4RCZA

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gdpnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 111
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rczA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rczA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rczA01
3TR5A 3W3AA 5TDHA 5CJ2A 2OBLA 5HTKA 4BZQA 2HEIA 2ONJA 2PZGA 4Y0AA 4YXWA 2AR7A 4KO8A 2C98A 1P2VA 4ITRC 4JVLA 2C8VA 4II7A 4X8MA 2D2FA 1Z0JA 1J90A 3A58B 1GNPA 3PR1A 3IO5A 5F9HA 4IOLA 1MO4A 4JLAA 3CD6B 4PZLA 1YJ9B 1XTJA 1ETUA 4HATA 3UWOA 3ZQJA 1MR3F 1R0WA 2OILA 1TLLA 2RHDA 2V1UA 1G5RA 1FNCA 2A5DA 3QXJA 5GVSA 4B44A 2LKCA 2REXB 4C0AC 1N3BA 2WZQA 4JLPA 1XF9A 3L2OB 3X1WA 4JT4A 1JBKA 3SBEA 4MRNA 4MKGA 2ZTSA 1T5LA 3LDAA 5LPNA 1L8QA 2IYXA 4AF7A 1E2HA 1VYUA 1W5TA 1W2HA 5J40A 5EE9A 1T8UA 3W9YA 1VQMB 5EJEA 2H92A 1VYVA 1QG4A 1UEIA 3VR6A 5JZVA 1CR1A 2WWWA 4HAXA 2O8BA 2FSFA 4EQ6B 5EXSA 4F92B 2NIPA 2V1XA 3C14C 4QHTA 3RRZA 3RRMA 5CITA 3NEJA 4Q1EA 5JEEA 3EC1A 1JXMA 2ZI9A 4Y7CA 1LF0A 4FCTA 4TSFA 4LPSA 4TYNA 3LY5A 4HZIA 2GVZC 2HXSA 2EYQA 1AKEA 1N6PA 2E9SA 2ZEJA 1XMIA 2QTZA 4FIDA 1SVSA 3RNLA 1VPLA 4B3DA 4EPWA 5FOXA 4JYCA 2R2AA 2QUZA 2BCJQ 1P75A 2OTJB 1E0KA 4AKIA 5AN9A 1H42A 4CEHA 8OHMA 1W0JD 1Q7YD 4CIDA 2ZETA 2QQ0A 1AA9A 1SVLA 1ANKA 3PVSA 5KSPA 3JZMA 2OE2A 5FUXA 5IDVA 2ZU0C 3GJ7A 1GRQA 4Q1CA 1W44A 4KITB 1CULC 2J7PA 2VP5A 4JLMA 4QBGB 2QE7A 5CB8A 4B75A 1GITA 1P60A 1G5PA 3MWLA 4MQBA 2ZUDA 3J81k 3BORA 2BN4A 3PIRA 4KVGA 4Z1MA 1VCMA 1F2TB 5SZIA 3SI7A 5AUPB 1EG7A 2JJ1D 2UVQA 1VDZA 1QH0A 2JCSA 3HU1A 3QKTA 2OBMA 1M7HA 1W1WA 2XNDA 3CNNA 4NE2A 2G9NA 3THWA 2DYKA 2X19A 4PHHA 2QBYB 1HYQA 1BYIA 2BBTA 2O52A 4FMBB 1W4AA 5BWMA 2JLSA 1Z0KA 1NY5A 4QHSA 2WPDD 1UKVY 3AUXA 1KI4A 1AS0A 2BEJA 1OFTA 1QDEA 4AC9A 1HURA 1NBMD 4E03A 2IUTA 2RGAA 1XJQA 1NKTA 3QKSB 3CR8A 3A1WA 2YWEA 2C95A 4S2EA 2IXGA 1T4GA 2XNSA 4A2WA 3C41J 2GVDC 2RGBA 5A5GA 2J9RA 2RMKA 1G7CA 3EPLA 4TZ6A 3FOZA 1AN0A 2BOVA 1QG0A 2AXPA 1GNRA 1P6XA 2GXSA 4BLOA 3I55B 3FFAA 4EJSC 4O2LA 1EXMA 2YC2C 3AF1A 4EH1A 4XVUA 1JAHA 1H8HA 1FUUA 5P21A 5KPDA 5L3SA 1S8FA 1DG1G 2B7BA 2OSBA 1KO4A 3EXAA 4I99A 1VKJA 1TQDA 2PT5A 4HE6A 4RY2A 2ZS7A 1J7KA 1NVVR 3N2EA 1Z8FA 3QE0A 4P33A 1FDRA 4H9GA 1NN3A 4ZDIA 2GZAA 3W5VA 1P61B 3MWYW 2WOOA 4GI7A 5JCPA 3G71B 3ZIAA 3GJ0A 2J7KA 5EE0A 4CEJB 1NI3A 3E2IA 2CHQA 2IYUA 2QMOA 4GRAA 1CXZA 5KSZA 3QVVA 1NNEA 2Q6TA 2XJ4A 5AUNB 1GZSA 2GK7A 3I73A 5GJVC 4NYJQ 2MSEB 4WIAA 1AS2A 3AVTA 3KKMA 3DM9B 3OE7A 4JBWA 4M1YA 3VR5A 4D0LB 1ZD8A 1FOEB 2GXQA 1ZW6A 1NP6A 1EFCA 4A1FA 5EZ6B 1WDTA 2WSSD 1CRPA 2VP0A 4LJAA 3BERA 1SVWA 3SQXA 4MA4A 2GCOA 4HB3A 1Z0AA 3L0IB 1W36B 4M9SA 1N6IA 1FQJA 4ESHA 5J5CA 1ELOA 3QVUA 4LX0A 1XPRA 4QM7A 1E64A 4KFUA 4KFSA 4ZV4A 2QTHA 4DLZA 5IT5A 2PX3A 4NMMA 2Q9AA 1BMFA 3I3SR 1R8QA 4IEIA 4DLSA 1KO5A 2VP6A 2QTFA 3C7KA 2GJ9A 4Y9RA 2RGNC 1ZJ6A 1ZCBA 4KBGA 2FA9A 3KL4A 1FRQA 1KZ7B 1KKMA 3OW2B 1Q3HA 1TL7C 4DDWA 1M1YE 1ZYUA 5KDOA 1G4UR 3MGCA 3VKGA 4G1BA 5DHFA 5CM8B 4FXPA 2OXCA 1IN6A 4KCGA 5F98A 1FNDA 4FMDB 1JA0A 5CLQA 1S0UA 2FEOA 4LV6A 1YZUA 2GESA 1Z0FA 1S3GA 1DO2A 1Z47A 4RD0A 1QGYA 1E1QA 3EIEA 4M53A 2H18A 3ZBUA 3GLFB 4DSTA 3QI2A 2FOLA 2OAP1 3E70C 3W6OA 1KTVA 3JQPA 2F3TA 2GJ8A 3CPWB 4F4IA 2XEXA 1Q21A 3VR2A 4YMSA 5EP2A 4ZGNB 3H84A 3IPXA 5C4GB 1SKQA 2CJWA 5TARA 2IYRA 4P4TA 1TUIA 3A8TA 3LH5A 2ATXA 1KJZA 1OV4A 4YXWD 1E2KA 2Q9CA 3P1JA 2BMEA 2HF8A 2QAJA 1SXJE 4A4DA 2F55A 2CLDX 4G5GA 5KDDA 3T61A 1R2QA 2Z43A 2Z83A 3Q7PA 2WKRA 5LD2B 2JLUA 3SYNA 1J70A 2VF8A 4RZ3A 1GTVA 3B78A 3RYTC 4U7DA 2G83A 4G5RA 3W2IA 2JLXA 2IEYA 3FKSA 1G18A 4ON9A 4E5UA 3CC7B 2QDXA 2XZOA 4ILEA 4TTRA 4CGZA 3EAQA 3IBGA 3UKDA 1XPOA 3Q7QA 1XU4A 1IM2A 5EQTA 3TGPA 3K9HA 1Y63A 1P2UA 2VNJA 1V5WA 2V3CC 3QXHA 1COWD 4MYTA 1JJ7A 5HCNA 2ZI6A 3GLIA 3WHLA 1PLLA 4PO9A 4PANA 3OIUA 5E3HA 4V03A 2VSFA 4DCVA 1NJID 3OZWA 5J4LA 4ZIRA 4WA7A 4V0LA 5FPSA 4CYMA 1CJVC 3SJCA 1BKDR 2WHXA 2YOFA 2WKQA 2XSZD 3CC2B 3W8RA 4B35A 5M04A 3IQWA 4P4UA 4LJ6A 1YHQB 5AWFC 5HZHA 521PA 2REBA 3WBKA 3VO2A 1Q0UA 4D4MA 4Y9UA 1G8FA 5H1YA 2PCLA 4HAWA 1DAMA 1OFHA 1A5TA 1VYTA 4TLDA 1YZKA 1MO6A 4MUAA 4DZZA 3BRWD 2A5YB 2IYVA 5DO9A 2N1BA 4DIDA 4RZXA 2ZI3A 2QPOA 1VQKB 1ZUNB 1BIFA 1M7GA 4XWOA 2IF2A 2W83A 2H1LA 1E99A 4B47A 2E87A 3HPQA 2N46A 2Q3MA 2NO7A 4DLTA 3CCMB 2F1HA 3OJXA 1E69A 2F7SA 2QSYA 3UMRA 2WIAA 1N6LA 3X2SA 4F93B 1XJ0A 2DCUA 3KJIA 1EGAA 1T0HB 2ORVA 4BFYA 4BFXA 1GL9B 1TF7A 2JJ8A 621PA 4OJQA 3TUZC 1E3MA 1PVOA 4I1SA 2QMHA 1XFAA 3H86A 4B48A 1FPMA 3ZD6A 2EFHB 4P4SA 5A0FA 1WCV1 3P20A 1Z6AA 2BHRA 3KXLA 1SVOA 1YZLA 3N5CA 4TTPA 2D7DA 3CRVA 3MHPA 3KJHA 1F2UB 1XXHE 2XJ9A 1U8ZA 1MKYA 3W5HA 2YJTD 1G17A 3OZXA 4RD1A 4MDEA 2ZJYA 4Q4HB 4IDQA 1EP3B 2WAYA 1YITB 3OJWA 1SXJC 4WZ6A 3H4MA 1N25A 4XIGS 4P32A 1HEIA 5FTJA 3AVQA 2IS4A 4YMUA 4KJZA 3VTKA 4P6VF 4QM6A 1H85A 4HUQB 3SZRA 2BWJA 5KHOC 2VSOA 3KZ1E 5J4YA 4Q19A 4B34A 4D4KA 1TU4A 2RKOA 3ZVLA 5KPJA 1MV5A 1X8KA 1II9A 1IAQA 2P0EA 5GJCA 3THXB 2B21A 5JCZA 1BOFA 5JECA 2ZRLA 3DL0A 3L8ZA 3MFYA 3K70B 1BYUA 3OAAD 1G7RA 2JAQA 3K8YA 2HF9A 1JB9A 3NG1A 3U6KA 3Q3JB 4DUGA 1GOTA 2IXEA 5EXTA 3B6EA 3SEAA 2AK2A 3ZBTA 1TVCA 1H8HD 2VLIA 2Z0MA 2MSDB 1NMZA 4TLAA 4FMCF 1IHUA 1XEXB 1PLKA 3QNUA 2FWRA 1OF1A 1CJMA 3NVAA 2R8RA 3Q8XB 1CR2A 1TMKA 2PBRA 5B30A 3CO5A 2OG2A 3AF3A 1IB0A 1KI2A 2ZAMA 4DQLA 3C5HA 1IY0A 4IDOA 2CK3D 4HAVA 5JLJA 4MGYR 3R8FA 1XEWX 2AWNA 4Y0VA 1N5LA 3QXXA 3E1SA 2ZR0A 5A4JA 2QMEA 4FK8A 1HT1E 1N5KA 3FVQA 5IK2A 4OK5A 1XD8A 2ZYTX 3UG6A 4N3NA 3KKQA 4NYJR 4TWZA 5AJYA 1JALA 4N1AA 3PEWA 3K9GA 1BO6A 3PUWA 4TL9A 4A9AA 2QGZA 1XTRA 1NLYA 3R9WA 4C0HA 3VKWA 1VHLA 3NBYC 4WBSA 1U0LA 5SZKB 2W0SA 3K53A 5CK5A 4CF7A 1WF3A 3FMIA 3R8CA 1T3SA 4IXNA 2FFQA 2GKSA 4K81B 2PLFA 3W5UA 1QFYA 2YWFA 4LK2A 2BM1A 3CCQB 1YR6A 4UNSA 3UANA 3VX3A 2Q3FA 4DT1A 5DNYB 1C9KA 2R6CA 4Q4AB 1Q3TA 3CMEB 4JBYA 1M90D 4AIIA 1J9ZA 4RJLA 4TYYA 1NVWQ 1DE0A 1YQTA 4PC6A 2IYZA 2WKPA 1GO2A 3A4LA 1R7RA 3M6AA 5FL7D 5TVKA 3U2QA 1XXHA 4JSTA 3TR0A 4QL3A 2PJRA 1TAGA 1AGRA 2W58A 1Z5ZA 2XX3A 2P6RA 2YOGA 2VYQA 1JR3E 3WRYC 5EMNA 2ZRNA 2ZRCA 1OB2A 3KKOA 2A5GA 2Y8EA 1II8B 4U9UA 1AQUA 2WMNB 3AKEA 1GAWA 4L8GA 2XITA 3G5UA 4QJ4A 1GM5A 3WYAA 2WJYA 5DI9A 5DN6D 4CEIA 1HV8A 2BBSA 3H0KA 1DARA 1SXJB 3A1SA 2OLJA 1SQ5A 2O8FB 1DEKA 3ZH9B 4DDVA 2IBMA 1UAAA 2VH5R 4U02A 4EKDA 2NO9A 5FPTA 2GZDA 2RH5A 1ZCAA 1NRJB 2QNRA 3CPHA 4BZPA 3A37A 2A78A 4AG5A 4DIEA 4C7OB 1US8A 3AF4A 3FYHA 2J0QA 1EX6A 2W6ID 2DWOA 3K1JA 5BQ5A 4C0JA 3NHAA 3FHCB 3ONWA 5LB4A 2Z5FA 1Z83A 2Q9BA 2X77A 4GFDA 2QTVB 4KBFA 4DEYA 4B73A 3K0CC 3MUFA 1Q81D 3FKSD 2A5JA 5DH9A 5E7IA 4Q4JB 4YC7A 5DE3A 3S1AA 4UNRA 4Q1BA 5KNBA 5JHGB 2GHIA 4LOAA 4G3XA 4DB2A 2ZIAA 2QPTA 2R6HA 1G7SA 5AJVB 4V0ME 4ZI3A 4Q7JB 3LFUA 4PC7A 1OIVA 2O8EA 1W4RA 4Q7MB 3GQBA 1I4DD 3TIFA 1I2MA 1UADA 1ZUIA 2GBLA 4F7WA 4BPBA 3BC1A 3K0FB 5EZ5A 2DFNA 4UNNA 1RE0A 3ASZA 4PO1A 2DHRA 2JLVA 4XD7A 4IOMA 3ZVNA 2DBYA 4QGFA 1E2PA 1EFRA 3R7WA 1BJKA 5KSYA 1MH1A 1AZSC 3QBVA 3F5FA 1Q12A 821PA 5TMPA 4LC0A 2ZJ8A 1KMQA 5KDLA 3ZS9A 3FB4A 4RKEA 3T34A 3CW2A 1KRHA 2ECKA 4Q1AA 2GF0A 5JWHA 2CE7A 5JJLA 2KJQA 1XMVA 3O8CA 1G9XA 1KSGA 2OK8A 2O8DB 2JDIA 4HDOB 4HLDA 5K8IA 2QRZA 4JZKA 3TE6A 3CCVB 5CYPA 1OHHA 1E9CA 2FSIA 1O87A 1XBTA 1UM8A 4QHYA 5J4HA 2IL1A 1JA1A 2IYQA 1M34E 2H57A 4TT3A 2D62A 2ZSFA 3IIJA 2HYIC 1Q22A 4DHEA 4P0TA 3ECCA 5FH9A 4PPNA 2O0JA 3WYGA 3VMFA 4HUTA 2GTPA 2W2XA 2WVJA 3WMGA 1EK0A 1RC8A 2J0SA 4LJYA 3EA5A 1JQJC 2WSMA 4PSAA 3H2YA 1AS3A 3B5JA 4IDNA 5K8UA 3RANA 2BJVA 2XTNA 3VR1A 2NQ2C 1YR8A 3ZQ6A 2UZIR 2H16A 4RFSA 1PV4A 4MYCA 4PC1A 4MYUA 1P62B 2P5TB 5DYIA 5F3WB 1E0SA 4CT5A 4AYWA 3OF5A 3TLXA 3A1TA 3DZDA 3OHMA 2QA5A 3WYFA 4Q48A 4LBVA 1TEXA 1SXJD 3ASYA 3EZ2A 2RCNA 1Q1ZA 2GZHA 1ZNYA 1E2EA 1D2NA 2ODNA 2J59A 2IYTA 2H17A 4GBMA 4BLPA 4UAJA 5IF9A 3NIBA 3AGQA 4PQYA 4JLDA 2DERA 3PEVA 4B3GA 4G1UC 2B6HA 1JR6A 4F38A 1Z63A 1JPJA 1LNZA 1E79A 1R6BX 3PCRB 5KSOA 3U44B 2L0XA 3IEUA 4DXAA 4M2LA 4A8JC 1KOFA 1GL6A 2CHVA 3QF4B 3JQQA 4ZKEA 4BE7B 3DDCA 3ZJYA 4MRSA 1UBCA 3IEVA 2PMKA 2QU8A 4RFVA 3ZYCA 4HLCA 4LRWA 5FOSA 5JSZA 3SNHA 1UPTA 1II0A 2AD1A 1XZQA 1KHTA 4OQLA 5EP1A 3QFRA 1P73A 1XCGB 3AVYA 3KQUA 4KXFB 2DR3A 3LXRA 3ZVMA 1DAHA 3OEHA 4MYHA 1DAEA 1OSNA 1TQ6A 3TNFA 3BB3A 1KO1A 4RSGA 4L16A 4Q9IA 1XTKA 3OFND 3UPUA 4DLXA 2JIZA 4AWXA 2IUSA 1TTTA 1A82A 4IDPA 3QKRA 4BGDA 4IKEA 1E4YA 1LTQA 3DOEA 3KTAB 1CLUA 3VX4A 2JJ2A 2ZJZA 4BASA 4D4LA 2WWGA 4B3BA 3CB4A 2NGRA 1GILA 3ZZTA 2ZI7A 3QXSA 2WV9A 4EPTA 1X86B 1G8YA 3UMSA 5H70A 1KMHA 221PA 3GFTA 1EWQA 2F43A 1P7CA 4LCBA 1G1MA 3EC2A 4PR0A 1WA5A 1I7PA 3GD7A 4KSCA 4DEXA 3LQQA 1LFDB 3L0OA 2DWQA 2FN4A 3LO8A 4V02A 4JVMA 1ZU5A 4URXR 3BFKA 2FZ4A 2CNWA 1RJ9B 2DPXA 1DDGA 2B8WA 4PC3A 4M9QA 4NYMQ 4K46A 3W3ZB 1M6NA 1B0UA 4JLKA 4B6EA 2OCPA 2E1RA 4WW0A 3LXXA 5FOTA 1CRQA 2YNMA 5EP3A 1YJ5A 3GLHA 1DPFA 4R71A 3K9LA 1IY1A 3IO3A 3BAFA 3FKQA 4QBHA 4R2IA 4C0QC 1BS1A 1Z0DA 4Q1DA 4ARZB 1WBBA 1E6CA 4DLUA 3W2FA 5BYKA 4EDHA 1N6OA 4JS0A 4BRWA 2X1VA 1NJFA 3RWMB 3L0PA 4PHTA 2W0MA 2ZSAA 3PEYA 2G0TA 1FRNA 4GNKA 4BFSA 2DB3A 4OK6A 4HE5A 1JB1A 2ATVA 4X8LA 4C0BA 2VYFA 2HCBA 4EPVA 4DRZA 2XGJA 1XNJA 1DVRA 4GZMA 1E2NA 2YKGA 4YONB 4G5QA 2C78A 3CRZA 4UJ3A 4ZO4A 1IJEA 2K5UA 1AKYA 2JLWA 1W46A 2PMDA 1JQLB 3IILA 3U7HB 2WWYA 4TL7A 5E4FA 3B8HA 2DEUA 3PUXA 1M1KD 1R5BA 1NLZA 4YMVA 4BECA 1X1SA 2EU8A 4ZDWA 5C18A 4TYQA 1NVXQ 3U3RA 4LYFA 2GJKA 1GNQA 2VIIA 4A36A 1FNNA 2ZANA 5JHHB 1G6OA 4NCKA 2ZSDA 3CR7A 4A8JB 2VNHA 1VG0B 1DBSA 1EESA 2OLKA 1S1MA 3CMAB 1W0KA 3Q9LA 4PPQA 5D3MB 1T8TA 4Z8YA 1B2RA 3GEIA 2OK7A 1KYIA 1DTSA 4WXPA 1YHNA 2QM7A 2Z4SA 1Z22A 4UNPA 3FTQA 4QXAA 3MJHA 2F1JA 2ZVPX 3BOSA 4RVCA 1OFUX 4B43A 3A4MA 3C8UA 3IHLA 4QBFA 3CXCB 2GAOA 4PFSA 1FP6A 4OQXA 5CDFE 3NC0C 2AWOA 3BE4A 1U2RA 4LHWA 4BLRA 1OH8A 3QQ5A 4IVQA 4QGGA 1GRRA 5K8TA 1HH4A 1A7JA 4RD2A 1N6HA 4XD7D 2RB4A 3JVUA 3TMKA 3UATA 4CVNA 4KODA 4LJ9A 1Q82D 5EUQB 1XCMA 3IQXA 4FMCB 1H65A 2OFWA 3IGFA 3W6PA 2DY1A 2NO6A 4FCWA 5EE1A 2QG6A 2PZEA 3PUZA 4JVSB 4NCHA 4PAQA 1MABA 4Q66C 4ABYA 1OYYA 3PFIA 2ZS9A 2VQSA 3LQRA 3OIYA 1NL3A 1PZNA 1XD2A 2QEXB 4RZUA 3UK6A 3KXKA 3RAPR 3GP8A 2OZEA 1AZTA 1OHHD 4NHOA 4A0GA 1SVKA 2YINC 4Q18A 3GLIE 4TMXA 2O8BB 2EIXA 3LVRE 3NC1C 3U4QA 2PLRA 4WXRA 1QHHA 3CWQA 1FZQA 4BLTA 5FBWB 4DCSA 4HB0A 1KK1A 2EFDB 3RWOA 4DLVA 5JWOA 3G4SB 2NZ8A 3EARA 2R9VA 2H5EA 1JR3D 2VEDA 4M8NE 1F6BA 4YDHB 2AXNA 3MSXA 2A5FA 4PQRA 1PUJA 4QGHA 4ASUD 2VHQA 1E94E 2QL6A 1OIXA 4KSBA 3NBFA 1N2CE 4PX9A 5K8LA 3FPAA 1ESMA 3AH8A 3FWYA 4OHWA 1IJFA 5H5JA 1UBEA 1QFJA 4ACAA 4HB2A 2IUUA 4B76A 2D4HA 4R7ZA 3U5ZB 2X3UA 2HLDD 4IVPA 4OBEA 3RS0A 4B2LA 4LJ8A 3R9XA 2F3RA 3FHOA 3EZ9A 1LV7A 3OZUA 4CEHB 3U3OA 1HT2E 3T5DA 5EP4A 5HXBA 4TMKA 3G0HA 4Q1FA 2WM9B 1YR7A 2ZAOA 4GL2A 4Q21A 1ZM2A 5E7MA 1JNYA 1D1NA 2JATA 4MGIR 1YRBA 4RD4A 3CCRB 2PCJA 5F9FA 2V7QA 1G16A 3K09C 3K09A 3VR3A 2XZLA 3U7GA 4O3MA 3CCEB 3SFVA 2VPPA 5C4MA 4TL6A 4ZDKA 2VBCA 4IW3B 2IWHA 5UKDA 1G8HA 2KE5A 1E79D 1G64A 4D26A 1OXUA 2OO7A 3EWAA 2MMGA 4MITA 1ESNA 2YWGA 4OHVA 3THWB 1L4UA 1SULA 1H8EA 3QIAA 4K1XA 4EFNA 4KU4A 2CBZA 1ZIPA 1XMJA 2Z4RA 1GAQA 2LCFA 1RIFA 4JLVA 1GIAA 4KI0A 4QKQA 1GVHA 2V6JA 2CXXA 3B85A 2OFXA 1N8RD 1XTIA 3ADBA 1KAOA 4LZZA 5CDFA 2TMKA 4LYAA 4JLJA 4GZLA 2OFOA 4TMWA 1SHKA 1R4AA 1RRFA 1A2KC 3ZGXA 1L7VC 1KY2A 1NN0A 1QHIA 3D7MA 4AI6A 2G1KA 5CIWA 1XX6A 4TMTA 2IF0A 4OI4A 4I81A 721PA 2LKDA 2OCYC 2QP9X 3D8BA 5JFGA 4NTZA 4IJMA 3NXSA 2B7CA 4Z8XA 2CDNA 2AKAB 1FTNA 4EJSB 4C3ZA 3RRNA 5HKKA 2HMAA 3B1ZA 4LSGA 3RC3A 2XB4A 5AUOB 4YDSA 5L3SB 3HYRA 1RYHA 2W00A 4QFMA 3DMDA 1WMSA 2PX0A 3M0EA 5KNCA 3BH0A 3P32A 2OCAA 3I4LA 4E22A 2GILA 1ZP6A 4UXHA 1MRNA 3U3KA 3IBYA 2FMXA 3TUJC 2AFHE 4Z54A 1WB9A 3BGWA 3W34A 4GOJA 1T91A 1HTWA 4DDTA 2MSCB 2REOA 3OEEA 4URYR 2XZPA 2CNWD 4OI0A 2C9OA 3TBKA 5JI3E 2GJAA 4TQAA 1ZD1A 2A2ZA 3CX8A 4FINA 1KI6A 4OI2A 4EPXA 1HY3A 3RVBA 4NYMR 1CJKC 1P72A 3B1XA 4DCUA 4WQMA 5FTNA 2BVNA 2F6RA 4TSFD 3CX7A 1CNEA 1FFHA 2ZYVX 3B9PA 3CNLA 4G5OA 1KDPA 2C9YA 2GCOB 4B3XA 1VTKA 4ZCLA 1UEJA 2IA5A 3C5CA 4QOSA 5JS7A 1CR4A 2RC5A 3QSYA 1RYFA 3LVQE 4ZKDA 5KYKA 3X1XA 3QG1A 2ZUCA 3UG7A 1N0VC 3B13B 1W47A 1E9RA 2I3BA 3QY0A 2V9PA 5CIQA 4C43A 4D81A 5D3QA 2V55B 2BCGY 2VL7A 3W90A 4AKHA 4LC1A 5JWRA 4BQSA 2ZRMA 2B5OA 4DB4A 2J7PD 1X8LA 1IXZA 2QE7D 3FMFA 4Q01A 3FE2A 2J0UA 3KKNA 4HZUA 3T1QA 4Z1MD 1T9HA 1W2GA 2GCPA 4K8OA 4JKIA 5G53C 4DJTA 4KHZA 1U81A 4POAA 1DAIA 2IYLD 2QTLA 2IYSA 2X8AA 1NKSA 2ZE8A 3QENA 4KFRA 2UKDA 2CLSA 2KWIA 2XNDD 2CHGA 2O8CA 3EZ7A 3VU9A 4PZZA 2O0HA 4LI0A 1OW3B 2ZREA 1EP2B 3QFSA 1DADA 3I8XA 4FCVA 3X1YA 3A36A 3DHWC 1T5IA 2R6AA 3W2GA 4JSYA 2IK8A 1WRBA 1TPZA 4HAZA 1KI7A 1NMYA 2XNCA 1VQPB 2QEQA 3RSOA 3TK1A 4FN5A 2RGEA 2FU5C 2CJWB 4FWTA 4DBLC 3DMNA 4FW9A 4LHXA 3V76A 4LUCA 5BN3A 4HI0E 4Q9KA 1GP2A 5DI3A 4LBWA 1OKKA 2HCJB 2QAGC 2QAGA 5FUVA 5B58C 3LAWA 1XP8A 3U3JA 2GF9A 1F60A 1WQ1R 2W6JA 1NY6A 4LHYA 3MJRA 2WICA 1GWNA 2FNAA 3TQFA 2EYUA 1JJ2B 2ORWA 2BBWA 4I1OA 2KB0A 5HPYB 1XTSA 3PV0A 1JPNA 4NPHA 1GKUB 4M1MA 2FEMA 3VHLB 2FGJA 1GKIA 4KFTA 1KSHA 4TYWA 1KK0A 1VIAA 4WAUA 2KBFA 5GJWC 1GAJA 2X2FA 2ZE7A 2V6IA 3LD9A 1HA3A 1U98A 3THYA 1ZNZA 1FX0A 4IRUB 3K9NA 3GLIB 2WBLC 3AF2A 1S9DA 4TMVA 2FDCA 2ODBA 2P6NA 1XCPA 1O3YA 4ZIRB 2QMUA 3DOFA 4HB4A 3ZIAD 1ZMXA 1KJWA 1Z6TA 1FNBA 1U0HC 3MD0A 3Q5DA 1QBKC 3BIFA 5AK0A 1G8GA 4N3GA 3LW8A 4BFTA 3RRYA 1X1RA 5EXXA 2FSGA 4PPGA 3EZFA 1TEVA 3OE7D 5CYOA 2PJZA 2XNJA 3B60A 4GOKA 4XTCS 2ZE6A 2W2TA 5J4KA 3KJGA 2HDNB 1YZGA 4AKGA 1SKYE 1GJRA 1ZD9A 4U5XA 2F9LA 1EFHA 1E2JA 4XVRA 3CCSB 1HE8B 1KO7A 1MRSA 3RC8A 1XDBA 4RCZA 4OYHA 2SHKA 2Z6VA 4TL8A 3GJ4A 4BFVA 5L3QA 1T3HA 2WIBA 3KQLA 5FI0B 3WNDA 1D8TA 4D0GA 1S9HA 1V43A 4ESVA 4PHFA 1RRCA 2GA8A 2R6GA 3RS3A 1X8JA 1AGPA 3UWKA 1BX0A 2IYYA 1BMFD 3LLMA 4L9SA 1MO3A 1KC8D 3MG9A 4Q9HA 3T15A 3TH5A 5HE9A 1KDRA 2FFBA 2J46A 3D3QA 4P31A 4PSVA 4MUBA 1XE1A 2GJSA 1P9WA 2G77B 3AUYA 2AL7A 3CIOA 3LO5A 4P4SB 1FL9A 1NN1A 3EIHA 5FTKA 4JL8A 1NN5A 1QUEA 3LV8A 1E1QD 3CF6R 1TQ4A 1H8ED 1KZGB 3F8TA 2F9MA 3AEZA 4Q03A 3CRMA 3ZVRA 2YHSA 1TUEA 4YHBA 1ZM9A 2G6BA 2FJUA 3GLGA 3ICEA 1M8PA 3HR8A 4JYBA 4C9BA 2EW1A 2BIFA 5JS8A 3RSLA 2V4ZA 3K0EA 1C1YA 1SZPA 3LA6A 1Z29A 3M4YA 3MWJA 4UJ5A 1E9BA 2WMOB 1KQSB 4IXMA 1M7BA 3VFDA 1VQLB 4FMDF 3NEYA 1QUFA 4MKFA 3GPLA 4XH9B 1UF9A 3EG5A 2NMVA 4C2UA 3QBTA 2ZVQX 3I32A 3RS7A 1NLFA 3W2EA 1E9SA 3PG5A 4HLQB 3TSOA 2LWIA 5F2EA 1EFTA 3AVPA 2XXAA 3QPVA 4CT4B 2D2EA 1OH7A 3ICQB 1YR9A 3LVBA 5FL3A 2RC6A 4UXJA 3DM5A 1UMKA 4M1KA 1HQYE 2GRJA 4KLNA 5BYJA 4JL6A 5KNDA 1NG1A 2CRVA 4GMXA 3RS4A 2KI5A 4A0FA 4A0RA 2JJ1A 3EX7C 3WP1B 2PZFA 1DAFA 1AQYA 3WNBA 2OAQ1 2GBLC 4CZ2A 1IOZA 3QUSA 4KYIB 1PJRA 3DO6A 4TYPA 2GETA 3P4XA 3T35A 4ZCIA 3EASA 2ZRHA 1MOZA 2WPDA 3K0AA 4F7DA 3NWJA 3FGNA 2JLRA 3PENA 3NH6A 1Z08A 4AURA 3EIQA 3HU3A 1TX4B 3ZDQA 1NBMA 3KQHA 2VTKA 5AUQA 2IS1A 3VKHA 3GEHA 1IXSB 2ZI4A 4Q9LA 4O0MA 3W6NA 1P5ZB 5JMTA 2QP4A 1GDDA 5L8VA 1TF5A 3CRRA 2V54A 1ZU4A 3DEFA 3HYTA 1W4BA 5SZJA 4ACBA 1IY2A 2FH5B 3W5JA 3BJIC 1YZQA 4EIWA 2BM0A 2FSHA 1CF4A 5DHAA 2Q21A 3RLFA 1BX1A 5KSWB 2BMFA 3GCGA 2WWHA 3R20A 4M9ZA 3WMEA 4S35A 3PUVA 3AKDA 1QGZA 2HYDA 4DT1B 3ZLJA 2QPAA 5FI1B 2B8TA 1DAKA 3ZZUA 2GNOA 1J99A 2OEPA 3REGA 3VNVA 3I5XA 3KQNA 1ODFA 2ZI5A 1XXHB 1E9EA 3RS2A 4NONA 1JJVA 3NHBA 1WP9A 3A1VA 1S1CA 2D06A 3HDTA 5KTYA 4A2PA 3M1IA 4US0R 2G88A 4Q5IA 2D74A 4EQ6A 3GLHE 2GPJA 1N5IA 3VR4A 3CBQA 3QKUA 4G5SA 3T06B 3WHKA 1QVRA 4JT2A 2ZRFA 5LDDC 3OIVA 4DSUA 4CEIB 3TAUA 2WTUA 1RKBA 2PL3A 3CKLA 1NSFA 2WSSA 2VP9A 1J8MF 5SZHB 1AK2A 2ZS8A 1VQ4B 1HUQA 4JLBA 3QJYA 3ZD7A 1E2QA 4LJ4A 2CE2X 2VHJA 1Q44A 3EA0A 3QF7A 4JLOA 1US8B 1CS4C 4XSHA 1G8PA 3QFCA 3KX2A 3T1OA 1W48A 5B57C 5THXA 2CCKA 1E9DA 4I4LA 4DUGD 2PT7A 1A2BA 3JVVA 5J47A 1VCIA 1QFZA 3NH9A 4RZ2A 1IQPA 3WBJA 3BWDD 2AX4A 3S1AB 2IWRA 1KI1A 2BSAA 4J0QA 4A15A 3ZZ0A 3TSWA 4HYYA 1UBGA 1QHXA 3RABA 1F2TA 5FBRB 4I1VA 1XRJA 2CL7X 3B1YA 4TQUS 5HCIA 2O8EB 3SN6A 4V0NA 2J3EA 3CH5A 3CONA 3E5HA 1S72B 3JQRA 5EE5B 4LV5B 4MGKR 1WE2A 2QBYA 1XB2A 2CVFA 2OT3B 4HEJA 3CF0A 4FI3C 1SKYB 2W2VA 2ZRBA 1QHYA 2A3RA 3CCJB 1CP2A 4O2RA 5IK2D 2CCGA 3R7WB 2F1IA 3QKSA 1G41A 2YVUA 4NZYA 2QN6A 2FGKA 1NF3A 4CW7A 2OM2A 2HJGA 1CTQA 2C5LA 4H1VA 4URUR 1E0JA 5GVRA 4D80A 1IN7A 3HP1A 2BV3A 4DVGA 4YAFA 4Q00A 4B2PA 3ETLA 4GDFA 3NDBB 1G19A 4Q9JA 3MCAA 3AF0A 4OI1A 2C04A 3B2EA 5FFMA 2EFGA 1G7TA 3SYKA 1KK2A 3IKJA 4PAOA 2GK6A 1UKEA 3DKVA 2DFKB 1L2TA 3GMTA 4JVNA 4PGOA 2ZE5A 1YZTA 5FTMA 5G41A 4NKRA 4NDZA 2P67A 1KSJA 2B92A 1G6HA 1XPUA 1OT3A 3CNOA 1N5JA 1YJWB 1A4RA 4C4PA 1COWA 4TZ0A 1NSTA 4M1WA 3TSZA 3W2HA 3WY9A 2A7QA 2J41A 4LWZA 3MRSA 2AN9A 2ERYA 5DSZA 3FMPB 5KOYA 4DLRA 2ERXA 3SYLA 2WJJA 4M9XA 2OV2A 3P27A 4URZR 4CEJA 2JA1A 1CNFA 1XZPA 2XSZA 1GVNB 3LX8A 3TKLA 2GQFA 2ZJ2A 4LBYA 4RFSB 4PAMA 3OZVA 1I4LD 3LX5A 3NTUA 4IOKA 3ADCA 5BW8A 4B6FA 1E32A 1U9IC 1U9IA 2VP2A 3QPWA 5HE8A 4BFWA 4LJ7A 2HT6A 1K73D 3B82A 1ZNXA 2V8OA 1IONA 1F5NA 1S96A 2ZJOA 2VHCA 2QGNA 2XB2A 2ODWA 3CPEA 4DLYA 1AJEA 1KO8A 3CUEF 421PA 1P9NA 5AJWA 2HT1A 3C4JA 3EWSA 1W36C 3F3YA 1Z06A 4OKSA 3E20A 2IC5A 4A82A 2O0KA 2A30A 4KLZA 2AFIE 4IDHA 4LDJA 3O8DA 4EFLA 1Z6YA 4CRWB 2BBOA 2FPKA 2NTYC 1R8SA 1VQ9B 3OIWA 3IDQA 3KFVA 2RGGA 3ZC3A 2ZM5A 3LBIA 1CJUC 1VQ5B 2EWVA 4AF6A 1GFIA 3AV0B 2RGCA 3VO1A 2FX3A 1ZINA 5JSZB 1FQKA 3KUCA 1LW7A 1CIPA 2ANBA 5KO2A 3QE2A 2AKYA 2VZLA 1EWRA 2DFLA 3NBXX 1XEFA 1RPZA 3L8YA 5FBQB 1W5SA 3SHWA 4XWKA 1Q57A 3CWZA 1X3SA 2ZJAA 1N6NA 1ONBA 1U8AA 1KJYA 2G1JA 4YALA 3I56B 4LHZA 1YI2B 1EFUA 2DFTA 2D3WA 3ES9A 4F4CA 3GLFA 1UKZA 4V0OA 2R65A 1F20A 3GJ8A 2ZRDA 3QKRB 4FWIB 3X1ZA 2WWFA 3E1YE 4B4DA 4EPYA 1OH6A 4DCNA 3QFTA 1EFRD 4MKIA 3KXIA 3T5GA 4MRRA 2QP3A 4PPFA 4FD2A 1A8PA 1KMHB 1E1RA 2QT0A 1E96A 2P6UA 2F43B 1OJLA 4ZPXA 5LD2C 4W5HA 1JXOA 2CL6X 1NG9A 2JDID 3OAAA 121PA 3KFXA 4EJSA 1C4OA 3V00A 2BMWA 3CC4B 1DDIA 1U8YA 1S4QA 2OCBA 3SJAA 1W2BB 5FUWA 4OHYA 1KI8A 1Q1BA 4W5WA 1YVDA 3TJZA 4NCNA 1OXSC 4TT3D 4ZCMA 2ZJBA 4OHZA 3UMFA 4GOXA 1ZM4A 3I92A 4XOIA 2QI9C 3LBHA 5DISB 1NIJA 1CEEA 1NDHA 2QT1A 2QROA 3FDIA 2RGXA 1K6MA 4QJ3A 1M2OB 3GLHB 3U6BA 2BGJA 3PQCA 4N0EA 2H7VA 5JEDA 2IS2A 4GT1A 4TLBA 4BEBA 1QHGA 4TTQA 4AKEA 2CK3A 2JASA 2IW3A 2JLYA 1ZM3A 4L9WA 4A92A 4JIMA 3WXMA 3GJ5A 2BJWA 1EX7A 3O8BA 1Q1EA 4M21A 2XAUA 4G1VA 1R5OA 5AJZA 1FUKA 3QG5A 4MKHA 3U61B 3C15C 3KB2A 3V4FA 4EPRA 4HDQB 3TVTA 2NPIA 4WZBE 4M0LA 2CNDA 3KB1A 2WJGA 5DGXA 1X6VA 1JECA 1R0ZA 1GR1A 3P4YA 4L4UA 3IPYA 1CU1A 1G5TA 2NO0A 3BXZA 1I4TD 1ZAKA 3BB4A 4MRPA 1QG2A 3AQ4A 5CK4A 5H68A 1E4VA 1CR0A 1YKSA 1BH2A 2G3YA 4HLUC 4Q47A 4HLUA 5FBVB 2AHOA 2G0NA 3SBDA 4AK9A 3I61A 1KI9A 4QRHA 1K5GA 1ZNWA 2RGNA 3CF2A 2ZRPA 5B64A 2I1VB 2NPFA 1MO5A 2NO1A 2R6FA 3BFVA 3AVUA 5KU1A 2ZR7A 1GUAA 4GMDA 4Q7KA 5FL7A 2VP4A 1PUIA 5JRZA 4E07A 1D2MA 4XWAA 2DETA 2ZRGA 1SVMA 3OEHD 3LW7A 1VCOA 3SJBA 1EP1B 1S3SA 4PSKA 5FPHA 5L3RA 1ZBDA 2C2HA 2JIZD 2WWXA 2ZU6A 3L82B 1F2UA 4NP6A 4Q02A 1TADA 4JKYA 2ONKA 2ZITA 1E98A 3KJEA 2RGDA 4BLQA 1XD9A 2ZXUA 4Q4HA 1LS6A 5DN6A 1ZRHA 5FR1A 4DC9A 1Q20A 3OESA 2C99A 2CMKA 1S2MA 4Q4LA 4R9UC 4BEJA 2JJ2D 4QGAA 5B2ZA 4D82A 5CB6A 4YMWA 3X1DA 1ZC4A 2GXAA 4AD8A 2QA4B 1ZC3A 6Q21A 4HUQA 3TQCA 1YRAA 4OQNA 5FTLA 3SC3A 2JLZA 1I2DA 2Q3HA 2XOKA 3THXA 4JL5A 1MABB 1VCNA 2CL0X 2W6IA 3K70C 4D2IA 1KDTA 3W8NA 3DZ8A 1XD2B 3IHWA 4BLSA 1LVGA 4XVQA 1UJ2A 4PQFA 1K5DA 1ZVQA 4C2TA 5TXGA 4C0LA 4RD6A 1KD1D 1Z0IA 3T1VA 1G20E 1W49A 2WAXA 2WJVA 3U4QB 1QHHB 4PC2A 4NYIQ 1ZUHA 1XEXA 4KV9A 5AR1A 1OXXK 1Z07A 1TU3A 5BN4A 4L15A 4TN1A 4B2IA 3KDSE 2VNKA 1JEDA 4JLNA 3B1VA 4JBXA 3ND8A 3IIKA 1B23P 1D9ZA 3B7GA 4MH0R 5DLQC 1W87A 4B33A 5JBQA 1IN8A 4GP6A 5ELXA 2JLQA 4GP7A 2R44A 3MWKA 5DIFA 1JEEA 2ZUBA 4US1R 3O47A 3AVXA 1LB1B 1E63A 1QGAA 2AD5A 1UBFA 1WXQA 3P26A 4DWJA 1QF9A 1RW4A 1Z2AA 5HZKA 2FV8A 3PEUA 4YAWA 2PIAA 3KUDA 2P65A 4AG6A 1GRNA 5GJBA 1NVUQ 2GAAA 1W36D 2OBNA 3O8RA 5KUTA 1QVAA 2NOAA 3BK7A 1GSIA 2BPOA 1G3UA 4C0SA 4TLCA 3A6PC 2QSZA 3AKCA 2H8KA 1OB5A 5GV8A 1G291 1NIPA 1WBDA 5BXQC 4LJ5A 4Q4AA 1OLOA 1E9AA 2P2LA 3N2IA 4HAUA 3DPUA 2GEUA 3KKPA 2OTLB 1W0KD 1RVDA 2D7CA 5AJXA 3U7FB 1U0JA 3MLEA 5ANRB 4LBZA 4D25A 2FFHA 1Z3IX 2JGNA 3H1TA 3CLVA 2O5VA 1IN4A 1IXRC 4XJXA 4QC2A 1SGWA 2J1LA 2OXRA 1FW6A 3FMOB 2WOJA 2ZRJA 5BN5A 3N70A 3GLGE 4B71A 2KBEA 4LYJA 1QVGB 3PXGA 4EUNA 4YQFA 4TMZA 1G21E 3HU2A 2WJHA 3HWSA 3VNUA 4YLGA 3V4RA 1DG3A 1II8A 3FFBA 1VG9B 3CM0A 2ZRAA 4DSOA 2X2EA 4MGZR 1YU9A 2YV5A 2CCJA 4G0NA 4RCYA 4B32A 1SXJA 4NCIA 4BWYA 5G3YA 3IIMA 2O8FA 4JJKA 1QX4A 1YE8A 2EFEB 1YJNB 1FMJA 2OESA 2R6DA 4LGMA 4PHGA 2YWHA 5E95A 1R0XA 4A6XA 4WOPA 3PITA 1E1RD 2FE4A 1E2GA 1K8AD 2ZJ5A 3Q85A 5FUYA 4W9MC 4C7OA 4KAXA 4NH0A 3IUYA 5FR2A 5TY0A 3TW4A 2IX3A 3WMFA 1P3JA 3TUIC 4QNRA 1XMSA 2ZROA 1HE1C 2C9CA 1A1VA 4OJKA 1D9XA 2YZ2A 3FHTA 1QRAA 5JJIA 4Q4JA 4NBSA 3I62A 3C16C 5HR5A 1TF2A 1KI6B 3SDZA 4M4SA 1VQ6B 3AKYA 1VHTA 2ASEA 2QZ4A 4YAOA 3B1WA 4DCTA 3AVVA 3ADKA 3RS5A 5L3VA 2BEKA 4NU0A 3LWNA 3EPJA 4C30A 2ODEA 3W5IA 4D0NA 4RD3A 3JZAA 2JEOA 2MMCA 3OFNA 4RKFA 1NBME 1T0JB 3MMPA 3K0FA 2ORIA 2R62A 1QZXA 4DSNA 5LB2A 1D2EA 1AM4D 3PUYA 4CDGA 3U3MA 3DKPA 1GL7A 1LS1A 4L5BA 3QEOA 5C1BA 1W7AA 1GG2A 1UFQA 2BC9A 3AP1A 1R0YA 4IFEA 4QJ5A 3FJOA 1E2FA 1Q1QA 3L0SA 1D5CA 4IHQA 3D6TB 2WJIA 4U00A 5G3ZA 1E2IA 3BD9A 1CBUA 2C77A 1OYWA 4HDCA 3TW8B 1KNXA 2V7QD 2IEZA 2XTMA 3HPRA 3EPKA 3EPHA 3CZPA 4IEEA 3UXMA 2J0UB 3SHFA 1UDWA 1R5NA 1OGJA 5FA6A 4HZUB 4KYUA 2EWWA 4D4JA 1W4CA 2BMJA 1E62A 2O8DA 1FP7A 1FTSA 3CZQA 4PXAA 1W34A 1EWYA 4A6PA 4BPRA 3WNCA 2YC4C 1N0WA 2ZSEA 2QY9A 2NG1A 1UDXA 2O8CB 3LLUA 3VU9B 4XTRA 3AP2A 4B74A 3CRQA 5EE3A 4WZAE 1VG1A 3RDPA 4BFUA 4OL0A 1VIYA 5FOWA 2IHYA 3I5YA 1E2MA 2PEYA 4ZGQB 5IHPA 1E2LA 5TB5A 4W5JA 3HJNA 4LPKA 4BFZA 2OHFA 2BKEA 4UQOA 2AK3A 2YOHA 4M1TA 2CLCX 1P4SA 2WWIA 4OK3A 4IFBA 2GEDA 1Y3AA 1XWIA 1KY3A 1NMXA 4JMPA 1IN5A 1Z2CA 4KVAA 4AYXA 1RRGA 3SQWA 5DI3B 3BBPA 1K9MD 2ZQ5A 4V0KA 2QAGB 4A0HA 1RZ3A 4C0KA 5J4VA 2P5SA 1CKEA 5C2JB 1ZIOA 3VAAA 2ZR9A 3Q72A 5JI2E 1LF5A 4IOJA 1P2TA 1W0JA 2EFCB 2UZ3A 5GADl 5EXPA 5FPKA 4HSEA 5HKKD 4BRUA 3CRW1 2YYZA 4PO8A 2VO1A 4JJZA 3CPJB 5EUMA 4GSYA 4A2QA 2ZYUX 3UIEA 4AYTA 1QHNA 4OHXA 3TRFA 1J8YF 2QM8A 4QBIA 3LNCA 5FOVA 3ADDA 2BF4A 2IT1A 2OUKA 3WP0A 2XOKD 3THYB 1FX0B 1XTQA 2RAPA 5G40A 3TVDA 1E2DA 2HUPA 4H1UA 3U44A 4P3YA 1SHZA 2QORA 3K70D 4URWR 5E7JA 3SS8A 2VA8A 5H8WA 1DAGA 5LBIA 3ZS8A 3OEED 2PH1A 3QF4A 3FPKA 3K0CA 2J5XA 1VQNB 1N6RA 1U90A 2I1QA 3GJ6A 4MRVA 3A4NA 5DYGA 1VQOB 2QRNA 3AB3A 1KNQA 2FZLA 3AP3A 3B9QA 2BMDA 5CLLA 3CCLB 1MT0A 1P9RA 4NYIR 4Z51A 1KK3A 4OQFA 1KI3A 3MAAC 3GJ3A 3I1FA 1YIJB 2A9KA 4DQKA 3BH6A 3BB1A 4TQ9A 2J45A 1NJGA 3R9IA 3AVWA 3K0SA 4TLEA 3LBNA 2J87A 3VHXA 4D6PA 1BQEA 1LY1A 1OGIA 2DWPA 5L3QB 2BGIA 1VG8A 3T12A 1VMAA 4W7SA 4LY6A 3G82C 3KTAA 1FMLA 4R98A 3GJXC 1TQ2A 2HJVA 2BDTA 1G3RA 3ND9A 1SM4A 2GXUA 1FNMA 1R10A 2VRWA 2IYWA 2P3SA 1HQCA 3BH7A 1AMOA 3I8SA 4UKDA 2VHUA 1T3LA 3QPUA 4B3CA 2PEZA 1P2SA 4LYHA 2C03A 1Z28A 1CQXA 3GEEA 1NVVQ 3I72A 2I4IA 3SFZA 4ZI2A 3EZ6A 1OE0A 3BS4A 4AY2A 1OXTA 2BKUA 4M22A 4BZXA 2EQBA 2F1RA 4DKXA 2ZRIA 4URVR 4F91B 1KAGA 3AVOA 4R2HA 2NZJA 4YMTA 3Q5EA 5IRCD 1JAIA 1GKYA 1DO0A 1ZM7A 1Q86D 3QOFA 4YAUA 1QHSA 2IHBA 2ZRKA 4BUJA 1KSFX 1G3IA 1PLJA 1RJ9A 5CM9C 3CH4B 4XSGA 1OPXA 2QENA 2VSXA 4N0DA 2IXFA 2GEVA 3T1TA 3REFA 4PZYA 3SE0A 1KKLA 2Q0HA 2FPMA 3HR7A 5CJPA 4EAQA 3SR0A 3GLGB 2ZSBA 1JR3A 2VHTA 4US2R 1OH5A 3F0TA 1L4YA 5GV7A 4M1SA 3D31A 1VQ7B 3NDPA 1F3OA 4ASUA 4ARZA 1D6JA 3L43A 3KQKA 2C96A 1AIPA 4UNQA 4B3FX 2N42A 1OKKD 4UXIA 5H59A 1W35A 1RRPA 1KGDA 5TR9A 1XJCA 2VF7A 3QXCA 3CCUB 2HXYA 2W6JD 2HLDA 3SJZA 1G3QA 1DS6A 1XEWY 4DDUA 3WRXC 1CJTC 2VNIA 3BFXA 2RHMA 4X8OA 3NKVA 1KIMA 3QEJA 5FPYA 3EW9A 4O25A 1U94A 2CEAA 3RHFA 4EFMA 2XXAB 1DELA 1JI0A 1YZNA 1G3MA 1UKYA 2J0VA 3CX6A 3DVLA 3V9PA 2QQEA 1SVIA 4MDFA 1VECA 2KSQA 3SU8A 1DOAA 1E9FA 1TNDA 2HV8A 4Q7LA 3SOPA 3GFOA 2XTZA 2ZPTX 4GPTA 2GWHA 1OFIA 4M1OA 4PTLA 4NCJA 3AM1A 3NBZC 1OIWA 3THOA 1U99A 2EVWX 3TAHA 3VQTA 5JJKA 3AGPA 2CVHA 1F48A 4DLWA 4NL4H 1N0UA 1VQ8B 2ANCA 1J2JA 1K8RA 4ZDJA 1N6KA 1RFLA 1QVFB 1IBRA 1M74A 4QNMA 1Z6XA 4LHVA 4E09A 2GDJA 3A1UA 4IVRA 2IS6A 5TV2A 1KDOA 4A8JA 5FOUA 4X8HA 4HAYA 4QG7A 2FG5A 1G4AE 4V0MA 3U60B 4I1UA 3GFPA 5JRJA 2ZYWX 4ERNA 1OXVA 3K0AB 1Z6GA 5D3MA 5FBLB 1E0AA 3U7EB 5C46F 2GCNA 2FPLA 4WVFA 3LRPA 4F4JA 2FFAA 3GLFE 3PJRA 4OQMA 3G6EB 1T6NA 4LV8B 2FF7A 4G01B
chains in the Genus database with same CATH superfamily
3W3AA 5TDHA 1FBNA 4KQMA 4K6MA 2HEIA 1QOQB 4FQ8A 4HGQA 4XM2A 1G0NA 3WQZA 2C5FA 4G0MA 4LXXA 2A4KA 1SZCA 1P2VA 4ITRC 4XLLA 1EPUA 4UCXA 4CMIB 4YRZA 1J90A 1SU4A 2CXSA 2RAFA 3PR1A 4NI5A 4TXHA 4Z4RA 1T5BA 2VJIA 1MO4A 2D1TA 3FGZA 3I09A 3WX0A 5F9HA 3JQDA 5LDGA 4CM4A 4L6CA 1YJ9B 1W4LA 1XTJA 5JAQA 5HVNA 3UWOA 3ZQJA 3L7MA 4JR0A 2PL1A 5EEGA 4YI5A 3DAHA 4XWYA 5B3JA 1FNCA 2XDYA 5IARA 5J3OA 2HUNA 1N9ZA 3FCEA 3WSWA 4KW7A 3N7UA 4Q3NA 2J0EA 5EHNA 1GZHB 5F4OA 1L7DA 4I50A 3Q7IA 3QTLA 2V3VA 2H9IA 4JT4A 3SBEA 5A05A 3G8DA 3RRFA 4KXNA 4R0MA 3LDAA 3ORHA 4PAGA 4V0QA 4FGZA 2POQX 2H2FA 3DLIA 4EL0A 2IYXA 5IYZB 1W19A 5LVAA 1VYUA 4GD3Q 2Q3LA 2EEPA 1ZGGA 2R4UA 4ZQGA 1UP6A 2V03A 4QPDA 3W9YA 1VYVA 1NVDA 4GXNA 4YPVA 3WLAA 3L8HA 2FSFA 4EQ6B 2Q4DA 4LRQA 1VE6A 3DR3A 4F92B 3D7NA 2HO5A 2V1XA 3CSSA 4JHLA 4QHTA 3UMCA 2PKEA 4K0KB 4J07A 3Q41A 1LA2A 4RZSA 2I4NA 4Y1FA 1H1LB 1MHTA 2ALJA 4DLBA 3AY0A 1UK7A 3JATA 3LY5A 1QR2A 2ZTHA 2JD2A 2HXSA 2EYQA 3ZE8A 3I4FA 1N6PA 1QB7A 1MN6A 4D4GA 3OUZA 1SVSA 5K3BA 3G3EA 3ZXUB 4KK3A 3BTUA 5HFJA 2G5PA 1WDWB 4NDAA 4JYCA 3LT2A 2QUZA 2OTJB 4G5HA 4J0DA 1L1RA 4I3FA 3KR9A 4X8IA 2AMYA 3F73A 1MPTA 1VJGA 2IIQA 1RMTA 4WFIA 4BNUA 5DPMA 2WYRA 1UFRA 4Z4EA 2GHTA 2JHGA 3PVSA 1LBTA 1YC5A 1YK1A 3JZMA 5FUXA 3O4IA 1UH5A 1GUBA 1GRQA 1ZH6A 4Q1CA 3TZHA 4P2BA 2J7PA 2VP5A 2ZDHA 1YBFA 3RC7A 3P9KA 2QGFA 1GITA 1P60A 3N3BC 3V5NA 4B75A 3RYCB 4GS5A 2DFDA 1JLMA 5DGIA 5A4FS 1EG7A 5KYWA 4HWOA 2QTRA 3QKTA 3RT7A 1H0SA 2GASA 2ZBGA 3P2OA 2C3OA 1M7HA 2DKNA 3GFRA 4NE2A 3UXYA 1TM1E 2G9NA 5AW8A 5FO1A 2IHVA 1BYIA 1JHRA 3C3JA 1ZJYA 3EZGA 3I45A 1V5VA 1U2ZA 3OOSA 1Z0KA 1L8XA 2O3RA 3ID6C 3EFOB 3MWFA 1UKVY 2WU4A 1FP4B 1ULBA 3FOCA 4KKUA 1ZRNA 2BGUA 3AUXA 4EGFA 3GXOA 2NP6A 5CCEA 2B61A 1ZW1A 3FR7A 1FDVA 1FP1D 1ZIXA 3AR2A 1UM9B 5DGDA 4S05A 3SF0A 2X9LA 1B76A 1PWEA 1YCHA 4CM8B 2YWEA 1KL7A 2X6QA 3DGFC 1QR6A 3I2KA 1GG9A 4S2EA 1GSOA 3UPDA 3V8PA 2ZR8A 3PPVA 4PW0A 3DOCA 4A2WA 5E6UA 4RTPA 2GVDC 3EPLA 2WK1A 1G7CA 3QVLA 1KEKA 2JB9A 3FOZA 3BQNB 4P7GA 3MWDB 1QG0A 1P81A 4I4TF 4XSVA 1EQAA 2C58A 2D9RA 1P6XA 4RHUA 1CX9B 2C7OA 3F6BX 3ESBA 4RPKA 5EXDA 5BOVA 1EWKA 1J8DA 3AF1A 4ZVVA 2CD7A 3HJGA 4EH1A 2FEXA 2JKVA 4XVUA 1RBMA 4PSUA 2AH5A 1JAHA 4H7JA 4GMGA 1FUUA 2XF8A 3W7BA 1O6CA 1P77A 1V2GA 4ZYLA 3TD6A 4OU5A 4GX5A 4YNBA 4HT3B 3NPAA 1DG1G 5FBHA 2OSBA 2ZPAA 5IYQA 3AOEA 3EXAA 3I6IA 4I99A 4L28A 3R7SA 1UP7A 5BR1A 1TQDA 4HE6A 2ZB2A 3C43A 3FDXA 3RKSA 3DXZA 3V97A 4JNKA 1Z8FA 4DBVO 3H17A 4BB9A 1NN3A 4RK7A 4WBXC 1TYAE 4ZDIA 2WKSA 1P61B 3MWYW 4QJIA 1LDGA 1EE9A 3ELYA 3GJ0A 4ND8A 5EE0A 1GZ3A 1YB1A 2JBAB 3NWEA 2CBXA 4CEJB 2B2NA 1CXZA 2NZUG 3QVVA 1XUOA 2IEAA 2PZLA 2Q6TA 3Q4GA 4LRUA 5ERYA 1ADCA 3SKVA 2ZBDA 2B83A 3O5AA 4F56A 4PINA 2OB2A 2MSEB 3O4VA 4HY3A 3LU1A 4WIAA 5A9RA 4MR7B 3WGLA 4LZNA 3VR5A 1E6KA 2R1VA 1IZ8A 4TV8F 3OQHA 1VLLA 1NP6A 2VAVA 1PSWA 4A1FA 4P84A 4JGGA 5EZ6B 1VBNA 1ZKDA 3ETDA 3MXOA 4Q7QA 4V1CI 1QONA 1QVWA 2Q6OA 3BERA 3OJCA 1QH1A 1LK0A 1TFRA 3DC2A 2QD1A 5H0IA 4P82A 4DMHA 1J49A 1W36B 4ESHA 3EK2A 3LA8A 3DLBA 4XJVA 4DLZA 5G4KA 2W2PA 5IT5A 4XOPA 2J08A 4UNRA 2P2ZA 2QTFA 4NFLA 3C7KA 5CA1B 4UOZA 5IDYA 1Y1SA 1QP4A 1ZCBA 2I6GA 4CFSA 2FA9A 4HDSB 1JXQA 4XM3A 1ZZGA 3IKLA 1QMPA 1XTVA 2R68A 3FNEA 4ZO7A 4AMGA 4C4SA 4C1BA 1NQWA 4DDWA 4LTNA 1X7XA 2NV0A 2LDBA 4LDAA 1ZYUA 3B12A 3UCXA 4W5RA 3KOMA 4I1YA 4MO9A 3OQIB 4OIMA 2GB4A 5DHFA 4YRGA 2WQ7A 2OXCA 2IUFA 1MU0A 1NZDA 1WU8A 2Z5VA 4LV6A 4HQOA 1NR1A 5GTDA 1YZUA 5E1BA 1DO2A 1Y33E 1QGYA 1E1QA 3B6IA 5AM4A 4BVAA 1XKXA 2H18A 2NTEA 4NG4A 4RELA 1UD4A 2OAP1 2JGIA 2B4RO 2R79A 1ZO8A 3JQPA 4LXIA 5CBKA 2V6BA 5ICFA 2F3TA 4TYMA 4LDNA 4UTNA 1LRLA 2HWXA 1A7KA 1KVRA 3UWMA 3W77A 1AG9A 2B9EA 4YMSA 2IFTA 2ZYAA 1RSZA 2CDCA 2CJWA 5TARA 4NIMA 4TZKA 3QEMB 2X6YA 1TUIA 3A8TA 2Q1SA 4WJKB 3KBBA 5DTRA 3T7KA 1OV4A 1R66A 4J2HA 4Y1RB 1T0BA 3PUMA 2HF8A 3P1JA 4FYYA 4MQ4A 1SXJE 3WYEA 2VDPB 1BA3A 2CVOA 3TNJA 2CLDX 2JAHA 3PHCA 2ECPA 2VJJA 2WU0A 4I1IA 2RAUA 5SICE 1KZ1A 1U0EA 4U7DA 1NA5A 3K6KA 4ZOAA 2G83A 4BCCA 4G5RA 4CG1A 1BNCA 1L8OA 3PXDA 1UPXA 1KZ9A 1JKJA 1TFUA 1M5UA 1O0SA 1TJYA 2AB0A 3EMVA 4Q15A 4D9CA 5J58A 1G18A 1KIFA 4P1VA 5CDUA 2QDXA 2FI1A 2P77A 3GGJA 1L4HA 4B5LA 5J43A 3EAQA 4J16C 3BZUA 4XCXA 4D7AA 1XPOA 1MO2A 4PG5A 1M1UA 4UDOA 3EZLA 1IM2A 3DBRA 5T5QA 1W85A 3K9HA 1NX9A 3SF8B 2VNJA 1WXFA 2V3WA 3DE0X 2ZJ0A 4MYTA 1A9PA 2X9GA 3FD8A 3H1GA 4XGRA 1GKLA 4Z99A 5ARCA 3HJHA 4ZVQA 2PT6A 4B3TB 1O58A 5AQ1A 4DCVA 4NOLA 4B87A 3OZWA 1WEHA 2YN4A 2K7FA 4ZIRA 4G1CA 2ISSD 1NRKA 3KALA 1BKDR 3A27A 3N8GA 2WZNA 3S2IA 4YV7A 1GZVA 4KGVA 3W8RA 3VR6D 3WWZA 5FNVF 3PA6A 4P4UA 1AO0A 1WMAA 5AWFC 3SGLA 1O95A 1E60A 2REBA 4JT9A 5HZHA 1NXWA 2I2AA 4BGIA 3VO2A 1EHIA 1OY1A 2F8LA 3TEJA 4NV1A 2I80A 2QT9A 4HAWA 1A5TA 4TUYA 4CETA 1CY8A 5DEIA 2WHYA 1NOIA 4LY3A 5A4KA 4RU1A 1QCDA 4DZZA 1TMOA 2A5YB 4LW8A 2HPVA 2N1BA 5DO9A 4DIDA 5ISMA 4L72A 3O8QA 1P5JA 2QPOA 3QW4B 1ZUNB 1E43A 1XN4A 5HRAA 4XWOA 2OV8A 5CLFA 1YX2A 1K6EA 1N9GB 2BF7A 2W83A 3BWXA 3O3MB 4YVFA 3V55A 2E37A 5A3VA 4A5SA 4AMBA 3S0JA 4REQA 3HHPA 1DJPA 4R81A 1U3CA 3CCMB 1BLIA 2FZKA 4PGAA 3SEFA 1ZSYA 4DLAA 5KYXA 2F1HA 4UMEA 3T0FA 2Z9CA 1XJ0A 4XYMA 2Z6UA 3KJIA 5BSXA 1EE1A 1EGAA 3Q7EA 4IZIA 1TF7A 1OTYA 3K35A 5T8KC 3RC2A 4BFXA 1E3MA 3B9RA 2QMHA 1NC1A 1RQ2A 3GEPA 3FM9A 3P2MA 1VPVA 1C7IA 1CZKA 5C81A 3H86A 1SNYA 4PX5A 5HM6A 4F2PA 4UU0A 5DK6A 1M1NB 1O6BA 1DXQA 3TSCA 4CPDA 3M70A 2X6RA 2OYNA 5ITZA 3EPPA 1M0TA 2OZKA 3L7CA 4AJ4A 4JK3A 1JFRA 3EVZA 3LX6A 3EZYA 3A7EA 4CCYA 1FS5A 4LG1A 5H83A 4OV6B 3NT2A 3ZW9A 3IAAA 4WLUA 4C88A 1AMNA 3KLBA 4YEDA 1LPOA 3BWCA 3CRVA 2D7DA 1XXHE 2PA3A 1PYGA 4AB1A 4RTKA 4QLAA 1L4NA 5LP6F 4MDEA 3AJ9A 4MS4B 1F14A 3TAXA 3CIFA 2VZ8A 1E7MA 3DDNA 1XVAA 2J85A 2WLSA 4X93A 1HEIA 5FTJA 3AVQA 2IS4A 1OWLA 3KYIB 1NV9A 3ISVA 3WGZA 1V48A 1AGXA 2FQWA 3L0DA 3LDHA 1FU8A 3I34X 2XNHA 3PC3A 2PFKA 4GYWA 4KJZA 1X8XA 4P7FA 3SZRA 1Y9JA 2BWJA 3EGOA 4MW2A 3ZHUA 3RODA 3ZKWB 1TU4A 3ZVLA 1C8VB 1ADBA 4RF4A 2PFGA 2XKKA 3DEYX 1ADFA 2MSKA 5GJCA 1K7XB 2W42A 3BQMB 3THXB 5K3FB 1KHHA 3CX4A 1BOFA 3T5PA 5JECA 2ZRLA 3DL0A 2V7TA 3A1PA 1RE1A 1CLEA 2HJSA 3MFYA 5LXTF 3OAAD 1VBFA 1G7RA 2JAQA 3S7ZA 3K8YA 4Z86A 2HK7A 3U6KA 1H05A 4ZOBA 4Z3KA 1YRQA 2IXEA 3KPJA 1DDOA 1N2XA 4XB6B 4ZC1A 3WFJA 3SEAA 1H3EA 4N3CA 2VLIA 2Z09A 2Z0MA 2IVFA 3OI7A 4BNHA 4ZOCA 4FMCF 3A4TA 1IMJA 3PJEA 4IINA 4B17A 2IBTA 1SBCA 2AFHA 2OP1A 2P7IA 2C5AA 1R0BA 1VPTA 4QXMA 2DXIA 2ZSIA 1IRXA 2ZIXA 4UD6A 1N75A 3P0RA 4P4LA 1Y3CE 3NVAA 1TMKA 2JFPA 5EIBC 4B6GA 2C8KA 1V16A 4YV2A 1MAAA 1T2NA 3CO5A 3I9MA 3N0XA 3PNOA 3SICE 3ZJVA 1ZGBA 3GEGA 3ECAA 3ANNA 3IDAA 4OG2A 1KAQA 2ZAMA 4WNAA 2QY6A 3DZKA 5ESXA 3R8FA 2Y1DA 3QXXA 2ZR0A 2QMEA 3BD8A 3WIOA 1XZBA 1N5KA 4D79A 2X5XA 3RU9A 5IK2A 3L0CA 3QLVA 4RDHA 2ZYTX 4NQRA 2XR1A 1H4QA 3C6XA 1ZK0A 2AXEA 3AHGA 3I04M 4IG9A 1NF2A 4OHBA 4EHDA 5KNDH 5TMBA 3PEWA 4NJEB 2O0LA 3PUWA 3H1FA 3K15A 3RF6A 4A9AA 4S04A 3R3YA 1J1IA 3VU8A 1XMXA 1I18A 4JB8A 4KMOA 1OBOA 1NUQA 1AKQA 2PANA 2H63A 3S29A 1DL5A 3A28A 4UUMA 1U0LA 2H00A 3SQDA 1Y7IA 1GQSA 4MW7A 3OPOA 1GUFA 1H6DA 4HR7A 1D5WA 1T3SA 1KC3A 3F8WA 2GKSA 3JR7A 4IXNA 4E6EA 1YQGA 3L6DA 3JQAB 2PLFA 1E8MA 2YJ5A 1WB6A 1JFVA 4INOA 4JLUA 4O02B 3UANA 5DHTA 4DA0A 1DC3A 2XPCA 3Q39A 4MUXA 1BCRB 1MEEA 1BOOA 5TLSA 3CMEB 4JBYA 3PDUA 1J9ZA 1Z5NA 2A9JA 4LVCA 5KYYA 1YB4A 1YHYA 2FUG6 1DWQA 1N05A 2PNFA 3MJFA 4FS3A 2NXEA 1SIUA 3RVQA 1SHUX 1GO2A 1WUTA 2HGSA 3M6AA 4LOLA 5JATA 1XXHA 4EG6A 2GM4A 3FSRA 3M2PA 1AGRA 1S7CA 1V96A 1ZZEA 2IU3A 4HX5A 4PLPA 4WNCA 3I30X 1PNRA 7YASA 1MAWA 1Z5ZA 3TM5A 3GFBA 5F73A 4BNDB 4PLZA 4C4OA 4Y1GA 2ADFA 3KPYA 1XG5A 2JD1A 2ZRCA 4TRNA 5I7EA 2BSXA 3KKOA 1R16A 3LK6A 5A0VA 3FUWA 3INTA 4U9UA 1IZZA 3A2MA 5AIAA 1GM5A 2XITA 5KUTA 2Y93A 3WYAA 2YY7A 4D98A 5DI9A 3PYXA 4ZK6A 1H2WA 2P2NA 3PR2B 4O1HA 2BBSA 1O96B 1JPUA 4WINA 5LZ2A 4R4JA 4Y2PA 1SIWA 2DT8A 3A1SA 3R3HA 2HPZA 4FXOA 1HFEL 4W7HA 1A7UA 3ZH9B 3ZX5A 3H9EO 4U02A 1PU2A 4IVNA 1UAAA 4JQOA 3UMGA 5FPTA 2V65A 4N0MA 3UB4A 3Q40A 3QVGA 1NW8A 5IH7A 4B6QA 3S68A 4G0PA 4EHIA 2QNRA 1RWVA 3NBQA 2BM9A 3UAGA 2ETXA 2VH2A 1H5QA 1GGJA 4AG5A 4DIEA 2P35A 2EGGA 3BF7A 1Z0ZA 2HJWA 2NZ2A 3B1FA 3K1JA 4L7VA 2RE8A 3UUWA 1IK6A 3KOOA 1P74A 4IRXA 4KBFA 1Y98A 4OXIA 5CH5A 5EIFA 5EMMA 4BNKA 3CEPB 3QU5A 2UAGA 3EBPA 4R69A 3EFEA 3FKSD 4MVJE 3WYBA 1D0IA 3FNFA 1WLSA 4Q4JB 1M8FA 2VBGA 5DE3A 3TZEA 2XA2A 3H2ZA 3QUQA 2VDJA 1P4MA 4LOAA 2DRIA 3J7AC 2MHCA 2NACA 2R6HA 3RCBA 1EGHA 5L45A 1N2GA 1SQGA 3FNGA 4RAQA 2Z3VA 4RORA 1UDAA 3URKA 4PC7A 4P6YA 1W4RA 5DYTA 3YASA 5KMGA 3KTDA 1PR1A 4JI8B 3SZ3A 1RXUA 2QK4A 4BPBA 4CMHA 4UNNA 5CNMA 3WLHA 3FG9A 4PO1A 4YCCA 2NU8B 3RBAA 1EVZA 2CMFA 4R8RA 2EV9A 2NVWA 2OFFA 4EZEA 4ZEMA 4IY1A 4X3CA 2X40A 3NHFA 1YE5A 1XAIA 2I7DA 4UBIA 2I55A 2PX5A 3QNMA 2QTBA 2J09A 4QGFA 3R7WA 2A7XA 5KSYA 4O4LB 1MH1A 1Q0LA 2EEZA 3JZDA 1P0IA 4R1LA 5F2OA 5J1TB 821PA 1H0KA 4KGZA 1QO0A 3VNQA 1QS0A 5KQLA 4RKEA 4GBED 1OILA 4TXLA 3W4KA 3FKJA 5A2QA 3CW2A 1KRHA 2CXRA 1MAVA 3H3FA 1MQAA 3OZTA 4KP7A 5G1NA 1A9QA 3TXYA 1XN1A 4F8JA 1LPAB 4JLWA 3REQA 2NZVG 1G9XA 3H2KA 5H1YA 3L9XA 5K8IA 1XAHA 2QRZA 3TE6A 1LLUA 4HMQA 2FEPA 1AF4A 9ATCA 4QBKA 2FSIA 3O26A 1XBTA 1UM8A 2BZSA 3WIDA 1N0HA 1TM4E 3QHPA 4QHYA 1JA1A 4TT3A 3L6CA 2P2GA 2AQIA 4ENSA 4D44A 1JR4A 5AK5A 3W3AH 3RYIB 4DHEA 3BMQB 4P0TA 5CIYA 2O0JA 3JAKB 5EMKA 2OV3A 2J48A 3DNMA 4AL4A 3Q3AA 3RT1A 3DAFA 4RSHA 3I2JA 4B8ZA 1XKTA 3PP8A 2B2CA 3UGKA 2VZEA 3IALA 4N8EA 4D9FA 5L40A 2EW2A 4PSAA 1AS3A 2GN0A 1RLUA 3F8SA 3K96A 2BJVA 3SC2B 5K8UA 2WZCA 4DJ5X 1LWOA 1YR8A 4I9FA 2C2XA 1EX9A 1Y4DE 2UZIR 3QVWA 3E15A 2ID8A 1OC4A 4HD8A 5EFOA 2Q5QA 3CVYA 2NYRA 1P62B 1N3YA 3GVCA 4LVNA 2IZ7A 3K9WA 3ZHTA 1OFUA 3G2PA 3HWWA 3ZHRA 3TLXA 5KTTA 1VLJA 2QA5A 2E21A 3IE2A 1C0LA 3RSCA 1U0FA 4LBVA 1TEXA 1EDBA 3EZ2A 4HDNA 1RWPA 1Q1ZA 1QZ3A 3L7LA 2GZHA 3BIOA 1QU2A 3L4BA 2Z2YA 1E2EA 1D2NA 2DWCA 4GWKA 5ECYA 3ASQA 1YVUA 1Y9EA 2H17A 1NKVA 1GYRA 2H59A 2IYTA 3LK7A 3PGXA 1AZLA 5COAA 1PZXA 3JD2A 3NIBA 4KXXA 5AHXA 3UGJA 4JLDA 3T3PB 4AIRA 2BZGA 1TUBB 3QTTA 4G1UC 3IQHX 4DZTA 4F38A 1Z63A 3E5RA 2R7NA 1FSGA 1LNZA 1E79A 1R6BX 3DF9A 1V1RB 3ETNA 3JYQA 3WNQA 3IEUA 4C7MA 3R6LA 3QNWA 3SX0A 1Y7PA 1XCOA 3UGTA 1J97A 3BVPA 2QPLA 1GL6A 1FBTA 4FJ0A 1ZHFA 3QF4B 5E6SA 4DJDC 2QQGA 3BRQA 4J29A 1A8IA 3DDCA 3ZJYA 2F1MA 4A7PA 4JB2A 1JKFA 1P8JA 2FPGA 3ZYCA 1UMDB 2DPLA 2I78A 1KPIA 1SQSA 2P5UA 3E53A 4LRWA 5JSZA 2AD1A 3TRDA 4QULA 1HDEA 1JQKA 1FMFA 1IB6A 3K4HA 1KBZA 4UM8B 3AVYA 4Q24A 2I4TA 3U16A 4JBGA 1PKEA 1TK3A 5EJIA 2JLBA 4DA9A 5EIBD 3H0EA 4N03A 4DNRB 3BHNA 3DE5X 1VL6A 4RSGA 3UPUA 1IH8A 1E4OA 2XB9A 1L9KA 4JUBA 4X7FA 5JAUA 3LT0A 2O8VA 4BFCA 1D7OA 4EFKA 2BGGA 1W52X 3Q9NA 3GFFA 4AWXA 2F8MA 4K88A 4K9MA 4L27A 3EISA 3EOAI 1YIDA 1IMOA 1NT4A 3MWGA 3NIWA 4IDPA 4Z7NB 1YDEA 4IJKA 2RHJA 3KTAB 4ZGBA 1UZMA 2FN3A 2ZZQA 2NUAA 4BNWA 4KE8A 4BO3A 5B3JC 3IVAA 2DG2A 1EFVB 3CB4A 1KU0A 9GPBA 1OAOC 4CQMA 2QVBA 4UUBA 4WK2B 2WV9A 4UZFA 1X86B 1DC6A 5EKUA 4E7OA 3MOIA 3MQFA 4JELA 1JLHA 2AJTA 4NK5A 2F43A 5EWJA 4X1KA 1I8TA 1P7CA 1XIVA 3R09A 1C3OB 2CLIB 4CCWA 3WWOA 3GLTA 4PR0A 4B4KA 2Z8YM 3PNMA 5TRDA 2P4SA 3GD7A 3H19A 3QU7A 4KSCA 4B6OA 4CR7A 4CM5A 4DEXA 3LQQA 1LFDB 4H77A 3ZCTA 3DWFA 2DWQA 2FN4A 3LO8A 2QW8A 4V02A 2PL9A 1ISIA 4X63A 1XLVA 4B0OA 1SHLA 3BFKA 2FZ4A 5EA2A 2IV3A 2DPXA 2XMZA 2B8WA 1BX3A 3ILHA 3Q8MA 1BWSA 1M0WA 1M6NA 2PWPA 3PC6A 3ZG6A 1ATZA 9MHTA 5ERGB 1QJCA 1GPWB 3MTDA 3LXXA 3D0KA 3KAJA 1CRQA 3PBKA 5FOTA 4CCAA 3WLNA 5TQ2A 1M2OA 1YJ5A 4QFDA 3SXUA 3GLHA 1DPFA 1FTYA 3D3NA 3MK31 4ZT7A 2NYUA 1V8FA 2PWAA 4W9NC 5TF4A 4C0QC 4QBHA 2B5WA 1XSEA 1BS1A 4PRZA 4Q1DA 4L22A 2G08A 1CUSA 3EH2A 4DLUA 4BLWA 1JHQA 4PCLA 2YJ3A 2UYQA 3HDQA 3WK7A 4RK4A 2ZSAA 2VTDA 3RT9A 2V6GA 1O03A 1KY4A 1U7ZA 3NNSA 3HKBB 4HE5A 1U11A 2ATVA 5IZCA 4X8LA 2I3DA 4U2DA 5LCXA 5FFFA 2PGOA 3OJEA 1I7DA 4E5VA 4UJ3A 4ZO4A 2WTXA 2K5UA 3JSAA 3KJZA 5G1PA 3T1NA 5JQWA 4JHXA 2PQ6A 1CQWA 4JP2A 1T6XA 1K63A 2ONCA 1D04A 1W46A 4Q1VA 2QXTA 3IILA 1P45A 1LWNA 2DVMA 2WHEA 4TL7A 1Q19A 1R5BA 4KACA 1X1SA 2EU8A 3PL1A 1S2NA 1WP4A 1NVXQ 4NESA 3C48A 3NBMA 5C1IA 1QYIA 3DG9A 4A36A 1L0BA 1PNOA 1FNNA 4P26A 2BI4A 2ZL7A 3TRIA 4PFQA 4NCKA 2GUWA 3CR7A 4RESA 4IIXA 4ZAXA 4A8JB 2C2KA 3VR5H 5LP6B 1FFSA 4AXXA 4KKVA 1JL3A 1EESA 4ZVLA 3ND7A 2OLKA 1S1MA 3A6HA 3LPCA 3AJAA 1LPPA 1HZZC 1NNI1 4NZZA 3HLYA 2FN7A 4YTEA 4K05A 2XTAA 1YHNA 2NXNA 3LPAA 3QMMA 4R16A 5ALOA 2C0QA 3MJHA 2ZVPX 3BOSA 4FGUA 4BTVA 1M8JA 1WSBA 2YFYA 3C8UA 3N2YA 2ETVA 1F2VA 2OBRA 1NRXA 3SR4A 3TQQA 5EJ7A 5E4JA 2VZ9A 5CDFE 1RI2A 2JFXA 1YS9A 5EPEA 4LHWA 4E5MA 1CUXA 4QGGA 1V11B 4CHGA 1I7QB 2F8TA 2PYDA 1A7JA 3GLKA 3VVBA 3DFKA 4XD7D 4W4TA 3FDZA 3II6X 1Q82D 2DX7A 4FMCB 1WU7A 3I52A 2MJLA 1YS6A 1JVNA 1V7PC 1IC6A 3ZGZA 2DY1A 4Y2GA 2FFRA 1UPBA 4PLYA 3ESYA 3AY7A 4R9VA 5EE1A 5A4AA 2PZEA 3BYZA 3P9XA 4KR2A 3WYNA 3PUZA 4JVSB 3NETA 4O2AA 4PAQA 4KL8S 4JXKA 1PIWA 2XB8A 2V9CA 1KGSA 4I0WB 5JO9A 2ZS9A 1PZNA 2G7MC 3OLQA 1YS4A 2O3SA 1YE3A 3UK6A 2C2BA 2KLHA 4UZEA 5HCUA 2OZEA 3W5DA 1OHHD 2GM3A 1SVKA 2YINC 4LY0A 5TGTA 1U4OA 5LMCA 2E3JA 3DDOA 3NC1C 1D2RA 3IDFA 4RA9B 4X07A 1CUUA 3CWQA 3LQ1A 4HN9A 4D3DA 2AQ8A 2BKLA 4J8PA 2NZ8A 2DCMA 1B42A 1CD5A 2YRXA 3AI2A 3EARA 3ORQA 4M8NE 2VEDA 4PS0A 4ZAVA 1AQLA 1HDOA 3C1OA 2WRZA 2WZBA 1EFDN 2A5FA 3O03A 1PUJA 3FWZA 1DIBA 4NZOA 4DUYB 1WCIA 3UB3A 3VAYA 1YTUA 1OIXA 3LQ4A 4EI9A 1NVGA 5LMNB 1ESMA 3FWYA 1DIHA 5JXIA 5H5JA 1TQ8A 1UBEA 2HADA 5EWMB 3TLGA 1RU3A 3KFLA 4HB2A 5CB4F 2D4HA 1EBUA 3EBLA 2R00A 4IP0A 4X44A 2I91A 3BWEA 2HLDD 3D2AA 4IVPA 3RS0A 4LJ8A 5KNLA 3ZWDA 5AM3A 1LV7A 3AJEA 1RZVA 3A9SA 4TMKA 4Q1FA 1ODKA 2F67A 1W5AA 3BGVA 2WM9B 5KOJA 4XX0B 4XI9A 1GT91 3JYLA 4YB8A 5B1EA 5IT9A 4GL2A 4FDTA 1NWCA 4H7IA 4Q21A 4FQ5A 4AN0A 2CFTA 2AFIA 2F00A 4GYJA 1K6JA 3NX4A 1GPKA 4ME6A 4CKZA 3QVJA 5K4HA 5DNCA 3K09A 3ZWNA 2KM1A 4O3MA 3CCEB 2RCYA 3IR6A 1E77A 3QVKA 2Q5LA 5MF6A 1KETA 3DGEC 5UKDA 3T9EA 1BRMA 5JH7A 5AKKA 3GL9A 5E0KB 3O8OA 5EIAA 4D6YA 3QX9A 4F04A 3TIGA 2OO7A 3EEOA 3UAYA 2YWGA 1Q83A 3G0CA 1L4UA 4YUAA 3BCHA 3Q0EA 4EFNA 3VC3A 1ZIPA 5IWCA 1V5IA 1I14A 1GAQA 1RIFA 3MMZA 1GIAA 1Z5OA 4KI0A 1QORA 4L4ZA 5ILGA 4BMNA 4C6SA 2POCA 3B85A 3LHKA 1KAOA 5CDFA 4AUEA 4P3PA 1KP2A 1ZD4A 2OFOA 4GZLA 3RBXA 3G2JA 2GN9A 1SHKA 3W3AD 4MQ6A 1R4AA 2P9BA 2GQ0A 4ICIA 3PQFA 4M76B 4MW1A 1DTWA 1L7VC 3I01M 5DHRA 3WL4A 1HYGA 3C5VA 1EUCA 3P9IA 2Q6KA 3IDSA 4RULA 2JFHA 4RL4A 3TO5A 3DUFA 4TMTA 2FEWB 3I1JA 3NTLA 3JY6A 3ODPA 4PSCA 2QP9X 5HA5A 5F3DA 5JFGA 4PGHA 2RH9B 5FRDA 1OBCA 1SXQA 4DBLE 5LZ7A 5BQXA 2B7CA 1OLSA 5JS2A 2CDNA 4RPIA 3GPDG 4EJSB 4BWGA 1XZHA 1N9KA 5GINE 3LXUX 4WADA 4IUBS 4LSGA 3QUCA 3CZ4A 2DYIA 1C1XA 1JA9A 4EGQA 2XB4A 4H17A 5AVSA 4EG7A 1LDNA 3DZCA 5L3SB 1C3XA 3HB4X 2H5IA 1WMSA 3DMDA 1B8PA 2G07A 3M0EA 2TMGA 3BH0A 4OBWA 3USES 5KNCA 3P32A 3I4LA 4E22A 5TQ0B 3UW1A 2CYAA 2GARA 1ZP6A 5K8JB 5DF1A 2FUG1 3A6EA 4B3IA 4OM7A 3A26A 1L7AA 1H4SA 1K7FB 4V1CA 4YIKA 1HTWA 1ONNA 1XZCA 5BUZA 4U6QA 3RYFA 4KNWA 4D9EA 1HE5A 2WINI 1MOSA 2XZPA 1YD7A 1SIBE 2D3TA 1OASA 2DGDA 3SHTA 2WHRA 2NSYA 3TBKA 1Y6QA 4TQAA 3CX8A 1XU7A 1LQ2A 4K6CA 4OI2A 1FRFS 2IIBA 3TOXA 3TLAA 1RLMA 3RVBA 3ZLUA 2UZ1B 3OY2A 2XQIA 4CT0A 2OR3A 4PZUA 2LGJA 3ZXYA 4BJ1A 4MZXA 2RB5A 3A31A 3CX7A 2VJAA 1VBMA 3KYCA 4M7OA 5C7IO 3P9ZA 2ZYVX 3B9PA 2PU7A 1U2SA 5HS6A 3F6RA 2C9YA 2GCOB 2HA4A 1VTKA 4MLPA 2IA5A 1VKHA 3RAEC 3HA5A 2RC5A 4WACA 4ZKDA 2OCIA 3X1XA 3QG1A 4HHEA 2ZUCA 4FU0A 5I7HA 1XTZA 1M6YA 3S1LA 1T9DA 1N0VC 5HJEA 4R05A 3BJMA 3TEFA 4P3XA 4B0PA 7AT1A 4C43A 3U62A 2V55B 5JBNA 2Z1NA 2ZTUA 3ESXA 4OFZA 3W90A 2Q7OE 4KRFA 5J59A 1E5QA 1QIIA 2XYVA 3K0HA 3WQQA 1WW8A 4BQSA 2ZRMA 4M0FA 1CQPA 1Q7TA 1WTAA 4OOVA 2J7PD 1NB9A 1V2HE 4BNIA 1JS1X 4GX1A 5LDHA 1XWWA 1E8NA 3C6MA 2OXIA 2TMDA 2DQZA 4N5NA 1T9HA 1W2GA 4RA6B 3VSAA 2VUSA 3M1AA 4KHZA 1NXVA 1Y1QA 4QXRA 4R3NA 3ZVKA 2X8AA 5AXBA 1FFXA 3GMIA 4X6LA 5JARA 4GHWA 1U6KA 3OKAA 5DBFA 5BR4A 1FYXA 4PZZA 2ZREA 3IUMA 3QFSA 3I8XA 1RWMA 5TEWA 3TXXA 2P41A 1HDIA 5K0TA 5A4IS 4UW9A 1XQ1A 5D3ZA 3ZH2A 3EXEB 3X43A 3W2GA 5HM8A 2PS9A 3QX7A 1MC1A 2BR3A 2PZJA 2Q5CA 1NMYA 4NECA 2OVBA 2JIOA 2QEQA 3GT7A 4OLHA 4B7XA 5JW6A 1JHYA 1PWYE 3CSDA 1PNVA 3VH3A 5JNLA 1C4KA 2C7VA 2C3YA 2ODAA 4CU5A 4B7UA 4D8WA 1DUSA 1X9GA 2VBVA 4HI0E 4QPZA 2NVUA 4Q9KA 5BN3A 1IVNA 2RD2A 1S5PA 5IANA 1TAHA 2P4HX 2QAGA 3AIIA 4M54A 4B79A 4NU6A 4WRRA 2VQFB 4HMPA 2L17A