4RCYA

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gtp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVAHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rcyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rcyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rcyA01
3EPKA 4AKIA 1KRHA 2HLDD 4JLMA 2DETA 1OH8A 2BJVA 4YAOA 1HQYE 2OILA 1NLZA 1CULC 5EMNA 2CJWB 4TN1A 1SXJB 3H4MA 3KKQA 2UKDA 4EQ6B 4WQMA 3KJGA 3VAAA 5IK2D 1E9EA 3KTAB 2Q21A 5G41A 3EARA 4PC7A 1NBME 3DEFA 3T1VA 3K0SA 1P6XA 3K1JA 5FA6A 4KAXA 3VU9A 1M34E 1QG2A 3KQLA 3TQFA 3U7HB 1I4TD 1W0JA 5JJIA 2OAP1 2VIIA 3OE7D 1N6HA 1KY2A 2WWWA 4QFMA 1AIPA 1ONBA 5FH9A 2IYYA 2QG6A 3GJ6A 2P0EA 4WXRA 4JJKA 1YR6A 1H8ED 4ESHA 1ZW6A 1FPMA 3GLIA 1E2DA 4TYQA 1E94E 5H70A 1OXXK 2D74A 3FYHA 3TVTA 3FGNA 3SYNA 4JT4A 4FCWA 3K0AB 5EE9A 2J0SA 1T5LA 5FPSA 3CCRB 1T3LA 2MMGA 4LC0A 3FPAA 2EWWA 4D81A 1P73A 1K73D 4N0DA 1IQPA 2QTLA 1JXMA 4EAQA 5FPKA 4AKGA 1Q3HA 1G3QA 2VYQA 4UNSA 1G3RA 1ZINA 1G4UR 1L8QA 1SXJA 3GJ5A 1OXVA 2CBZA 3LBNA 1WMSA 2AFIE 4EQ6A 2C98A 2W83A 4NPHA 3A1SA 2J9RA 1SHZA 3FWYA 5CB8A 1KYIA 2IL1A 1KKMA 5L3SA 5SZJA 4IOLA 2P6UA 1NJFA 3B6EA 1P2TA 2XTZA 5LBIA 4B3BA 3BC1A 4HLQB 1EFRA 4D80A 4C0JA 3PUZA 1W2HA 1F48A 3FKSA 4GRAA 4DIEA 1UBFA 2JLXA 4Q4AB 2ZRHA 4MQBA 3ADKA 2MSEB 3VO1A 3CCMB 2CVFA 4EPTA 4Z1MA 3RNLA 3RRMA 4TWZA 4DLZA 2Q9CA 1ZJ6A 3E5HA 4OJKA 4PXAA 2WSMA 4M1SA 1CF4A 4NCKA 4KITB 1QFJA 4I81A 3N70A 1JPJA 3I56B 3GPLA 3ZYCA 4WZBE 3K0AA 4DCNA 1EWQA 1JR6A 1RRPA 1DAMA 3EAQA 1KD1D 2G1KA 2V1XA 3G5UA 5EP1A 1XZPA 1BIFA 2FSIA 2OAQ1 4JMPA 2A5FA 1Z6TA 4JKYA 1B23P 4XVRA 2NTYC 4TMTA 4DQKA 3E70C 1F2UA 3TLXA 4F92B 1U8ZA 4DDVA 2AXNA 4C2TA 3N2EA 4BPBA 4HB0A 3K09A 3A4LA 1ZIPA 1DO0A 3H86A 1VQ5B 1SVWA 2VSFA 3NC1C 4Q7JB 2K5UA 1RFLA 4LI0A 3A1WA 1S1MA 521PA 2VLIA 2H8KA 3R9XA 1WCV1 4JVLA 3T06B 5GV7A 2CHVA 3RS5A 3CCUB 2GJ8A 2QMUA 4HAWA 1T6NA 2W00A 4Q9JA 1L7VC 4Q21A 1XPRA 1TF2A 1G21E 1ZM7A 2QRZA 2FZLA 2HXYA 5FL3A 1ZMXA 4DSTA 3K9GA 1YZGA 3X1YA 2DWPA 2GCNA 2GEUA 2WJJA 4DDTA 1TADA 3LBHA 4LDJA 5DI9A 1XDBA 3KUCA 1J7KA 1NBMA 1EGAA 2AWNA 3P4XA 4GNKA 4ARZB 2JCSA 1GAQA 4F4CA 2B8WA 2R44A 2BM0A 3L0PA 4MGZR 5BYKA 1ZNYA 2QMHA 1JALA 4DCTA 4B75A 4QJ3A 4RD4A 2YOFA 1N6PA 2PZFA 2DFNA 2ZUDA 3BB3A 4LJ4A 3ZIAA 4C0SA 2O5VA 1CR1A 4JLBA 1UDWA 3L82B 4IVPA 4PPQA 1BYIA 4CVNA 2FDCA 1KI3A 1D5CA 4JLAA 1QH0A 2FSFA 4LYFA 1SVLA 3H84A 2UZIR 2PLFA 1KAGA 4F4JA 2QRNA 3B8HA 3QFRA 1XNJA 2J5XA 2ZRDA 1WE2A 2O0JA 2G88A 1G9XA 3QKSA 1D1NA 3X2SA 2JLRA 2IXEA 3AKEA 5EE0A 2WSSA 1AA9A 3ONWA 3SJCA 3VFDA 1Z8FA 1II9A 3TAUA 3R8FA 1UKVY 4TQAA 1D2EA 5TB5A 3RYTC 4ZI3A 1CS4C 2FPMA 2OK7A 1Z2CA 1ZAKA 4A36A 5FOXA 1VQPB 1LFDB 2QEQA 2AHOA 3W8NA 4TSFA 4I1UA 4YMVA 3CC2B 4RKEA 5EUMA 2ODWA 3OZWA 4PPNA 3OIWA 2OFOA 3B85A 3PEUA 4WXPA 4QJ5A 4BFZA 2XNDD 4ARZA 5KHOC 2CXXA 4GZMA 3KJHA 2D7DA 2CNDA 1TU4A 1VIYA 1GKYA 3UATA 4DZZA 1VTKA 1YHQB 5FL7D 1XJQA 5EZ5A 3QXSA 4AI6A 2JA1A 1SVSA 1X1RA 2ZJYA 3GLGB 5CM9C 1U9IA 4DEYA 3ADDA 2H7VA 1KIMA 2IXGA 5LPNA 1E4YA 1QBKC 3KKOA 1EP2B 4XTCS 3SS8A 4XVUA 5FOVA 2XX3A 2QMEA 1OF1A 5JJKA 1Q1EA 2ZE5A 3ZVNA 1N5KA 5IT5A 2GETA 3LQQA 3EWSA 5DIFA 1E0SA 4Q1DA 2W6IA 2PT5A 5D3MB 2OK8A 1FRNA 1G8FA 3OEEA 4AF7A 3C14C 1S96A 2P67A 1NY6A 1W0KA 2YOHA 2ZI6A 3TNFA 1WQ1R 3PCRB 4I99A 4PHTA 5HKKA 2NQ2C 4P4SA 3AQ4A 4GPTA 1W5SA 1YZKA 3CR7A 2IS1A 1E9SA 1Z6GA 4IHQA 2ZM5A 1YRAA 4QGGA 2BPOA 2X2EA 4C4PA 4UJ5A 2AD5A 2RGAA 3VR6A 3ZGXA 1Q21A 2DEUA 5F98A 4Q03A 1KHTA 1J99A 4LJ8A 3FFBA 4OBEA 3ZJYA 5K8UA 1N2CE 5FTLA 3IO3A 1E0AA 2ZQ5A 4HAZA 3P27A 1II0A 2J1LA 4JLNA 1FNDA 1M8PA 3U4QB 3K9LA 5JMTA 2B6HA 2WJHA 3V00A 5FI0B 1DBSA 2OZEA 5TXGA 5B30A 3TSWA 3K9HA 1XPUA 2O8FB 1IN5A 1JJ7A 4EPVA 3OAAD 1WBBA 3I8XA 3O8CA 4U5XA 4LV8B 5D3MA 1K9MD 1TAGA 1U90A 1OXTA 4XH9B 3CWZA 4BFXA 1MO6A 2F43B 1BQEA 1GVNB 1KQSB 5FUXA 2TMKA 5KNCA 5K8IA 1OB5A 5IDVA 1MR3F 2A30A 1XPOA 2CNWD 2VNIA 1QHHA 2NO0A 1KI2A 1COWD 3FTQA 4EFLA 2WJYA 4B47A 1TX4B 4CRWB 1GG2A 4KODA 3RWMB 1CR0A 1CIPA 4P32A 5AJXA 3GLFB 4FN5A 3O8DA 2QORA 5EJEA 4PX9A 4YXWA 2XNJA 3SHFA 1N5JA 2J7KA 5THXA 2A78A 3RABA 2QAGB 4A2PA 4FCVA 5KPJA 1KZ7B 2HCBA 4DDWA 4NCJA 2ZJZA 4BFVA 4JYBA 4BLRA 4Q00A 5B58C 4R2IA 2QDXA 4JS0A 2ZE6A 4OQFA 3LH5A 4O3MA 2C5LA 5AR1A 1DARA 2PCJA 2ZRGA 4BLSA 3RS7A 1E62A 3LBIA 3A58B 4ZPXA 1Q3TA 1OXSC 1R0XA 4OHYA 2F43A 4AYWA 3UMSA 2G6BA 3CCLB 2QTHA 1ZU5A 1VHTA 2VSXA 2QE7A 2J46A 2VQSA 1DAFA 1TMKA 4OQNA 3KUDA 4BFSA 4L9SA 1FP7A 3JZMA 4K8OA 1LS1A 2IYSA 2ZPTX 4Q1EA 3PEWA 2EU8A 2QSZA 3EIQA 4QL3A 3QE0A 4M0LA 4BZPA 1KNXA 4LZZA 3T61A 5K8LA 2A3RA 2FX3A 3KQUA 3V9PA 3F5FA 3B78A 3PVSA 3OIYA 1GITA 4PSKA 2JLWA 2CHQA 2WAYA 1HY3A 1QDEA 2CHGA 3NBFA 4UNPA 3W5JA 4GP7A 2ZRPA 1E1RD 4DBLC 4DB4A 1VYTA 3CD6B 2OG2A 1Q1BA 5JCPA 4L16A 4OK3A 4B71A 1L2TA 2DR3A 3OEHD 1DAEA 2Z6VA 4CEIA 2QNRA 2KBFA 1QGYA 4M8NE 4M1MA 1U0JA 1XEFA 3NDPA 2XSZD 2I1VB 3QEJA 2RGNA 4UXHA 1XRJA 3R9IA 1IHUA 5BN5A 5KSPA 5LD2C 5DLQC 1GVHA 4TL8A 1KI7A 3ETLA 4ZDKA 5EXPA 3SFZA 4TZ0A 2NPIA 3SFVA 1G7TA 3JQPA 1ZYUA 4D82A 2O8DB 1FL9A 1R0YA 2DWQA 1WDTA 2GDJA 2NGRA 2V55B 3I72A 5DN6A 3TSZA 5HR5A 2VP2A 4TMZA 2VTKA 2AFHE 3MWLA 3QPVA 5FPTA 2IYVA 3CMEB 1OGJA 1X86B 4A8JA 3PUWA 4KFUA 1BH2A 4C7OB 1X6VA 2ATVA 1XTKA 4NDZA 5AUNB 4WW0A 2ZSBA 1Z6AA 2ZAMA 4CF7A 3CKLA 2ZETA 1KO8A 2WKPA 4FIDA 1XCPA 3I73A 1UAAA 5DO9A 4RVCA 3NH9A 1BS1A 2CE7A 4KFRA 4DUGA 1T0HB 4OHXA 2ANCA 3KB1A 3MWKA 4C0LA 1FQJA 4DLVA 3WY9A 1NL3A 4XD7D 1ZP6A 3H0KA 4HZUB 1F2TA 2KE5A 1KDTA 2FFQA 4F93B 1G5TA 2EFEB 1G17A 3Q9LA 3T1OA 1AQYA 1W0JD 5KSZA 1H8HA 3IILA 1Z0IA 1EFCA 3FPKA 1YR7A 4MH0R 2F1HA 5F3WB 2JLVA 4GOKA 2JDIA 2QL6A 3BB1A 3BFVA 4GP6A 3VMFA 4PO9A 4AKHA 4OK5A 2YV5A 3W3AA 3BAFA 5M04A 1VYVA 4D0LB 2P6NA 5DH9A 2JLUA 4DLUA 1SZPA 4ASUA 5F9HA 2YYZA 5FOSA 3CCQB 2XXAA 4C7OA 3RAPR 2C96A 2C04A 2C03A 5CLQA 5TVKA 3T15A 2PJRA 1FDRA 4IFEA 3EW9A 2AD1A 1R5OA 1G5PA 2FNAA 2YZ2A 2R6CA 4RZUA 4JT2A 1R2QA 2OLKA 3F3YA 4XJXA 4LRWA 2LKCA 4U02A 3SYKA 3UG7A 3C41J 4MKFA 3RANA 1PJRA 1SXJD 4OJQA 3ZZUA 2QUZA 1E2LA 1W44A 4RFVA 5C1BA 4AYXA 2LCFA 4URZR 2ANBA 1BYUA 5EXTA 4M1TA 2FSHA 4R2HA 2BF4A 1E69A 1ZNZA 2DY1A 4S35A 3T34A 4IJMA 1EFRD 2VHJA 2ZJBA 4QBIA 1AS2A 3FKSD 3AVYA 1RRCA 2WHXA 4I1VA 4W9MC 3QJYA 2WJVA 4Z1MD 4QGFA 1P7CA 1E9RA 1E99A 1BKDR 1OT3A 1Z2AA 2GEDA 4H1UA 4N0EA 2R6AA 1N5IA 1Z3IX 1GKUB 1LS6A 1CJKC 4YAWA 3MAAC 2OXCA 4DIDA 3KFVA 1A8PA 4DCVA 2ZR9A 3NBZC 1G4AE 2PT7A 2A5JA 3K8YA 1GWNA 3FMPB 2REBA 5EP3A 4W5WA 1W36B 5KSWB 3OF5A 1KK2A 4B32A 1XX6A 4HLCA 4ZCMA 5D3QA 1FUKA 2JGNA 2ZEJA 4MRNA 5FBWB 1X8JA 3CPHA 3MWJA 2EFHB 1K6MA 1OFUX 1YZQA 1W48A 2QZ4A 5E3HA 5GJWC 4U9UA 1IN4A 2AKAB 2XB4A 3ZC3A 3FMFA 1OKKA 4B35A 5KU1A 1DE0A 4JBXA 5FBRB 3L0OA 1V43A 4Q1BA 1U81A 4JLKA 3I92A 1XEXA 2CEAA 1OFTA 4X8MA 2O8CA 2C95A 2WBLC 1E63A 4BFUA 5J4YA 1VG9B 2CK3A 4WIAA 4Q9LA 3WP1B 1NNEA 1AN0A 4JIMA 4JLPA 2G3YA 2BVNA 3A1TA 3FKQA 2OEPA 3OZVA 3K0CC 5CITA 1AJEA 4TL6A 2QP9X 1IJFA 4HLUC 1ZM3A 5TARA 1E9DA 1FTNA 3Q3JB 4FWTA 1AK2A 2O52A 4RFSA 1NBMD 1GAWA 2GZHA 5BN3A 4A0RA 5BN4A 2ZRAA 3CF2A 1EFHA 2IWRA 1JI0A 4TL9A 1CJTC 3LFUA 3M6AA 1WXQA 1E9CA 4OKSA 2BKEA 1G6OA 1W35A 1Z6XA 4BRUA 3O8RA 1QX4A 3W6OA 3WNCA 1NSFA 3QE2A 4MUAA 2GPJA 4TLEA 4JLDA 1MO3A 3AVTA 3L8YA 1ETUA 4DCSA 4AWXA 3G82C 3I8SA 1BJKA 2WSSD 1FX0B 3JVUA 3PUXA 4BE7B 4G01B 3CIOA 3ZZTA 2PZEA 2I1QA 4PHFA 4TT3A 5J4HA 4Q47A 2OCYC 1DG3A 2NO6A 3LD9A 5L8VA 2V6IA 5KDLA 2IYRA 2ZI3A 1A5TA 4MYCA 3VKWA 1CQXA 4TSFD 4PC6A 5DHAA 1RC8A 4NONA 3AVWA 1WF3A 3HU2A 2QEXB 1P9NA 3U60B 5EE3A 1E64A 1MO4A 4QBGB 3U3MA 1KI6B 3RS2A 2XZLA 4DC9A 1A82A 2ZE7A 2R6DA 4ZO4A 4N3NA 5DNYB 4ILEA 5E95A 2ZANA 3GEHA 4D4KA 2PL3A 3KDSE 3FVQA 3AUXA 4QM6A 4ZGNB 2GWHA 2BMDA 1D2NA 4A15A 1MABB 3CH4B 2WJGA 1E96A 2JEOA 2Z0MA 3Q85A 5HPYB 3AM1A 2HJGA 1UDXA 3OW2B 4M4SA 1HYQA 3HU3A 3NBYC 4P33A 4Q4HA 3VU9B 4GBMA 3U3JA 4GZLA 1WRBA 4B48A 1FX0A 1IBRA 2NIPA 2W6ID 4WAUA 3W5IA 3EZ9A 1OW3B 2QP3A 3OEED 2GJ9A 1RZ3A 3BK7A 1E2FA 3NG1A 4A82A 3GJ4A 3EZFA 3KQKA 4PPGA 5DE3A 1S1CA 1NMYA 1Y63A 1Z6YA 2D2FA 5HKKD 3GLIB 4IOMA 3QKRA 1Z83A 3EG5A 1T8UA 4JZKA 1IXSB 3ZS8A 2P5SA 4IDHA 3LA6A 1Q12A 4JVMA 1YRBA 4QGAA 4AURA 3TK1A 1DVRA 3M4YA 4MDFA 4NCNA 4PAMA 1CJVC 2OTJB 4KFTA 1W46A 2ORWA 4KBGA 5H5JA 1CNEA 1W47A 1SGWA 5TDHA 4DDUA 4OI2A 3O47A 1ZNXA 2VSOA 4B3FX 2V3CC 3I55B 2OHFA 2VHUA 4JLJA 3U3RA 4YMUA 3A36A 3FHTA 4PHGA 2OFXA 2A5GA 1MABA 1AQUA 5L3SB 3AF2A 1RW4A 4GFDA 5JZVA 5C2JB 2DYKA 4DLXA 1YI2B 1GDDA 3HR8A 1HURA 4XWAA 2ZRNA 1E2IA 4JJZA 4MKIA 2XOKA 2WKQA 1IXZA 2GBLC 1PVOA 3WMEA 3BXZA 4M53A 3QFTA 2ZYTX 4PC2A 3EZ7A 1CXZA 1S72B 2P5TB 4RD1A 1AZTA 3Q7PA 4QXAA 1O87A 1HA3A 2IS2A 5HCIA 3CNLA 3MMPA 1DG1G 2VL7A 4HAXA 1OXUA 2P2LA 3QG5A 2ZAOA 4ZKDA 1TLLA 4JBYA 3DHWC 1J2JA 3FHOA 2FJUA 2ORIA 4TMKA 4WA7A 1KC8D 1O3YA 1R8SA 4YXWD 2W58A 5G3YA 3MSXA 2BKUA 4BZXA 2FPLA 5JEDA 1F2UB 4WZ6A 4B6EA 2EYQA 4DVGA 1SKQA 2REXB 3BBPA 3JQRA 2X77A 3WYAA 1S3GA 2QM7A 2WOJA 3T1QA 4OHZA 1D9XA 1JA1A 2BM1A 3TR5A 4ON9A 3NXSA 2ZRKA 3WYFA 1G8PA 4Q5IA 1ZM4A 4ZGQB 2PEYA 3AP2A 4Q7LA 2GNOA 3W90A 3Q72A 2WJIA 2BCJQ 3KXLA 1XB2A 1DPFA 2GJKA 1NG9A 2PEZA 1G19A 4KJZA 3SOPA 3GP8A 2IYTA 1YZTA 4PFSA 1ZC4A 2J0VA 1OV4A 2MSDB 2RMKA 1DOAA 4LSGA 2JAQA 3C15C 3WBJA 4IDOA 4ITRC 2C9CA 2HYDA 1R5NA 3DPUA 1IB0A 2CLCX 4M22A 2QE7D 1NVVQ 3CRQA 3B9PA 3CPJB 1P5ZB 1ZD8A 2VP5A 5L3QA 2VF7A 4MRRA 3TJZA 1N6KA 1XE1A 1DO2A 1R7RA 3AVVA 1W4RA 4A0HA 4EPRA 1S0UA 1FMJA 1YJ9B 1AKYA 2F1IA 2N42A 4V0NA 3QF7A 4FMCB 3ZD7A 1E9BA 3VHXA 1GR1A 2OUKA 4BZQA 4EJSB 4A0GA 3NVAA 1PLJA 1YZNA 3IQXA 2L0XA 4JVSB 4Q7KA 2P6RA 3AF0A 4ABYA 4URVR 1XWIA 5KOYA 4HUTA 2OLJA 3K0FA 1QVAA 2VYFA 4MYUA 2XTNA 3IIKA 5KYKA 1NP6A 1W2GA 1QVGB 4GL2A 1F60A 4FK8A 3VR3A 4RD0A 3KB2A 3L0SA 5EP4A 3KXIA 2J41A 1TQ2A 3QKSB 2ZRMA 3SEAA 1Q44A 1S3SA 1SULA 3MRSA 4PO1A 5J4KA 2ECKA 2HF8A 1WBDA 4TTPA 121PA 1S8FA 3EPLA 1KJYA 4F38A 1IONA 4H1VA 1E2NA 2ZJ2A 1N6OA 3GEIA 2IYUA 3L0IB 4OHVA 3W3ZB 3LX8A 621PA 4RD2A 1VG0B 4TTQA 1RE0A 4KSBA 1ESMA 1NN3A 5G53C 1QG4A 3OJXA 3P1JA 5DN6D 3DKPA 1PV4A 1XJ0A 3NDBB 1Z07A 2AN9A 2BMEA 3ND9A 4Y0VA 1ELOA 3HYTA 4PHHA 4WZAE 1TNDA 3DDCA 4FD2A 1GZSA 2GEVA 3A1UA 3NHAA 3QKUA 3RRNA 5GADl 4EJSA 4ZDIA 1VQLB 2V54A 4Q48A 2XJ4A 1VG1A 2ZVQX 4E09A 2J3EA 4Q4LA 4V0LA 5CK4A 1YR8A 4B2IA 1J8YF 4MDEA 3RC8A 4BASA 2VZLA 4YQFA 3CC7B 2AXPA 1KZGB 2BMJA 2WIAA 4TZ6A 2Q3MA 2IC5A 3K0EA 3W2EA 1F6BA 3CUEF 2W0MA 1UKEA 4QOSA 3R8CA 2EYUA 4M1YA 1KI9A 2QT1A 3SU8A 1EK0A 3PUVA 2W2VA 1P61B 2ZRLA 2GJSA 3S1AA 4UKDA 3B5JA 1E2EA 4G1BA 1H8HD 1DAGA 2CVHA 3NEJA 1E1QA 1YJ5A 3PQCA 1A4RA 1E2QA 2ZYWX 3V4FA 4BUJA 4GMDA 2JDID 5J4LA 5G3ZA 4P4SB 1ZCAA 1M90D 1FZQA 2QBYA 4CIDA 2NZ8A 4PQFA 1T5IA 4MRSA 3PEYA 1Z0FA 2ODBA 5AK0A 1GJRA 2CL0X 4KV9A 1N6IA 4ASUD 5E7JA 1U2RA 3RS3A 2C2HA 2ZS7A 4M2LA 4PQRA 5FUVA 5KNDA 2QTVB 5AUPB 2GA8A 3E20A 1UEIA 4AG6A 1GO2A 3RLFA 1NJGA 3R9WA 4TYWA 1KKLA 4PC1A 2ZUBA 3UXMA 2YINC 3KL4A 4XVQA 2BGIA 1NIJA 4RSGA 1YJWB 4B2LA 4RY2A 2X3UA 1HT2E 3F0TA 1K5GA 4LHVA 2HMAA 3EASA 5C18A 3I5YA 4KI0A 4R98A 3CB4A 4JSYA 5JEEA 1SVIA 2JJ2A 2R6GA 4HUQB 3RSOA 1KI4A 3TIFA 4XTRA 5J40A 3B1WA 1E32A 2R2AA 3VHLB 5KO2A 1YJNB 1E2GA 4G0NA 3GD7A 3N2IA 1QHHB 4LBZA 2WWXA 2OXRA 2ZXUA 4M9SA 1E0JA 2B21A 2YOGA 1SXJC 3FB4A 5AWFC 3WMFA 5DI3A 3U5ZB 3LW8A 1F20A 1ESNA 2HT6A 3THWB 2V9PA 4D6PA 2JJ1A 4S2EA 3CR8A 2QSYA 2V6JA 2Z5FA 1GM5A 1Q0UA 1PUJA 3WRXC 2WWYA 2EQBA 3TH5A 3SI7A 3HYRA 1OLOA 1KGDA 1GRRA 2IWHA 1UFQA 4ZDWA 3C5CA 4KYIB 3LVQE 4V0ME 4QJ4A 1G5RA 1RRGA 1N6LA 2BEJA 1DDGA 3EIEA 2CMKA 4AG5A 1CTQA 4HUQA 3Q5EA 1EWRA 4IVRA 2W2XA 1VYUA 3HR7A 5KSYA 1QHXA 1YQTA 2CK3D 3BRWD 1JR3E 4DHEA 1XU4A 2DBYA 4LBVA 1DTSA 3VKGA 3QXCA 1RYFA 4ACAA 4AC9A 5J5CA 2O8BA 1VHLA 3LV8A 3LX5A 2ZSDA 1Q82D 3THWA 3OE7A 4I1SA 5LDDC 3REFA 4F4IA 1VQKB 4O2RA 3G71B 1P60A 4R7ZA 4PAQA 4JLVA 4AK9A 1VQOB 2Z4RA 4HATA 5FTKA 2ZRFA 1W34A 1SKYE 3EPHA 3SC3A 1T9HA 1ZD1A 1W36D 5E4FA 1DDIA 2W2TA 1F5NA 4XSGA 2QP4A 3AVXA 1GTVA 1LW7A 1YZLA 4QBFA 3TW8B 4NYIQ 4ZCLA 4B6FA 4CEIB 3PXGA 3VX3A 5FR1A 4FI3C 1NY5A 5IHPA 3LVBA 5KTYA 2FH5B 2V1UA 2PMKA 4M9XA 1QGAA 1KMQA 4IKEA 2F3TA 1KI1A 4PSVA 2ONJA 4TT3D 2NO9A 3LAWA 3UWOA 3CM0A 1JJVA 3N5CA 4HAVA 2D3WA 4XOIA 1I2DA 2QA5A 4IEIA 1P62B 3DVLA 5FUYA 3P20A 4A8JB 4Q18A 1N3BA 4FW9A 4Q9HA 2RC6A 4FINA 1FUUA 4DSNA 4KO8A 4G5QA 3LY5A 3BS4A 2HJVA 3CMAB 4BECA 1FOEB 5SZHB 3SR0A 3ECCA 1YE8A 3GLHE 4IEEA 4C0KA 3AVUA 1ANKA 2Z4SA 5FOWA 5GV8A 2F3RA 2JJ8A 1TEVA 2GAOA 3L2OB 2HT1A 1M1YE 1MT0A 4P6VF 3X1XA 4JBWA 1F2TB 3OZUA 2GZDA 1XTQA 3EWAA 2RH5A 4HB4A 3U6KA 4N3GA 3FJOA 4Z51A 4ZIRA 1AKEA 2HXSA 3EZ6A 1VCIA 2DFTA 1QHNA 1N0VC 1KO7A 3AP3A 4DLWA 221PA 2VPPA 3VNUA 4C2UA 1HUQA 3K0CA 4IDQA 4X8LA 3ZQJA 1CKEA 1SVKA 4MYHA 4UXIA 4EFNA 2O8EA 3BH6A 3CX8A 4C0AC 5JBQA 3KKMA 1KSFX 1LV7A 4PQYA 1XTIA 1B2RA 2FPKA 3THXA 4DKXA 4RZXA 1DEKA 2J0UB 4A6PA 3EPJA 1VQ4B 1FMLA 2XXAB 4NYMQ 4US2R 1GKIA 2HCJB 1QHGA 4V0MA 4PAOA 4X8OA 1G8GA 1NN0A 4W5HA 3SHWA 1T8TA 4DT1A 3IO5A 2RKOA 1G3MA 4FXPA 5CIQA 5AJWA 5E7MA 2J7PA 2JIZA 1Q86D 3LDAA 2XAUA 4YHBA 1G6HA 4DB2A 1XMIA 4FMDB 4A9AA 2VO1A 2C9OA 2RGXA 3PUYA 2O0HA 2X1VA 1JR3A 3C4JA 1V5WA 2BBOA 2J45A 2A5DA 3B1XA 4HI0E 1IY1A 4KBFA 3CONA 4IOKA 1J9ZA 2Z83A 5CYPA 3G4SB 1Z0JA 3UANA 2DERA 4K1XA 3THOA 3CCJB 4I1OA 3RS4A 1XZQA 5FBVB 3W5VA 2WTUA 2WKRA 1KJWA 1Z28A 2YKGA 2QPOA 3CW2A 2RGGA 4IXMA 2KBEA 3GLHB 4FMBB 2C78A 1ZRHA 1XCGB 1E79A 2BDTA 2RGEA 1TUIA 5F2EA 2HYIC 4BFWA 2GXUA 1NVXQ 3W8RA 3P4YA 5FR2A 2IF0A 4PSAA 5KPDA 1BOFA 1FQKA 2J0UA 3FMOB 4UQOA 2D2EA 3JVVA 4C9BA 1G41A 1XMSA 2ZYUX 4Q4JA 5AJZA 2Q3HA 4ACBA 2DWOA 1VQ9B 3D7MA 4JVNA 2EVWX 5EZ6B 3TW4A 1IOZA 3WMGA 821PA 1CRPA 1TVCA 1G20E 2XEXA 1OSNA 1YHNA 2WPDA 4AKEA 1M74A 1N25A 3BJIC 1RRFA 2BMFA 2BC9A 3AVQA 3GFOA 4HAUA 4TQUS 2GZAA 4YDSA 2XB2A 2IYQA 2QGNA 1OB2A 4TYPA 4WOPA 5F9FA 2FMXA 1XF9A 2JLYA 5JCZA 1ZCBA 4LJ5A 4FMCF 1NJID 2WV9A 1XD9A 1Z5ZA 2XNDA 3IGFA 1Z63A 2WICA 4YALA 1ZM2A 3A4NA 3AVOA 1R4AA 3FMIA 2YNMA 2OCPA 3PENA 2WOOA 4NCIA 2BIFA 1JQJC 1XEXB 3OZXA 1KNQA 2O8CB 2PX3A 1QGZA 1IN7A 3SDZA 2Q3FA 2WWFA 2IUUA 3QF4B 3WNBA 4A0FA 3B1VA 3GLHA 4HAYA 4FWIB 1MH1A 1QHIA 4LYJA 4U7DA 421PA 2PIAA 1NRJB 1Z0DA 4URXR 1P2VA 4R71A 1XTRA 1OE0A 1AM4D 3DZDA 1TQ4A 1ZBDA 3KXKA 1SQ5A 2AK3A 2PCLA 3MHPA 4RFSB 4UXJA 3BD9A 1PLKA 1E6CA 3LW7A 1Q1QA 4B2PA 4EPYA 3QOFA 4CEHA 2G1JA 2EW1A 3CO5A 1QHYA 2PLRA 5J4VA 2ZITA 2NZJA 3X1ZA 1IAQA 2ZU0C 3TQCA 4LX0A 1P2UA 1QFYA 2KI5A 1Z0AA 3AP1A 5KNBA 1UF9A 3QSYA 1P4SA 4G5OA 1T0JB 4YMWA 2OFWA 2RHMA 1A7JA 5B64A 2PZGA 2ZIAA 4PPFA 5JJLA 4WVFA 2FFAA 2QMOA 2OBNA 3ZDQA 2CDNA 3QVUA 5GVRA 3L8ZA 3WRYC 2ZJAA 4F7DA 2GBLA 2WVJA 3IHLA 3LNCA 5A0FA 1NLYA 3WP0A 2AR7A 5B2ZA 4ZI2A 2BOVA 3QF4A 4IDPA 2CLDX 2GVZC 3R7WB 2OT3B 4KLZA 4A4DA 2QAGC 3EC1A 2VP6A 3I4LA 3NKVA 3RS0A 2AK2A 2IUTA 3DOEA 3UKDA 4X8HA 2ZSAA 4DCUA 1LNZA 3OAAA 4YONB 3G0HA 4EFMA 3LQRA 2BBWA 5FBQB 1NVVR 2R62A 1ZD9A 1PZNA 1FRQA 2IYZA 3KFXA 1G3IA 1US8A 2GILA 3AVPA 2RGNC 2VHTA 5JFGA 2DFLA 1E2JA 1XD8A 1XXHA 4HDCA 3ZIAD 3ZBTA 2ZREA 3AGQA 4A92A 4EKDA 4TYNA 1FNCA 3BE4A 4NZYA 4HLDA 2BN4A 3OFNA 2JASA 3GJ3A 3OIVA 5CLLA 1G16A 3DKVA 1HV8A 3RRYA 3EA0A 4JL5A 3IDQA 5DHFA 4B3GA 4Q4HB 4GOJA 2B8TA 3FOZA 3PITA 3HJNA 2GF9A 3GJ7A 5EP2A 2NMVA 1SVOA 2OO7A 5CYOA 3W2FA 5BW8A 1GILA 1VQMB 5JS7A 2IYXA 3K53A 2BEKA 3R7WA 1E1QD 2EFDB 1BMFA 1C4OA 4AIIA 3LO5A 3QKRB 3SNHA 3U7EB 4V03A 1VMAA 4LYAA 2XNCA 3QENA 2C8VA 5AN9A 3BFKA 1NI3A 4HZIA 2F9MA 5AUOB 2OSBA 3C16C 4B33A 3ZD6A 2BBTA 5H1YA 4DJTA 2ZS8A 5G40A 1NKTA 1P75A 1R6BX 1XTJA 2PJZA 2R6HA 1G7RA 1N0WA 2WMOB 2ASEA 3AKCA 4PANA 1Q20A 5H8WA 1JXOA 1XEWY 1JQLB 2A7QA 2ZI5A 1QVRA 3CNOA 4OI1A 2IF2A 1TL7C 1Q57A 3CC4B 3IUYA 5HTKA 1M7HA 4OL0A 2OM2A 3B82A 2G0TA 3D3QA 3MGCA 4V0KA 3ZH9B 1A1VA 2R8RA 3EX7C 4CEJA 1ZC3A 1P3JA 1YU9A 1KO5A 1OIVA 5FTMA 2XNSA 3SJAA 3OJWA 1ZM9A 2JJ2D 4QG7A 2IHBA 3VR2A 2ODEA 3MG9A 1I4LD 1HE1C 3NH6A 3ICEA 1W0KD 5KDOA 3IKJA 5B57C 2NG1A 1E2MA 2VP9A 3OEHA 5H68A 4ZCIA 1Q81D 1G7CA 3QFCA 3CPWB 4DLRA 1UADA 3W34A 4J0QA 2D7CA 4B76A 4KXFB 1BO6A 1UM8A 4M9QA 4PTLA 1II8B 1QZXA 2XSZA 3CRMA 1CJMA 1AGPA 3OHMA 2YHSA 2CRVA 3QY0A 2GXSA 3CRZA 1G64A 2ZUCA 2XGJA 4RCYA 1N5LA 2JJ1D 1NVWQ 2QTZA 4TMXA 5FI1B 2CE2X 2LKDA 2D62A 1RJ9A 1U8AA 3CCEB 2H57A 2QI9C 3C7KA 4D0NA 2ZRCA 4R9UC 3UWKA 2ZRJA 3SBDA 5JS8A 2DPXA 4PC3A 3IHWA 4DLYA 3SQWA 3QBTA 2QA4B 2FE4A 3X1WA 3CCVB 1XBTA 3WBKA 4HB2A 3LLMA 5K8TA 3QNUA 2V7QA 2NPFA 1S9HA 2IA5A 1WB9A 2ZR7A 2ERYA 4NP6A 1Z22A 1EESA 2EFCB 2SHKA 3TKLA 2JATA 2A9KA 3BFXA 4RZ2A 3ZLJA 1ZU4A 3W9YA 3QKTA 1OJLA 1E9AA 1VG8A 3C8UA 1W4CA 1KAOA 3ASZA 4Q02A 4TQ9A 5SZKB 3RSLA 5CB6A 4MRVA 4P31A 3MLEA 4KVAA 4H9GA 1D6JA 5HXBA 3B7GA 5E7IA 4RD3A 1H85A 2QT0A 3CNNA 4XD7A 2XZOA 4LUCA 5L3QB 2GXQA 5GVSA 2IYLD 1PLLA 4PZZA 4Y9RA 5KSOA 1II8A 5C4GB 2N1BA 3LRPA 2DB3A 1BX0A 3CBQA 4DSOA 4LPKA 1K5DA 1GRNA 3RVBA 4EH1A 2WWGA 1CU1A 2DFKB 3I1FA 4XIGS 4MGIR 2PBRA 1JPNA 3H2YA 5SZIA 4DLSA 1VECA 1XCMA 2PH1A 5AJYA 1U0HC 1MO5A 2VEDA 1FTSA 3K0FB 4URUR 1H42A 1A2KC 1LF0A 3MD0A 3PFIA 4A2WA 2IXFA 1OHHA 2QY9A 2ERXA 4MITA 1E2KA 1M6NA 1W4AA 2J87A 3B9QA 3D8BA 4E22A 4CZ2A 5IF9A 2A5YB 2OV2A 2FFHA 2H16A 1D2MA 4HE5A 4XWOA 3DM9B 5DSZA 1EX6A 1NVUQ 1ZNWA 3QEOA 1KMHA 2Q9BA 1NN1A 1ODFA 3J81k 3TVDA 3NBXX 4OK6A 3DM5A 2H18A 5BXQC 3UPUA 5GJVC 4NCHA 3Q8XB 2CJWA 1TU3A 1EXMA 1YR9A 2GTPA 4LC1A 1Z0KA 4L9WA 1W36C 3I5XA 2Y8EA 2ORVA 3KTAA 4AY2A 3IEVA 3I32A 2W6JA 2BBSA 4Y9UA 3DMDA 1EFUA 5FPHA 1KY3A 2IX3A 4OQLA 2IEZA 3BIFA 3TBKA 5H59A 4C0QC 2HUPA 4POAA 2NO1A 1M2OB 1C1YA 1C9KA 1XTSA 2GHIA 1VCMA 2OESA 4CT4B 1VCOA 3KX2A 2QU8A 1E2PA 3AF3A 4KCGA 5GJBA 2QQ0A 1CEEA 4PR0A 1S2MA 2ZTSA 3K9NA 1CRQA 4FMDF 3SZRA 1UBGA 3S1AB 2FN4A 2XTMA 2FG5A 4Y7CA 4NYIR 4NL4H 1YITB 4DLTA 3CXCB 1HH4A 2OBMA 5JHGB 1KTVA 4BLPA 1IXRC 3AEZA 4N1AA 4MUBA 1U99A 3KKNA 1P2SA 1J8MF 4US1R 5HZKA 1L4UA 1W49A 2R65A 2ONKA 5FPYA 1NKSA 2QBYB 4CYMA 4Q1CA 4GMXA 3K70D 3W2HA 4M1WA 4PO8A 4HB3A 4EDHA 2X19A 1X1SA 3BORA 4LWZA 4P0TA 3Q5DA 3WXMA 3WNDA 1NN5A 5BYJA 3HU1A 3QQ5A 3X1DA 2OTLB 2B5OA 4QGHA 1KO4A 4NTZA 1GFIA 2I3BA 1GIAA 5HE9A 4DWJA 2C99A 2J7PD 2JIZD 3GLGE 4IDNA 4Q4AA 2KWIA 3WHLA 2ATXA 4NYJQ 5L3RA 3EIHA 2VHQA 3EA5A 5JLJA 1VPLA 1UKYA 1JR3D 1DAHA 3SBEA 4BLOA 3AUYA 4DUGD 1AS0A 3T5DA 4D25A 2B92A 3KZ1E 3DZ8A 2KB0A 2PMDA 1AS3A 4D0GA 5LD2B 5TY0A 1QF9A 1MRNA 4BPRA 1T4GA 1EWYA 4QBHA 3QXJA 3B60A 4P4TA 2EFGA 3SJZA 4HYYA 1Q22A 5HCNA 1JA0A 2FZ4A 1EFTA 2AWOA 1OFHA 3AGPA 1A2BA 2CCGA 4IRUB 1E79D 1D9ZA 3E1YE 3LWNA 4B3XA 1JAHA 2QENA 4M21A 2EIXA 3V76A 4Z8XA 2D4HA 3U6BA 2O0KA 3OESA 4EPXA 5KDDA 5DI3B 4G1UC 1IJEA 3EZ2A 2FSGA 3B13B 1X8LA 1KO1A 2HDNB 2IUSA 1ZVQA 4Q9KA 4E03A 3B2EA 1XMVA 2NOAA 3Q7QA 4BFTA 3HPQA 3VR1A 2BGJA 4Q9IA 2FEOA 2WWIA 2QGZA 3NIBA 2CL7X 2ZU6A 4NYMR 2GCOB 4V02A 5C46F 3QBVA 1KSGA 2WPDD 5TV2A 2XJ9A 2X8AA 3EC2A 4B3CA 4NH0A 4GSYA 3UIEA 1Z29A 2MSCB 2H17A 3QG1A 4NKRA 1ZUIA 4Z54A 4NE2A 4C43A 2P65A 2YC2C 3W5UA 2FA9A 5TMPA 1NG1A 3CZQA 3D6TB 3DOFA 3NC0C 2YWFA 4YMSA 4Z8YA 3BH7A 3TMKA 4L5BA 2IEYA 4CW7A 4Q1AA 3GCGA 3P32A 4G3XA 2VNJA 1EX7A 5JSZB 1QG0A 1JEEA 2Q0HA 3REGA 3LVRE 4QHTA 3UMFA 2R6FA 2ZR0A 3MJHA 4G5RA 3W2GA 1JEDA 1LTQA 3CRVA 4LHWA 4C30A 3CPEA 1W2BB 1G3UA 3NTUA 4JKIA 1OGIA 4DSUA 2GXAA 3ZZ0A 1H65A 5AJVB 3GLFE 2O8BB 4B3DA 3TSOA 4MGKR 1IY2A 4UNNA 1XP8A 1G7SA 2QM8A 4TTRA 2C77A 4G5GA 3G6EB 6Q21A 3GEEA 1TUEA 2GCOA 4JYCA 3V4RA 5L3VA 3TR0A 4K81B 1OH6A 4LCBA 3IBYA 3U2QA 3VR4A 4YLGA 3JZAA 3C5HA 5A5GA 3CZPA 4OYHA 3CF0A 3CRRA 4TLBA 1XEWX 1MOZA 1JNYA 4MKHA 3SQXA 1GRQA 4B4DA 2BCGY 1CR2A 4BRWA 4YAUA 2VHCA 1UEJA 4QC2A 4QNMA 1OH7A 3A1VA 1I4DD 3T5GA 4HEJA 1GNQA 3ZVLA 1EP3B 4NBSA 4MYTA 1F3OA 1OKKD 2FOLA 1IN6A 2ZJ5A 1YIJB 1IN8A 2YWHA 3KJIA 3RRZA 1NLFA 3MWYW 3PEVA 4C3ZA 2GCPA 2HLDA 5JSZA 4NHOA 3LO8A 2GJAA 4PZYA 3HWSA 4Q01A 4NMMA 3GLGA 3U7GA 3M1IA 2DCUA 3BB4A 3DO6A 2AX4A 5IK2A 4TMVA 2HV8A 1DAKA 1MV5A 5P21A 1CBUA 3K09C 4D4JA 3AF1A 4JSTA 1X3SA 2F7SA 1G291 2UZ3A 1G8YA 3F8TA 4I4LA 5DGXA 4D2IA 5GJCA 4DXAA 5JRJA 3AKDA 5BQ5A 1FNMA 4LBYA 2EWVA 1ZIOA 1J90A 3TE6A 3GMTA 5DISB 3IBGA 2BHRA 1OH5A 1SHKA 1H8EA 4M1KA 1RYHA 5JWHA 3NHBA 3PR1A 1G18A 3VKHA 1GL9B 2BSAA 3QFSA 1P9WA 5TR9A 1Q7YD 3QPWA 4LBWA 2GVDC 3OFND 2ZE8A 1M1KD 3IQWA 4KVGA 4L8GA 4TLCA 2BJWA 1DADA 4EIWA 4QNRA 3T1TA 4MKGA 1B0UA 2WWHA 1LF5A 4LHYA 4ZIRB 3ZVRA 1EG7A 4BFYA 1E0KA 2F55A 1FW6A 1OPXA 4GI7A 1E3MA 2C9YA 1R10A 2B7BA 4EJSC 4HDOB 4LYHA 5LB2A 3GJ0A 2O8EB 5BWMA 3K70B 4B44A 1FP6A 2OE2A 2ZSEA 4OQMA 1BMFD 3CLVA 4LGMA 2ODNA 3U4QA 2ZVPX 3SJBA 3THXB 4D4MA 1KK3A 2IT1A 4TLDA 2J59A 3IIJA 4UAJA 3U44B 2O8FA 3IIMA 1JECA 4C0HA 1CNFA 2W0SA 4DT1B 1TTTA 1VQ6B 1BX1A 4KFSA 3SN6A 4FCTA 4BEBA 3D31A 1OYYA 1Z08A 4Q7MB 3WYGA 2GKSA 1M7BA 5JI2E 1NDHA 1G8HA 1NSTA 1VCNA 1RKBA 3R20A 4E07A 5KUTA 2KJQA 2G9NA 2ZROA 1T3SA 1FNNA 4MGYR 1QHSA 1SM4A 1ZUNB 1TQDA 3GFTA 2RGBA 3GLFA 3LXRA 3KJEA 1OIXA 5LB4A 2IS4A 4TMWA 1QUFA 5EXXA 4HE6A 1W7AA 1N6NA 4L4UA 4LY6A 2QAGA 2FV8A 3BWDD 2ZRIA 4YMTA 4IW3B 2KSQA 1SKYB 1UBCA 3AB3A 1JB9A 2E87A 2H1LA 3BERA 4LJ9A 4B43A 2FF7A 4HLUA 5FTNA 4LV5B 1E4VA 2RGDA 5ELXA 1U9IC 2VP4A 2AL7A 1N6RA 2I4IA 1RVDA 3A8TA 1VQ7B 3TUZC 4CDGA 2E1RA 3W2IA 2ZI7A 3U44A 2CCKA 4Q4JB 1I2MA 4LJ7A 4O2LA 1L4YA 2WIBA 1LB1B 2DHRA 2V4ZA 1KK1A 4YC7A 3NWJA 2PX0A 5DYGA 2ZRBA 1TF5A 4PZLA 4CT5A 3AV0B 1CR4A 4YDHB 1XD2B 4D4LA 4EPWA 1AMOA 2AKYA 1VIAA 3AKYA 1HE8B 4PGOA 1K8RA 3QXXA 3T35A 1VQ8B 2CLSA 2VA8A 4DRZA 1XJCA 2ZI4A 2RGCA 4QRHA 3ZQ6A 4A2QA 4LPSA 5JRZA 4OI0A 2UVQA 1QFZA 4BLTA 5CIWA 2V7QD 3TAHA 1KDPA 1HQCA 2G77B 2ZYVX 1W4BA 3AF4A 4M9ZA 3RWOA 4B74A 2RHDA 4KSCA 2VF8A 1MKYA 2XOKD 4KU4A 1XXHE 1UBEA 3UK6A 4LHZA 3QXHA 2QN6A 4IVQA 3SE0A 1IY0A 4UNRA 2G83A 1GP2A 5EUQB 1N0UA 2QQEA 4OHWA 1KSJA 4AYTA 3DMNA 3LLUA 4CEHB 1U94A 4RZ3A 2WM9B 5CJPA 2H92A 1DAIA 1T91A 1W5TA 4A1FA 1UMKA 4U00A 4QM7A 3PJRA 3A4MA 4GT1A 1WA5A 4K46A 1XD2A 3ICQB 1DS6A 3WHKA 1KI8A 3GFPA 2OCBA 3IPYA 5EQTA 4ESVA 2O8DA 1U98A 2QAJA 3GJ8A 2RB4A 1JJ2B 4LHXA 4JLOA 3NEYA 2QROA 4AF6A 2Q6TA 1OHHD 2B7CA 4GDFA 1Z06A 2JLSA 3FE2A 2VNHA 3P26A 5AUQA 3PV0A 1R8QA 2A2ZA 2FEMA 3PG5A 2R9VA 3O8BA 5FL7A 4P4UA 3SYLA 3QPUA 5FUWA 2BV3A 2QTFA 3KQNA 2XITA 3CRW1 1X8KA 4JL6A 5CDFE 5J47A 3VQTA 3HPRA 2F1JA 4RKFA 3TUJC 1CLUA 1HT1E 1NF3A 3UG6A 3I62A 4Y0AA 5FBLB 3QUSA 2RC5A 3QIAA 3RHFA 1CP2A 4ERNA 4HZUA 4Q1FA 5CJ2A 1SVMA 3AH8A 1S9DA 5JWRA 4XSHA 1KSHA 2IW3A 2MMCA 2W6JD 3U7FB 4RCZA 1LVGA 4KHZA 1KOFA 4L15A 1US8B 2BWJA 2F6RA 1LY1A 2V8OA 2ZS9A 3ADCA 4MRPA 1HEIA 4Q66C 5JI3E 3ND8A 1XXHB 1CJUC 1J70A 1OYWA 3TGPA 3W6PA 3CF6R 4QHYA 3FDIA 1NMZA 4YAFA 3OIUA 3W6NA 3PIRA 1UKZA 5C4MA 3CX7A 1GNRA 2YJTD 1G1MA 2JLQA 1RPZA 2GK7A 5FFMA 4BWYA 4LJAA 2FGKA 1TF7A 4DEXA 4G1VA 1R0ZA 2FFBA 2OCAA 1TEXA 1NIPA 3UMRA 1P9RA 3ZS9A 4M1OA 1N8RD 4A6XA 3KKPA 4NU0A 4IOJA 4JL8A 1RIFA 5ANRB 3A37A 4TYYA 5FTJA 3FHCB 3HP1A 1E9FA 3JQQA 4QHSA 5FOUA 3VR5A 1D8TA 2G0NA 1E2HA 2REOA 3RC3A 3VO2A 3GJXC 2X2FA 1XFAA 2YC4C 3L43A 2N46A 3HDTA 5UKDA 4AD8A 2ZJOA 3GQBA 5FOTA 2HF9A 2YWGA 2D06A 3DL0A 4BEJA 1IM2A 4LK2A 1E98A 3W5HA 4GOXA 4MA4A 3ZBUA 1GL6A 1JB1A 3U61B 4URYR 1YVDA 4BQSA 5JHHB 1QRAA 2IHYA 4O0MA 2CNWA 3TUIC 4TL7A 1COWA 4WBSA 1GOTA 2VRWA 4QKQA 2BMWA 3H1TA 4D26A 2YVUA 4HSEA 3CCSB 3K70C 3A6PC 4E5UA 4OI4A 2ZSFA 5EXSA 2GK6A 2F9LA 5IRCD 4A8JC 2VP0A 4CEJB 4IFBA 3MJRA 2F1RA 4US0R 2YWEA 1W87A 3E2IA 2E9SA 3CH5A 2QPAA 4B73A 1MRSA 4F7WA 3VX4A 3I61A 1GSIA 3U3KA 4V0OA 1K8AD 1WP9A 2RCNA 4W7SA 3KQHA 1W1WA 4IXNA 5CK5A 4B34A 1R0WA 1FNBA 3THYB 3GLIE 3FFAA 3ES9A 2FU5C 4BLQA 5HZHA 3QI2A 1Z47A 1VQNB 3ZVMA 2WMNB 2IK8A 1I7PA 2WAXA 2P3SA 5A4JA 1YKSA 2Z43A 3IPXA 4UNQA 1UJ2A 2QPTA 2IYWA 1TPZA 3IEUA 5CM8B 2CCJA 4TLAA 1RJ9B 3U3OA 1VKJA 2GESA 4HDQB 1KJZA 2RAPA 1EP1B 1SXJE 3QVVA 1GL7A 4UJ3A 2GAAA 5CDFA 4KLNA 4G5SA 4EUNA 3E1SA 3MFYA 3CX6A 4LJYA 4URWR 1U0LA 2IBMA 2WZQA 1PUIA 4NYJR 2VH5R 3B1YA 4OQXA 1OFIA 1S4QA 4DQLA 3VTKA 2GRJA 2HEIA 5EE5B 1AZSC 4RD6A 2VNKA 1GUAA 1XMJA 3M0EA 721PA 2VBCA 1TQ6A 3BOSA 3TRFA 1JAIA 1E1RA 3ASYA 1JBKA 2LWIA 3ADBA 2GQFA 2OBLA 2CL6X 2Q9AA 4KYUA 3THYA 3B1ZA 4LJ6A 8OHMA 3BGWA 4II7A 4XWKA 1Y3AA 4ZDJA 5JWOA 4ZV4A 4W5JA 4RJLA 3CWQA 2JLZA 1DELA 2XZPA 2J0QA 4ZKEA 1VDZA 4P3YA 3BH0A 1GAJA 4Q19A 3T12A 2ZI9A 1QUEA 2ZJ8A 2NO7A 4O25A 1T3HA 2H5EA 3RDPA 3I3SR 3MCAA 4F91B 1KDRA 1HTWA 1R5BA 4C0BA 1YZUA 3EXAA 1AGRA 1ZUHA 2IS6A 1UPTA 4LV6A 1KDOA 2FWRA 1Q1ZA 5EE1A 5DYIA 1FFHA 1OIWA 1NMXA 3VNVA 1M7GA 1U8YA 4LOAA 1P72A 4CGZA 2GF0A 5JECA 1KK0A 1KI6A 1KMHB 1GNPA 1QVFB 5HE8A 2FGJA 3MUFA 3LXXA 4BGDA
chains in the Genus database with same CATH superfamily
1QO9A 1OH8A 5DHTA 2DETA 3Q2OA 5K0LA 4YAOA 1AOXA 1NV9A 4OFXA 1CULC 5EMNA 2CJWB 5GGYA 4QUBA 2P2GA 2UAGA 2QV7A 2A33A 4Z9FA 1N1GA 1NVTA 3KTAB 1SELA 5T3YA 2GH1A 1H6DA 3B53X 3V55A 2A3NA 3ND6A 2A59A 1CIVA 3OZEA 3Q10A 4KAXA 2CXQA 1M34E 1XK7A 5BUSA 1I3CA 4UW9A 3KQLA 2PD6A 3FNEA 2XUZA 4CMKA 4FYHA 3UYLA 1W0JA 3OZTA 1UKAA 1J0CA 1IHXA 1EWVA 4I2NA 4AU1A 5JJIA 1F8XA 1XQ6A 3G5AA 2FWAA 4ZRMA 3TLCA 4FJ0A 4FUQA 1QIGA 1CDDA 3DXZA 1PS9A 2YMQA 3WWOA 2O1XA 2NV0A 5IANA 2AI2A 2PO5A 1YRQA 3RIHA 5DHUA 2G70A 4CQLA 5JXHA 3WYDA 4XMYA 1FPMA 2HRBA 2VNSA 1UWLA 3C5VA 4OLHA 5H70A 5LQMA 4DW8A 1CE8A 1DC6A 1YBAA 5FOQA 5FT9A 2G63A 2O57A 4JT4A 1IZ0A 1OZGA 5EE9A 4YCSA 1RNLA 2J0SA 3CCRB 1CCWA 2ID4A 2IYFA 2MMGA 3RC2A 5B7GA 3FUTA 4F6CA 4D81A 3UK1A 1SEPA 2JCGA 2Q29A 3EG9B 1GG8A 1XALA 2WIKA 4AKGA 1Q3HA 4UNSA 1F1JA 1SXJA 1ZINA 2CBZA 1TVKB 1WHTB 3H2HA 4IGAA 5AOAA 1JLRA 3A1SA 4I9UA 3ZCTA 5CB8A 1D1PA 5AH0A 3U0VA 3DCIA 2IL1A 3E22A 1D04A 3N0VA 4D9BA 1XNQB 3RAGA 5KYTA 1WCIA 1NJFA 3B6EA 2WLTA 1P2TA 1P5HA 5LBIA 4B3BA 2W6ZA 4YJHB 3K35A 4BWVA 1IULA 2WQZA 4QUIA 3SSMA 4DIEA 3N2GB 3QX3A 3RIYA 4Q4AB 3U7QA 1KFCB 2BONA 4OPVA 1ADFA 2ZRHA 3R6JA 4LIPD 4PONA 4CTNA 3R3XA 4LYDA 2O3TA 5TQ2A 3RNLA 4E2WA 1S01A 4HAIA 1ZJ6A 4MP8A 4OJKA 1CF4A 3INYA 4GWGA 4RKWA 4NCKA 1DO8A 3BZWA 3AG5A 4CM4B 4FGKA 1C1XB 2P7IA 4RE6A 2BTQB 4WZBE 3SHTA 5I7UA 4QDTA 3WIOA 1DAMA 3NJ4A 3UCFA 1YVPA 2V1XA 5HYVA 1TLTA 4JMPA 4NQZA 5JSQA 4I50B 1A9XB 4L8JA 4MSUA 4CTOA 4MQ5A 3O84A 2W2NA 1U8ZA 4A1OA 2AXNA 1KQOA 4P3XA 4V3BA 3AR5A 4IHJB 4BPBA 3NHZA 3V7FA 4OA8A 2XVZA 4U3JB 1A5SB 2H2FA 1XXLA 3KT8A 2QXTA 4EDFA 3OJEA 3WWYA 1K06A 2G5GX 4WWVA 1VF7A 1LJUA 4R1OA 1A9TA 5EKUA 3FDJA 2PS3A 1RLOA 4NXNB 1E43A 3R9XA 1BTOA 5GV7A 3H5NA 3RS5A 4K03A 2QMUA 5EJMA 1ORTA 3LT0A 1YL6A 4JP1A 5CDSA 3C6BA 1ZLXA 7ADHA 2NO4A 4ZOQI 1TF2A 1K6IA 2UYHA 2A0KA 5COAA 4B6RA 4P9SA 1D4FA 1UOPA 1IVYA 2FZLA 3EPRA 4H08A 4EI2A 2VYNA 4JWKA 3LLSA 4XFDA 1YMQA 2WJJA 2GEUA 2QVBA 2GN8A 3NMUF 5DTJA 5DI9A 5K4GA 1J06A 2G6TA 3LCJA 3LGSA 4RM3A 4TTAA 5AK0A 3UH1A 1NBMA 1EGAA 1KC1A 1ZRSA 2YFHA 3AK4A 4FSHA 3KXPA 2X4LA 2ORED 4FT2A 4I55B 3W9BA 1LDGA 1XL0A 2DKNA 2R44A 5CU7A 4F4CA 4XOUA 5BYKA 1W93A 3WGTA 3KVOA 1NASA 1JALA 3OJCA 4YR9A 2Y67A 2XVYA 4UU0A 4B75A 4QJ3A 2QTTA 1N6PA 1PUXA 2DFNA 2PGOA 4MA5A 4LJ4A 4BYGA 2GTHA 4PPQA 1BYIA 2EF1A 3TTVA 4F9GA 2ZBRA 1I5RA 1A8SA 1E5DA 1WEHA 2FSFA 4FYVA 1LRKA 4J91A 4JQZA 1TW2A 3ETCA 1PE0A 4L27A 2QRNA 4DR2B 3B8HA 3QFRA 2P6PA 4WY2A 2PUCA 4JJ8A 1WE2A 5HCUA 2JGFA 2O0JA 2G88A 3ZUGA 2RGYA 1D1NA 2VEOA 5DNWA 2IXEA 3AKEA 5EE0A 3VZSA 3SJCA 1WB5A 1XDDA 3HYSA 3EW7A 1EVYA 5HBRA 3R8FA 2TECE 1L4MA 5F1PA 4J0KA 1NUQA 1KE2A 3V7WA 4ZI3A 4FFBA 4P5PA 2OK7A 1QOQB 1Z2CA 2BGGA 2PGXA 2E82A 4FR2A 1MB2A 5FOXA 2ZDQA 3BAZA 5IYQA 2FRXA 3CC2B 4RKEA 1OTYA 1QRDA 3IDAA 5DOVA 2OB1A 2JVIA 3DSRA 3V2GA 4AZVA 4F2HA 3OZWA 1A8IA 3PCTA 4PPNA 3WDKA 3WGLA 2VUSA 4ZYUA 1AUXA 1OMOA 2Y1LA 2ZJ1A 3B85A 1CW2B 3IL2A 3BQ9A 2DAPA 2JAHA 4RPCA 2C4TA 2OBSA 1DXOA 1SUFA 2CXXA 3DVRX 4LOIA 3VC1A 1VCHA 3I0NA 1U5CA 4LDZA 4REQB 3REQB 2Z8ZA 1RQGA 4CMCA 5EZYA 5FL7D 2A9JA 2AG8A 3BDVA 3F6SA 1NW3A 1O6BA 1SVSA 2ZJYA 3DOHA 3KWJA 6YASA 4H3VA 5CM9C 1O95D 1U2GA 2BFNA 3FLAA 4ZVOA 3EEOA 1XQVA 5P8WA 1RM5A 1ENPA 1Z6PA 2H7VA 2IXGA 1U3GA 1E5XA 4URHA 3ZHZA 5LPNA 1DIHA 3LKVA 5CT6A 3SS8A 2VQEB 2I4TA 1MG0A 2MJLA 4LJRA 4KXQA 5JJKA 1A5ZA 1CFZA 1Q1EA 1XU7A 2X9LA 2A88A 2ZE5A 4HGPA 4HWKA 2GETA 4PYNA 2WYOA 3SXUB 3RODA 4N49A 5L9AA 2W6IA 2OP1A 1VQ1A 2OK8A 3MXTA 1UP6A 2EEPA 5DV9A 1KDYA 3PFKA 5SV2A 2Q2OA 4AF7A 2HN9A 4MI1A 3TOSA 5KC9A 4KQWA 4C3UA 1FXSA 2P67A 3QEMB 2BFDA 1NY6A 4E5KA 4C4PA 3H9JA 1X7WA 1MC5A 1HI9A 2NQ2C 2VPXA 3OJLA 2D9RA 3AQ4A 1PYOA 2J5RA 2EZ4A 3B6JA 4JUDX 3SP1A 1AXRA 1Q84A 2CZCA 5HQJA 2YWXA 4BRZA 4D79A 3CR7A 5EWJB 2K2WA 3Q7RA 3L01A 5DHPA 4JV5B 1OC4A 1U6JA 2IP4A 1NONA 1NUUA 3C70A 1A9OA 1NBOA 1B8PA 1M6VB 1U0TA 2X2EA 1WPGA 1L7EA 3DS8A 2GBGA 4GKVA 1E6LA 1DKOA 3DUFA 4LHEA 4BP1A 2QTVA 2DEUA 2AJBA 3A8KA 2GBPA 1KHTA 1B3RA 4H3KB 2Q2VA 1DUVG 2P5YA 3C3KA 3FFBA 4LJ8A 4NBUA 5LA6F 3V4OA 1MB9A 1N2CE 1X0XA 3NGLA 4R84A 1DB3A 2DJ5A 2ZQ5A 2B78A 2J1LA 3E84A 3OQOA 1DJNA 2WZNA 1PI3A 1SPXA 2O6LA 3PL5A 4H18A 2CHEA 3HJTA 1Z6QA 1H2AS 3OHSX 4INAA 5HILA 3V00A 5FI0B 1DBSA 3K9HA 4HHEA 1XPUA 1E3IA 1X13A 1IN5A 1JJ7A 2HU2A 2XE4A 3OAAD 5TT1A 4EPVA 3I01M 1TZMA 2B2NA 2QOEA 3LLVA 3OT1B 4M99A 4WZAA 5BVGB 1L4LA 1PJ7A 2HQ1A 2G0AA 2FPGB 2IU6A 1CWUA 3AIOA 3OPVA 2UUOA 3VH3A 3CB2A 2F43B 2VHVA 3FCXA 5GONF 1EIZA 1GSHA 2C5EA 1L8AA 2RI0A 1FP1D 5IDVA 2EAUA 2FPXA 2YXBA 1PJ6A 4ALKA 1XPOA 3FZEA 4W8OA 5A1TA 2ZSUA 4LZNA 1E5TA 2F8MA 4PZDA 4B47A 5HFNA 4Y7DA 3ZBPA 1EXDA 1T2EA 1SRRA 3L9WA 3ZWNA 2XNJA 4QFDA 2WAOA 1N5JA 1JAXA 2GQ0A 3RKRA 1TMGE 4RSMA 4BV3A 4FCVA 1UFOA 5ABPA 4WCFC 5I9NA 2DH6A 1KZ7B 2HCBA 3TLGA 1WOOA 4FZ5A 3ZXXA 4J0HA 2ZJZA 4RPLA 4BFVA 3NB0A 3OTWA 3FGPA 4JJEA 5K8VA 3B38A 4YJKA 2C4KA 3A3BA 3BF7A 2RI1A 3NBMA 5B1EA 2JH3A 1M0SA 3HEAA 4HDKB 4IIJF 4R2IA 3TMYA 2CV2A 2VOJA 2QDXA 3GLQA 5HHTA 1W73A 5BUCA 1ACLA 2IEDA 2ZUTA 4BIMA 2GN4A 3ZDAA 3BA6A 4BLSA 2ZRGA 3RS7A 5JPCA 1E62A 2OV8A 1EUDA 3IMCA 5J3JA 1OXSC 4YGYA 2O3UA 3ZCQA 1TJ3A 4BO1A 3BA1A 3LECA 2QTHA 1ZU5A 2ROQA 2FW8A 3ZE6A 5LP6A 4FX2A 4U2KA 3N6XA 3CTAA 3ZHRA 3L7DA 1BVUA 1IEVA 1SIOA 2R66A 3MT7A 4FFPA 5DTEA 2RHRA 4BFSA 2FMHA 2BEUA 2VSYA 4RGVA 2GTIA 1NFRA 2HWKA 2W4MA 3A6KA 1BWSA 3RFUA 5BV2P 4IICA 1TM3E 4NOKA 3ZCUA 4CTMA 3P2MA 4MVJA 2QRVB 5K8LA 3V9PA 3F5FA 1Z13A 1QYCA 2ERCA 3OIYA 2X40A 3QNWA 1GITA 4IDCA 4IUBS 3TBFA 3RASA 5JT1A 3DLBA 1GADO 1HY3A 3NBFA 4UNPA 1QK4A 1WNFA 4OSEA 1VYTA 4DB4A 4LFCB 4X0CA 2JRLA 2OG2A 2PM8A 3NIDB 4Z0TA 2A0XA 4HJRA 2GPAA 1RLJA 4NBLA 3R7FA 2DR3A 3A8JA 1P9OA 2WSYB 3E7DA 3HV0A 1U0OC 1DAEA 2RCYA 3IJEB 2JAOA 4KPUB 1T8PA 3DXYA 2QNRA 1O5TA 4RKRA 2OUIA 1QGYA 2V5AA 5K51A 3SLKA 5I8PA 4L8VA 3VPDA 1IG0A 5D3ZA 4ITUA 4TLMB 1XRJA 4UBMA 3TQRA 5BN5A 1XN4A 1VE3A 4G23A 5KSPA 3LUFA 5LD2C 1KI7A 3ETLA 5ALQA 4WESB 2BUCA 1Y98A 2IIPA 2Z1MA 3BXEA 3VO8A 1F06A 4RHEA 5JROA 4D82A 1FL9A 1EUYA 5HR5A 3FWPA 2NGRA 5DN6A 3TSZA 3A0RB 2P79A 2AFHE 2QN3A 2CNNA 2IYVA 3CMEB 3MCVA 4INJA 2JBWA 1Y3CE 3PUWA 4KFUA 4CQMA 4AJ2A 1YDWA 3M6VA 4HD8A 2ATVA 3AQIA 2FZCA 1CYEA 5AUNB 2ZUUA 4G1EB 1BVHA 2CNLA 4CF7A 3HB1A 4XFJA 2D59A 1RXVA 1T6YA 5CT9A 3H2SA 1WKBA 1CS0A 1SNYA 4UUPA 4B45A 3UF0A 4KXNA 4PYJA 1UAAA 2XBMA 5KYGA 3NH9A 1UMCA 1YKGA 2GF2A 2PRZA 1BS1A 1FMCA 2RK4A 1P1CA 4MMYB 1RZUA 2CE7A 1YQQA 1S8NA 3C4QA 1WX1A 1IH8A 1T0HB 1Y5MA 3PD0A 3H83A 2ANCA 3KB1A 4C0LA 3T1HB 3AFGA 2PA3A 3WY9A 4DLVA 2GK3A 2P27A 1GZ4A 2ZTVA 4KAFA 3H0KA 5H9VA 4OUKX 3WLPA 3HKBB 4HZUB 1Y1SA 1HDCA 2BGLA 2KE5A 1KDTA 2W6OA 1LJLA 2WNSA 3KZXA 1UKBA 2EFEB 2AS0A 2P35A 4GGPA 5EGNA 2A8YA 2GPYA 3AWIA 5K7SA 3T1OA 3DDSA 3ZY6A 4MPTA 4F9EA 3ER6A 3IILA 3AL0C 3FPKA 1YR7A 2J32A 3PPVA 4LGCA 5ILGA 4R1LA 2IV7A 4GP6A 4AKHA 3ESZA 3IBCA 3JSXA 1H6AA 1WR8A 2JAPA 3I2HA 4Y6RA 4ENVA 2IU4A 9ATCA 3MCTA 2J5KA 5LQKA 2Y92A 1EFDN 4FGUA 1RYDA 4NECA 3WL5A 1KU6A 4UDNA 1IYZA 3CCQB 5JAHA 1OWLA 1O58A 2CFIA 1DWUA 2GPNA 4FFSA 4F60A 5KNDH 4R16A 4UTXA 3T15A 3D7NA 4IFEA 3EW9A 3G5LA 4MWDA 4XQFA 2C5HA 4XLTA 5JNVA 3F3SA 4AO7A 4EKGA 3OQ1A 1SY7A 2PQMA 4RIIA 1YGYA 2FNAA 5JD3A 4IXDA 2YZ2A 1BH6A 4BJHB 5CH3A 1R2QA 2AR9A 1XNGA 2XUFA 2LKCA 3GG2A 3PNQA 4U02A 2BHTA 5WRFA 3UG7A 3ZI0A 2HLPA 2VH2A 4MKFA 1NLUA 4ND8A 4GM1A 3DBOB 4AP5A 4B7UA 4GC9A 2P2SA 5EJAA 1L7BA 4EEKA 5DRTA 4RFVA 4FKZA 1ZZEA 3N8NA 1EBBA 2ANBA 2DULA 1BYUA 4HMPA 4KE6A 5ALGA 4B5KA 1H3FA 2GLTA 2FX5A 2Q8NA 2BE9A 4IV8A 4R2HA 1E69A 4YN3A 4S35A 3T34A 4UOQA 3TJRA 4CG1A 1EFRD 3PT5A 2PH5A 4IDGA 3AEQB 3FKSD 3JASA 3ZKAA 5IZCC 1ENZA 1V1RB 1RRCA 2ZVJA 2RK6A 2WA1A 3FTNA 2E7ZA 3K1TA 2WJVA 3IYLW 4QTYA 3HABA 2HA2A 4L4SA 4W7HA 4Z4WA 1QIIA 3PYXA 4RK7A 3T9EA 4Z1MD 1OT3A 5G4KB 5KX5B 2BLLA 2JB9A 3WSWA 1WCYA 4E2FA 1GKUB 1SQGA 2CWWA 2JD1A 1LS6A 1J21A 3CURA 4IH4A 4IX1A 3UJ6A 3UWSA 4IYRA 3WOHA 4YAWA 1HFKA 2VDJA 3W6ZA 1NVBA 4D97A 4DV5B 3Q3CA 4F4DA 4AL4A 4J90A 1G4AE 2YY7A 2A5JA 2Q1XA 3HXLA 3K8YA 3EEFA 2UZ4A 1W36B 1O89A 1KK2A 3MJEA 4B32A 4P82A 3UAOA 2HDOA 3AJ8A 2XCRB 2XYVA 2G4VA 1X8JA 2EFHB 1OFUX 5E3HA 2QZ4A 2B82A 5EFZA 2X53S 5C8DA 2IKSA 3F2IA 1VLMA 4U9UA 1IN4A 2V3VA 4HDAA 4MK4A 3ZC3A 4QUHA 4EG6A 1OKKA 1MAHA 5JAPA 1CY4A 4JBXA 2ZWMA 4F72A 3PE6A 1XEXA 1M8FA 2C95A 3FOBA 3H5AA 3PTZA 1IHYA 2BGUA 3D1VA 4BFUA 4XAQA 4HT3B 2CK3A 5J4YA 1NM5C 5JNTA 2BEVB 4EFKA 1NX6A 5E3JA 4Q9LA 4ZJPA 2FPIA 4CFZA 1FJ2A 3ZWKA 1OWNA 1QO0A 3TECE 4H6PA 3TM4A 3OPMA 4IMJB 1DX9A 3G9QA 2BE7A 2WG2A 4AJPA 2YZNA 4BB5A 2BVNA 2GARA 2OV6A 3FKQA 2OEPA 4IG4A 4LE0A 4YP9A 4ENTA 4F6LA 5BY2A 5JNSA 1QP4A 4FDTA 3NZEA 4HLUC 4YT2A 2JZCA 5TARA 3UMCA 1DEOA 2FR1A 5CFLA 2GZHA 4WKGA 2IP2A 1ECGA 2VPWA 5CLGA 3PGKA 2FWIA 2EFJA 4YUVA 1JDJA 2ZL5A 5GTDA 4FQ5A 2NU7A 2QL7A 5AM1A 2VK2A 3EHEA 3EIWA 2Z08A 4ZOAA 1J2EA 3G2MA 1JI0A 1YQUA 5B4TA 4INPA 1WXQA 1NYRA 3KQOA 4OKSA 2DM6A 4G86A 1NQXA 4QPCA 1SUIA 1T9DA 3AOEA 1W35A 1ZGGA 4PE5B 5H82A 4BRUA 1QX4A 3AHDA 4L0QA 2NUTB 4D56A 1IRXA 1XLUA 1E4EA 3QE2A 3QA3E 4PZ0A 4BP8A 1OTHA 3K9CA 3LCMA 3UJHA 4YX9A 5JV5A 3K5HA 2V8BA 4PYLA 3AVTA 2BUBA 5JMOA 5BW4A 3VVCA 1ETUA 4C7BA 4DSAA 3ESCA 4OV6B 4KNWA 4C0WA 3G82C 3I8SA 3K1AB 1BJKA 2WSSD 2G5TA 3PUXA 4BE7B 3CZMA 3JZDA 3ZZTA 4MVJI 2OCDA 1VJSA 3Q2KA 1UOEA 1ZN9A 4RVDA 1UMDA 2XR1A 3OCCA 4PLCA 2I03A 5DLYA 3PI7A 2JGDB 2Q3BA 2HW8A 3KC2A 2FDRA 1CQXA 2HFJA 4YT4A 2MR5A 2PYDA 3DMTA 4YBZA 5DHAA 3K1YA 3PQ3A 2NUPB 3CEAA 4NONA 4ISCA 4YMIA 1WF3A 5IYZB 2I76A 4HH1A 2REQA 3K16A 2QRUA 1J0DA 4YGXB 2TYSB 3UK0A 3K0KA 3WK8A 1OY1A 3U60B 4IXWA 2AFRA 4DV0B 1Y9ZA 1JHZA 1IUKA 1URPA 4IPTA 1CUFA 1NAHA 3U3MA 3GAZA 1KJQA 1KAHA 2FG7C 4JP5A 1JHPA 2DY0A 3NAGA 4ILEA 4L3VA 1CJSA 4JX8A 1Z45A 4RTLA 1B26A 4O2AA 4WZEA 1MUUA 3V1UA 4Z0HO 2OQVA 3AUXA 4JC5A 3VMMA 1VPWA 1Y8QA 3HH8A 4FZJA 4F56A 1SXPA 4CETA 1IBMB 3IUSA 1N3YA 4NDAA 1FYDA 3PFHA 3VU9B 3JATA 3NASA 5AM3A 3P4UA 4HDMA 1OAOC 4MRMB 1LBEA 2NIPA 2ZIUB 4C6TA 3GR6A 1UDAA 3EZ9A 3OEED 2GJ9A 3FAZA 1G9TA 2Q4TA 1RZ3A 1GARA 4O1IA 4ZU6X 1CHNA 3UN1A 1FF9A 2QL9A 3NG1A 4ISBA 4M37A 4B09A 3HYNA 4QDOA 3EZFA 3WJ7A 2FN7A 5HKKD 4M8IA 2P40A 1XWWA 3GLIB 3WADA 2AMYA 1Z83A 1ODCA 3CN9A 1XZDA 3ELDA 1UJ6A 1JVNA 3KVYA 5CH5A 4IDHA 3VKVA 4EI8A 1K28D 1QPZA 4G1MB 1YRBA 2KMLA 4QGAA 4R9VA 4Z3KA 3EMBA 3MHTA 1WSVA 1ULSA 3L6EA 2FX2A 4RSRA 2M1ZA 3V4PB 3GNSA 4MDFA 5IYRA 1CJVC 2H4HA 2VPTA 3PK0A 4I6GA 1QQ7A 2NPOA 3R7BA 2OTJB 5E6UA 5KAMA 4KFTA 3WAJA 4KBGA 2CLKB 3OZGA 5H5JA 4CMIA 3ZZ1A 3PGVA 4I08A 4JI5B 1S3FA 4B3FX 1FMTA 2ET6A 2J6CA 2R1TB 4RVSA 4I9GA 5KWJA 3U3RA 1RC1A 1RI4A 2OHFA 3JQ9A 5DTRA 4DRYA 1Z33A 4W5OA 1WSWA 2OFXA 1O4WA 2A5GA 2DH5A 2OOKA 2R8EA 1MABA 4KACA 3VOSA 5L3SB 2CXNA 4F1WA 2ZB2A 1UT5A 2Q3CA 3G17A 5C2JB 3ITKA 2X5JO 2L19A 4MIOA 4MWEA 1ESCA 4FJ2A 4FTWA 3WWZA 4C7JA 2FYTA 4XWAA 5M34A 3TEMA 2WDZA 4YCLA 4JJZA 4P7KA 3NVDA 1K7EB 2B5VA 3ZWBA 1VHOA 1XRPA 3WGNA 2G80A 1XA0A 2VTDA 4M53A 4DNOA 5I3ZA 3HI4A 3Q3GE 3QFTA 2ORYA 5IAAA 3MGAA 4PIPA 2OXFA 1S72B 2P5TB 3V3TA 4F3TA 4RD1A 4EBBA 3G2LA 3P0IA 5HGXA 1RXWA 1GTMA 4QDJA 4FGWA 3E61A 5ILQA 3M6IA 3CNLA 2C20A 1OXUA 2P2LA 1SCIA 4DBZA 1TLLA 4BIIA 2W43A 1YOVA 1C0IA 1J2JA 1ACMA 3QVGA 3QELB 3QPBA 1MJGM 2B98A 4ND7A 3VZCA 1O3YA 1R8SA 1XCJA 5I5EA 1U1CA 4UD6A 4UEWA 3T95A 1TE2A 2VDKB 3VYVA 5CFMA 3WL3A 3ASPA 1LUAA 2AYZA 2FPLA 3SY8A 3EGDB 1ISHA 3ZGVA 1CY1A 3BBPA 3JQRA 3T1QA 1DGQA 4JQCA 4JDPA 2OAEA 2NX2A 4R2LA 2W11A 1CUVA 3H04A 5IDYA 4ON9A 2VDVE 4D4HA 4ZEXA 3IHTA 5BSRA 1CG6A 3C97A 1DBIA 2JKVA 5A03A 4FSDA 4G67A 4JCCA 3Q72A 1E7MA 4BV8A 2H85A 4TZKA 5C8ZA 2O54A 2AUMA 5IF3A 2PEZA 1J07A 4Y6QA 4KJZA 1TT5B 3GP8A 2IYTA 1YZTA 2Q2WA 3AFMA 4L07A 1YJAA 3T56B 3DAHA 4PYOA 1PFKA 1OV4A 2RMKA 4J9VA 1FS5A 2M6RA 4E2XA 2AC4A 3K31A 3HY3A 4LSGA 4TVKA 2XRFA 4P0QB 4YRPA 4FZVA 1M2HA 4MR7A 4Z9XA 2PFGA 1R5NA 3DPUA 1IB0A 2CLCX 3KCNA 3QK7A 4M22A 2FW1A 3CRQA 1O2DA 2PANA 3RYHB 1P5ZB 1FRVA 2PE5A 3GAFA 2VS1A 3C1UA 3L7OA 3TJZA 1IZ8A 4MKRA 1DO2A 4A0HA 3BH4A 1Q17A 3A3OA 1YJ9B 3DBVO 4V0NA 3LUCA 3QF7A 4K2AA 4DABA 1OXBB 2QRLA 3VHXA 2OUKA 2UYOA 2X7HA 2NSJA 3LKDA 4A0GA 3NVAA 1PLJA 5KNBH 3H94A 4ABYA 1XZFA 1UT6A 5KOJB 1LK7A 1LC3A 3K0FA 4RH3A 3RT7A 3IIKA 3L84A 5BNZA 1XU9A 1NUTA 2C4VA 1FK8A 1HDXA 1DT5A 2ZRQA 3E4CA 4FK8A 4GL2A 3RJ9A 5EP4A 5EC8A 2J41A 4KL8S 1JH8A 3CYFA 1KZ6A 3K2BA 3QKSB 4D7AA 4DAOA 5K09A 3ABZA 1UZUA 3EY9A 3GDWA 3L3BA 4G4SP 1ZJWA 2CV1A 4P86A 2FFJA 4IUYA 3B6ZA 2DJIA 3LK7A 3RREA 4WOJA 1WBDA 4IZHA 1X3LA 3PDUA 2VRCD 3EPLA 5HKAA 1XE3A 3K8ZA 3EAGA 4MVWA 1YU6A 4H1VA 5ERXA 3L0IB 2A67A 4G25A 2IEBA 2E2WA 3TDMA 3VC3A 5A4MS 3SDBA 2UVPB 3NOVA 2WF5A 3S2IA 2VDOB 4KXLA 2GZ1A 5EJ8A 4FYPA 3TINA 3F3KA 1Y5LA 1OQAA 4O8ZA 1PV4A 3EGVA 1YS2X 2RHLA 2YY6A 4WFJA 4C3OB 1Z07A 2AN9A 5HRCA 3HDGA 3HYTA 5JE8A 3QVJA 4DLBA 3DDCA 1GZSA 4LOKA 1E5VA 5DRYA 5GADl 4DDHA 4NG4A 1FU8A 4EJSA 4Q48A 4BNFA 1NI4A 3ZHSA 1IHOA 1DAPA 2ZVQX 3IVRA 3QLVC 2J3EA 3CTPA 4MJLA 1U7TA 2AEFA 2AXPA 2WWTA 4C4YA 1KZGB 4GYYA 3CJQA 4A8TA 3ONVA 2IC5A 4WN9B 4D4IA 2IDZA 1JJBA 1UKEA 1K2WA 4UZEA 3N8KA 2PKWA 3RHZA 5AVYA 3GQVA 2ZZQA 1QDUA 2H1OA 4BBAA 3RI3A 1EK0A 2X0JA 4WVLA 3F96A 4WZBB 2XMBA 5K4HA 5HZBA 5DULA 1Y1QA 2GJSA 3L41A 1RACA 3T5TA 5IKXA 1NC3A 3N76A 1GQFA 3UQZA 4FM9A 1LH0A 1MDBA 4G1BA 2CVHA 1E1DA 3LCCA 3ZGLA 1W30A 2AI1A 4HDNA 2WU3A 3M9WA 1HMYA 3W8FA 3H3JA 4G37A 3HXPA 2O2YA 1WTHD 2AOUB 3CZ4A 4IGFA 3A9CA 3MIZA 4INZA 3W3AD 3CT4A 4PQFA 2JGJA 1XCOA 4M7RA 5JQGF 2ODBA 1X8XA 2CB0A 2CL0X 3HQ4O 5E6RA 5F7OA 3DL2A 4NJEA 3C8ZA 4ZT5A 5E7JA 1TW3A 4BLWA 2C7PA 1TJ5A 3WVNA 3KU4A 4MUGA 4J0EA 1W52X 3G9ZA 5E6SA 2XV1A 3LCUA 5AUPB 2QB5A 4E5MA 3OMWA 1UEIA 1GO2A 1AE1A 1ZRNA 1AUVA 2EHJA 3U4DA 3ICQB 2OVFA 2ZYGA 3GRYA 1PFGA 1WD7A 3GP5A 4Y9TA 3CZ5A 2ZUBA 1SUEA 1PJTA 1XTUA 3IEPA 2BGIA 8ATCA 2Y0BA 1SBZA 1X94A 5IS2A 2HMUA 1K5GA 1DRUA 3FY4A 3TQQA 2HMAA 1CVLA 5C18A 1U0FA 4KI0A 5T8KC 2PVCA 3F6CA 4R98A 1SVIA 2JJ2A 1U8EA 1ULAA 3ITNA 3NT4A 1RAEA 1Q7EA 4UVGA 2HU8A 3CUWA 1EJ6A 2R2AA 3C45A 4IHAA 1UXHA 1WXGA 4ZHSA 1U2EA 2DR0A 2XE6A 3GD7A 4I66A 2P4EA 2OBRA 2PS1A 3RK0A 4YRFA 3HWX1 4F97A 2ZXUA 3TZHA 3WRVA 3IV7A 4M9SA 1E0JA 2B21A 4QU0A 5LQJA 4BVFA 5IAOA 3PQ8A 4TS1A 4RENA 3BJMA 3L0ZA 4OBWA 5TMEA 5CA0B 2XYQA 4L3WA 5L4SA 1SCUA 4ZCPA 3J81A 2JAWA 4QUKA 2JJ1A 1WZIA 1P7PA 3HDHA 4FBLA 4P3NA 4S2EA 4TXNA 4C04A 3T3OA 3TMAA 1GM5A 1XMPA 4BO7A 1PUJA 5JXJA 1UD2A 1WVMA 4QTZA 1PR3A 2OORC 3CMMA 4QTUB 2HMSA 4CIVA 4YRBA 2V96A 4RC9A 2X8JA 5AKIA 5EJIA 1ONNA 3PPXA 4PZPA 1YKFA 3RTDA 3WOVA 4UQPA 1FTWA 2FR8A 2Q5HA 5JAUA 3IBFA 1SCDA 4L1KA 1V8OA 3HLYA 2J3DA 4DA0A 2VPIA 4ZDWA 4Q05A 4TRNA 3E3AA 1H1LA 1PS8A 1B43A 1OYOA 3VJRA 5IUJC 1VHDA 2HEGA 3KKEA 3MBOA 3D6NB 1YNSA 2XA2A 4PLWA 4Q15A 4RQBA 1WSAA 3ZLTA 4AG5A 1CTQA 4E33A 3AR8A 1TKAA 1M2GA 1W5EA 1YVRA 2JVKA 1QONA 2GEFA 4D0SA 3HGQA 4L74A 1EQUA 4PLGA 3BRWD 3DLCA 4KJXA 1USUA 4DHEA 1YFKA 1HNXB 1CEQA 1O7JA 2GFIA 3PDHA 1RCUA 4WOBA 4LMRA 1R1DA 3GRZA 3PGLA 3QXCA 3IUNA 2PX4A 2NTEA 3GT7A 3IOBA 5J5CA 1MVLA 1A5AB 1WDLA 5DM4A 3UBMA 2IPAB 3ELYA 4OHBA 4ZAFA 1BCRA 1X7XB 2BM9A 3THWA 3OU2A 4MVJG 1ICEA 3NUZA 4O2RA 3UPDA 3PEFA 4OFZA 3UKOA 4Z4ZA 2Q5CA 4AK9A 3GVKA 3OFKA 5BR8B 4HATA 2TMYA 2E3JA 3HXMA 3GMIA 2HOQA 1SKYE 2HA5A 1QRSA 1T9HA 1ZD1A 1W36D 1QMPA 5E4FA 2WINI 2OQ2A 1PK8A 1PZXA 3GLTA 4ZZ3A 5AD1A 2O1WA 1F5NA 3B7WA 1L5HB 1LJ8A 2AMFA 1GTVA 1LW7A 4OVKA 4AZ0B 1U7PA 3ICOA 4F2DA 2EP5A 3UC5A 5C51B 1HPLA 2PL5A 1UOQA 4H17A 4FI3C 3OICA 5KQPA 4M9XA 2MSWA 3GEPA 4FXOA 1KMQA 1ZRMA 4IIEA 2PWYA 5HDQA 4TT3D 1NZJA 3FDZA 3T7AA 2NO9A 3UWOA 2GM4A 1V6AA 2BFEB 2HF7A 5EEHA 1NHWA 3Q98A 4NU8X 1FYWA 3C3DA 2D3LA 2QA5A 4HH0A 4LCJA 4NENA 1ZI9A 4XPIA 2Y1XA 5BQXA 3UK2A 2QPLA 4PNEA 4ZEMA 1VDMA 1JIXA 3N6VA 4N47A 3WNQA 3Q1KA 3SEJA 1KS2A 1EVEA 4FINA 4L8FA 3SGLA 3V8VA 4DSNA 3BS4A 4ZV9A 4BECA 5KYUA 1FOEB 3VI3B 3ZXSA 2EX4A 1GTL1 4LSZA 5I9MA 3SR0A 4NBNA 3GLHE 1KFBB 4X1YB 3F6BX 1ANKA 1KOJA 1Z5PA 5FOWA 5GV8A 2PTHA 3U62A 5TJ9A 3AL3A 2CDBA 2GAOA 3CUKA 2X7JA 2HT1A 4M0CA 5IC4A 1M1YE 1MOSA 3D1JA 3FVWA 4LRSB 3MQ2A 4BX0A 1H22A 1NURA 3F67A 4EW2A 3X1XA 3ESAA 3ZHTA 2H59A 3EWAA 4WZZA 1YRLA 5C1OA 2I6GA 4I6JA 3AR6A 5J3OA 1EEXB 1RBMA 3SR3A 5I01A 3EZ6A 2DFTA 4D5GA 4GKJB 2X5KO 3DOJA 3VNUA 4URFA 4PLTA 4IDQA 1JSXA 3I1IA 3P9PA 4MYHA 4OB8A 3GJSA 4KRGA 3V46A 5JBQA 2CLIB 1LV7A 3CLTD 2AQHA 1OX4A 2PE3A 3MLAA 1FTQA 4C2BA 1GA4A 1SUPA 1D4AA 1LDYA