMKA 4O2AB 4ZT6A 2EHDA 1Z7BA 2QRJA 4IDGA 2NMVA 4YQFA 4KAJA 1NOKA 3D59A 3QVXA 3HB0A 4W1PA 1KZHA 2ZJ0A 4FI3C 4Y7DA 4YQZA 4UM7A 1TFUA 4JLNA 3UXYA 1SK8A 2A57A 3O84A 3NDJA 4ETIA 2IE8A 5EE3A 3BWYA 1E9FA 2VC2B 3V7NA 4JK3A 5JCOA 1QHNA 4KNWA 5JNLA 3O38A 4MVXA 5HNKA 4G26A 4WBNA 3AFHA 1U1EA 2J3JA 5DEOA 4HAVA 4R3UC 3LDAA 2VF4X 6LDHA 4HK4A 5AK6A 1YC2A 3SZLA 4OPSA 4WOJA 3O8CA 1ZPDA 2VZ9A 3PICA 4D4IA 1C9JA 2WHEA 4F97A 5BO5A 3EIXA 3Q9SA 4LVOA 5CX4A 2EX1A 1FRQA 4KKVA 1FP6A 5G41A 1K7SN 1KVQA 1SCJA 5B3JA 4K3UA 4QKQA 5A0VA 4H77A 2DT8A 4J4BA 2HUNA 2QE7D 1ST2A 5DO9A 1HE4A 5ANRB 5J2TF 4D9MA 1WBJB 3JAWA 3GFSA 1R8XA 3FG9A 1Q1EA 4R41A 5EWJA 2NGRA 2QDKA 2CK3D 1SVOA 4ZARA 4E2ZA 2FA9A 1C0KA 1GTZA 1ZRHA 3GW8A 4KFTA 4BO1A 2PE3A 3VAAA 4YJFB 1RYZA 3ZG6A 5CUQA 3OJLA 3FGPA 1R74A 4PG7A 1XD2B 4MIYA 2I34A 4ITVA 5HCUA 3WSWA 1WSVA 1P5ZB 1YMUA 1GG5A 3ZWXA 2HY7A 5FXMA 2X5OA 2BGIA 1FFHA 1V35A 3VVCA 1K88A 3HV0A 2LWIA 4TKVA 5BORA 3C3JA 2EV9A 2EZTA 2NYAA 4DY4A 2WM2A 2IVZA 4G07A 1K8RA 3REQB 1PT5A 5HYVA 3P5BA 1CZRA 4RLSA 4D0SA 3VBCA 4UMFA 2ORIA 2VHWA 2QTRA 1CU1A 4UM5A 3HQ4O 1K3TA 5JS1A 4XVCA 1T91A 4JP2A 5EHGA 3WK8A 4F9TA 1Y98A 1WB9A 2ZWVA 3QPDA 1DQPA 3ZDXB 4EYOA 3PNSA 2D6FA 1QSGA 3DDOA 1CSEE 3LYLA 3PB3A 2FMKA 4PC6A 2G06A 3EN0A 3MJDA 3TDNA 4C20A 4BEBA 1IXYA 2PUEA 7MDHA 3MTEA 4C6HA 3ZK8A 5LR6A 5KMGA 4X41A 2YWXA 4LW8A 2H4HA 4UNRA 1JLLA 2VP3A 4GRDA 3SYNA 2VRNA 5I5GA 4C0SA 3R20A 2WF6A 5BV7A 4M99A 5HEKA 1LI4A 4DNTB 2DPMA 3B6ZA 5A9RA 4QDKA 3EUEA 4EFKA 3LQ4A 3GRCA 3QUQA 1HA3A 4ZCLA 1AM4D 3TSZA 4EHHA 3VQTA 1PLKA 4TLAA 2WP0A 3CGGA 4OBEA 5BRJA 1SQ6A 1MB9A 3RGWS 1GL7A 2BUCA 2WZQA 5I3CA 2I3DA 3AUUA 4KDFA 1Y1QA 1WMEA 1E6KA 3ZU5A 4MLZA 4NPCA 4E5YA 4I1YA 1NJ8A 3ESCA 1YB1A 1NFQA 1YMQA 5EHNA 2O0MA 3WYBA 2W4IA 1NYTA 3O75A 1HDGO 1T5DX 2O48X 2UYCA 1JFSA 3TNYA 1W5AA 3C3AA 3M49A 5KS2A 4H1WA 3AF1A 3B8EA 3EQ9A 4BVFA 5A4IS 4EGCB 3PNBA 3QVMA 5IJ0A 2J0QA 5FWYA 3DAFA 1CX9B 2NV2B 4GI7A 1JFFA 1M67A 2I4NA 3CURA 3DG9A 1WX1A 3L41A 2XGJA 2P91A 1P4AA 1B42A 3I6BA 3B2QA 5DXJA 5LC1A 3P9PA 5FF9A 1TZCA 1R0BA 3E9MA 4H3VA 1P0QA 2BF7A 2GD6A 3HCBA 4FEAA 5FA5A 4ZGGA 4FR2A 4UQLA 1G7SA 2YXEA 3P9YA 4KNYA 3FF4A 1A69A 1DRJA 3NWEA 3M83A 3BJMA 5ALGA 4NMXB 5JVDF 4JXJA 2XBLA 3UJ3X 3KQNA 5DX1A 2XITA 3H19A 2VG8A 4W6QA 5LDHA 3E4DA 1KDZA 2O05A 1GDHA 4UZSA 3RHZA 4DNOA 1USUA 4JFRA 4WN9B 3CW8X 3DDZX 2CEKA 3GZJA 3L0PA 1AKTA 3QHPA 2GD2A 4GGOA 4KMSA 3G1WA 4M1ZA 1IOWA 4WK6A 5AVKA 5TMEA 4L73A 1JR3D 4ZDIA 4FFLA 1J09A 1KOFA 1TTPB 2I6GA 4G1BA 5D7BA 3W2IA 1BXGB 1H4TA 1HF3A 3GRAA 3K16A 3SBXA 1C9NA 3O3CA 3UJPA 3E53A 2A1UA 4B3SB 3FWNA 3PXEA 5DBFA 5DN9A 5I45A 1L5OA 4E4RA 1G9XA 1ZNWA 2F1RA 4GSYA 1ELOA 4ND1A 5I7VA 3PZRA 1Z63A 3SKYA 1DDIA 1EK1A 2QW0X 3PHIA 1Q7YD 2Y1DA 4J1QA 2BI7A 4LSMA 2QL7A 1GSIA 3CCMB 1RWBA 4CFZA 1ZD3A 1Y5NA 1UKYA 4NCKA 3R7WB 4IIJF 1QE3A 1Y3AA 2P0AA 1EK0A 1FUKA 1UXOA 3NBFA 5JD4A 1Y6GA 1E1RD 4YP5A 1O0CA 1E2LA 1FDWA 2TMDA 1XZBA 2EX4A 3A4MA 3GJ8A 4DLBA 1NVDA 9ABPA 1OPRA 4EF6A 5COBA 1SIOA 4DNXA 1WCIA 1VJ1A 3LWBA 4PLFA 1H1DA 3C7TA 2ZAMA 2CXRA 3OT1A 3S81A 4G0OA 2CL7X 1C9KA 1BQ3A 1ZIOA 2AFIB 2CT8A 3LVRE 1OZHA 1J1UA 5HFNA 1GL3A 4PZEA 2FE1A 1G21A 3L82B 2OFPA 4JOBA 2I6SA 4HUJA 3G9XA 5ENVA 3TTVA 3OO0A 4DR2B 3TSCA 3CCVB 2LCQA 4KCGA 4JQYA 3V8QA 2ZWPA 3BKXA 3IQIX 1OXTA 1IWOA 2PFSA 3E2IA 5EWMA 3UWSA 4OPVA 3V32A 3VX4A 1CEXA 1BCSA 2P1RA 4RZIA 4AIIA 4BEVA 3HVHA 1NE7A 5ELLA 2BJVA 2UAGA 1DWOA 4Q0MA 4UNIA 1ODTC 4D9CA 2IL1A 3LM8A 4Y3UA 4JBIA 2LTAA 2UXCB 2XYVA 3PPYA 2PAFA 3QSGA 3TFWA 3RC2A 2IPLA 4BJ6A 3BTSA 2E82A 1DAFA 2AKYA 2HMVA 3OQNA 2X0JA 3WAJA 3NBZC 2W43A 3AZOA 2AN4A 2WTAA 3I9V1 5ERYA 3LUGA 3AM1A 1X0XA 3HB9A 1E3TA 4FR5A 3WWCA 2FVYA 4ZAWA 3IP5A 3EVTA 3ITNA 4LDRA 1KWKA 3S8EA 4QPCA 3EMVA 2ECQA 5E3JA 4HGPA 5FUXA 4TRRA 5J4KA 2VTVA 5AKIA 4A0SA 2P7HA 4YRTA 3GJRA 5BY2A 5JNUA 5JTTA 1WUKS 1W29A 4KQ9A 2Q1WA 3I5YA 3MCAA 1SVWA 2GJSA 3H97A 3NOVA 2X15A 4MI9A 5AHRA 5AW0A 1ZO8A 2C7PA 1J5XA 5K6AA 4KI0A 4LPKA 2BBWA 2JVKA 1B26A 2PKRA 1DX4A 3L46A 1G4HA 3C87A 3P1JA 3P0FA 4P4SB 5EYPB 3SOPA 3ZLJA 2FJUA 3CUEF 3A28A 3LKBA 5ALZA 1GTJ1 1V71A 2BEVA 4ZT4A 3TQHA 2WFLA 1V7QA 3IIMA 3ICCA 1GPYA 1SQFA 4R5HA 5SY4A 4YRBA 2AEJA 3IMEA 4H3HB 2A1TR 1OA0A 4FMPA 4GPBA 4KXNA 4L9RA 1CVRA 3G2HA 3GLHB 4PYIA 4RJJA 1XTUA 4F5DA 2OD7A 4JHXA 2XQJA 2ICAA 3W2EA 3ZZNA 3NRJA 4LGVA 5SY6A 2JLZA 1H94A 1I14A 1N2CE 1U9CA 1C7EA 2IOFK 4ETMA 3VO2A 2PXAA 4HLUA 2QORA 3W2HA 1UDXA 4AJPA 3V4SA 2VCHA 4PC7A 3RTEA 3EE6A 4W1SA 1HNZB 1XNGA 2H6EA 2QK4A 2W4MA 3UATA 1M7GA 1E1MA 4PZ9A 4FMCF 4FQ8A 4MB6A 5ILOA 3I1FA 2IS2A 4GI2A 3TJZA 3QFRA 2CNLA 3AF5A 1IMOA 1XVIA 3DXYA 4MQEA 4MW6A 4OHCA 1TL7C 1P1HA 1FTGA 1TU4A 2XIQA 2VHYA 5SZHB 4WA7A 2CLIB 2ECKA 2G82A 2R96A 3VKWA 1R4NA 1USIA 1WNTA 2I9PA 3GEPA 3HNRA 3N8IA 3Q11A 4G4SO 4IZIA 3BH7A 3WQQA 2I2CA 1T4CA 2XUAA 3IBTA 3ASPA 3JQGA 3L8GA 4QQNA 1GU0A 4OHOA 5DLPA 3GL9A 4ZI2A 2IGBA 2EYUA 3JARA 4JQOA 3IAS6 1PJ3A 4NEHB 4TQAA 2I91A 3ZWYA 2G36A 3FTCA 4F04A 5LFAA 5C5IA 1MT3A 2FPKA 3ELBA 1D9XA 2FWIA 2HBYA 1EWKA 3GDFA 5JDCA 1Z7WA 4JNCA 4JP8A 2AWOA 1BG6A 4Z4YA 5ALXA 1UD8A 3HZRA 5F9FA 1SC4A 4IZOA 4IO0A 2WMNB 1T26A 3E7PA 2QG9A 3LT4A 3LSYA 4WZBB 2VTBB 4W9RA 1F6BA 1ZRNA 3PX3A 5H9VA 5A5VA 3W8DA 1T1SA 1U8UA 1U8CB 1GCOA 3FCYA 1VCOA 5ALIA 1QKJA 3BZUA 3WGKA 1D4FA 1SQ5A 4JJ4A 3PDUA 4UAUA 1Q86D 2QXYA 5IEBA 5KWIA 3UHJA 4RQAA 3I12A 3NC4A 3UWKA 2HNKA 1A76A 3M81A 1XZQA 4D43A 1A72A 1XR3A 4LYGA 4WIAA 3C3DA 1XMIA 3HXQA 4PO3X 4HB2A 3WNZA 5HW0A 2RGCA 3DEAA 3GRKA 3KZMA 4BOYA 1F2TA 2VJNA 4Q48A 4CV2A 2H5EA 1B8UA 5KAPA 2HUPA 1C1XB 4DSTA 1SR8A 5BWNA 1FDTA 3D8BA 3DT9A 3VJLA 1V3QE 1KAEA 5EVCA 5BUQA 3NDBB 3QE9Y 1KTVA 1GQYA 1LI7A 1QCZA 3KUDA 3ZEIA 4MDHA 1RZRA 1O95C 1ZOSA 3KAJA 4RTRA 4BE7B 1ZYUA 1F0YA 4R1TA 2QLLA 4EO4A 2K6GA 3R0VA 4NV3A 2VDLB 1JAXA 3TM5A 3W0LB 3C45A 3N87A 2X9VA 1WP9A 3GQBA 2II6A 3QFCA 2FHSA 1GA4A 1PJ5A 2JFPA 1HTTA 2OGUA 1K73D 2ZATA 3CG0A 3K3PA 1YE8A 4M22A 1F3OA 1TIBA 3OA0A 2GN2A 4XLLA 4EI2A 5BRAA 1M6VB 4DMFA 1A9RA 1M1YE 2J4CA 1S2IA 4LJYA 4RJ2A 4V0SA 4HH4A 4PLPA 1FBTA 1SMKA 4PX5A 5CBKA 4YRDA 1DBPA 1Q0PA 3HO6A 1XLTC 5B1DA 4NQZA 3DHWC 1QFSA 4WERA 5F98A 4KLRA 3LY8A 4ARAA 3KXDA 3WJ2A 1Z2NX 2Z0MA 4KN5A 4RXMA 5AR1A 1NLYA 3JZIA 3O4HA 4HS9A 2OCLA 5LSAA 4QPPA 1I9CA 1DO2A 1FUUA 2GUGA 2GXQA 3HY3A 2DCUA 4W6ZA 3I2FA 3NBMA 4BNLA 4DJFC 4KRGA 1XJ0A 5LPNA 3AL0C 4JP1A 4LY3A 1KYTA 3GWGA 1ULZA 3OWOA 1AK2A 3JZAA 4US2R 5LCXA 1XB2A 5BSUA 1J9ZA 1RHJA 3GAMA 2VUUA 3OE5A 3R09A 4KWTA 1HV8A 4O0MA 3ZDZB 2QL6A 4EF5A 3O9ZA 4RIFA 3FKSA 3PT9A 1GUFA 3MMZA 3DBHB 2ZJ6A 3SVTA 3I2KA 4YRLA 3NHRA 2AGVA 3GJSA 1UPTA 5FPKA 1O1YA 4RABA 4FB5A 1N25A 3E58A 4IIBA 4Q1CA 2VT6A 4Q4JB 3CSUA 3X43A 2QBYB 5G3YA 5IYPA 2WWXA 2HNAA 4UKDA 4UHHA 4XYBA 1FYDA 3OURA 2I2AA 1NRKA 3R6WA 2DR3A 4M49A 5KWJA 5CLLA 1VF7A 1W4AA 5HKKA 1J70A 4B4WA 2RKBA 1IE3A 3BIJA 4B45A 2X4GA 2ZRPA 5IHPA 1WB5A 3TJRA 3GIRA 3T1NA 3T7DA 5IF3A 2FN8A 1SC1A 4MVCA 2QRPA 4A8JB 4AN4A 1AMUA 1XRQA 1RZ3A 1N0VC 1KJWA 1HT1E 1V0EA 4QDXA 3DBLB 3O8DA 3FPSA 1SUDA 3WLJA 3RS2A 3KEMA 5IT0A 1UPCA 5L4SA 2XTNA 1KGSA 2UUPA 3M6MD 3O8BA 1J90A 3H2GA 3I92A 4Q4LA 3VR4D 4HMQA 4TLCA 3CZMA 5I7HA 3F6CA 1IZ0A 1ZLXA 2JGDB 3NHSA 4QRIA 4RGYA 1H2YA 4MPJA 4Q7QA 3NFYA 2QPAA 4BYGA 6REQA 4DLUA 2O2IA 2Z4TA 2WIJA 5JXIA 3TR0A 5LUBA 2F9FA 4BN0A 1L1RA 3ILSA 4DJ5X 2XWSA 3LUKA 2XCUA 5F4OA 5KJ6A 2W6OA 4KWEA 4Q1VA 4EBFA 1L5QA 3O4FA 4P32A 2K5UA 1KQNA 1THGA 4E70A 4B31A 4MWCA 4F21A 4NH4A 5ENDA 4B4DA 1G8GA 2YJGA 1Z6QA 2QAGB 4NENB 1KO5A 3A1VA 2WUEA 3OLZA 1QIDA 2G9UA 3P97A 1C4OA 4AFNA 1JVBA 4DQVA 1AC5A 4KMMA 3TCKA 5AN9A 1P7WA 1PTKA 2A6PA 3BERA 2HSJA 3OX1A 4LHEA 4RV9A 5YASA 3UVEA 2C99A 1GFWA 1ZM7A 5E3IA 1XVUA 1J9GA 1RRMA 4G0XA 5KHLB 2Y05A 1MCZA 4RD2A 1AUOA 2A9KA 2PV0A 3HL4A 3LU1A 4RMIA 1SBZA 3H17A 1BKSB 1MOSA 1PZXA 3N70A 4YAEA 4CKBB 3QXGA 3BA1A 1M5UA 3LO8A 1W8IA 1QLHA 4DMMA 3IJ5A 3EZGA 1ONBA 2OLKA 3L8MA 4U2EA 3GN2A 4P1ZA 3GEMA 4M21A 4E21A 4BGUA 1TLLA 4HZGA 4JJ6A 2PGOA 1PV2A 4X07A 2X9LA 4KX3A 3KWMA 2ZXUA 4CE6A 1KBZA 4Z4GA 1A98A 1Y4ZA 1KI6B 3VKUA 1OC4A 4NU8X 3TQIA 1ULSA 2C2YA 1FC0A 2GMWA 1N36B 3VNAA 3I2IA 3RANA 2RK6A 3GGDA 4QLBA 1SUAA 4HEHA 4IHKA 2OV8A 5JROA 2C2BA 4O4LA 1JWLA 4OP1A 4YRJA 3N1UA 3KKNA 3AGQA 4HNVA 3E22B 1XTBA 5FDFA 2DWOA 4B3RB 1A9QA 2P77A 4ID3A 4C6TB 4BX3A 1YL7A 4N18A 5KNDA 4LQCA 4QM7A 4MUFA 13PKA 5IXJA 4Q7LA 2PANA 5ICCA 1KMHA 3WLSA 4IUDS 1E43A 2ZSBA 3V6MA 4N76A 4ZEMA 1G8SA 4A0RA 4Y9RA 1Z4LA 1T3ZA 4HSGA 1DX9A 5EJ2A 3RU7A 5CBPB 4A3SA 3E3MA 3DL2A 2DUJA 4JI0B 4XD7A 5IDXA 2QMZA 3QEOA 3M2PA 3WWDA 5LIRA 4IDAA 2NO5A 4MRRA 4ZCSA 1DRWA 1ZL0A 4I0WB 2HA4A 1PX0A 2BFCB 3Q9LA 4M8IA 1Z37A 1SC3A 1V7ZA 3CZPA 1X7ZA 2XF2A 3OZXA 3QBJA 4ZI7A 4MW9A 1VGVA 2XQGA 1MFPA 1N75A 3FOCA 4JU8A 4NL4H 3ADPA 3LA8A 2B4YA 1BXZA 1S2NA 2FW1A 2LDBA 2FZ4A 3BK7A 3PUYA 5JZ9A 4OXYA 4DWVA 4HIZA 2J4DA 1SNYA 3SJZA 1ULAA 2VF8A 1AKEA 4KKXB 1F12A 5EJ7A 3PITA 3WV4A 3TAUA 1TMOA 5BW8A 3T3NA 5FLEX 5MFPA 2OCGA 1AHHA 3WLNA 1H8EA 2UYYA 4UM9B 2FX3A 1RHQA 4A23A 1MC4A 1U28C 1E4OA 2F8MA 2A58A 3N53A 1FW8A 3O1IC 5CX1B 1ND5A 1PP4A 3ZZMA 3U3KA 4G0VA 5FB3A 3T3IA 4C7MA 2EGUA 2VPIA 3BCRA 5K8VA 4NOLA 3NVMB 1AMNA 3WBFA 1AQUA 2YXLA 2IDJA 2PA0A 3A6JA 4XFJA 1QE5A 1JSXA 2HDHA 3AR7A 5KU1A 2Z5FA 3DBRA 5H80A 3FLBA 1E62A 2XY4A 4LE1A 4WWHA 1RJEA 1ZH0A 1G5IA 3L0CA 4P4NA 4U2GA 2AMFA 4YRFA 2BH2A 3WYEA 1A2QA 1QFZA 3C85A 1THTA 5FQNA 4PHGA 3QTLA 1SC9A 4WK4B 2R5WA 2R87A 3KPWA 4TN1A 1QOPB 4B6PA 1NYRA 3MCVA 3OLQA 4MVJG 4MUNA 1T1GA 2QVBA 3CLTC 2EFGA 3THOA 1N6KA 2PLAA 1DQNA 2RBEA 3DW1X 1LSUA 1TMKA 4D96A 3H8WA 5JXHA 2O8FA 1UBGA 4GI1A 1XXHA 2AI3A 4WGGA 1E3LA 1K6MA 1FB5A 1HSZA 1TIPA 3A6KA 1SXPA 3PGKA 2X8AA 4JNKA 4R69A 1XMOB 1J2JA 4I81A 1EJ2A 3W5HA 1WWKA 3BCSA 3LX6A 2JHAA 4Y6SA 1AKVA 2HMTA 2RGDA 1GPNA 2XODA 3FY4A 1G20A 3N6RA 1PSWA 4TV9B 3GEGA 2FLWA 3DEJA 4H1UA 4M55A 1UFRA 4ZV4A 1JHAA 4D4KA 1X9GA 3V8NA 2P0EA 2W90A 4OHFA 4BPRA 4K9KA 2WM9B 3IP8A 5FYDA 2GM3A 2JLAA 2R8XA 4WHMA 2EKPA 4HQOA 4QUGA 3ZNOA 1RYMA 5JT1A 4Q01A 3RTCA 2Q2VA 3H5AA 3UG7A 3FPGA 3G5UA 5BSGA 1ZA2A 1UIMA 1NBAA 3K6RA 2B7BA 1XTRA 3HKBA 3MWJA 4P7BA 4QVKA 4CODB 1PQ4A 3EMBA 2CF4A 2DUUA 3OO1A 1ZK1A 2NU6B 2QMUA 1FEZA 1OROA 2CVFA 4KVAA 4DGQA 3BDAA 2ZWOA 4JKYA 5JNRA 4RHUA 1O0BA 4CZ2A 1JKFA 5CCDA 5FH9A 2HV9A 1GN9A 1U3CA 3DUWA 4JFAA 4PG8A 1T2AA 1UL1X 3WYGA 3TH5A 2Q6TA 4CKCA 1VL1A 2FP4A 3CVOA 1JDVA 2ODTX 3CPWB 1UXJA 3DWFA 5GONB 1OV6A 4WCFA 2VUIB 1CS4C 5BT9A 2AMLA 3M9WA 4HH0A 5E1MA 1NT4A 1QIGA 1X0VA 2P3OA 1S7CA 2RH9B 1V7CA 3MTIA 4RENA 4N5DA 4OQLA 5KX5B 3CW2A 1GN8A 2XXBA 3I4CA 4QASA 5DFAA 4PG5A 1G2QA 3HA2A 3GN1A 2LDXA 1Z2AA 2G09A 4MW2A 5DN6A 1IEVA 4I4IA 2HLHA 1Y7PA 4N3BA 1BROA 4MPRA 2FCAA 3BMCA 3C48A 1PGJA 3GQVA 2DLDA 1L7XA 3A3PA 5KWEA 2I4RA 2ACKA 1QYRA 4BVLA 1SVIA 4IHJB 1ENZA 2EX0A 4DA8A 1RCFA 4PVCA 3MTGA 1EBFA 1SHUX 2OBFA 3SHOA 2GPAA 3GA0A 2F43B 4D6YA 3O2JA 4CEHB 3L5OA 3ENZA 3VV2A 4M0EA 1OLOA 1QF9A 3WNDA 1UC8A 4H18A 4ZRNA 4DT1B 4AJ4A 2BI8A 3GRRA 4BQNA 1BMFA 5IT5A 5C18A 5JYDA 3RVLA 4NCJA 1MORA 2IDZA 2Y0BA 2QT9A 4LJ6A 5EPOA 4L4RA 1RJGA 1ZGAA 3SP1A 4B1FA 2VH1A 4Z3OA 5H1YA 2VQ6A 3HPRA 1VLVA 2JS7A 3B53X 2IW1A 3W9UA 2HCTA 1DBVO 2ZVQX 5DBOA 3D6JA 1KP9A 1Z2DA 2WIKA 1QONA 4BO8A 1HLGA 2Q0HA 5TC4A 2A4KA 4HAWA 2PL9A 4DA7A 5BVGA 1A4UA 1ZJ5A 2G5PA 3DEHA 4LDQA 3LPAA 4I50B 2WLSA 4C08A 3ORRA 2IV2X 5M34A 1B2RA 4LMRA 3QWBA 4P31A 1KDYA 2V59A 4CMEC 4HZUB 5TPZA 1J1IA 1TUIA 1XRJA 1E8NA 1DWPA 1QWOA 2VDOB 3N8HA 4TMKA 1X86B 1EUCA 3QWIA 4YRPA 3RLFA 5CB8A 1FNSA 1GGMA 3D8SA 3TXYA 4Q3DA 1GKIA 3LT2A 1MJGM 3TD6A 3HBAA 2JCSA 2PGDA 3OVMA 4XIJA 2DVMA 3HC7A 2BWJA 4KAXA 1UPAA 2R44A 2J30A 2J59A 3GBPA 3KEFA 1CUAA 1EM6A 2VHEA 3KR9A 3Q8WA 1ACMA 5K7SA 1BVRA 1QTNA 1SHJA 1ZOLA 4ARZB 2H54A 4YMVA 2UXBB 2ENUA 4QYTA 2IYLD 2CLOB 1R4MA 2PSDA 2VTKA 1PDWA 2MDTA 2P2LA 2ZGVA 3UMSA 3MM4A 1AZSC 3NH6A 3ONVA 4PC3A 2FE4A 4L75A 3L7OA 2WKWA 3PU6A 3D3QA 3PQ6A 5IM4F 3GA5A 1KORA 2DWUA 3EG9B 1Q21A 1XP5A 4JH0A 2QX9A 1ZR4A 3ORSA 4MYUA 1OXSC 2N9UA 3KJIA 4KN8A 2IOQA 2IYSA 1H0HA 4XLAA 3AZPA 2J4FA 2NW6A 3HH8A 4XYGA 5IC4A 3N86A 2ZIWB 1IWPB 1EFDN 4EITA 3BX1A 3UEOA 3T0IA 3DTVA 1V9SA 3JQ7A 1W1WA 3MGCA 3ZGLA 4BV2A 4RCZA 1NAIA 1WUYA 1U0NA 2WVJA 3T4EA 4LQDA 4R2XA 3ESAA 4AJKA 5LKAA 1VHDA 4R40A 1WQ3A 1L1FA 3TW8B 3DMYA 1SVUA 4NCNA 5CYOA 3RAGA 2ZZNA 4P7FA 1CQWA 4Y9DA 4JLBA 3QU5A 1EIWA 2P5TB 3IP1A 3SIXA 1DAMA 3I8OA 1Z38A 3L07A 1TJ5A 3D6MA 4GR5A 4LX8A 4QXPA 2OV1A 3U1VA 3WX0A 3C7DB 1WF3A 1SGWA 4RPLA 1UMDB 4ZAZA 3VZDA 4AF8A 3HUFA 2JCVA 1KYVA 1YNSA 1RI1A 1WD7A 2IEBA 3K0FB 1OI2A 4ZXPA 1DFIA 3TRHA 5CCEA 3C1TA 3QVTA 4ZO9A 2Q27A 1CUIA 4RVGA 4YR9A 2FYTA 1RAAA 4O63O 4QQ8A 3GLGA 4MI6A 1XRNA 2VNAA 5CIWA 4DV7B 1WZIA 3EC1A 4EI9A 4MV0A 4AS1A 4LQLA 1C3EA 4I5IA 2XKBA 5FKJA 1YZYA 1MBZA 1PFYA 2PCJA 5FWAA 5HBRA 3ZWBA 4RVOA 4AZ0A 3PTLA 1FPMA 1O58A 2Q2NA 3EWNA 3GMIA 5CFNA 3CLKA 3D31A 3GMSA 4HOYA 2W2NA 4NG4A 4AO7A 3S40A 2GVDC 3R75A 4MWDA 4WT7A 1FDSA 1ZKMA 1AH2A 2XF8A 4P98A 4BMVA 2O3QA 4S35A 1P7CA 3M6LA 1UODA 3H05A 3ZJYA 2C84A 1ISPA 1B1CA 2IHKA 2X40A 1YRBA 3L6BA 3QU2A 4IV5A 5L3RA 1VJ5A 4BLSA 4D1YA 5BWCA 5IU6A 2FZVA 2X8LA 4J0QA 1YFLA 3WL8A 1BEEA 2GAIA 4FZVA 3ZY2A 3K5HA 2JLUA 4H1HA 1CNFA 5CG2A 3C6QA 1YOVA 3EUFA 1Q95A 2AUNA 3EQ7A 3AJAA 4LC1A 3DV9A 4LMBA 3PEEA 1L5KA 1W5TA 4YCMA 3RW9A 4OOVA 4B33A 1IOLA 5A3RA 2QEXB 1MPTA 1WQ1R 2B5OA 3N58A 1ZM3A 4DIKA 2I03A 3QHQA 2QX6A 3PCTA 4FQ5A 4EDFA 8OHMA 3GT7A 4HYTA 3OZVA 3G7NA 1W19A 3D6NB 3QE3A