4RCZA

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gdpnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 111
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rczA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rczA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rczA01
1RZ3A 2HF9A 3HDTA 4Q4JB 5HZKA 4PHFA 3VMFA 4A0GA 1AZTA 3PEVA 3T5DA 1S8FA 5D3QA 1R6BX 3IILA 2IXFA 4ZGQB 2H18A 1RW4A 2HJVA 1X3SA 2FN4A 2QRNA 2ZR0A 3L8YA 4ZDJA 4XJXA 5CK5A 4YC7A 2HCBA 2JGNA 3A4LA 3CZQA 5TY0A 3W2FA 2IHBA 3T06B 4Q66C 4B3DA 3SJZA 4QG7A 2JAQA 1J99A 1BS1A 3W2IA 4O2LA 4ESHA 1EP3B 1OIWA 4XWAA 4BZQA 2XTMA 2ZU6A 4N0DA 2A5JA 1AS3A 3EA0A 4LWZA 2EFEB 1ZNWA 2IT1A 3AB3A 3AGPA 4AWXA 3L8ZA 2G77B 2RGXA 3VX4A 1TTTA 2D06A 4ZV4A 5E4FA 6Q21A 2CL7X 5B2ZA 5FOSA 1PLLA 3CWQA 3MG9A 4EPYA 4QRHA 2XTZA 1E6CA 2LWIA 3RYTC 1VG8A 1JJVA 1KJZA 1JJ2B 3NEYA 3QVUA 4HDOB 1E9AA 3ZBTA 2XX3A 1VTKA 5FPTA 2V3CC 1TF7A 4LCBA 3K0FA 2FMXA 3GJ8A 3AVVA 1P2SA 2F1HA 1E62A 1N0UA 1E98A 2CHVA 1CS4C 2DYKA 2C9CA 1KZ7B 3KL4A 4EFNA 5L3SA 5KNCA 4RFSB 1E69A 4FK8A 1E2MA 1G3QA 1R0ZA 2KI5A 2ZRLA 4LRWA 2AWOA 4JYBA 4PQYA 4Q1BA 3HU1A 2GJAA 4AIIA 4LYFA 1X8LA 3RWMB 1YR7A 5KPDA 3NG1A 4KITB 4P4SB 3Q5DA 1NVVQ 4CIDA 1UF9A 3LWNA 1X1SA 1UKZA 4Q00A 3BGWA 3UG6A 2WJYA 3HJNA 4CEIB 4MRVA 3G71B 4ZGNB 4J0QA 1CRQA 1X8JA 3TUJC 3U5ZB 5BYJA 2ZTSA 4IW3B 1E96A 3EAQA 4M53A 1R2QA 5JS7A 3NTUA 1VQ8B 1Z3IX 1Z47A 3KZ1E 1VQ9B 3PFIA 5H59A 1MO4A 4O3MA 2OILA 2D3WA 2WKRA 4DZZA 2HT6A 1KRHA 2XZLA 2R65A 4JT4A 4ZO4A 1E9BA 1N6IA 4TQUS 4BLQA 3T1VA 3PUZA 3F3YA 4DT1A 4KSCA 4KVGA 3PV0A 5SZJA 3ZQJA 3B78A 4QHYA 4JBXA 1E9DA 1QUEA 4QHTA 3QKSA 5TXGA 5GVSA 3KQLA 2ZYWX 4LYAA 5FL7D 3U4QB 1R8QA 2ORIA 3HWSA 4HZUB 2QTZA 4DCNA 3RHFA 4BFWA 5EE5B 4D2IA 4C0AC 4DC9A 1EFTA 4TMTA 1W0JA 3CW2A 3A1TA 1D2NA 2NTYC 3AEZA 2YC2C 2PZFA 1ZC4A 4AF7A 2WAYA 4HUQB 3PEYA 2N46A 4KHZA 4OJKA 1P5ZB 1KK1A 3Q85A 3JQRA 4R7ZA 1ZU4A 1GVNB 2IX3A 4QBHA 1R0WA 4JLJA 1GFIA 3KTAB 1M34E 1I2MA 3CF2A 4POAA 2ZROA 2JLUA 1W34A 2KJQA 1D6JA 2FDCA 4B74A 3ZD6A 1TMKA 1E0AA 1VCMA 4LJ6A 1ZNZA 5GV7A 5EXPA 2JDIA 2OG2A 3BH0A 3P32A 1UFQA 2V6JA 5B64A 2B5OA 5FTLA 2KB0A 1YZQA 2BOVA 2OAP1 1XCGB 1WDTA 1U9IA 3QSYA 2O5VA 1G16A 4V0KA 2OBLA 1T4GA 3UK6A 4H9GA 2FOLA 4WZBE 1OV4A 1TQ6A 1RRFA 3ND8A 3GJ6A 4W9MC 2VP5A 2WV9A 1ZW6A 1KI8A 2AN9A 4Q7KA 4Q4AB 3ICQB 5CLQA 1EESA 2FH5B 5HCIA 1YJNB 5FL3A 2GCPA 1BQEA 2F9LA 3A4MA 1QHIA 1UPTA 4QM6A 4HDQB 2J0QA 3T35A 2VSXA 4CVNA 1ZRHA 4WVFA 3W6PA 5FPYA 2VNJA 3PJRA 1EX7A 3O8RA 4AC9A 2P2LA 2XXAA 5KU1A 3H84A 1CQXA 1YZLA 3LW7A 1W36C 4C0LA 3SFZA 3RANA 2LKCA 2G0NA 4QM7A 1OFHA 4JVNA 2C78A 3OW2B 2W00A 3TAUA 4JJZA 2J1LA 3T61A 4Q1FA 3PUYA 3N2EA 4LBYA 1EWQA 1YKSA 2J87A 3DOEA 1Z63A 1YIJB 1PUJA 1KYIA 3CXCB 5FOVA 2UKDA 3VTKA 5L8VA 1NLZA 3HP1A 2OXCA 3WP1B 3KQKA 3DOFA 1AK2A 2JLVA 1P2TA 2DERA 4GI7A 3LLMA 1KMHA 3VR2A 1N25A 4MKIA 1US8B 1LNZA 2VBCA 3CPHA 3TE6A 4JVLA 1Z28A 2BPOA 2ZRPA 2QAGA 4QXAA 1KQSB 3VKGA 1NIJA 2BM0A 5AUPB 2P3SA 1ZVQA 1VQLB 1YR9A 2IYUA 5KDLA 3KQNA 1VG0B 1K6MA 2VNHA 1GWNA 2WWXA 3PEWA 2QL6A 2O0JA 2ECKA 4NYMQ 1G6OA 1W48A 4EIWA 2WOJA 5FPKA 2PEYA 2K5UA 2GBLA 1R0XA 5AR1A 1Z5ZA 1AN0A 1P6XA 2RH5A 2W83A 2QG6A 3R9IA 4PTLA 4CGZA 1N6HA 2QMEA 3U7FB 1G7SA 2J7PA 2BBTA 3Q9LA 2JLXA 5IRCD 2ZE5A 4AKEA 3FHTA 3EC2A 4W7SA 1G9XA 3MWKA 2QBYB 4QL3A 1TUEA 2VH5R 1QH0A 3WMGA 2A3RA 4DQKA 2ZRIA 1COWD 1NIPA 2ZRMA 3R20A 2NO6A 2YOFA 1Z6GA 1F2UB 2GXAA 3NC1C 1FRNA 2FSIA 4NYIQ 1HV8A 1JR3A 2NO9A 4PHGA 4JS0A 2ZPTX 2ZS9A 3J81k 2C5LA 1SVIA 5G40A 3QKUA 5HZHA 1G4AE 1QGYA 3SYKA 3U2QA 1W46A 3DKVA 4PXAA 2GHIA 1XD8A 4OI1A 2YINC 3ZDQA 4B3FX 3BRWD 2V6IA 1OHHA 3QXCA 4NCIA 3AVTA 3TNFA 4US2R 1KO4A 2QU8A 4PC7A 2BVNA 4PPGA 3RS0A 3P4YA 4IFEA 2ODNA 3DMNA 3C5CA 3BC1A 5FI0B 1WP9A 1MOZA 3CRVA 4O2RA 1TNDA 3FKQA 4NU0A 4JVMA 3KKPA 3SJAA 2RGCA 3CIOA 4L9SA 3QG5A 2DEUA 1IM2A 3D31A 2ZE8A 4OQXA 1CJTC 1XCMA 5E7MA 4LV5B 2HCJB 1S2MA 1SXJA 1F60A 1G7CA 3ASYA 4TSFA 5B58C 1CLUA 2QAGC 4C30A 3M1IA 2F55A 2ORVA 1J8MF 2QY9A 4AURA 2H5EA 2BSAA 3NWJA 3AF1A 2BF4A 1N3BA 3TUIC 5HCNA 2G0TA 2J7KA 4M4SA 3ES9A 4DLTA 1G3IA 2F43B 3U3MA 1H85A 1E0JA 3RAPR 1E2HA 3H2YA 4JSTA 1D2MA 2NZ8A 1KI7A 2WMOB 1CBUA 2IA5A 2GBLC 5G3YA 1QG2A 3U61B 5FR2A 4M0LA 2RGEA 4NE2A 3SYNA 121PA 4OK6A 2DWQA 1FQJA 3ZYCA 1SVMA 2NQ2C 3TGPA 3NDPA 1PVOA 1GR1A 2CCJA 5J4LA 1CEEA 2ZXUA 3PG5A 5GVRA 1KMQA 4U00A 5JHHB 3Q3JB 3VNUA 1GAJA 3GP8A 1KC8D 3GJXC 2FSGA 1NF3A 1IN8A 3GJ0A 1N2CE 1R10A 3FGNA 3IPYA 4N1AA 4BECA 3I61A 2XGJA 4F93B 2ZI7A 4A92A 5K8IA 1X1RA 4JSYA 5UKDA 2GJ9A 4P33A 5LD2B 3K0CC 1KSJA 4MA4A 2A7QA 2DETA 3QUSA 2ZVPX 4MGYR 1IXRC 1QHNA 5FI1B 1QVGB 2XJ4A 3ASZA 1HY3A 4KVAA 2R2AA 4OQFA 1ANKA 2B6HA 2C9YA 3MGCA 4LHYA 5EUQB 5K8TA 2PZGA 4CT4B 2P67A 4EPTA 2ZSAA 3FVQA 3UATA 1T8UA 4JL5A 2J7PD 2XNSA 4FCWA 3K70C 2XAUA 2A78A 1KI6B 4NCKA 1MT0A 1Q3HA 2D4HA 2QUZA 3V4FA 1G6HA 1S9DA 2GAAA 3QENA 4ITRC 4QOSA 3VO1A 4G5GA 1XCPA 3H0KA 4LOAA 4BASA 4WXRA 2OSBA 3ZH9B 4DLXA 2OCBA 1LS1A 4GFDA 3LBNA 3R8FA 1WQ1R 3EPJA 4TQ9A 5FFMA 1JJ7A 4LBWA 4DQLA 4ZI2A 2NZJA 5H5JA 2QMOA 2YOHA 3EWSA 4KSBA 3MFYA 3AUXA 2AD5A 4LJ4A 4L9WA 1G21E 3NBXX 1NVWQ 5IK2D 1G3RA 3CUEF 4Q4HB 4M9ZA 4X8OA 3VR4A 1GO2A 1XTRA 1VQNB 4YONB 2IYWA 2QT0A 5JSZB 1EK0A 3UANA 2CLCX 4JKYA 3FE2A 3LH5A 3ZVMA 1J9ZA 1RFLA 5EP4A 4DSTA 2WWWA 3FMPB 2YKGA 3HU3A 3CR8A 1CJKC 1CULC 4DLVA 1XPRA 2PCLA 1P72A 3TSWA 3CCMB 2FE4A 1E1RD 4U02A 3X1YA 3B60A 4WW0A 1KI9A 3K70D 4Q7LA 1UBEA 3GJ5A 4ZKDA 1ZIOA 2IUTA 4RSGA 1QGZA 4FINA 4DBLC 5LDDC 5KSZA 2FU5C 3FMOB 4OKSA 4TSFD 1JA0A 5JECA 1WBDA 1BO6A 3THWB 4HAUA 3THXB 1G4UR 3A36A 4TT3A 3C41J 1P9NA 4URYR 4LHZA 2QA5A 2NG1A 4QFMA 4JLVA 2QT1A 4HDCA 3VR6A 2B8TA 4EJSA 1ZD1A 1Y63A 1CRPA 5KDDA 3RSLA 3FFAA 4BFTA 1K5DA 3IQWA 2ZRDA 4L16A 1S1CA 4HATA 4PC3A 2Q3HA 4A6XA 4K1XA 4URXR 4XOIA 2AK2A 1BYIA 4RD0A 2J9RA 5EUMA 4B75A 2QQ0A 4LHVA 3CC4B 1GUAA 3B2EA 1GNPA 3ZLJA 4M1KA 2XZPA 1YJ9B 4JL6A 2WMNB 4S35A 4MYHA 1D2EA 1QHYA 2WZQA 2Z6VA 4AG6A 3W6OA 1S9HA 4IEEA 5C4GB 2F3TA 1TX4B 3U3JA 2GQFA 1PLJA 2HLDD 1JXMA 1YZUA 2VIIA 1D9ZA 1XNJA 1CJVC 2GF0A 3B9PA 2CK3A 4Q7MB 4JLMA 1UBCA 1NI3A 2GDJA 4A1FA 3VAAA 3W3AA 2P65A 3T5GA 4E09A 1KK0A 3BERA 4NH0A 1RRPA 1VG1A 3BFKA 4DRZA 3LNCA 2HV8A 4ERNA 2EFDB 3QE2A 1NJID 2R6GA 4UXJA 1IBRA 3NIBA 4E5UA 2C2HA 4YDHB 4MUAA 1U90A 2CMKA 2PX3A 2EU8A 4QJ4A 4OL0A 1NG9A 4RD1A 3K0EA 3PVSA 3EZ9A 2R8RA 4A82A 2OK7A 1IXZA 1F2TB 2ZSEA 2ASEA 1K73D 3EIQA 1S3SA 2W6JA 3K0AA 1DE0A 3QF4B 5FOUA 4ZDWA 4R71A 3AF4A 1NN5A 4ACBA 1XFAA 3QPUA 1NBMD 4MUBA 4XSGA 1SHKA 2PL3A 3DL0A 2XB2A 4WA7A 2HYIC 2GF9A 3OF5A 1EP1B 3ZQ6A 1VIAA 1ZP6A 2ZR9A 4Q9IA 3KQUA 2JLQA 1WMSA 3AKEA 4L5BA 4C0KA 4B35A 3EASA 3R9WA 1U99A 3SQXA 3RC8A 3WP0A 1FL9A 4LJYA 2FPMA 2JA1A 2VYFA 2B7CA 1XEXA 3AVWA 1RVDA 2WKPA 1EFHA 3JZMA 3ADBA 1RRGA 1EGAA 3KJIA 5FBRB 5TARA 2W2TA 2ERYA 3SS8A 1KKMA 4YMVA 2YJTD 4RVCA 3OZXA 4EFLA 3JQQA 3GJ4A 3KUCA 2GESA 2AK3A 1FNBA 4A0RA 2IYYA 4F92B 1M2OB 2A30A 1A7JA 4HLCA 4GP7A 1W7AA 1MKYA 1TQ4A 2QROA 3X1DA 4UNQA 3L43A 1Z0KA 2J0VA 4EQ6A 2ZRJA 1GRNA 3AF2A 4TWZA 3QIAA 4KYUA 1OJLA 4KAXA 3K53A 2AR7A 5DH9A 2CHQA 5DHAA 4XWOA 1GL7A 3NVAA 4LV8B 4FCVA 2VHUA 2YC4C 3CH5A 1AS2A 5JFGA 1DAFA 2BV3A 3I5XA 3KXLA 2R6CA 3KKOA 4CT5A 2OE2A 2WSMA 1CTQA 4YMUA 4DLUA 3VR3A 5CM8B 1XEWX 2WM9B 1KI1A 4LJAA 1JXOA 1N0WA 2ZYTX 4G5RA 4ASUD 4D81A 2DCUA 3ICEA 4F4IA 1G1MA 3DM5A 5F9FA 4BEBA 1TAGA 3UMFA 2OBMA 3V00A 1U94A 3K0FB 1ZUNB 3X1WA 4ZDIA 1Z8FA 3EG5A 1NNEA 1A2BA 3W5VA 3ZGXA 4PSKA 5BN5A 4P31A 4NYMR 5L3SB 1DAIA 2VTKA 2VSOA 3S1AA 3W9YA 4YQFA 3TQCA 4EH1A 3D8BA 4N0EA 4Q01A 3R9XA 2RC6A 2BKEA 1EWRA 3GFTA 3I3SR 3OAAD 3PUXA 2IS2A 3KDSE 1AS0A 3LAWA 5A4JA 2GEVA 3W2EA 3BAFA 1N0VC 1IY0A 1Z0AA 2JASA 4JLNA 3AKCA 2GXSA 4LC1A 3ZC3A 3L0IB 1HURA 1LY1A 5DYIA 4B73A 1I4TD 1TPZA 2WIBA 2VF8A 5GJCA 3BORA 1HE8B 1EFUA 1MO6A 2ZAOA 4P32A 1TEXA 2OFOA 2VRWA 4ZI3A 2F1JA 4C0HA 2YWFA 4LY6A 2WWGA 1E2DA 4JT2A 4OI4A 2QM8A 4IDHA 1VQ4B 2FA9A 2VQSA 4B3CA 2BMFA 3QEOA 5EP3A 4DT1B 1IXSB 1DAMA 1LF0A 2Z4SA 3NKVA 1AJEA 4GPTA 1DVRA 4EFMA 4QGFA 1II0A 2QTFA 3W2GA 3EZ6A 5FL7A 3ADCA 1ZINA 4GT1A 1ZNXA 1XD2A 3QKSB 4BFUA 3NDBB 1P75A 3H1TA 1W36B 2Q3MA 2ZJZA 4A0FA 3ONWA 2ODWA 1CXZA 1XEFA 1Z22A 3RLFA 3MCAA 1FRQA 3A1UA 5CYOA 2O8CB 4HAZA 2JATA 1CR1A 4PANA 3W8NA 4QJ3A 3D6TB 3JZAA 1JR6A 4QKQA 1J8YF 2QMHA 4GZMA 3OJWA 1K5GA 2IW3A 1W1WA 3T1OA 3RRMA 4ARZA 2XSZA 5TV2A 5J40A 2Z5FA 2ZIAA 3LW8A 2A9KA 3WYAA 3SHFA 2V7QD 3BB1A 4JL8A 1VYUA 2OTJB 2QP4A 4XSHA 3KXKA 3Q7QA 4GBMA 3R8CA 4WXPA 2W2XA 4HE5A 3T34A 3WYFA 4IXNA 3GQBA 1NSFA 2BEJA 4R98A 3CX8A 2D2FA 2A5FA 5CB8A 1N5IA 2IYXA 5AWFC 4K46A 4ZPXA 2XNCA 3WRXC 421PA 3QI2A 1FX0B 4LSGA 4YMWA 3K9GA 5AJXA 1UKVY 2GTPA 3I72A 4I99A 3CX6A 1OE0A 3SFVA 4OQMA 1LTQA 1KK3A 2PJZA 4PZLA 3VU9B 5KTYA 2NPIA 4BFYA 5L3VA 3WYGA 5AJWA 3CO5A 1N6PA 4WAUA 2F1RA 3E1YE 2FPLA 3B9QA 2CL6X 3WNBA 4EKDA 4Q1DA 2V1UA 2ZYUX 4KCGA 4DB2A 4IKEA 2CCGA 2J3EA 3W3ZB 5L3QA 1YHQB 3C7KA 3UWOA 5G53C 4XTCS 1AKYA 1SVLA 2EWVA 2VP4A 4G5QA 4US1R 2XB4A 4EUNA 4YAOA 1T5IA 5E7JA 3Q7PA 4M1MA 1CR2A 1N5KA 2C99A 2YYZA 5JJIA 2IYRA 1SVSA 4C7OA 5FTMA 4Q9LA 1W0KD 3CCRB 1KJWA 2XXAB 2ZAMA 3PR1A 1N5JA 4PQRA 2FV8A 2C9OA 2QTHA 3JVVA 1ZCAA 4C0QC 3IEUA 3KKQA 1E9FA 4PC1A 2X2FA 3HR8A 1M7HA 3AVXA 1I4DD 1M7BA 2CVFA 2F1IA 4Q7JB 2J0UA 3M6AA 3QNUA 4LHWA 4Q19A 3EZFA 3AM1A 3EPHA 3K8YA 4UAJA 1E9RA 1JR3E 2RHDA 1Z83A 1OH6A 1QHHA 1QX4A 4E22A 2NGRA 4YAUA 2VPPA 3GFPA 4URZR 2NPFA 3EPKA 2VHTA 2D7DA 2ONJA 4YMTA 5EMNA 1GNRA 3QG1A 2VHCA 2RCNA 2WJVA 3DO6A 4DUGA 4XVUA 1SVWA 5J4VA 3P26A 2AX4A 2DY1A 4RZ3A 1ZD9A 4G5SA 1G8HA 1K9MD 4XTRA 1NVXQ 4DWJA 4M21A 2Z4RA 4PR0A 1AKEA 5IT5A 2QPOA 4TMKA 4B44A 4EPRA 1GSIA 5JHGB 2ANCA 3A6PC 2QRZA 4OK3A 3TH5A 2GEDA 5CITA 2PCJA 4FWIB 4MRRA 4PHHA 5KOYA 4CRWB 3I62A 4I4LA 1FUKA 2W6ID 3Q5EA 4NYJQ 1BJKA 1ZMXA 3NBZC 4WOPA 1SZPA 5EP1A 1SXJE 3D7MA 3MJRA 3QOFA 3IEVA 5FH9A 3EC1A 2REOA 4JLPA 4EPVA 2WWHA 2P5SA 1OLOA 1M8PA 2MSDB 1COWA 2E9SA 3TW8B 4DXAA 1G291 2B8WA 3KJEA 4Q18A 3TJZA 2F7SA 3SC3A 1M90D 2XSZD 3MMPA 2G9NA 1T91A 2GXQA 3DZ8A 1BX0A 3LVRE 4HLUC 4K81B 1VHTA 2WSSD 1XMSA 3K9LA 1G7TA 1E2JA 3KB1A 3SZRA 4JYCA 4BQSA 4FMCF 1ZM2A 2JJ2D 4X8MA 4Q5IA 1DOAA 1FDRA 2O52A 2QE7A 3GLHA 4DB4A 4LK2A 2QZ4A 4TYPA 2IEZA 2ZUCA 2IF2A 4Z1MD 4OHYA 4LZZA 1G8PA 2YOGA 4NBSA 1L4YA 4B2PA 3GLGA 2VHQA 5CDFA 4FD2A 4U5XA 4D4JA 2BMDA 2CVHA 5E7IA 3LV8A 3T15A 4NPHA 3TR5A 3C16C 2GJ8A 3BD9A 2BMEA 2REBA 3DDCA 1YR6A 1EP2B 2O8BA 2FEMA 1Z0JA 1SXJB 1ZM7A 2CLSA 1E2IA 2CNWD 1TQ2A 4L8GA 2DFKB 3B5JA 3QFRA 3ZBUA 1T3SA 1ZBDA 2D2EA 5KNBA 1XWIA 1XE1A 1JB9A 2ZE6A 1FMLA 1Q21A 1L4UA 2FFBA 2Q9AA 3BB3A 3EW9A 2IYSA 4KODA 1QVFB 2GVZC 4II7A 3I55B 1QDEA 1U8AA 3BB4A 4I1OA 3U3RA 2ZSFA 2ZRAA 4RFSA 3L2OB 2NO7A 3C5HA 2OCPA 1MV5A 2ZJ2A 3LBIA 4OK5A 3SQWA 2C03A 2IYLD 2AXNA 4G1BA 3AUYA 3ZIAD 5EZ5A 2OESA 4Y0VA 4LJ9A 4HB4A 1M7GA 4WBSA 2IC5A 4P4SA 1ZM4A 3OIWA 3LFUA 5HR5A 5JEDA 4BFSA 3UPUA 1H8ED 3LBHA 1S4QA 2UVQA 3CC7B 2CLDX 4CEIA 1B0UA 2P5TB 4ZCLA 5AN9A 4DUGD 4KFSA 2X2EA 4ACAA 1P62B 1FP7A 2G1KA 1CU1A 4R2IA 2ZM5A 4WZAE 5EXXA 1UKYA 1UBGA 1W35A 4ABYA 4S2EA 2QNRA 4LV6A 4D0NA 1DDIA 2HUPA 1NY5A 1IOZA 4IDOA 5KYKA 2P6RA 2CBZA 2WWFA 1UEIA 2EFHB 1AM4D 1GP2A 2OO7A 1G20E 4Q21A 3I73A 4DDWA 621PA 4B2IA 4G5OA 4V0OA 4GZLA 2HF8A 3BIFA 1X86B 3B6EA 5FBQB 1MO5A 4W5HA 1KTVA 4D4LA 3UXMA 4TZ0A 1HE1C 1I2DA 4TLAA 1HT2E 1WF3A 3BH7A 2EVWX 3F0TA 3NEJA 1S96A 1NRJB 4D4KA 1ZU5A 4FMCB 4HLQB 5IK2A 1G5RA 4GP6A 1T3HA 1GITA 2W0SA 4B34A 3K0CA 4AYWA 4C2TA 1CIPA 1IY2A 1GJRA 1CKEA 3A4NA 5TR9A 5CB6A 1K8RA 2CL0X 3CCUB 2QQEA 2VNKA 1OYWA 1Q57A 2QE7D 3IO5A 2ZRKA 3GLIA 4US0R 4DDUA 3HR7A 1ZC3A 2DWPA 3IQXA 5AK0A 5B30A 2HMAA 4FW9A 2KBEA 1E1RA 1UAAA 1YHNA 3QE0A 4A2QA 1T3LA 4G1VA 1U2RA 2WWIA 1UKEA 2AXPA 1KY2A 1D1NA 1XMIA 2DPXA 4ILEA 3TQFA 1IB0A 2EIXA 1KAOA 2FWRA 3KFXA 4X8HA 2J41A 1GVHA 2PEZA 4V03A 4BRWA 1CJUC 2C98A 5JWRA 3G0HA 1PJRA 3R7WA 5JI2E 4Y9UA 4B47A 4D82A 3AP1A 3QY0A 1HTWA 5J5CA 3CZPA 3N2IA 1HEIA 4DEYA 3I32A 5KO2A 4DEXA 4LUCA 1VKJA 1H65A 1YZNA 4OHVA 3GPLA 4OJQA 4D0LB 4MDEA 3RS3A 4EDHA 2OK8A 1R5BA 4QNRA 2H1LA 2QORA 2WJGA 1Q20A 4HE6A 2JLZA 2QI9C 2H16A 3C14C 5CJPA 4EJSB 4LBZA 1FZQA 1OGJA 4P3YA 3VO2A 1AZSC 5K8UA 1JALA 4FWTA 4HYYA 3O8DA 1B2RA 3MWJA 1KO5A 4JJKA 5AUQA 3W2HA 5FUVA 4CEHB 1DO0A 5HKKD 4HUTA 4FIDA 2EFGA 1K8AD 2N42A 1VIYA 3TSOA 3B85A 3IUYA 1DARA 3W5UA 4D25A 4CEJA 1JPJA 5BW8A 5DISB 3W8RA 2DFLA 2CJWA 4UNRA 5K8LA 1Q12A 1YE8A 1C9KA 1DAHA 2HLDA 4F7WA 3CMAB 4KV9A 1FNMA 4H1UA 4LPSA 1HUQA 4IOMA 2BMJA 1QHGA 3GJ3A 3W90A 3RWOA 1IJEA 1NP6A 3VX3A 1WXQA 3GLFE 4OBEA 3WMEA 3MAAC 3NHBA 3O47A 4OQLA 1M6NA 2CRVA 4O0MA 4HEJA 4BGDA 1P73A 4DDVA 1OB5A 4A9AA 4MQBA 4NCHA 4ZIRA 4MGIR 3DPUA 3PCRB 3CC2B 2XJ9A 2JEOA 2QENA 3U7GA 2V54A 3VKHA 1F20A 2R6AA 3NC0C 4XD7A 4OHZA 4IOLA 3LY5A 2BM1A 3ND9A 1YI2B 1C1YA 1IN6A 1YU9A 2DWOA 2GNOA 3QKRA 2A5YB 2RGNC 5G41A 2OUKA 1JQLB 2LKDA 1GL6A 3LX8A 1E79D 1MRNA 5H68A 1GZSA 5DIFA 4D80A 4BE7B 1R5OA 3SBDA 1NBMA 4H1VA 3K0AB 4ZCMA 1M74A 1OSNA 4URVR 3LO8A 3U6BA 3LRPA 3L0OA 4GRAA 1KDTA 4E03A 1XTIA 4V0MA 2C77A 1KI3A 2X3UA 3M4YA 1YJ5A 3M0EA 1G5PA 4BPRA 1UDWA 4G01B 1VCNA 5F2EA 1W4CA 2YZ2A 2ZI9A 4B32A 2GJSA 2VO1A 4Q48A 1J70A 5TB5A 3U6KA 1OXSC 3FHOA 1E94E 1T6NA 3RRYA 1II9A 2BGJA 2ZJOA 1ZCBA 2Q0HA 4F91B 3BOSA 1ESNA 3GLFB 2FGKA 3NHAA 3KKMA 5BN4A 1CP2A 2D7CA 4AG5A 4V02A 3TMKA 3MJHA 1ZM3A 2VHJA 1AA9A 4RJLA 2B92A 3NBFA 4GMXA 2O0HA 2YNMA 2O8EA 3LVQE 4EQ6B 1CR0A 4KU4A 3T1TA 3WBJA 1HT1E 1FUUA 1BKDR 1N6LA 3OE7D 2RB4A 4JZKA 2VP9A 5H70A 3I8SA 4F4JA 4OI0A 2O8FA 2WICA 1P9WA 1IJFA 3E5HA 1NVVR 1WBBA 1F6BA 3DKPA 3TVTA 3QBVA 3OEHD 1R5NA 3P1JA 4C0JA 1P2UA 1IONA 1JBKA 3TKLA 1Q44A 1FTSA 3U44A 4JLOA 1JAIA 2VP2A 3WMFA 4ASUA 1QHSA 2PIAA 2H92A 2QSZA 1XBTA 2QA4B 1T9HA 3AVOA 3IDQA 3QF7A 1AGPA 1UJ2A 1OGIA 3ZZTA 1GRQA 3AVQA 2G1JA 5CYPA 5HE8A 2JIZD 4EPXA 3KUDA 5GJWC 2NOAA 4C43A 1KSFX 1OXUA 3IKJA 3SHWA 4DCVA 5LB2A 1QFYA 3DM9B 1WE2A 2BCGY 1ZUHA 2IYQA 3AKYA 1ZNYA 5KSPA 2FX3A 1VG9B 2R6DA 3AH8A 2ZANA 2DFTA 2QN6A 1D5CA 1FMJA 2FZ4A 3KXIA 3OAAA 3S1AB 1I7PA 2D74A 1LV7A 1FNCA 1G3UA 4TQAA 3BFXA 1E0KA 1NLFA 1YR8A 2HDNB 1EFRD 1Z0FA 2UZ3A 4QGAA 1GIAA 4MRNA 2H57A 4OQNA 5DHFA 4AK9A 2ZRFA 2YWGA 3THYA 1SKYE 1GKUB 2KE5A 3Q8XB 5DGXA 5TDHA 3K0SA 1RJ9A 2YVUA 1QVAA 2MMGA 3K1JA 1OFIA 4C9BA 4F7DA 1OXXK 1W4RA 1Q1EA 4XD7D 1OFUX 1A5TA 2FSFA 2ZEJA 4ZCIA 1G17A 3EWAA 1RE0A 1A82A 2JLWA 3AVPA 2OV2A 2N1BA 1C4OA 4RZXA 1S72B 3FHCB 1KI4A 1Q7YD 3WBKA 3SNHA 2O8DA 3P4XA 4QNMA 4ZKEA 4WZ6A 2RGAA 3V9PA 3BS4A 1QF9A 4NP6A 4QHSA 3ZVLA 1JEEA 4JLKA 5FUYA 2YV5A 5IHPA 3QVVA 5KUTA 4OI2A 4IDNA 2RKOA 1FNDA 3ZVNA 2WOOA 3CRMA 2WHXA 2QGZA 2VEDA 2BEKA 2Q21A 1RIFA 2BJWA 1GL9B 3BWDD 3SOPA 1XD2B 3FKSA 2IXEA 3OZUA 2OM2A 2GCOA 4PPQA 4B6EA 4CF7A 4LX0A 2GWHA 4MITA 1SHZA 3TAHA 3OZVA 1DO2A 1E4VA 1ZJ6A 2H8KA 4NZYA 4N3NA 2P6NA 1J90A 4L15A 1VQ6B 5FTKA 5JSZA 5C4MA 4Q1CA 2J0SA 1KO8A 2IYZA 4W5WA 1LFDB 2P0EA 3CH4B 3CCEB 1ZAKA 2V1XA 2OXRA 2V7QA 1SKYB 4BLPA 2Z43A 4PX9A 4DLWA 2QEXB 1BYUA 3LDAA 4M1WA 5C2JB 2YWEA 2ZVQX 1GTVA 4XVRA 2FNAA 4KYIB 5EXTA 4MH0R 1ELOA 1U0LA 3A1SA 4Q47A 2HXYA 1LS6A 4KBFA 1ZIPA 3VR1A 2GEUA 4WIAA 4JIMA 5AJYA 5E3HA 1TU3A 4XIGS 3DEFA 1MRSA 5CK4A 3THWA 1KDOA 2ZI4A 3FPAA 1XF9A 3MSXA 4NCNA 3SJBA 3WRYC 2LCFA 1AQYA 3A1WA 1XEWY 1HQCA 4B43A 2KBFA 5LD2C 4B76A 2G88A 1UBFA 1ZUIA 1Z6TA 5JWOA 1RYHA 1KZGB 1WCV1 5TMPA 5AJZA 3WNDA 4M9QA 3RNLA 4U9UA 4PO1A 4Q03A 2RHMA 3PITA 5E95A 4PQFA 3VNVA 3TK1A 1MABA 3L0PA 2G83A 4MYCA 2VSFA 1VQ5B 3UKDA 5A5GA 5JMTA 2OT3B 2BCJQ 3QBTA 5L3QB 2WPDA 4B3GA 2J46A 3ZS9A 1T0JB 3IIKA 1W0KA 4F4CA 4TL7A 1U8YA 1UEJA 2ORWA 3VKWA 2ZS7A 3O8BA 3CKLA 2XTNA 2Q9CA 4C7OB 5KSYA 3OHMA 5L3RA 1E9SA 3PUVA 3SE0A 2XNDD 1GDDA 1CNEA 1OPXA 2ATVA 3DHWC 5H8WA 4PPFA 5EJEA 2QP3A 3AP2A 1E2LA 1TADA 4I1VA 5AUNB 2ZSBA 3SBEA 5EE3A 2QP9X 4OYHA 3PEUA 2J0UB 3CONA 3IO3A 1OH7A 4Q02A 2HXSA 4D4MA 4EPWA 1OKKA 3D3QA 3B1ZA 1KSHA 4OHWA 1IHUA 1E99A 1F3OA 1QHHB 1XXHA 4NYIR 5BQ5A 3SDZA 3PENA 1HYQA 1W4BA 1W2HA 1GAQA 4PO8A 1Q1ZA 2ZE7A 4Q9KA 3GLHE 1H42A 2QDXA 1SQ5A 2DB3A 2EFCB 5DN6D 4XH9B 5DI3A 1ZD8A 1JAHA 4NDZA 3W6NA 1GNQA 2FEOA 1KIMA 4A6PA 4QBFA 1N6KA 3IPXA 4UXIA 4B6FA 3OIUA 3GLGE 1RYFA 3H86A 3HYRA 4B2LA 5CDFE 4TTQA 1A8PA 4A15A 2W6IA 1OXTA 3B7GA 2Z0MA 3FKSD 3QF4A 2JLSA 3LXRA 4XVQA 3T12A 3RRZA 1O3YA 3CR7A 4NCJA 4P6VF 1BMFD 1N6RA 2AFHE 1E9CA 2OEPA 3QPVA 3P27A 5HPYB 3ZZ0A 4UNSA 3A1VA 3EZ2A 5ANRB 3RSOA 1BIFA 1NKSA 3QXSA 4YXWD 1V43A 4QBIA 2GA8A 1II8A 3CF0A 3DZDA 2QMUA 5JRJA 2PT7A 4LPKA 3AVYA 5J4HA 1J7KA 1E2EA 4LJ8A 1GAWA 4JVSB 1DS6A 2BHRA 2WSSA 3QFSA 3AF0A 2GILA 3CPJB 2WKQA 3B13B 1MO3A 3OZWA 4GNKA 2G6BA 2FPKA 3CX7A 1U81A 4AKHA 1FFHA 1YVDA 3CF6R 1E2KA 2JJ2A 2OLKA 4FMBB 4HAVA 1VQPB 1U98A 1M1YE 4C4PA 1R8SA 1QG0A 2GZAA 1DADA 1QZXA 2QPAA 3VFDA 1FNNA 2Y8EA 4Z1MA 4DLYA 4IVQA 1KO1A 4DJTA 1PUIA 4B48A 1LB1B 4M8NE 3GLHB 3EIHA 2RMKA 1W2BB 1E9EA 3CM0A 1DDGA 2XOKD 1JB1A 4RKFA 4QBGB 3VHLB 2ZSDA 4IHQA 1LW7A 2E87A 4RD6A 3GLGB 2ZRGA 1Z06A 2ANBA 4M1YA 4O25A 3HU2A 3FWYA 3QXJA 3EARA 3WNCA 1E2GA 1XZPA 2XEXA 3CCVB 4UXHA 2GVDC 2WJJA 1YITB 2FFAA 3ZVRA 521PA 4DCSA 1OFTA 2NMVA 2NO0A 5FOTA 4KO8A 2CNWA 4HLUA 5GJVC 2O8BB 3ADDA 1MH1A 3NH6A 2H7VA 4A8JA 1S1MA 4Q1EA 1HH4A 1VMAA 3IHLA 3IGFA 4B3BA 3C15C 3NXSA 5FTJA 1LVGA 2OHFA 1F5NA 2WPDD 4NHOA 1JPNA 1XMJA 1Z08A 2BIFA 2YHSA 3QPWA 1TQDA 3OFND 2MSCB 2IF0A 4MKGA 3G4SB 4KXFB 2OLJA 1TVCA 1CJMA 1SM4A 1N6NA 2D62A 4CDGA 5D3MA 1NJGA 1Z07A 4MGKR 2WJIA 1DAGA 3ZIAA 5DSZA 3SR0A 3UMRA 3WXMA 2HEIA 3KB2A 3RS4A 3FTQA 8OHMA 1H8EA 1KMHB 1Z0DA 4DVGA 1OKKD 4LI0A 4PFSA 2QAGB 5ELXA 1G41A 2I1VB 4JKIA 5LBIA 3GEIA 3W5JA 3E20A 3N5CA 4PAOA 3GLIE 2G3YA 2ZJBA 1W44A 3GFOA 4JLAA 4N3GA 4JBYA 5EXSA 1KO7A 3CNOA 3GMTA 1FTNA 3OEED 1TF2A 1Z6AA 2IWHA 4HAYA 1R7RA 2V55B 3SEAA 3HPQA 1UMKA 3LLUA 5FUXA 2RGDA 1T5LA 2IXGA 3IIMA 2QEQA 2A5GA 1P61B 5J4YA 4K8OA 3PUWA 3FJOA 3HYTA 4AI6A 4GOJA 3LVBA 4Q4JA 821PA 4Z51A 2I1QA 1KOFA 4RZUA 5BYKA 5SZIA 2NO1A 1D8TA 1FOEB 2SHKA 3QFTA 3B1WA 4BFVA 4DSOA 2ONKA 2O8CA 2GCNA 4A8JC 3DVLA 2VP0A 5A0FA 1IAQA 2YWHA 3CLVA 2X8AA 1ONBA 1XJCA 3CNLA 2BBOA 4NKRA 4Y9RA 4BUJA 2FJUA 4DSNA 2MSEB 4W5JA 5KSOA 4C3ZA 4TL8A 1IY1A 2OFXA 3GLIB 4PZZA 4B3XA 2NIPA 1JI0A 4YAFA 1NLYA 3K70B 3T1QA 1Q0UA 3EX7C 5GJBA 4IDPA 1E3MA 1SVOA 3MD0A 4PAMA 3SN6A 2GRJA 4KLZA 1H8HA 4IDQA 1FX0A 4IRUB 5FBWB 4MKFA 2E1RA 3KFVA 1NN3A 1OW3B 3K9NA 2AKAB 2HT1A 1KNXA 2VP6A 4PGOA 3V76A 1NKTA 3RS2A 3R7WB 1VHLA 3VU9A 4URWR 3MWYW 1QUFA 2ZETA 4XWKA 1OXVA 2VLIA 5AJVB 1OH8A 5FPHA 2WBLC 2AD1A 3GEHA 1LF5A 3CWZA 3WHKA 4TZ6A 1N5LA 1W47A 3SJCA 4DLSA 5KNDA 3RS5A 4YAWA 1A2KC 4TL6A 1YZKA 2BGIA 4URUR 2ZJYA 4V0NA 1P9RA 4UJ5A 4TMXA 1NL3A 1E1QA 4M22A 4B71A 1SVKA 5HKKA 2JJ8A 2X77A 1VECA 1P2VA 1X6VA 4UNPA 5EE9A 4KLNA 5KHOC 721PA 2QTLA 1KAGA 2OAQ1 1NBME 5JCPA 3QXXA 5JBQA 3GD7A 2IL1A 2BKUA 2IK8A 1RPZA 2P6UA 2I3BA 1KD1D 3FB4A 1ZYUA 3PXGA 3RVBA 4V0ME 1JECA 1O87A 4LJ5A 4UKDA 4RCYA 4CEJB 1E0SA 2EQBA 2OFWA 1OF1A 1YZGA 1JNYA 2CJWB 4CEHA 4A2WA 3CCLB 2DR3A 1PZNA 2AKYA 3I1FA 4G1UC 5SZHB 4IOJA 4LDJA 3I5YA 3GJ7A 1T0HB 2V4ZA 5DLQC 4IJMA 1KHTA 1WB9A 1EFCA 4GDFA 1ESMA 5CIWA 3FYHA 2PJRA 5HTKA 2AFIE 4DIEA 2XZOA 2CXXA 2ODEA 1G5TA 1YJWB 3FPKA 5IF9A 2ZUBA 4TMVA 4ZIRB 2ZRHA 4DCUA 3U4QA 4HZUA 3HPRA 4M2LA 4AYTA 1IQPA 1XP8A 2R9VA 4PZYA 3KKNA 1W36D 2Q6TA 1E79A 5FPSA 1U9IC 3CB4A 3QKRB 4LYHA 4FCTA 4KFTA 2RGGA 2WIAA 4HUQA 3U7HB 1CNFA 3DMDA 5CLLA 3CMEB 1W0JD 4B33A 2ZITA 3QXHA 2PZEA 2ZQ5A 3L82B 5HXBA 4HB3A 1W5TA 2FZLA 1KJYA 4RD3A 3KTAA 3SU8A 2VF7A 3W34A 4C0SA 4PPNA 2BJVA 2ZS8A 3K09A 1XB2A 4C0BA 3THOA 1ETUA 1WRBA 2EW1A 3REFA 3WHLA 4TMZA 3K9HA 5DE3A 3IHWA 4DDTA 4ZDKA 5G3ZA 2ZREA 3E1SA 4G0NA 2JDID 4PC2A 1I4LD 2REXB 3P20A 1UADA 5JI3E 1W87A 2RGNA 1RRCA 2JJ1A 1H8HD 1HQYE 2PMDA 2VNIA 2PH1A 1R0YA 4Z8XA 4KI0A 1GRRA 1PLKA 1P7CA 4CYMA 1N8RD 3O8CA 1EX6A 4M1OA 4QGHA 2F6RA 1G8GA 2DFNA 2PT5A 4Q4AA 3OE7A 3VHXA 4Z54A 1G7RA 4TYNA 1OT3A 2O8EB 4YHBA 5GV8A 1QG4A 5JEEA 1E63A 2EYUA 4LC0A 1VPLA 1OIVA 2ZYVX 4Q4LA 4CZ2A 2O8FB 3NBYC 1TU4A 1AGRA 3OEHA 2EWWA 1WA5A 1W5SA 2GK7A 2HJGA 3LD9A 5DYGA 5JJKA 2QAJA 2B7BA 2KSQA 5IDVA 1EG7A 4HAWA 3PQCA 2PLFA 4HI0E 4P4UA 1E1QD 3E2IA 3ZS8A 1QVRA 3IIJA 4TTPA 2GPJA 3U44B 3CRZA 1GKYA 1G18A 2OBNA 1QFZA 2JIZA 1XD9A 4CW7A 3UIEA 2C95A 3VR5A 1UDXA 1AMOA 2QTVB 2J45A 4PHTA 1NMXA 1E2QA 4WQMA 5EZ6B 2HYDA 3TUZC 3JVUA 4Q9HA 1RKBA 1DBSA 1US8A 4BFXA 4TN1A 1Q1QA 2CE2X 2A2ZA 3TRFA 4DLRA 2PX0A 1TUIA 5AUOB 3RC3A 2ZRCA 1BX1A 4RFVA 5C18A 1EFRA 2B21A 4IOKA 4RKEA 1TLLA 4RD2A 2QM7A 1R4AA 4IVPA 3K09C 1NVUQ 3B1XA 4NTZA 2IHYA 4NONA 2QSYA 2IUSA 2X1VA 5CJ2A 3MLEA 2C96A 1Q86D 4BFZA 3OESA 4LYJA 4RY2A 2DHRA 5JWHA 5FBLB 2GJKA 1OB2A 3THYB 4ESVA 4JLBA 3N70A 1RJ9B 3H4MA 1M1KD 3AKDA 3G6EB 1YZTA 5BXQC 5C1BA 1QBKC 1E2NA 4MYTA 4RCZA 3AF3A 3U60B 1FPMA 2RGBA 5EP2A 1DG1G 4BEJA 3SYLA 1HA3A 1Z2AA 1VQMB 1UM8A 2FFQA 3I8XA 1XPUA 1P4SA 1Z29A 4HLDA 1S0UA 4BZPA 1Z6YA 2XITA 2PLRA 2GETA 1TF5A 4I1UA 2QBYA 2IS6A 2O8DB 5EE0A 2Q3FA 5F3WB 4TLEA 2WVJA 1F2UA 2CDNA 2XNJA 4Y7CA 2BBSA 2VYQA 4KBGA 3EZ7A 3VQTA 1SXJC 1RC8A 5F98A 1L2TA 5SZKB 1GM5A 3W5HA 1XTQA 1JR3D 1G64A 1XEXB 4BLTA 2BWJA 2GCOB 4PSVA 1GILA 1DAKA 3CD6B 4A2PA 4AY2A 4D26A 4PAQA 1CR4A 3EXAA 1NJFA 3B8HA 3KJHA 2ATXA 2C8VA 2J5XA 1JQJC 2W0MA 2JJ1D 3CRRA 4L4UA 1OHHD 2EYQA 2VA8A 2ZI5A 1QGAA 3FMIA 1CF4A 4YLGA 5HE9A 1SULA 5FR1A 1BOFA 1Q22A 3BE4A 5KPJA 4PC6A 1Z6XA 1Q3TA 4B4DA 1G19A 1E4YA 5FUWA 3G82C 5DI9A 4HB0A 2F3RA 1YRBA 2AWNA 4A4DA 2FGJA 4TLCA 4AF6A 4Z8YA 1DELA 1DG3A 3AP3A 4I1SA 4M1SA 4TTRA 3UG7A 1TEVA 3QFCA 3TSZA 2O0KA 1SXJD 4DIDA 3JQPA 2GZHA 3MHPA 3I4LA 4YALA 1E64A 4MDFA 1OIXA 3E70C 3F8TA 4BLRA 3BBPA 4U7DA 4BPBA 2A5DA 2IYVA 3F5FA 1AQUA 2F43A 4C2UA 1XDBA 4P4TA 3OIVA 4HAXA 1GG2A 2H17A 2CNDA 1XXHE 4IVRA 4NL4H 1W49A 1Q82D 3LQRA 1E2PA 4UQOA 5JS8A 4BRUA 2GXUA 1KNQA 2UZIR 2OZEA 1F48A 3LO5A 4HSEA 2JLYA 5JJLA 1N6OA 3GCGA 1VYVA 3TW4A 4M1TA 3FOZA 1X8KA 3WY9A 2I4IA 3BH6A 1IN5A 4LBVA 1MABB 1GOTA 1DPFA 3ZZUA 2IUUA 4GL2A 4MKHA 3CRQA 2ZI6A 3A37A 1QFJA 4MRPA 3ECCA 3RABA 1XTKA 2XNDA 4Q1AA 4R2HA 4IEIA 1DTSA 3X1XA 5M04A 1Z0IA 3CNNA 4DHEA 1NG1A 4NYJR 4G3XA 3CRW1 5TVKA 5JLJA 1QRAA 3TVDA 1P3JA 2ZR7A 4F38A 1NMYA 3X2SA 3CCSB 4JBWA 1A1VA 5LPNA 4AD8A 1NSTA 4BLOA 4TYYA 1VCOA 3REGA 5LB4A 3CPEA 4FMDF 1G3MA 5CIQA 5F9HA 2Z83A 3RS7A 3MRSA 3U7EB 4AKGA 1IN4A 3NH9A 4IFBA 5P21A 4MRSA 1XXHB 1KI6A 1AIPA 2BDTA 3Q72A 5JZVA 5DN6A 2JCSA 1TL7C 221PA 3U3OA 3EPLA 1XJ0A 3CBQA 4D6PA 1NMZA 2AL7A 1U0HC 1XZQA 4TLBA 1FP6A 1G8YA 1T8TA 2IS1A 5DI3B 2AHOA 2BN4A 3ETLA 1KSGA 2GK6A 4YMSA 3CCJB 2R6HA 3I56B 1KDRA 1BMFA 2R62A 1V5WA 3C4JA 2JLRA 4Q4HA 2OTLB 2PMKA 4BLSA 3OJXA 2IEYA 1D9XA 4M9SA 1XTSA 2CHGA 2CE7A 3FDIA 1A4RA 4YXWA 2W58A 4GOKA 2ODBA 4PO9A 2BBWA 3FFBA 2QPTA 3BFVA 5JCZA 2ZI3A 1E32A 2RAPA 2ZU0C 1U0JA 2RC5A 4EAQA 4EJSC 5EQTA 1OH5A 3RRNA 4ARZB 4MGZR 1II8B 4E07A 4FN5A 2V9PA 1OYYA 2OCYC 3AVUA 3I92A 4TYWA 4AYXA 2CCKA 2ZRBA 1NN0A 5B57C 3QEJA 3KX2A 1XPOA 3GLFA 1L7VC 2X19A 1VQKB 3BK7A 4Y0AA 4HZIA 2MMCA 3MUFA 1ZM9A 3U3KA 4RD4A 4BWYA 1XMVA 1VYTA 5C46F 3FMFA 4NMMA 3THXA 1DAEA 5CM9C 3LA6A 3G5UA 1FW6A 1KDPA 4KFUA 3AQ4A 3PIRA 4GSYA 1KY3A 2XOKA 1BH2A 4X8LA 5GADl 4QC2A 4LGMA 4M9XA 1YRAA 4KJZA 3TR0A 1DEKA 4HB2A 2VL7A 1IN7A 1L8QA 2WWYA 4TT3D 1NDHA 1XX6A 5BN3A 3L0SA 1VDZA 3ZD7A 1YQTA 1MR3F 2W2VA 4KFRA 3UWKA 2WTUA 4UJ3A 3ZJYA 4UNNA 4AKIA 5EE1A 1SKQA 2BC9A 2FSHA 4GOXA 3CCQB 1P60A 1EXMA 3B82A 3QKTA 3KQHA 2IBMA 3LXXA 5FBVB 1Y3AA 1Q81D 5KDOA 1G8FA 2GZDA 5FTNA 5JRZA 2IWRA 2C04A 4BZXA 4LHXA 2CEAA 4A8JB 3C8UA 1U8ZA 4OHXA 2FF7A 1KK2A 3OFNA 1Z2CA 2KWIA 1W2GA 1B23P 2QGNA 2R6FA 4DCTA 3B1VA 3QJYA 4P0TA 3CPWB 3IBYA 3BXZA 5J4KA 2R44A 5DNYB 1VCIA 2VZLA 1KKLA 4TMWA 1FQKA 2PBRA 3A8TA 4Q9JA 1XTJA 4R9UC 4PSAA 4TLDA 5KSWB 4FXPA 2ZJ8A 2ZRNA 1KGDA 4FMDB 4QGGA 5D3MB 3X1ZA 4QJ5A 2WAXA 1SGWA 5FOXA 3TLXA 2IYTA 5DO9A 2CK3D 2L0XA 5THXA 4IXMA 4DLZA 1ODFA 1W4AA 3OIYA 4TYQA 3EIEA 1PV4A 3LQQA 4RZ2A 3UMSA 5FOWA 1KI2A 1XU4A 3KJGA 1NN1A 4YDSA 3TIFA 3W5IA 3BJIC 2WJHA 4ON9A 4TL9A 1EWYA 3GEEA 3MWLA 4DKXA 1JA1A 2FFHA 4FI3C 3ADKA 3AV0B 1J2JA 2FG5A 2OCAA 4I81A 3IBGA 3OEEA 4V0LA 1F2TA 2TMKA 3QQ5A 1E2FA 1VQOB 2GAOA 1XRJA 2V8OA 4D0GA 3B1YA 4A0HA 3TBKA 2GKSA 1S3GA 4GMDA 1NY6A 5BWMA 2W6JD 4JMPA 2BMWA 1QHXA 2IS4A 1JEDA 1XJQA 2J59A 2Q9BA 3EA5A 3LX5A 4LJ7A 3AGQA 4JLDA 4DSUA 2ZJAA 3RDPA 2DBYA 1GKIA 3A58B 5H1YA 4MYUA 3SI7A 5FA6A 2F9MA 2ZJ5A 1VQ7B 2ZUDA 1Q1BA 5J47A 2ERXA 4A36A 3V4RA
chains in the Genus database with same CATH superfamily
5HZKA 2HF9A 3HDTA 3ZWQA 3ENNA 1NPTO 3DBRB 1RBMA 2C2BA 3PFNA 5T41A 1NXSA 2OVBA 4QVIA 4CG3A 4QLBA 1T34A 3PEVA 1S8FA 1UK8A 2Q50A 5D3QA 2G1PA 1AD2A 2B2XA 3BD7A 3IILA 1ARZA 2V4DA 2XQGA 4HADA 4TRRA 1RW4A 3QUTA 4AP9A 4ERXA 1X3SA 2QRNA 1UDCA 2ZR0A 1M76A 1XYGA 4E7PA 3AU9A 1AO3A 2FMKA 2PQ0A 2CLLB 4MQFB 2OPBA 4R0VA 2V6BA 3WGYA 2IHBA 2PX6A 1TRKA 5ENZA 2EX4A 4Q66C 3KAKA 3RUFA 1H5UA 3HKDB 3F2VA 5CA0A 1BCSB 3WZLA 2NVOA 1T1JA 3LHKA 3SJZA 2O5EA 1X70A 1J99A 5ALWA 4NNJA 2ZBFA 4YJHA 5CAEA 1ZMBA 4ESHA 1EP3B 2VXYA 3P0RA 3VZPA 3AESA 2OGWA 2ZU6A 4N0DA 4ZJYA 1AS3A 2E0IA 4E88A 3E2MA 2B8EA 2XOXA 4MR7B 2CVOA 2ISSD 4V2UA 2G77B 5D85A 3LBAA 3VX4A 1TTTA 1MLDA 2CL5A 2EV9A 3D54D 3L8GA 5B1HA 5CAEB 4G7WA 1R6VA 1PHRA 5CHYA 4K9RA 5CVTA 3GUYA 4KK3A 1MB3A 2BF7A 5FOSA 2RGRA 3FJYA 2GJPA 1PLLA 3AHGA 2XTZA 4QBKA 1O4VA 1O0BA 5AW4A 1JJ2B 3NEYA 4ZU6X 3U80A 3KSAC 5HM6A 1E9AA 3ZBTA 4D5GA 3PKZA 1V1RB 3ANYB 3B6MA 3D5QA 3K0FA 1NRKA 1YR2A 1ZUNA 2F1HA 4AS2A 3HEMA 3LX4A 2K2QB 2YCLA 2RG1A 4HAIA 4RFSB 4EFNA 4GPBA 2RK3A 2AJTA 4RTQA 4FK8A 1WEKA 2KI5A 2O7NA 1PP4A 2WF7A 2ZRLA 2ODPA 3E9YA 2XIJA 1Y42X 4Y1GA 4J4BA 2RD2A 4H77A 3T9FA 2MSNA 1X8LA 5IZCC 5JDIA 2Y0PA 3CLUC 3ZOKA 5KPDA 5FYQA 3IEMA 2CJYA 4YRIA 2YZ7A 4KITB 5FO0A 4P4SB 3EGCA 2IITA 4CIDA 1RYNA 4EABA 3LWNA 3LKDA 1Y98A 1UD2A 3UG6A 3G9TA 4GBED 4JEMA 4CEIB 4MRVA 1MEOA 1YGYA 3VVBA 3G71B 4BMPB 3G2NA 1X8JA 4FC7A 2YBEA 5JNRA 4PN3A 1HXHA 2HRRA 2LIVA 2QVCA 3T9BA 3DXFA 3NAZA 3IAS6 1XF1A 2VDRB 3D8RA 1VQ8B 4HDNB 4X3OA 5K0LA 1IEWA 1Z47A 2YIVX 1VQ9B 1MO4A 4WHMA 4O3MA 2OILA 2ZYRA 4N5HX 4WRRA 1NOIA 1KRHA 1DRJA 2NO4A 3F90A 4QDUA 2TMYA 3ONVA 4JI8B 4BLQA 1XDDA 3AHJA 1BU8A 3R7DA 3T1VA 3VPBA 3ZY5A 5JAUA 2AG5A 2I03A 4HWPA 3PV0A 5SZJA 4YAKA 3G05A 2XYHA 3MS2A 3B78A 4JBXA 4R1NA 4M0CA 1QUEA 1VSTA 3BG5A 3L06A 3BD6A 4JQYA 4MR9B 3RJZA 4DLAA 5J58A 2UXDB 2CNNA 4KKSA 4HS4A 3LF2A 4MLPA 3TSCA 1MC1A 1QIFA 3WISA 5JSUA 1R8QA 1PNQA 2ORIA 4HZUB 2QTZA 2GFQA 3RHFA 3VYRB 3WIEA 3UH0A 2WVGA 1XHFA 1PZEA 1Z2DA 2ZYHA 1KVQA 4F56A 1JLRA 4HTFB 1WAMA 3WO1A 1RI5A 3CW2A 3ED1A 1REQB 2DOGA 1D2NA 1RLIA 2NTYC 3JQ8A 2YC2C 2CLKB 4P22A 3GLVA 5BQOA 3EHDA 3P0IA 4J2TA 4IIJF 3PEYA 4KHZA 4OJKA 1YVEI 4I19A 5J2UF 5AKZA 3PSHA 5BVHB 2PG3A 1OT5A 4GQNA 2I2BA 3AETA 5KJEA 1Z4OA 3GB9A 3MUNA 1R0WA 4RJKA 3A3KA 3NYIA 3IAUA 1ABFA 1A8UA 2EHDA 4GE0A 1I80A 2C3OA 2ZROA 5CCBA 1GZVA 2VN8A 1FFGA 4M54A 4MROA 4DC0A 3B1KA 1E0AA 2R7MA 1UPAA 2PKRA 4OD0A 5BV2P 1ZNZA 5GV7A 1JVSA 4M7PA 3BZBA 1UFQA 3N2ZB 3ABSB 4YWHA 5IBRA 3UJ8A 5I7SA 4X92A 4ZCSA 1EGHA 1JX6A 4RU1A 2BOVA 3UVEA 4LQDA 4YCDA 3KXPA 1GPH1 1Z2NX 3OC0A 5FULA 3RBVA 2AG0A 1G16A 4V0KA 2XWQA 1KJJA 1Y37A 1OQAA 3SDSA 4F2PA 3BXXA 2F48A 4BMVA 3D5EA 4WZBE 1L5VA 4M9UA 4XSVA 4HD8A 2VBGA 1VBMA 1K8XB 4NHEA 5LIPA 3VHXB 3QNWA 1EESA 1FS6A 1F0PA 3DE5X 1ZS9A 3IRUA 4BVBA 4CGYA 2DFPA 3DAHA 2ZZGA 4X9XA 1ECPA 2F9LA 4BXOA 1QHIA 2R25B 3LY9A 1UPTA 1V3VA 2FP4A 4KDFA 5JUWA 5I4KA 2PRKA 3A7DA 4DYHA 4KX5A 2VSXA 1KJNA 1RCUA 4OYRA 1ZRHA 4CVNA 1A4XA 1T1GA 1YAJA 1Z5PA 3W6PA 5KX5A 1C8VB 3GIRA 1EUDB 3A32A 1EX7A 3CLRC 3R6LA 1OCEA 3AEYA 1LNSA 3ZOZA 2XXAA 5EVJA 4JMLA 1LJ8A 1DV1A 3F1LA 1EXDA 3LW7A 1I24A 2DSNA 1XA4A 4P7FA 1M34B 3I9OA 4R2XA 4LXHA 3TDKA 4IXDA 3RANA 4G9BA 2PRJA 3KVNA 4QM7A 2C4NA 4JVNA 3OW2B 4C7JA 1TVKA 3AERB 4RIGA 1PR3A 4AY5A 3ABZA 4TS1A 1Z63A 3VDXA 4Y9SA 3H8WA 1UKCA 2LBPA 2P79A 2WIFA 3ACDA 5HTOA 2Q5CA 2WU8A 1VLVA 4BKPA 1C3LA 1W19A 1SUSA 2VJDA 2DERA 3LLMA 1KMHA 3F49S 1US8B 1SIWA 1YV9A 2Y1GA 2VBCA 2QYOA 3CPHA 3T3HA 1Z28A 4KE9A 4WOKA 1B6TA 2QAGA 3PP8A 4QXAA 5G0SA 3RYIA 3T5MA 4RNDB 5AUPB 2GN0A 2ZQYA 3DHVA 3HUFA 4J49A 5ALIA 3RIGA 1YR9A 5EHXA 5TPZA 2P27A 3KQNA 1KFJB 2VNHA 1GWNA 3FPCA 4CG0A 5JD4A 3LPMA 1SPBS 3NWOA 4RQAA 3AXTA 1EU1A 2C31A 4GLBA 1UWKA 3PFCA 2DPLA 3OCYA 1CZNA 2I6QA 3BREA 3EVEA 4Z4QA 2P35A 4DMHA 4J03A 3K2QA 1P6XA 1DXQA 2RH5A 4LECA 4TMFA 3R9IA 3RK4A 3ZHZA 5A04A 1O97C 1WB6A 2E4VA 3PI6A 4QSHA 1GPUA 2JEYA 2JI9A 4W1PA 3DZIA 3RKRA 1PJ7A 2GD6A 1E6MA 3AG5A 5G2OA 2J7PA 5IYZF 1LXCA 2GN8A 3TTXA 2ZE5A 1QC5A 2CXNA 2Y1FA 3N8HA 3P5SA 4Y6QA 1G9XA 3HNOA 5TQ2B 2CVPA 2QBYB 3P9SA 2B1GA 2H48A 3WMGA 1VBFA 4ZP1A 2PWZA 4BB6A 1NIPA 1PYDA 3R20A 4O33A 2YOFA 4MJLA 2A9FA 3CESA 1XVIA 1GQOA 4J9VA 1YQ9A 3SIRA 4BVFA 1U0OC 2FSIA 1STOA 4NYIQ 5ITWA 2ZZEA 4D56A 4HVLA 2JBHA 5E0KB 4GUDA 1D4AA 4J0FA 4BAGA 1GT91 2C5LA 3OTHA 5G40A 4QGSA 2AN5A 4FXOA 3KCQA 1H94A 3BHNA 1G4AE 4ZVKA 2BDUA 2VQ3A 1P5JA 2CVZA 4OI1A 1XD8A 2YINC 4PO3X 1J1IA 1DAOA 3BRWD 4KQXA 1FEZA 5EGNA 3AVTA 4EKYA 3L4BC 4PPGA 2R7LA 3PA8A 4BFCA 3C5CA 4BV8A 2HMTA 4DJ5X 2CY0A 1S5PA 1YS6A 2G71A 2PANA 3IMCA 4O2RA 4PLVA 3TD6A 4CL8A 1YT5A 5A7FA 2E89A 3BXGA 4DM4A 4LE0A 1Y8QA 4O6VA 3CIOA 2EARA 2XGOA 3QU4A 3AUUA 3QG5A 3VNRA 4YPVA 9GPBA 1A7KA 1EJ2A 5HFJA 4OQXA 4DRXB 1RQ2A 5AJTA 4BVLA 5BPFA 3C5WP 5KQMA 5E7MA 3IL2A 2JHFA 1S2MA 2UYHA 1F60A 2Q1SA 4C30A 5HVNA 2F55A 3VC7A 2BFCA 2Q5JA 4OU4A 2R2GA 3P71T 4OATA 3EJ6A 2R97A 3C3XA 3IULA 3NVMB 2BF4A 3PA6A 1FU4A 1N3BA 2EQ5A 3TLMA 5KNBD 2JAPA 2YHUA 3C8HA 3G23A 2J7KA 4TV9F 3ES9A 2F43B 3WGOA 1PUXA 3S0JA 3HVHA 1E2HA 4CI0B 2WA1A 3KTDA 1U8CB 5F35A 2NZ8A 4O4JB 3G1UA 1YRQA 2W6ZA 4LOIA 5CT5A 1QG2A 3RVNA 5FR2A 5LOVF 4RA6B 4E11A 2ZZFA 1PWZA 3GARA 4NE2A 4F3NA 5IAGA 1N5DA 4A6EA 3TGPA 5D3ZA 3NDPA 4KWEA 1PVOA 2J33A 4AZ0A 4LWQA 4U00A 4M49A 2BAGA 2YZGA 1CUHA 1YB4A 5T6BA 1YFZA 2PX5A 1WDKA 2BGLA 3UHAA 3VNUA 1GAJA 1KVRA 1KC8D 3GN2A 1OAAA 2FSGA 3WIDA 4TUYA 4ZC1A 1Z5WA 2HA0A 5B6JA 1HF3A 1V4NA 3FGNA 3IPYA 3ASPA 3I61A 2PVSA 3DWFA 5KVCA 3KU4A 1ICIA 4Z2YA 4H6WA 2IU0A 3ZCXA 3AR8A 3K31A 1C8KA 1Y9AA 1ZA2A 2RHBA 6PFKA 5HK8A 3HI6A 2CVQA 2B25A 2RSLA 2BDEA 2JRCA 3H2GA 3IAM6 1D2GA 4QLAA 4F1WA 1U5AA 1J07A 4G6IA 2GZRA 4J1QA 2PWAA 4OQFA 4RDHA 1T8YA 2C9YA 3JRNA 2XB6A 2PZGA 3EVBA 1M8FA 1JQ3A 2P67A 4EPTA 4JELA 2OMEA 3VPSA 4FHGA 1XZ8A 3LYLA 4G0MA 2CLOB 1T8UA 3TTTA 1MXFA 1ZGZA 1OXMA 2J7PD 4FCWA 2J9ZB 1QRSA 3OD1A 1KI6B 4CMHA 3GT3A 4NCKA 1Q3HA 3M6UA 1YCGA 4GX1A 4ITRC 4QOSA 1WCIA 3VO1A 5IYQA 3COWA 1XCPA 4K9KA 5ENDA 4LOAA 4BASA 4QASA 3T94A 2C9BA 3PC7A 4MV3A 4KSYA 1JAZA 1X0VA 3BXOA 4G2NA 4GFDA 2A58A 3UGKA 3WL7A 1H1LB 1WQ1R 2Q4EA 3EPJA 4DQLA 2L19A 5ETJA 2QMOA 4KSBA 3BDAA 3QVJA 5IK2D 4OHRA 3L41A 2OHOA 4RY0A 4CQMB 2V74B 2PXAA 3NTRA 4X20A 1MB0A 4M9ZA 4YV0A 5L7TA 4DC1A 4KKTA 2J07A 1WABA 2VJKA 4GH5A 4JUBA 1N2CB 3RGWS 2FRDC 3QOWA 4P35A 1EK0A 1TYAE 2CLCX 1VQ1A 3FE2A 4JKYA 3ZVMA 1A8QA 3LQYA 5PNTA 3PGMA 2BGWA 4WZAA 5JNVA 1B93A 1CY0A 5FWXB 3PKJA 2YKGA 3HU3A 1I3CA 3NX4A 2ZVDA 5AI9A 1CULC 1P72A 4WBNF 1WF6A 2WF5A 4R83A 4U02A 3GMSA 1LSOA 1ULUA 2I4LA 1KI9A 3H1GA 4WW0A 3FRHA 5D3KA 5DNVA 3UHJA 2DPHA 4GQBA 2ACWA 3VV2A 3NWPA 3MBIA 4KPUB 4RSGA 1TYZA 1X2EA 3TQIA 5G0UA 3T95A 4KUHA 4DBLC 5HM8A 5EKUA 1QAMA 1AUPA 1XZAA 3AM3A 3LUCA 4TS3A 5DCWA 3WQHA 1TUBA 5JECA 4G0ZA 2ZZQA 1BO6A 3V1LA 4UUOA 3DOHA 1RYYA 5DEOA 4DA0A 1T5OA 5BV8A 5K0SA 3INYA 3K0HA 2X1MA 4UHCA 4TT3A 2BRUA 1OA0A 4Z4WA 1P9NA 1YKGA 2QA5A 3EGDA 2C3PA 3HYLA 5M34A 1TAQA 4BNNA 1PD1A 4D46A 2B8TA 5ALLA 5CA0F 4FYJA 2WIJA 4RABA 4UFNA 3D1JA 5HZGA 2FZ5A 4UQPA 3UJBA 3IIEA 5CEFA 5KMGA 2XLBA 2JFUA 2ZRDA 3VOSA 2FPUA 2VUSA 4L8FA 2WJ6A 4PC3A 4V3BA 4CEHA 4NG4A 4ZO9A 3DMYA 3GV0A 4YVFA 1QK4A 1YSCA 4LHVA 3CC4B 1IBMB 3A9VA 4AZTA 3ZWBA 1NQVA 1OI7A 3GLRA 1ZKMA 3ZJ5A 1RHKA 1D0SA 1YJ9B 1LK0A 2GREA 1Z0UA 4DCJA 2VAVA 1RI3A 4LDAA 2WZQA 1PBTA 1UM9B 3G68A 5JDCC 2CV1A 1TA0A 2X5KO 3U16A 1J8VA 4FUQA 5FBZA 1MVNA 5CT9A 4L78A 1Z7YA 3P2JA 4MRAA 1Z56C 3U3JA 3OLYA 4EEXA 1LDNA 1THMA 3EULA 3ZWKA 3WHPA 1YZUA 3RODA 2BYTA 4DWVA 4NBRA 1D9ZA 1XNJA 1CJVC 1YIOA 2G5CA 2GF0A 3L7IA 3L84A 4Q7MB 4TTTS 4Z53A 1ODLA 2BFMA 3IV6A 3Q5GA 2X8JA 3L1JA 3VAAA 3ZVKA 2P65A 3CUWA 3P0HA 4NQRA 1WOPA 3T5GA 3BERA 5DTEA 3O4FA 5A7HA 1GUZA 3MJ4A 4ZYWA 5DNDA 1UZMA 2CLIB 2M32A 2HV8A 3LNCA 1OLSA 3EEIA 1S2NA 1T36A 4NFSA 4W82A 5T8KA 3QE2A 4M0DA 1E7YA 1QQBA 4UXJA 3ZLTA 3R3XA 3HJFA 4X41A 1D5WA 3VNAA 1FY2A 2C2HA 1N9GA 4YDHB 4MUAA 2PX3A 1MX9A 2B20A 2GTHA 5HK9A 4DUZB 1TZCA 1NG9A 3K0EA 3IJEB 4WWVA 1JWAB 2WHYA 1C7JA 3NOQA 3KZMA 3QWHA 3QKIA 2NM0A 4A82A 5KTNA 5LVAA 1EDDA 2PMCA 3BL5A 3NBKA 1B2LA 4FKBA 1K73D 3SXJA 4DV1B 4ESOA 2GZSA 4BKUA 2H1FA 4FEEA 4J91A 1LUAA 1NN5A 2Q7XA 4QUGA 4ACBA 2IOYA 3QPUA 1NBMD 1P0QA 4ROSA 4XSGA 2O2JA 4F6RB 3DL0A 2DHQA 4WA7A 3RADC 3PJDA 4DIUA 3G2QA 1SG0A 1KAEA 1QTRA 1VIAA 3E9EA 4DS3A 1N32B 1I6WA 1BEUB 2H52A 2AF4C 2IUYA 1N5MA 1PWYE 1WMSA 3CU5A 3TOXA 1H6DA 1LBQA 3PWSA 2O7QA 4DPMA 5CDHA 1U99A 1VZ2A 3R9WA 1H69A 4IZOA 2FHSA 5HBRA 1KYYA 2EP5A 2FWMX 4IHJB 2GNPA 1VJ1A 2A35A 2VT2A 1JJIA 4XLTA 5AI0A 1PJ4A 3C85A 3JVDA 3KZVA 3TNJA 4AT1A 4F6CA 3QVXA 1OAOC 4GUAA 3AVWA 1HLFA 2DE0X 3JZMA 2YYYA 1F8XA 4L7QA 4QYXA 1RRGA 5EQDA 3ZDAA 2DTEA 2ZYGA 1SVNA 3P5BA 4L5IA 4PZPA 4ZXPA 3SS8A 5CG1A 3FTEA 4G65A 1SCUA 4YUZA 1WLYA 4RVCA 4KKUA 1PJAA 3BEDA 3JQQA 2H07A 1K4KA 2GESA 2AK3A 2NXCA 1AG9A 2IYYA 3KHKA 3UC5A 2BEVB 4F92B 4YMGA 5JNTA 4BIIA 1MV8A 3E61A 2C1XA 4GP7A 2FTKE 4UNQA 2J9XB 3EEQA 1RWVA 3L43A 5J2TA 2J0VA 2E18A 4GM1A 3IJ5A 4ER0A 4BVEA 1WQ4A 3HDYA 3QIAA 4KYUA 1OJLA 3E82A 5ICCA 1K4MA 1UP6A 2AR7A 3A04A 3K53A 2X5JO 4XWOA 3NVAA 4CTNA 1LRKA 5BUQA 1TW2A 4CJXA 1AS2A 1XR3A 2FR8C 3RHTA 3VDRA 3ZHBA 4AMBA 2X8LA 1TMOA 2R6CA 3HCEA 2NW6A 3LPNA 3DBLB 2Y1XA 2OE2A 3M6MD 4G5FA 2HPAA 2G80A 3ZGYA 2OECA 1G8KA 2PDAA 2J30A 4CIWA 3QUCA 4DLUA 2J5KA 1ZR2A 3VR3A 2CNLA 5CM8B 3KYCA 4RHYA 3HC7A 2P9JA 4LJAA 1N0WA 2ZYTX 1NVTA 2CNKA 4D81A 1IHXA 3VSBA 4BCDA 1ENPA 1CUFA 4RIEA 5EJFA 5KCZA 4OIMA 4PCAA 1UBRS 1WXHA 4FQ8A 4E1BA 3B38A 1MIHA 1ZKDA 1EVQA 3O2NA 3IPAA 1U94A 3IDAA 5A9TA 4DSAA 1B8UA 1B14A 2X85A 2G07A 1Z8FA 4ZDIA 5BN5A 4PSKA 5L3SB 4CKBA 2VTKA 3RD5A 1OMOA 3W9YA 1JAYA 2IRWA 4RXMA 4XWYA 5A7GA 1WXGA 4X7EA 1HDIA 4N0EA 4H6PA 4BMDA 2CJPA 2D00A 3KIPA 3RAGA 3WFIA 1E3TA 3I3SR 3GFTA 3JAKA 4IIEA 5KX5F 1NRXA 3KDSE 3LAWA 2X7XA 2GEVA 2QVXX 4RY8A 3RQIA 4CKEA 4D43A 1Z0AA 2Z6BD 3AKCA 1ADBA 1RQGA 3DKIA 1LPNA 3EPRA 3HCFA 3CNQS 4J0HA 1DX4A 4M8SA 4UUAA 5HDQA 1HURA 1U7DA 4ZXFA 4XKWA 1LY1A 1XZIA 3G85A 2ZRQA 1I4TD 1TPZA 2WIBA 2VF8A 3M6IA 4JC0A 3TTVA 3PEEA 4C29A 1EFUA 1MO6A 3F6CA 3QSGA 1TEXA 4J8PA 4P32A 4KOEC 5G1OA 4ZI3A 2I2FA 2HC9A 4KIFA 3FDXA 4LY6A 2YVQA 3NI2A 5I7EA 1V1MB 4FHZA 2YMQA 1EXVA 2VF2A 3EBLA 1LPSA 5KHLB 3U19A 4IDHA 3EBPA 5KAPA 1VQ4B 4E12A 2YFYA 2FA9A 4PCVA 5K8JB 2VQSA 2WJ3A 3GA0A 3GT0A 4PYLA 3VPAA 2R4QA 4TKUA 1DG9A 2A5LA 1RKXA 2GARA 4CF3A 2BMFA 2O50A 1JQDA 4S3MA 5K6TA 5DM4A 4DT1B 2I54A 2Z4SA 1T0BA 1U9ZA 4XA8A 1VPDA 2WUFA 4YIKA 4B73A 6REQA 5KVVA 2E5LB 1E4EA 1II0A 4XQEA 1V4VA 5AVVA 2QTFA 5JS6A 3W2GA 1ENYA 3OCCA 4GT1A 3FNHA 4UDYX 4QPJC 3VPFA 1P75A 1J42A 2I6SA 1XSEA 3GJQA 1V9CA 1O9HA 2ODWA 3FF1A 2FK7A 4KXQA 2J8ZA 1DQYA 2QJRA 2Y1CA 3MCAA 2FETA 1PEAA 3R6KA 2ID7A 2UZ1A 3A1UA 3AHCA 3CLTC 4JXKA 4HAZA 4INJA 4C5BA 3RF7A 3W8NA 3D6TB 1NB0A 2FEKA 2CFTA 2GPTA 1RYZA 5FD8A 2OC4A 3P2KA 1M8GA 5BSUA 4BGVA 4C2BA 2WWRA 5HBGA 1FPQA 3E9QA 4BJ3A 4UMFA 3RRMA 3K73O 4ARZA 3KQQA 3GG9A 3ID6C 2Z5FA 3JAMA 1H66A 4QVGA 4OA8A 3WE7A 4B4VA 3WYAA 2HREA 2P9HA 2V7QD 4KN5A 3VRHA 1VYUA 4B85A 4WXEA 2CF6A 2GASA 4XSHA 2OQRA 1NW8A 3Q7QA 5FWNA 5EWJA 2W2XA 3DD1A 3LG2A 5L6MB 3GVHA 4H3VA 1KOJA 3DBHA 1RMYA 1EMDA 2O5RA 2HY7A 3TWOA 2AOUA 2ID9A 3AR9A 4WKBA 2D2FA 3T5CA 3IXQA 2IYXA 4NZZA 4K46A 4YRFA 1GY8A 1S7GA 2GD0A 3G13A 421PA 2MDTA 3K9GA 4BNIA 2OB2A 5E9WA 1FFAA 1JZTA 1HNWB 3FUUA 4QPPA 4UHBA 4P4GA 5KVAA 2EZTA 1ONSA 1EVJA 4HDSB 1JWBB 1LTQA 2PJZA 3H9EO 2CYBA 3HNRA 2ZT6A 5EHIA 3VU9B 5KTYA 4LNUB 2FMIA 1YB2A 3WYGA 5L3VA 3I9V6 4JX8A 4IINA 2ZULA 3E1YE 5HMLA 1NBAA 4EUKA 1A27A 3NAGA 4EKDA 4Q1DA 4K3VA 1PK9A 1SB8A 3O95A 3DTVB 1L1EA 4DBZA 1KA9H 2PZ8A 2R8PA 3LUFA 1W88B 2J3EA 5HIMA 3SDBA 5J63A 2AC7A 2VS1A 3MJCA 5L3QA 2OHVA 4FNMA 5BSMA 4UM9B 4MEAA 1FQOA 1SEVA 2IIQA 3AFMA 2G1UA 1SVLA 2EWVA 1JHRA 2A33A 3PC3A 4UNIA 5IC5A 3VNBA 4EUNA 2ZSIA 3FCYA 3ZG6A 4URHA 3G2MA 5BNFA 5K3CA 1W0KD 1TJ4A 3IKLA 4NDNE 4PQRA 1KARA 4IV5A 4YAEA 2FZGA 3UW3A 1O5OA 1SK9A 1D2HA 1ZCAA 2ZR8A 3JVVA 3KKQA 2CB9A 4O59O 4REQA 3VZCA 5CJJA 2CV2A 3UJ6A 1M7HA 2VDWB 4YLGA 3T54A 4WN3A 4E3ZA 2Z4TA 3SLKA 4U3JB 1AK1A 1MX5A 1RXUA 4Q19A 4KN9S 2IOFK 3K8YA 1VFPA 5A3VA 4RS3A 1RPJA 2QU7A 4L3WA 5ARCA 3QZUA 1JR3E 1GQFA 3AOEC 3COSA 3RY8A 2H11A 3AUTA 3D43A 4Y2HA 4YAUA 4URZR 1A50B 3GFPA 2D7DA 2BI8A 3D3WA 1GUYA 3UAYA 3TW0A 2WJVA 3GMDA 2C94A 2VRCA 4AJ1A 4DUGA 3E1GA 1SVWA 2H1VA 3BCHA 1YDHA 3HWRA 3DT8A 4FYYA 4RZ3A 2YVLA 3WBBA 4RLSA 1L9KA 3A1NA 4G5SA 3TRDA 3LI2A 3M3HA 3P2MA 4DWJA 2LDBA 4NK5A 2L18A 4QUHA 4UFPA 5IT5A 4TUYF 1PK8A 3DTNA 1DIOB 4TMKA 4B44A 3HXLA 1F6DA 3FD8A 4RNCA 1WZCA 2NV4A 5HG0A 3PUHA 4MR8B 4NPCA 2GEDA 2GK4A 2OR3A 1K2WA 3OCVA 1R4NB 5JW6A 1FUKA 2P9CA 4JZYA 2YRXA 3QOYA 2NVUA 3TIVA 1SQ0A 3QVMA 3GUCA 1SXJE 3WNZA 4DIOA 3Q8LA 5CGQB 5FH9A 1ZONA 3I2IA 2J4FA 4HN2A 4PLZA 4KO1S 3H97A 3LPCA 4DXAA 1DC5A 4ZYUA 4UQLA 2PZBA 5EYPA 3HK2A 3JZFA 1M90D 3ONYA 1VCHA 3MMPA 3MOSA 3CX4A 2G9NA 3UWSA 2QR5A 3WWZA 2JGEA 2NU8B 5AW0A 2FLKA 1L4HA 3HVRA 2KPOA 4Z0PA 4B2YA 3C3DA 5KINB 3HRIA 4DILA 1E5XA 1A7UA 4JYCA 2HU8A 3ORSA 1UOQA 4MPPA 5AH0A 5LOVB 2ZM6B 1T9ZA 3ISJA 2YZNA 2EL9A 3O31A 4X8MA 1DOAA 2O52A 4BV9A 4TYPA 2ZUCA 4JUAA 1VJSA 2BTQA 2HSZA 4O4LA 4RZQA 4EF4A 2MYNA 4LZZA 2YOGA 4NBSA 4G5YA 2O54A 4W1RA 1CP3A 2WG1A 3HFGA 4RV4A 4JFRA 5LP1A 4U5XA 2JHCA 4D4JA 4LOKA 5E7IA 1VBKA 2WDPA 3EJWA 3GI1A 1YL5A 3T15A 1J09A 1E77A 3TR5A 2IHVA 1Y80A 4CDRA 5IH3A 5F4JA 1EHYA 2W2PA 3RVQA 2AFHA 3OQ6A 5JSKA 3L7YA 4NATA 4KQ2A 3ZE1B 4I3FA 1NXTA 4J94A 2WTEA 2FEMA 1RJFA 3INNA 4GPD1 5BSRA 3SIXA 3WQBA 1ZSYA 3ESCA 1ZH4A 2W6MA 4L8GA 3CFYA 3B5JA 5JPIA 2D2EA 1ZBDA 1O08A 1XWIA 3OX1A 2X6TA 1VMKA 1JB9A 2C2WA 2GF2A 2JVIA 1MU0A 1FMLA 1P4RA 1L4UA 2MINB 2P9QA 2QX7A 1U3GA 3GIDA 3RT7A 3H19A 4WCVA 1ST3A 1K8YB 4II7A 4WZKA 1OC2A 4UBOA 4GZ6A 4E2YA 1JSCA 3BB4A 2PH7A 1KZ4A 4ARUA 1GG5A 2X7HA 1PSDA 1FRVA 3GZ4A 3RUCA 4B8YA 1LSSA 3EGXB 1DQZA 5CA1A 1V48A 3K0KA 2E49A 3D7NA 1IU9A 4FMPA 5K99A 4IJKA 3E03A 1PT7A 2C03A 2IYLD 3HYSA 4J75A 2ZT5A 4P3PA 4YUAA 1AB6A 3GDOA 1WU8A 4HX5A 1M8KA 4MWCA 1U4OA 4Y0VA 5EZ5A 2HQ1A 2FW0A 4I4TA 4KGDA 5LDHA 1M7GA 1TYDE 1PN3A 4FBGA 4WBSA 3NQ41 1COZA 4EJ6A 5JEDA 4Z3OA 5HR5A 1RTTA 5EJ7A 1CETA 1YRHA 1H8ED 1I7LA 3VTFA 1S4QA 5B5SA 4I1YA 3PDIB 4GOND 4P86A 3DC7A 4DUGD 3ZKAA 4QLOA 3PF9A 2P4UA 1P62B 4X1YA 1ADCA 4LCJA 3K6SB 4F3KA 2CW5A 5GMOA 4Q3EA 5EXXA 4M98A 1ESZA 1UBGA 1W35A 1J6UA 4OAQA 3HGTA 3RR2A 3V8MA 4EG1A 1NONA 4YAIA 1U0TA 4QICA 1DDIA 1E60A 1NY5A 4IDOA 5H81A 3LBFA 3DE1X 2EZ4A 4UD6A 5HQTA 2O06A 1UEIA 1USVA 4DDWA 1LD3A 5G0TA 5C8YA 1NC1A 1AGNA 1CIJA 3D2AA 1GARA 1WOSA 1JXQA 5FRDA 3AR4A 3GGCA 4UAVA 3CF4G 2NADA 3UF0A 5L9AA 3R7BA 3RSZA 4EGCB 4MV1A 2QUHA 3FGPA 2XRMA 4TZ0A 1DFHA 3Q87B 4J2HA 4XCVA 5ALFA 5EFZA 2AX3A 2M1ZA 2R1TA 3JQAA 4OPSA 3BH7A 5JE8A 4G9EA 3OY2A 4F60A 2GB4A 3U4CA 1KVUA 4LVOA 2X58A 3VC3A 3SC6A 4FMCB 4HLQB 4L0MA 4CFZA 4HFRA 2P69A 4GP6A 1AXEA 2W0SA 4RELA 2RGUA 4AYWA 4M89A 3Q6NA 4XXHA 4C2TA 4F5WA 4LRQA 1J49A 4NSNA 5IANA 1Z5GA 3PVZA 5CB6A 3R6GA 5BR1A 1K8RA 3LUJA 2FDRA 1GEEA 1NW7A 2CL0X 4KH0A 2PAAA 3FNFA 1OYWA 5KB3A 5AK0A 1HBJA 2MR5A 3OZFA 3R0ZA 4RW0A 1E1RA 2IQIA 2Y1OA 2PXHA 3TGLA 1SR8A 4G1VA 1ZJWA 2AZ4A 2OXEA 1TO6A 4LSZA 3V8VA 2OBSA 1E43A 1KY2A 1AOXA 1NQOA 1XMIA 3CSUA 3HUDA 2Z3WA 4ILEA 4HXGA 2XXBA 4GDMA 3UJ9A 1CJUC 2GHQA 5E6SB 1L7PA 3OTWA 4FI3F 3I4FA 5H82A 4YQEA 3R7WA 3ZHOA 5EWMA 4B6PA 2A92A 5JI2E 4D82A 1O6FA 3QY0A 4ISBA 4QQ8A 4UCWA 1XMOB 4DEYA 1HEIA 4RANA 1NR1A 4GEGA 5HKAA 3KQMA 3PXEA 5FP0A 1A1SA 2VHWA 1H65A 4LUCA 4MV7A 1NA5A 4EAAA 2VBFA 5ADHA 1CT9A 3EZXA 2F59A 3D4PA 5E6UB 4ALNA 5DM60 2V03A 5A1TA 4MDEA 2FRDA 5J2TF 1EX1A 2VUIB 3HJGA 3H17A 4FLFA 2OK8A 3ABOB 3USZA 4CCWA 3RVKA 2WJGA 3HBLA 4WECA 1J5PA 4ZWNA 4RKQA 4EO9A 3ASQA 4HQFA 2NUTA 2VQ6A 3ZCQA 4P3YA 2A8YA 2P2DA 5KQGA 2DPYA 3EODA 1CS0B 4TV8A 5C31A 2IXDA 5LQDA 1PR1A 4ZO6A 4FONA 3O8DA 5IUJC 1QRTA 1THZA 3HFRA 3W2HA 2H8GA 5EIBC 5FUVA 2ZK7A 3V33A 3CT4A 5HKKD 3EPPA 4D7AA 2B9VA 4I5IA 1YBVA 1VIYA 2NWQA 4EKEA 4EP1A 4G0UA 4JGIA 4ZHSA 1DARA 4W6ZA 4D25A 2WF6A 5DISB 3MPOA 2AUTA 3ZHSA 3PZBA 4G89A 5JCXA 1ATIA 2CLFB 2YUIA 4P3OA 4QQRA 5EWLA 3TEMA 4F7WA 3UO8B 3W0LB 2G7ZA 4MULA 1H4TA 1WPCA 4H1UA 4X63A 3RB8A 3UT5A 1WXWA 1T8PA 4ZVVA 2BMJA 2ACEA 3C74A 4RJTA 3T7AA 1IJEA 5DBHX 4G4SP 3UYKA 1IMOA 3GLFE 1I7DA 4XLFA 3E15A 4PGMA 5E8JA 1NGSA 2JS7A 2XUQA 1FJXA