4RCZA

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gdpnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 111
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rczA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rczA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rczA01
2H1LA 1IONA 3U44A 3W6PA 1XRJA 3RS0A 2A5YB 2V8OA 3ZYCA 2YJTD 4ZGNB 2J5XA 3QBVA 2BBSA 1VG0B 3EC1A 4LJ9A 2JJ2A 1HE8B 4TMTA 4OBEA 2QENA 4TLBA 1FNDA 1GKYA 2A78A 2JIZA 1FW6A 3EC2A 5DH9A 3RSLA 4KCGA 1VQOB 3CRZA 1YRBA 2F1HA 4L9WA 1E2FA 2O8EA 5TVKA 5FR1A 1W4RA 4Q03A 1L7VC 4D2IA 3QG1A 4B75A 3OF5A 1FQKA 1P3JA 3D7MA 4A4DA 1AGPA 1XD2B 4CYMA 4DT1A 4LYJA 4XWOA 3W6OA 2JLZA 3SHWA 2BEKA 2PEZA 4R2HA 1NP6A 1CS4C 2VHCA 4MKHA 3QFSA 5BXQC 1DE0A 5FBLB 2P67A 4XH9B 2XGJA 4CEIB 1KQSB 1TQ2A 2AXNA 1ZM3A 2FG5A 3EG5A 4PQFA 4QFMA 4DHEA 3CW2A 3KKQA 2LKCA 5E95A 5F9FA 2ZRFA 2P65A 4K1XA 1G3IA 3Q5DA 4FWTA 2W6IA 2VNKA 1E0JA 2ZE8A 2ZJBA 4OQXA 2ZRAA 4DEXA 4J0QA 3AUXA 3KXKA 1KI8A 4DQLA 2BIFA 4HB4A 1FTSA 4MKGA 5EQTA 2G1JA 3A1VA 3QF4A 4O2RA 4B73A 5LD2C 1NVVQ 3AVTA 1P61B 1M90D 4AKEA 3LO5A 4DUGA 1A7JA 4JKIA 4QXAA 5GVSA 5KDOA 2OEPA 4XWAA 4JVNA 1Q3HA 4TT3A 4PC7A 5KSYA 1WP9A 2QL6A 1WB9A 4TZ6A 4KFUA 1R8SA 5J4LA 3GLFE 1NJGA 3CXCB 3CCEB 3H0KA 4KAXA 3FHCB 2F6RA 2KSQA 2W58A 3A36A 3BH6A 1G7RA 1BOFA 2HXYA 3ADDA 4AKIA 3QIAA 5AJZA 1N2CE 3GJ6A 2FPMA 2WJVA 4LZZA 5FL7A 2UKDA 5F2EA 1N6LA 2C03A 4C0BA 2IYLD 2XITA 4ZCLA 5AN9A 2ZI7A 3ZD6A 3L8ZA 5L3RA 1CR2A 1KO5A 4JYCA 3TK1A 1KDRA 3QEOA 3BRWD 3QXXA 4NYIR 1S72B 5EXSA 3AVYA 1UJ2A 1QVFB 1J8YF 3CH4B 1G5RA 2YVUA 5HKKD 1G21E 1G4AE 2ZRGA 4EPTA 2GETA 2ZM5A 1Z06A 5GV8A 2NO0A 2O0JA 2VP6A 4OI4A 2ZR0A 3R9XA 4B2LA 1AGRA 3F0TA 1G5TA 1DVRA 2ATXA 3SQXA 1IHUA 3RNLA 2B92A 1FQJA 4C0HA 1IN8A 1IN7A 3ZC3A 3K70D 3UANA 4A8JA 1EWQA 4LY6A 4R71A 3CRVA 4GP6A 5TARA 4OJQA 3IO5A 4E07A 1GG2A 1N8RD 5FOVA 4PTLA 3DZ8A 3H4MA 1Q57A 3K9LA 2BMJA 5BYKA 2QEXB 5CB8A 1HY3A 2G1KA 1IM2A 1LB1B 3LY5A 5E7IA 1VCOA 4TMXA 3MAAC 1NMZA 3TVDA 4M1KA 3T34A 3CX7A 4U02A 2IYWA 4PANA 2N1BA 1ZUNB 4DDTA 3G0HA 4B3GA 5AUPB 4RD4A 3AF2A 5FBQB 2ZIAA 1G4UR 1W0JD 4AYWA 1OHHD 1NIPA 2HJGA 2ZUBA 2GESA 3QNUA 1JR3A 2FEOA 1B0UA 1X8LA 4B3FX 3L43A 4TTQA 3G4SB 1G20E 1KI2A 1J90A 2XNJA 2O0KA 3AUYA 3VR6A 3MJHA 3CCJB 5GADl 4CGZA 1GRRA 1IJFA 1E9CA 2WWIA 5C18A 4PSKA 2BBTA 1JJ2B 1SVIA 2HYDA 3EZ9A 1T4GA 5KU1A 121PA 2O8CB 4NYJR 3T12A 1Z22A 2NTYC 3O8BA 4JVLA 4IHQA 4B4DA 3OZWA 1KI7A 1N5LA 2R65A 1NJID 2OM2A 4LCBA 2AXPA 3NXSA 1M74A 4RKFA 1OGIA 2HJVA 1COWA 3IHWA 4LOAA 4UNQA 4BEJA 4V0LA 1P62B 1DOAA 3BAFA 1UKZA 2FX3A 4OI2A 1T6NA 5FTNA 2J0UB 1N5JA 3O8RA 3J81k 1Z07A 1W5TA 2DPXA 5JFGA 4A92A 4O3MA 2CJWB 4KVGA 2GZHA 2BMDA 3P4YA 1VQKB 2D2FA 1HTWA 3FKQA 4Y0VA 5JS7A 2OO7A 2FDCA 5JJIA 1IOZA 4I99A 4F4JA 4YAWA 3VU9B 4ASUA 2HCJB 1G17A 2NO7A 4QJ4A 4QNRA 4NL4H 5GVRA 2QMEA 1ESNA 2D2EA 4UXJA 3CX8A 1F3OA 1GP2A 2ODBA 2OLJA 4GMXA 3T5DA 2CL7X 4PSVA 5CK4A 2B8TA 2WMNB 3ASYA 2R8RA 1FNCA 1E9DA 4DB2A 2ZETA 5EE5B 3U60B 3QPVA 4NU0A 4TLDA 5HCIA 1XMIA 3LNCA 3NG1A 4B2PA 2FFAA 1P75A 2V7QA 1D9XA 5IK2D 2FSHA 2ZJ5A 1EWRA 5HE8A 2OCBA 1N6KA 2CHGA 2GAAA 2P6NA 4YMTA 3W5HA 3GFOA 1SULA 1OKKA 3K70B 2MMCA 2CNWD 3W2IA 3LAWA 1N0WA 5CIQA 3CRRA 3ES9A 3ECCA 3A8TA 3W9YA 3GEEA 4Q48A 2QTHA 2ZJAA 1QUFA 4DSUA 1U0HC 1LS6A 2OZEA 1T3LA 2OFWA 2ZSEA 2FJUA 4GNKA 2GCPA 1KSGA 1R0WA 3CF2A 3EAQA 4Y9RA 1X8KA 4TL8A 5H1YA 3U3MA 4HAVA 1AS2A 4HAUA 1K9MD 3LBHA 4QM6A 3SYKA 2QNRA 2CK3A 1KIMA 1I2MA 3CCMB 1NVXQ 3QKRA 4HAWA 3CCVB 3K9GA 1YJ9B 1XMSA 5LD2B 1Q82D 4L8GA 1ANKA 4NKRA 4C0KA 3ZS8A 4BLPA 1P2VA 1EP2B 4YALA 4EPWA 5M04A 4PPNA 4C2UA 4L16A 1WMSA 2ZS7A 4AF6A 4MITA 1E0AA 1E79A 1Z0IA 2FSGA 3OAAA 5FBVB 1NY5A 5FBRB 1L4YA 3NEJA 4TWZA 2EVWX 4Q1BA 5EJEA 5JCPA 1XJCA 1W7AA 1JNYA 2XAUA 4GRAA 2BF4A 1N0VC 2OTJB 2JJ2D 2VHUA 4G0NA 4JSTA 6Q21A 2AD1A 4X8MA 2DFKB 4AG6A 3T1VA 1U99A 3GJ5A 1JBKA 1HQYE 2FFBA 3OZUA 4EAQA 1OFIA 3R9WA 4G5SA 4A9AA 4EQ6B 1HE1C 2W6JD 3ZQJA 5DGXA 3HYRA 4CT4B 1CJUC 4A6XA 3K9HA 4WZ6A 1U8ZA 1E4YA 4W9MC 1KY3A 4A8JC 3LQRA 4V0MA 2CHVA 2VH5R 4UNSA 2WJHA 3TUJC 2QROA 1FX0B 2B21A 4YAOA 4JLOA 3KXLA 1EESA 5FUWA 5L3SA 2C9CA 3A1WA 4LV5B 4DDWA 4Q47A 1G8GA 1X8JA 4Q7MB 4BZXA 1T8TA 1WBBA 2GAOA 1QDEA 2YC4C 4P32A 2ZRDA 1ZW6A 5AJVB 1LVGA 4MRSA 2RKOA 2HT6A 4ACBA 1KDPA 3KB2A 5J4KA 2WJJA 4DLVA 1EFUA 1JPJA 3I3SR 3VKHA 1OE0A 1HYQA 2WM9B 4TMZA 1RFLA 1Z47A 3AEZA 4ZI2A 2CMKA 3BWDD 3A6PC 1G8YA 1Q21A 1XXHB 4Q1AA 4URXR 1SGWA 4JT4A 3N5CA 3D3QA 1KO7A 4URUR 4DUGD 1JR6A 2QQEA 1XWIA 4JBWA 1KJZA 1HUQA 5D3MA 4CT5A 5JWOA 5BQ5A 1Z8FA 2YC2C 3X1ZA 2A2ZA 1G6OA 1SZPA 2OFXA 2FPKA 1GUAA 3U4QB 3ZBTA 2XSZA 4JBYA 2Q3FA 5JLJA 1GL9B 1RE0A 1S3SA 1N5IA 2RHMA 1E9FA 4M9XA 2OTLB 4CRWB 2RHDA 1KO8A 2KBEA 1Z29A 3AVOA 2QPOA 4OHYA 5L3QB 1A5TA 3KKPA 2AK2A 4G1BA 2J9RA 4D0NA 1XEFA 4ZIRB 1UKYA 4IVPA 3CLVA 4ARZA 1DARA 4Z8XA 4TTRA 1TUIA 1ZYUA 5AUOB 4DIEA 4BLOA 4BE7B 2GXAA 1P5ZB 2ZUCA 4D25A 5B2ZA 3VR2A 3BC1A 4RZ2A 4EUNA 1G3RA 1K6MA 1E0KA 4L15A 3B2EA 2XXAB 2ZRCA 2NG1A 1NLZA 2PLFA 1E2IA 3RS7A 3VO2A 4MYCA 5CM8B 1W1WA 2H92A 1GKIA 3U3JA 1II9A 4FCWA 4HB0A 4PHTA 1OF1A 1NVUQ 5DE3A 3LLUA 4B35A 3UWKA 4B2IA 1M7GA 5JI2E 2XNSA 2ZRLA 1X6VA 1K73D 1D2MA 3BD9A 1LV7A 4W5WA 1WBDA 5GJBA 2ZJ8A 2CLDX 2O8EB 4PR0A 3B1ZA 2CE2X 1VQ4B 3SDZA 2JDID 4A15A 4DT1B 5SZIA 1KO4A 2CL0X 5BWMA 2PX3A 4HSEA 1HEIA 2CLCX 3DKPA 3F3YA 1X1SA 1IXZA 3W2FA 3CZPA 2OAP1 1VPLA 1W4CA 1JR3D 2QPAA 2EQBA 2PT5A 5EXXA 2JLUA 4QM7A 2WBLC 1MR3F 4M1WA 2IC5A 2ZSDA 3RANA 5AJYA 3SE0A 1VKJA 2QMOA 2ZYWX 2FU5C 2PMDA 4YMSA 3NH6A 2AFIE 2OE2A 2DFTA 2FZLA 4CEJA 2IS1A 2WHXA 2C5LA 4G1VA 1GFIA 1SKYE 3QY0A 4K46A 2GXQA 4YAFA 5FTMA 4Q21A 1TQ6A 3QF4B 4XD7A 1FP7A 2TMKA 4PHFA 4DDVA 3E1YE 2ODWA 3CRQA 4XVQA 1COWD 5CK5A 1JQJC 4TL9A 1CNFA 1G8PA 2VTKA 1H42A 3R7WB 4GL2A 3IHLA 1NKSA 1SXJE 1NSTA 3I72A 3CC4B 2QE7A 1T91A 5DI3B 1WCV1 3ND8A 2BCJQ 4KBGA 1UBGA 4OI1A 1G6HA 4ZCMA 1JALA 4F38A 2F43A 2GEUA 1KKLA 2EWVA 2ONJA 4C2TA 2IHBA 2RGXA 4GFDA 1OFUX 3EPKA 2OILA 3HP1A 4ASUD 2FFQA 4PC1A 3B1YA 3THOA 4NTZA 1OV4A 2WKRA 5JRZA 2JLVA 2DEUA 1XF9A 1CNEA 4G01B 4Q66C 4D4LA 1OXXK 1KDTA 1M1YE 5KUTA 5TR9A 4RD3A 1P9WA 1Q12A 2X8AA 2ZI4A 3NWJA 4F4IA 5H59A 5B58C 4NYMQ 2AHOA 2VPPA 3B1WA 1KAOA 1Q81D 4GZLA 4C30A 3SBEA 1JAHA 2EFEB 1QHYA 2NZJA 1SHZA 1NLFA 4K81B 3MLEA 3PEVA 3TW4A 2CEAA 1DADA 4V0KA 2V7QD 4WVFA 1XCGB 4DDUA 1ZUHA 1FZQA 2CVHA 1TNDA 1RPZA 3OE7A 5JJKA 2XZPA 3OHMA 5TY0A 3REFA 4A8JB 3QE2A 5JHGB 1OIVA 3LBIA 3OW2B 2HUPA 1W44A 1Q1EA 2B8WA 3C7KA 4DCTA 1E32A 4N3GA 2W00A 3UMFA 2YOHA 1G64A 2YV5A 4JVSB 1QHSA 1M34E 3JQRA 1KI9A 3KFVA 3GLHB 4OHWA 2BSAA 3EZ2A 3LXRA 4YONB 4TL6A 1YR6A 3IKJA 1N6PA 2KBFA 3CPHA 5IT5A 1FUKA 3AB3A 4MDFA 4NBSA 1PV4A 3VKGA 3FMOB 2OT3B 4S35A 4BFXA 1HV8A 4QG7A 2RC6A 1XZPA 4MGKR 3SU8A 1MT0A 3IUYA 4IDQA 2PX0A 3PFIA 1XTIA 4PSAA 3THWB 2QSZA 3IIMA 2O8DB 2F9LA 4IJMA 1XD9A 1YHQB 5J5CA 1B23P 1E79D 2V1XA 3JVVA 3VFDA 1XPOA 1US8A 2JLQA 2WZQA 3CPWB 2ZI9A 3THXB 3RVBA 3VNVA 4M9ZA 3U3RA 1QGYA 4LYFA 1S9DA 3GJXC 4XIGS 3GLIB 2IUUA 3CCLB 4V0OA 4US2R 3LVQE 2V3CC 2FV8A 3NC0C 4RZUA 4IKEA 221PA 4HLCA 2VNHA 3C16C 3DZDA 4I1SA 4Q4AA 5EE1A 2XOKD 1V43A 4LJ5A 4CIDA 1CIPA 5FTJA 1TEVA 4GMDA 5JRJA 1IQPA 1S1CA 1GNRA 1DAHA 1P2SA 1KTVA 1VHTA 2G9NA 2ZS9A 3ZZUA 2FE4A 2XX3A 5FPKA 4XSHA 2QMUA 3TE6A 1RW4A 4FD2A 3OZVA 1XTRA 3K0EA 4IXMA 4HDOB 3LH5A 3OEEA 4L5BA 1YR8A 2VSFA 3HPQA 3IPYA 2R2AA 1W2HA 2JAQA 2GJ8A 2ZJ2A 2DWPA 2B6HA 4AK9A 1NG9A 1BX1A 1ZC4A 3CMEB 3VNUA 1NI3A 1MRSA 2REXB 4JLPA 2PJRA 4LRWA 1E9AA 2HF9A 1E99A 1N0UA 4P4UA 4BLRA 2X3UA 1E1QD 3UATA 1Z83A 2QAJA 1ZM9A 1KSHA 5AJXA 2QDXA 1GIAA 4P31A 2XTNA 2CCGA 1X3SA 3LDAA 4QJ5A 1GL7A 3FE2A 2FNAA 1QG2A 1T3SA 4MRPA 4OQNA 2XNDA 5HTKA 3X1WA 3FGNA 4N1AA 3ZZTA 4LHWA 4OI0A 4BFVA 2G77B 1ZNZA 4QHYA 3AF4A 1R6BX 2XSZD 3EZ7A 2C98A 4NYIQ 5AUQA 4U00A 3RWOA 1QHNA 1N6OA 1ZM2A 3ICQB 1DAMA 3CUEF 1OB5A 1F48A 3QEJA 2G0NA 3A1SA 1Z6XA 2CVFA 4JLDA 5IRCD 1HH4A 3SI7A 4TLEA 2GK7A 2GXSA 4MYUA 3IPXA 4NCIA 2PZEA 3U7EB 4BECA 1FMLA 3QKRB 4EPRA 1OIXA 2RB4A 2WWXA 2IBMA 4NONA 4B6EA 1T5IA 5JEDA 2OHFA 3BK7A 4Z1MA 4C7OA 2A5JA 2HXSA 4AF7A 5JMTA 2JEOA 2QP3A 2ZU6A 4FW9A 4W5HA 1C4OA 2OXCA 5C4GB 4M0LA 1DAFA 1IN5A 4POAA 1Z63A 1KNQA 2BOVA 3CPEA 4FCTA 1ONBA 4N0EA 1SKQA 1MO3A 5K8LA 1WXQA 1FDRA 4LC0A 2IS2A 2ONKA 1SVMA 4P33A 4RD1A 5JS8A 3UPUA 2BBWA 4Q4JA 2NPIA 2N46A 2W83A 1G8FA 5EXPA 1Q86D 4PC3A 3CR8A 3OIYA 4ZGQB 4C43A 1E2LA 1ZC3A 3WNCA 4HUQA 1KYIA 2ZRJA 3B78A 1XMVA 2J1LA 1NDHA 4EPVA 2SHKA 1UBFA 1AK2A 1D5CA 1VYVA 2J7KA 2RGDA 5L3SB 2J7PD 4NYJQ 1AS0A 1ZD1A 4Q7KA 1IB0A 1E2DA 3KKNA 1KZGB 1W47A 4UNNA 3S1AA 4KODA 1AA9A 3CF6R 1YJWB 5FH9A 3K8YA 1ZVQA 1SVSA 1XFAA 2R6HA 4HZUA 5J40A 1U0LA 4BEBA 3NBFA 2QP4A 1G7CA 3EWAA 3A4LA 1XDBA 3CNNA 3E1SA 3T1QA 2QRNA 1JAIA 4XD7D 2JGNA 2FGJA 1VQ8B 2LWIA 5JI3E 1YIJB 4UAJA 1E1RA 2OESA 4PZLA 3CH5A 1G7TA 4PO8A 5D3MB 4DLXA 2IXEA 1ZAKA 2CHQA 3PUWA 4BRUA 3FHTA 2QE7D 1NBMD 2IS4A 1J2JA 4QRHA 1I2DA 2KJQA 4OL0A 2WJGA 4MRRA 1YU9A 3VHLB 4MRVA 4QKQA 2NO9A 5KSOA 5LB4A 1OGJA 3Q9LA 3A4MA 3THYB 4MKFA 2G83A 4UXHA 2PMKA 3VR1A 3ETLA 1Z3IX 4JIMA 3SN6A 4G5RA 1Z0JA 1E9RA 3T35A 1K5GA 2R44A 4JS0A 4BFSA 4FCVA 5FPHA 1G8HA 2VHQA 2VNIA 4DLWA 1IJEA 2HLDA 2HV8A 4DLRA 5DSZA 3TSWA 3MG9A 3A37A 1G5PA 4ARZB 3KQKA 2B5OA 1WQ1R 3GFPA 2BBOA 3IBGA 4TL7A 5JEEA 1ZU4A 2J0VA 3QJYA 5CJPA 1RZ3A 1VIAA 3SYNA 2AN9A 3AF3A 1LW7A 4IFBA 4KLNA 4TN1A 1TQDA 3NC1C 3CX6A 2ZS8A 1A2BA 1VQ9B 1OYWA 4FMDF 4O2LA 4BFZA 4WQMA 4Q19A 3U3KA 3V9PA 3LW7A 1W4AA 1GVHA 1SXJA 1R7RA 2RAPA 4HLUA 1XCMA 4II7A 3RS3A 3PEWA 4ZKDA 1OH6A 1G1MA 1YZQA 5EE3A 2BDTA 2UZ3A 2ZAMA 3BOSA 4JLVA 3GCGA 5F3WB 1ESMA 1P9NA 1E9SA 1KOFA 2OCYC 4KSCA 2H18A 3GEIA 1KK2A 1UBEA 4LHXA 4DLTA 1QHIA 1MH1A 4NMMA 5L3VA 3SJBA 3QOFA 3CNOA 3T1OA 1CTQA 3HDTA 1CXZA 3QXJA 3ZIAA 3X1YA 1HURA 2Q6TA 3SEAA 2ANBA 4QGHA 5FUYA 4P3YA 2WOOA 2IWRA 2NIPA 1R5BA 2ZTSA 3I92A 3IIJA 3MWYW 1T0JB 4JJKA 3MJRA 3GLGA 4GZMA 5DN6A 2DCUA 3X1XA 2NZ8A 5G53C 1RYHA 2Z5FA 3HR7A 1G16A 4GOJA 2RC5A 4X8OA 3TGPA 2D06A 3IO3A 3CB4A 5AJWA 3TBKA 3TQCA 2DR3A 2B7BA 2BGIA 3B1VA 3FKSD 3NIBA 3QKUA 2JLWA 1W4BA 2EFCB 3IGFA 4M1OA 2G0TA 1VCMA 2QGNA 4EFNA 3O8DA 1X1RA 4QGAA 4A0FA 4PZZA 1VECA 2QT0A 3H1TA 4QBHA 2Q3MA 2AWOA 2NO1A 4RFSA 3SHFA 2N42A 4GSYA 3DL0A 4ZDIA 5AR1A 2HF8A 2RGGA 4KHZA 1GILA 1MKYA 3UK6A 1ZJ6A 2A5FA 4FMCF 1CLUA 1A82A 3K0FB 2Z0MA 5FL3A 3GEHA 4S2EA 2Q9BA 5DO9A 2XB4A 4HDQB 1KI6B 1IY0A 1R5OA 1TL7C 3DMDA 4URYR 5B64A 1K5DA 3OEED 1EFRA 2X2FA 3OIWA 4HB3A 3QBTA 1FFHA 2QUZA 1E9BA 3LQQA 2ZJZA 2CRVA 4TLCA 1NL3A 3B60A 3K09A 3BS4A 4Q1EA 2LKDA 2QA4B 2QGZA 3RRZA 3KDSE 1VYTA 1QVGB 3VO1A 2JLYA 2JLRA 3TW8B 1F60A 1A8PA 4TQAA 5FPYA 4DSTA 2BM1A 2WSSD 3E5HA 1XE1A 4QNMA 3NDBB 2P3SA 2I1VB 2X2EA 4P4SA 1P4SA 1F2TB 2A5GA 2QAGA 3P32A 2VP2A 3AP2A 1UADA 4HAYA 1ODFA 2XNDD 2IK8A 4A0RA 4FWIB 5ELXA 2BPOA 1UF9A 3M1IA 2VIIA 2P6UA 4B3CA 3PUXA 5GV7A 2PH1A 2OLKA 2ZRBA 2C96A 2Q9AA 4IRUB 1GNQA 5TB5A 2WKQA 2W0MA 5UKDA 4HE6A 1FUUA 3KUCA 3RWMB 4LBWA 4I1OA 3QI2A 3JZMA 2H17A 3FOZA 1AKEA 2VSOA 3EW9A 821PA 1KDOA 4PXAA 1HA3A 2DY1A 2YZ2A 1KI3A 3BH7A 1ZM4A 2XTMA 2E87A 1VIYA 2ANCA 5DHAA 1Z0DA 1YHNA 3RDPA 1M1KD 4KYIB 4P4TA 4PGOA 5TMPA 721PA 1IY2A 1OXTA 2X19A 3B1XA 4DWJA 2Z4RA 4OQFA 3I56B 4Q4HA 4LDJA 1CQXA 1S1MA 3JQPA 2ZSAA 1RRGA 1SVKA 2OBLA 3M0EA 3OJXA 1P73A 2ZROA 3KJEA 3HPRA 1XEWX 3FWYA 1YVDA 4LHZA 3TIFA 4EPXA 4IOMA 2Q3HA 4OJKA 1US8B 2DBYA 3ONWA 1CU1A 4TLAA 3QXSA 4BRWA 4BZQA 2IW3A 3W2EA 1QHGA 3UWOA 5K8UA 1QZXA 5HPYB 1Q1QA 3PXGA 5DHFA 3FPKA 2YHSA 5GJVC 5JSZA 1M2OB 3QG5A 1BYUA 1YR7A 2FSFA 3OZXA 5JZVA 3GPLA 1IXRC 2FGKA 3PR1A 4D26A 2EIXA 5LB2A 3RS4A 1OT3A 1ZD9A 2JA1A 4JJZA 1BKDR 3SC3A 4Q9IA 1OH7A 4CDGA 1KMHA 3X1DA 3FDIA 3KJGA 1U81A 4B34A 3EX7C 3NBZC 4HLUC 1UKEA 1EWYA 4C3ZA 3ZH9B 2ZJOA 5DNYB 2GJ9A 4ZDKA 3VMFA 3Q72A 5A4JA 1EFHA 3TJZA 2IX3A 4IDNA 4ESHA 2GEDA 2ZYVX 4BLTA 2P6RA 2IYXA 2O52A 4WZAE 1MOZA 2JIZD 2V9PA 3EIEA 4XVRA 3L8YA 4M1SA 3NTUA 2ZEJA 1T9HA 4A1FA 4GDFA 3ZVMA 3ZDQA 2WAYA 1TF2A 2Q21A 4TYNA 1PVOA 1P60A 4BFUA 3GFTA 4G1UC 4M22A 4WXPA 2WWGA 1H65A 2ZE6A 4KFSA 3IILA 3LRPA 2R6CA 1UDWA 5FPSA 1E2QA 1GAJA 3TLXA 4BLQA 3AVUA 5G41A 5HXBA 4V0NA 4A2QA 4IOKA 3C15C 4R98A 4DCUA 1WRBA 2B7CA 3MCAA 4GBMA 2I1QA 3B82A 4WA7A 4ABYA 1WF3A 1N6HA 2W6ID 3T61A 4E09A 2F55A 2R6GA 1MV5A 2GA8A 4D80A 3NHBA 3PV0A 3ZVNA 2BKEA 4PQYA 1ZBDA 1OIWA 1FP6A 4B3BA 1W34A 1XXHE 4OHXA 2WWHA 2GHIA 4C4PA 1IY1A 5AWFC 2QM8A 4TT3D 4Q1DA 3KTAB 4XVUA 2HT1A 3B13B 1DO0A 4C7OB 1KI4A 4LJ8A 4PPQA 4Q9HA 1CRPA 1GZSA 1PZNA 1YZGA 5BYJA 1WA5A 1BIFA 1W48A 1OYYA 3OEHA 4A6PA 1GKUB 1ZRHA 1RKBA 2A9KA 2ORWA 3ZVRA 3P20A 4Z51A 3PIRA 1NSFA 2K5UA 4Q00A 2OV2A 5FL7D 4B32A 1Z0AA 2OBNA 1OJLA 1ZNWA 3K09C 3QFTA 4KFRA 4IFEA 2CE7A 2P5SA 3I62A 2WJYA 2VYFA 1YJNB 2WTUA 3W5JA 3LO8A 3U61B 4G5OA 3REGA 3KXIA 1GVNB 5FI1B 5JCZA 1K8AD 4C0LA 4Q7LA 1QH0A 2QZ4A 4TYPA 2J59A 2PJZA 1P9RA 1VQMB 3U44B 1U8AA 4I1UA 3U2QA 2ZRKA 3AKYA 4HUQB 1NF3A 2I4IA 3R9IA 1FTNA 2IS6A 2QMHA 1FL9A 4M1YA 4H1VA 4HUTA 1I4DD 4G5GA 2BHRA 2QRZA 4PZYA 3SJAA 1QF9A 4E22A 1EX7A 2IT1A 1XPRA 3AQ4A 1Z28A 3S1AB 3GLFA 3ZGXA 1N5KA 4D0GA 2W2TA 1YRAA 1TU4A 2PBRA 5DN6D 3U6KA 3FMIA 4D82A 4RFVA 3BH0A 5FOUA 3CCRB 1PUIA 4B76A 3CC7B 1M7HA 2IEZA 4GPTA 1ZNYA 2ZU0C 3AVWA 4U9UA 3VAAA 5F98A 2WAXA 2X77A 2RGBA 2ZVQX 3VHXA 3MD0A 4FMDB 4IEIA 3QF7A 1XEWY 5H8WA 1II0A 2XTZA 2GBLA 2ZSFA 3ZQ6A 3WNDA 3GJ7A 4PAOA 3T1TA 3ZZ0A 2H8KA 4V03A 5FUXA 1VQ7B 4LI0A 3I73A 3C5CA 4DEYA 4C0JA 3CO5A 2ASEA 4Q9KA 5KTYA 4AKGA 3P27A 2W0SA 5CYOA 2JJ8A 4US1R 4A2WA 1D6JA 3BE4A 5LPNA 4KFTA 2VHJA 5G40A 4EH1A 4PO9A 2W2XA 1E69A 1EFRD 5CITA 3SOPA 5KSWB 1RRPA 2IYVA 1KSJA 2ZRPA 4YMVA 1LY1A 2OSBA 3UG6A 1S9HA 1Q44A 3LD9A 5CDFE 2PEYA 3OFNA 4PX9A 4LX0A 4ZPXA 3PEYA 1G7SA 2YWHA 3BORA 4Y0AA 3BBPA 4HE5A 4KBFA 1P72A 3WMEA 1W36C 1QGAA 1OW3B 1XP8A 4PAQA 5JWHA 5FTLA 2VO1A 1O87A 4ERNA 1P2TA 4QOSA 1BH2A 1GL6A 4KV9A 3ZJYA 1P7CA 2ZYTX 3O47A 4TMWA 1V5WA 4BUJA 2PCJA 5FPTA 3NH9A 4O0MA 2QQ0A 2G3YA 1TQ4A 2Q9CA 3G6EB 4KJZA 4US0R 1Z0FA 2BEJA 3TAUA 1J7KA 5TXGA 3U7HB 1TU3A 4PC6A 3SFVA 3L82B 1NY6A 2QN6A 1G3QA 4FMCB 4UNRA 1DDIA 2D4HA 1VG9B 3M4YA 4IDOA 1EP3B 4JLNA 1Z2CA 3KKMA 3PUYA 1DTSA 1XU4A 1WDTA 2CLSA 2PLRA 4DXAA 5KDDA 3DMNA 1GAWA 1F2UA 4B71A 4BZPA 1OKKD 3TRFA 1ZM7A 1E62A 1KAGA 3ZLJA 4LJ7A 1C9KA 1IXSB 2J0QA 3G71B 3GLGB 1TF5A 1AZTA 1CJKC 3IDQA 3I5YA 4XTRA 1VYUA 2CJWA 4WW0A 1DEKA 1KO1A 1GRQA 3IIKA 5EZ5A 4ZV4A 5CM9C 1UEIA 5B30A 4LGMA 2AK3A 2YOGA 2F3TA 3CF0A 3NDPA 1GR1A 3A58B 2ODNA 1XTSA 3GQBA 3VU9A 2VEDA 4EKDA 1RVDA 4Q18A 1P6XA 3GLHE 2DB3A 4PC2A 1KMQA 2CK3D 4LV8B 2AWNA 2O0HA 4Y7CA 3KL4A 1Z08A 4HLDA 1DG1G 5EP3A 1MABA 1JECA 3U5ZB 3CM0A 1RJ9A 4JKYA 5BN4A 4RFSB 2P5TB 1EX6A 1TUEA 1W5SA 4IXNA 5EE0A 3TH5A 5B57C 5HKKA 3HWSA 1JR3E 1OB2A 1A1VA 2EW1A 1AQYA 5K8IA 1RIFA 1XBTA 3MMPA 3QUSA 1J8MF 1EG7A 3T06B 8OHMA 3Q7QA 2NOAA 2HCBA 1RRFA 4EPYA 3OAAD 3I8XA 1KRHA 3ZS9A 1VG8A 3DDCA 4ON9A 4BFYA 4GP7A 2WIBA 2QY9A 4AURA 1W36D 3CCQB 2GJKA 2PCLA 4FIDA 2Z83A 3AF1A 3KQUA 2XB2A 4RCYA 1F5NA 2XZLA 1N25A 3CWZA 4DC9A 2F3RA 3RLFA 3O8CA 4URVR 1KKMA 3GLIE 2BJVA 1AJEA 2WPDA 1D2EA 1KZ7B 5SZHB 1CEEA 1E9EA 1I7PA 2RGNA 3E20A 3DEFA 4P4SB 1IN4A 3BERA 1NVWQ 2ZJYA 1SQ5A 3MHPA 1GOTA 1W0JA 1GAQA 4ZKEA 2ZXUA 1LF5A 1FRNA 1QVRA 2Q0HA 2GCOA 4Q02A 4UQOA 1RRCA 3D8BA 5C2JB 1JXMA 3I55B 2A3RA 1PLLA 2QI9C 3DO6A 1ZD8A 3IBYA 2VP5A 4IDPA 1QG0A 2BJWA 2GEVA 2DHRA 3WXMA 1U2RA 4NCJA 4HZIA 4LJYA 4OK3A 2IWHA 1U94A 1KSFX 2GBLC 1QFJA 2ZRHA 4B74A 1N6RA 2RMKA 2ZPTX 3T15A 2R6AA 1YR9A 3WNBA 5EMNA 3A1TA 5A0FA 4OHZA 1BMFA 4W5JA 1E2GA 4Q1CA 1JB1A 1T0HB 2OXRA 4MGIR 2GRJA 3BFXA 2V4ZA 2Z43A 3EA5A 2OK7A 1LS1A 4Q01A 5HZKA 2FSIA 2WVJA 3ASZA 2OUKA 4WBSA 3NHAA 5EE9A 2YKGA 5CYPA 4RD2A 3KQNA 4Q4HB 5KSZA 1VCNA 1R0ZA 4BFWA 3RS2A 2O8FA 1VG1A 1TADA 1JA1A 3K0CA 1Y63A 3L0IB 4DCVA 5TV2A 1CKEA 2DETA 1QGZA 1UMKA 2FFHA 5BN5A 5DLQC 4B47A 4WXRA 2HMAA 1TPZA 5DYIA 3N2IA 2GF0A 4A82A 5H68A 2V6IA 4E5UA 3NKVA 5JSZB 2AFHE 1UBCA 4F7DA 3WYAA 4IEEA 2ZE5A 3L0PA 3MWJA 4XOIA 3GJ0A 1BO6A 1XEXA 2ATVA 2BGJA 3TUIC 1OH8A 3EWSA 4Q5IA 2IYQA 3KUDA 5P21A 5DIFA 2IYRA 4D4MA 3CC2B 3ADCA 4GOKA 4NP6A 5TDHA 5THXA 3U7FB 2ODEA 5IK2A 1XXHA 1XB2A 2WOJA 3TR5A 3B85A 4TQ9A 1DPFA 1S8FA 4LPSA 4ZO4A 1W36B 1E3MA 1QX4A 4LYAA 2BWJA 1OH5A 2VRWA 1JJVA 1YITB 5EXTA 3WRXC 3LXXA 5E7MA 2XEXA 1JQLB 4QL3A 1TVCA 3W5IA 5D3QA 5FOXA 4AD8A 1ETUA 3Q8XB 2VZLA 3L2OB 4JMPA 4TSFA 4N3NA 4UNPA 3KX2A 3FMPB 3R8FA 1NG1A 3CZQA 4HAXA 3RSOA 4DZZA 1ZNXA 1D1NA 2PIAA 3JQQA 2UVQA 4I81A 1XJQA 2EFDB 1W2GA 3JVUA 1ZCBA 4LHVA 2QT1A 1JB9A 5J4YA 4LJ6A 2ZSBA 4AWXA 4EDHA 3CRW1 2RH5A 2BVNA 4DB4A 4XTCS 3TNFA 1M7BA 4IW3B 5J4VA 3LBNA 5E3HA 1Q1BA 5C1BA 1ZP6A 2GF9A 5KNCA 2GWHA 1CF4A 1JPNA 4AY2A 3BB3A 2QU8A 3SZRA 2IA5A 2FF7A 2BMFA 3V4RA 4CEHA 1GTVA 3PQCA 2YINC 2XXAA 3GJ8A 4WIAA 3HU3A 2AX4A 1OFTA 4M21A 3QSYA 3B5JA 4GOXA 5J4HA 3RRNA 1VDZA 1ZU5A 2PT7A 4JLBA 4MYHA 2ORIA 3OFND 1AM4D 2FH5B 4P0TA 1PLKA 3VX4A 1Z6AA 3I5XA 3JZAA 3QPWA 2W6JA 2GCNA 3N70A 2JJ1A 5IHPA 5CIWA 1ELOA 4HB2A 4CZ2A 3KQLA 2O8BA 5JWRA 3EASA 2GPJA 1NIJA 1S2MA 1KK3A 1Y3AA 2V54A 3SYLA 3FJOA 2IF2A 2OG2A 4M8NE 4FINA 3DOEA 3QVVA 4DJTA 2GJSA 4NDZA 4PHHA 1JXOA 1NJFA 1W49A 3X2SA 2RGNC 4R9UC 1BQEA 1Z2AA 3U3OA 3GJ4A 1B2RA 3CPJB 4OQMA 2EYQA 1ZIPA 4PPFA 3AKDA 4JLMA 5KNDA 1W0KA 1F20A 4EJSA 3U6BA 4AKHA 1JI0A 3BB4A 3OE7D 3FB4A 1CJMA 1YJ5A 2FOLA 4PPGA 3WMFA 2H57A 3QENA 2ZUDA 3G82C 3P1JA 5CDFA 4A36A 4TMVA 3R7WA 1GSIA 3GLFB 4YC7A 2ZRIA 1Q7YD 2KWIA 2WSMA 5DI3A 3AVQA 3ICEA 4C0AC 2IHYA 5JECA 1IAQA 1XTKA 1OXVA 5L8VA 3CIOA 1QFYA 4ZI3A 2F1IA 2IUSA 5FOSA 3SNHA 2YWEA 3KB1A 4HEJA 4OK5A 1DELA 3KJIA 3SS8A 2QA5A 3PUZA 4DCSA 1GNPA 3ADKA 4LPKA 4M2LA 5FOTA 5LBIA 4C0QC 1A4RA 2BKUA 4NPHA 3ZBUA 4KITB 3RS5A 1DAGA 3AVPA 2QTLA 1AKYA 3K0CC 4D4JA 2ZR7A 1X86B 3K0AA 4MQBA 4P6VF 2NQ2C 3R8CA 1S0UA 3OIUA 5CLQA 4CEJB 1T5LA 2X1VA 4PO1A 4WZBE 2QPTA 1VHLA 5DI9A 1RYFA 3VR3A 1GITA 2AD5A 3C5HA 4KO8A 1EGAA 1II8A 2KB0A 1CULC 3K70C 3K53A 1MO5A 2P2LA 1U0JA 1E63A 1KK1A 1L8QA 1Z0KA 3B7GA 4QBFA 3SBDA 3C4JA 2BN4A 4OQLA 4MUBA 2WPDD 3B6EA 4Q4LA 2GJAA 2HYIC 1NBME 4F7WA 1E64A 2F43B 5KPJA 2NGRA 4RY2A 3WHLA 1FMJA 2JDIA 3NVAA 1P2UA 3GLHA 2NPFA 4JLAA 2NO6A 4GT1A 1EXMA 3SJZA 4GI7A 5FOWA 4CF7A 3SFZA 1KNXA 4U5XA 1QHHA 1T8UA 2CCKA 1JJ7A 4RZ3A 3RAPR 3TAHA 3OIVA 4MDEA 2FMXA 4D81A 1OXSC 3V4FA 2JASA 3AGQA 1JA0A 3PEUA 2ORVA 4G3XA 1J9ZA 2OBMA 2AL7A 5FTKA 1BX0A 2R9VA 3THWA 1OFHA 1H85A 4QHTA 3W2GA 4N0DA 4FXPA 2C2HA 2O8DA 1OSNA 1IBRA 3DVLA 2V1UA 4B3XA 2VBCA 4NE2A 3QFCA 3CBQA 1E2MA 5E7JA 2VYQA 1BMFD 4X8LA 2XJ4A 2BCGY 1KHTA 2J87A 1FPMA 1F2UB 1FNNA 1ZINA 4V02A 3TVTA 3TUZC 3MFYA 3THXA 3EPHA 2WJIA 1S96A 2FWRA 3A1UA 2FEMA 4PHGA 2REBA 3GLIA 2DFLA 3HJNA 1BS1A 1LF0A 1SM4A 1YE8A 2QORA 3BFVA 2IYYA 2YWGA 4RJLA 2ZQ5A 4DBLC 1NMXA 1BYIA 4QC2A 3SJCA 4TZ0A 3CR7A 3W90A 1DS6A 3C41J 3DM5A 1M8PA 1JEDA 4JL8A 4DLYA 1N6NA 2E9SA 3CCUB 1E94E 2W2VA 1N3BA 2P0EA 5CB6A 4BPRA 2CL6X 3G5UA 3I61A 5A5GA 1E0SA 3DKVA 3RC3A 1MABB 4HAZA 1RJ9B 3TSOA 4Z1MD 1FNMA 4UXIA 2AKYA 3AH8A 2QBYA 1DO2A 5HZHA 1R2QA 1G19A 1VQNB 1NVVR 4B33A 1VTKA 2ZREA 4MKIA 5CJ2A 1G291 2IYZA 2Z6VA 2JATA 4O25A 2HEIA 1DG3A 2JLSA 5GJCA 3BXZA 4MYTA 2G88A 3NBXX 4JLKA 4KSBA 1W2BB 5KYKA 2VNJA 2VP0A 2CXXA 2GZAA 3IQWA 4MGZR 4AG5A 1XMJA 2BMWA 1EK0A 1U9IA 2IYSA 1DAKA 4QGGA 3MUFA 1Q0UA 1SVOA 4FK8A 2DWQA 3FYHA 2ERYA 2GXUA 2HDNB 4Q4AB 3KJHA 1E2EA 1CP2A 1E2HA 2A5DA 2FA9A 2FZ4A 3AV0B 3GMTA 4EJSC 1VQ5B 4XWKA 4AI6A 1PJRA 3WBKA 3P4XA 3PCRB 4TSFD 5C4MA 1SXJC 1FNBA 4JYBA 5EZ6B 2XZOA 2ZI5A 2D3WA 3WP0A 1A2KC 4IOJA 4X8HA 3WMGA 4DVGA 3VX3A 1U90A 5FA6A 1G9XA 2EFHB 4LV6A 4RZXA 4M1TA 2GCOB 5FBWB 2IXGA 5KPDA 1KK0A 2C8VA 4JL5A 2GILA 4Y9UA 5EUQB 1E2PA 3QKSA 2CBZA 1L2TA 4B44A 1E2KA 3MGCA 2EU8A 3HR8A 4FI3C 4XSGA 3QFRA 3RABA 3WY9A 1D2NA 3Q3JB 4YQFA 2QTFA 1E1RD 2AKAB 3UG7A 1C1YA 1OLOA 3ZD7A 2ZR9A 1AS3A 4ZDJA 3PUVA 3FMFA 3W6NA 1OXUA 2QSYA 3W2HA 3MWLA 1LTQA 3CCSB 2F7SA 2XOKA 3FHOA 2L0XA 2EYUA 3QVUA 3R20A 1HT2E 2O8FB 2JJ1D 4R7ZA 4MGYR 2J45A 5BN3A 2GTPA 4BPBA 4F92B 1NN1A 4AC9A 2LCFA 3CKLA 4ILEA 5G3ZA 2WV9A 1JEEA 1R0YA 4UJ5A 3BGWA 1TAGA 4OKSA 2OCPA 2HLDD 2IL1A 1KI1A 4MA4A 4BQSA 3DPUA 1DDGA 1EFTA 4LBZA 3W5UA 5EP2A 1ZMXA 5LDDC 4NZYA 1XJ0A 1DAEA 1KY2A 1R8QA 1XEXB 1Z6TA 1W35A 1E1QA 2IYTA 5FUVA 4Q9JA 2ZYUX 3Q7PA 3W3AA 1R5NA 2MSDB 4QJ3A 2XNCA 2Y8EA 1QBKC 1XD2A 1W0KD 1H8EA 1NMYA 3PG5A 3AF0A 3IEVA 4FN5A 1N6IA 1SXJD 3MSXA 3UMRA 1RC8A 3ADBA 1UM8A 4M4SA 4ZDWA 4CEIA 4NCKA 3TMKA 1WE2A 4H9GA 1AQUA 1TF7A 2A7QA 2GVDC 3I4LA 3RHFA 2BV3A 4D6PA 1YQTA 2R62A 3E70C 1CR1A 4Q4JB 3V76A 2QAGC 3DHWC 3VR4A 4EIWA 4HDCA 1KGDA 1NN5A 4AIIA 1Z6YA 4LC1A 3THYA 2CDNA 2V6JA 4G5QA 4JSYA 4KVAA 3EZFA 621PA 2G6BA 1T3HA 3TR0A 1H8HA 3C8UA 3GP8A 4LHYA 1CJVC 4LJ4A 5G3YA 4LBVA 4RCZA 4ACAA 2AR7A 4Q1FA 3ZIAD 5F9HA 2IYUA 5E4FA 3IEUA 4K8OA 3W3ZB 1VQPB 3LX8A 4L9SA 1E2NA 1J99A 3LLMA 4OK6A 4JVMA 4YLGA 3H86A 2ZRNA 5FI0B 3H2YA 2VL7A 1Q1ZA 1XCPA 3CRMA 4C0SA 4YXWA 2EWWA 1QG4A 4TYWA 2REOA 4HZUB 3QXHA 4CEHB 2OK8A 1I4LD 4YHBA 2H7VA 5EP1A 1MO6A 5HCNA 2ZAOA 2ZI6A 2QTZA 2PL3A 1MO4A 3K1JA 3UIEA 5BW8A 5KO2A 2DYKA 2EFGA 3AKCA 4KU4A 1DAIA 5J47A 3BJIC 4MH0R 3KFXA 2ECKA 1IN6A 1Z6GA 3QXCA 4MRNA 2ZE7A 1QHXA 3WRYC 3I32A 5AUNB 5KOYA 2VHTA 3FPAA 1EFCA 4QBGB 2H5EA 2R6FA 3AM1A 4UKDA 4L4UA 1YZLA 4YMWA 2CNDA 2WWWA 2O8BB 3DOFA 1VMAA 1U9IC 4DCNA 1NRJB 2C9YA 1VQ6B 1HT1E 4RSGA 1MRNA 4DLSA 4A2PA 3WYGA 3UXMA 1SVWA 2J7PA 2KE5A 2VQSA 4HYYA 4DLZA 2GVZC 4BFTA 1HQCA 1I4TD 3WYFA 4JLJA 3LWNA 2J0SA 3RRMA 3BB1A 4KXFB 5KSPA 1CR4A 3D6TB 4Z8YA 4DQKA 4ITRC 1SKYB 4BASA 1D8TA 2YYZA 1AIPA 3NBYC 2ZANA 3RC8A 1UDXA 1YZTA 2GKSA 4EFLA 1G3UA 3PITA 3ZVLA 2QTVB 3HU1A 4EJSB 1NLYA 1SXJB 3MWKA 2DFNA 2GK6A 4IVQA 1FRQA 3AP3A 2C78A 4TYQA 3F5FA 1M6NA 4QBIA 1NBMA 3A4NA 5HR5A 5H5JA 2QM7A 1AN0A 2D62A 2VP4A 3NEYA 5EUMA 4RVCA 3U7GA 2YOFA 4IVRA 5HE9A 2YWFA 4ESVA 1YKSA 3OJWA 3K0FA 1S4QA 2OFOA 2O8CA 2YNMA 2FN4A 2VLIA 2F9MA 3EIHA 4LSGA 1KI6A 1L4UA 4H1UA 1KJYA 2ZRMA 3PJRA 2PZGA 1R0XA 3EZ6A 3K0SA 5AK0A 3QPUA 3ND9A 4U7DA 2DERA 3W34A 1VCIA 1AZSC 1XNJA 4URZR 4NHOA 2J0UA 4LK2A 3K0AB 3LVRE 1BJKA 2D74A 4M53A 1UEJA 4HLQB 3RRYA 3GLGE 3SQWA 1U98A 1EP1B 4E03A 2NMVA 5SZKB 4YDSA 4NCNA 4LJAA 4M1MA 2WIAA 5KNBA 3OESA 2IF0A 4KI0A 4OYHA 1CJTC 1F2TA 2Z4SA 3B9QA 3PVSA 3PENA 5K8TA 1QVAA 4DSOA 4JL6A 1II8B 1OPXA 4LBYA 3CONA 5SZJA 4TTPA 2QG6A 4I4LA 3BFKA 3KZ1E 2V55B 1UFQA 1Q3TA 3D31A 2O5VA 1R10A 1KD1D 4AYXA 1TMKA 3EARA 3M6AA 1NN3A 2A30A 2D7CA 1NKTA 4YAUA 2FPLA 4UJ3A 4B43A 5CLLA 521PA 3IQXA 1UAAA 4URWR 1NNEA 4JBXA 1NN0A 4M9SA 3EA0A 2J3EA 1E98A 3P26A 3BIFA 3B9PA 1LNZA 3WP1B 2RGEA 4LWZA 1QHHB 2KI5A 1K8RA 421PA 1U8YA 4HI0E 1ZCAA 1YZNA 3L0OA 3VTKA 2WWFA 1W46A 3AVXA 3KKOA 3B8HA 5IDVA 2C04A 4DSNA 1QUEA 1PUJA 2GQFA 4TQUS 5GJWC 2ERXA 1ZIOA 1TLLA 2J46A 3K9NA 4Z54A 3W8NA 3N2EA 3HYTA 5KDLA 1D9ZA 4JZKA 1UKVY 2J41A 4PAMA 2QAGB 1J70A 3TSZA 4RD6A 3FKSA 4LUCA 5KHOC 2ZI3A 4BWYA 1OHHA 1XTJA 3FFBA 3UMSA 4YMUA 2JCSA 5JHHB 1QFZA 4B6FA 1XTQA 4A0HA 3I1FA 4ZCIA 3V00A 3WHKA 4RKEA 4D0LB 4PFSA 2RGAA 1Q22A 2WKPA 4KLZA 4MUAA 5ANRB 2R6DA 3GD7A 4D4KA 2MSCB 3FVQA 3DM9B 1CBUA 2F1JA 2QEQA 2D7DA 1LFDB 1TTTA 3AVVA 2CCJA 2F1RA 2VF7A 1ZUIA 2QP9X 4DKXA 1E4VA 1G41A 1O3YA 1TEXA 4BLSA 3EIQA 1YZKA 3FFAA 3LX5A 4NCHA 3EPJA 3TQFA 2WWYA 1FOEB 4OHVA 2MSEB 1VQLB 4QHSA 3VKWA 4A0GA 3E2IA 5IF9A 2C77A 1KJWA 1GDDA 1G18A 2VSXA 4Q7JB 1GO2A 2QBYB 5JJLA 4FMBB 1F6BA 1Z5ZA 1PLJA 4LYHA 4EQ6A 1E6CA 3OEHD 3EXAA 2WMOB 2WSSA 3HU2A 2UZIR 3UKDA 2GZDA 1CRQA 4PQRA 5EP4A 4W7SA 4R2IA 1H8ED 1CR0A 4DLUA 2OAQ1 5JBQA 1FX0A 2MMGA 4XJXA 1GRNA 2GDJA 3L0SA 1AMOA 1GWNA 1E2JA 2RCNA 3CWQA 3LA6A 3LW8A 4JT2A 2C9OA 1XD8A 2BC9A 2RGCA 3T5GA 3KQHA 3CNLA 2XJ9A 3WBJA 2OCAA 4F91B 3Q5EA 4KYUA 1W87A 3CMAB 2IEYA 3QE0A 1KMHB 3CD6B 2I3BA 3AP1A 2PZFA 3QQ5A 1SVLA 4M9QA 3VQTA 3LFUA 5DISB 2DWOA 2H16A 3GJ3A 4DIDA 5C46F 2JLXA 3Q85A 4B3DA 4NH0A 2VA8A 1DBSA 4F93B 3MRSA 2E1RA 3LVBA 1H8HD 4DRZA 3H84A 1XX6A 3C14C 2BM0A 3AKEA 4NYMR 4RD0A 2C95A 2ZITA 5H70A 3F8TA 3W8RA 3W5VA 2CNWA 4TYYA 3VR5A 3LV8A 3KTAA 4AYTA 1GJRA 4C9BA 4YXWD 1UPTA 4CVNA 1YI2B 3QKSB 2BMEA 3RYTC 4EFMA 3U4QA 4I1VA 1R4AA 4TMKA 4WAUA 3AGPA 4Q9LA 1TX4B 1S3GA 1YZUA 1QRAA 5FFMA 3SR0A 4CW7A 4IDHA 1E96A 1SHKA 1GM5A 5L3QA 2GNOA 2WICA 4V0ME 1XPUA 4ZIRA 2IUTA 4F4CA 4YDHB 3EPLA 4QGFA 2VF8A 4B48A 1Q20A 1G3MA 3I8SA 4BGDA 4IOLA 1KC8D 3TKLA 3FTQA 2C99A 2ZVPX 3QKTA 4WOPA 2IXFA 5DYGA 4HATA 5FR2A 2VP9A 1XZQA
chains in the Genus database with same CATH superfamily
1U8UA 3U44A 3W6PA 5F1OA 1U8XX 1OLSB 4LDPA 3ZHCA 4NEQA 2A5YB 5HUJA 1Q7BA 5REQA 3HSSA 4ZEVA 1MGOA 4ZGNB 1WSBA 2HPHA 1VG0B 2PYZA 4XIYA 3HN2A 3EC1A 1GUFA 3B3FA 4RVUA 5I9LA 4LJ9A 2J07A 4Y2YA 3A2LA 3A9SA 1HE8B 2G8LA 1NONA 4U2GA 1EKXA 4OBEA 2QXYA 1RLIA 4RS3A 3RHSA 1FNDA 1GKYA 3JZDA 1Q14A 4ZRNA 3CUWA 2QLJA 4EA6A 5DH9A 1QHEA 5T8KC 1TEZA 1M0EA 1ZI9A 2TRSB 2VAWA 3L0BA 3V8VA 3AYZB 3UYLA 4NE7A 4K0RA 2CUZA 3MTAA 1L7VC 3RSSA 3TDNA 4D2IA 2D7JA 3QG1A 4J3JA 4CYMA 2LNDA 4A26A 1C4XA 1NBOA 4LYJA 4RCVA 1FLAA 3ELDA 5E6SB 4P1VA 3FWHA 1NP6A 3BN3A 4MKHA 1RI3A 2B0JA 3W8FA 3QJGA 3T3OA 1XYVA 3FIUA 3KXDA 2H4YA 4PQFA 4IDFA 2BP7B 2EKQA 5ETJA 4C3VA 1R00A 1L5RA 4DHEA 3QFHA 3H1GA 5E3IA 4EG6A 5HOQA 4TS9A 1E3QA 2J33A 3SYRA 2C4MA 5HOEA 1MC8A 3MN1A 4AJKA 2NUPA 5EJGA 3UHJA 2VNKA 1E0JA 2ZJBA 1UP7A 2OOKA 1P2DA 3JATA 2WP0A 3G2PA 4WI1A 2BIFA 4DQLA 3GUYA 2C59A 5EQTA 1WDMA 3DAYA 5LXTB 1HVXA 5LD2C 3AVTA 1O96A 3RKUA 4AROA 2Y1CA 4J1NA 4QXAA 3RC9A 5KDOA 5F1PA 2KS6A 2O1SA 1JL3A 4Q6BA 2J3LA 5K5EA 1OYVA 3DZIA 5ESWA 4PC7A 3L7MA 1WP9A 2QL6A 2XYQA 1PGQA 2HQ1A 3QRWA 3GLFE 1NJGA 5BQFA 1NV9A 3CXCB 3RV3A 4L28A 3V7UA 5BWCA 2W58A 1XRSB 3BH6A 3DTVA 3EOZA 1CJSA 3CPXA 3DGEC 1WQ3A 2BLNA 3GJ6A 1ADJA 1M2VA 3G2OA 5FL7A 1UL1X 5LOVB 2C03A 3MF4A 2QGFA 4X1IB 1Y4DE 2IYLD 2XITA 3GN2A 5KAMA 4C88A 2HBQA 5FUBA 1E7YA 4ZO7A 3M6XA 4FHEA 2F8MA 2A1TS 1RWOA 3GROA 3WLQA 1S72B 2GN0A 1ENOA 1Z82A 3KKKA 1RRVA 2XUAA 2YVUA 3ZDFA 4J4HA 4AJLA 4X71A 1SK8A 4L8VA 2CNNA 2OWEA 2ZRGA 4UTPA 5JCJA 5LN1A 3PGKA 4G09A 4S05A 4BQRA 1N8TA 1VP3A 4FSDA 5A7HA 4B2LA 3CC8A 1PGPA 4G86A 4GWGA 1Z8HA 2IITA 3V5NA 3C48A 4MCAA 4BEWA 1TI7A 2P5UA 4JB0A 3UUWA 2B92A 4OD0A 4M0CA 9ATCA 1IN7A 4UEOA 3K70D 1WXGA 1NRWA 3ITKA 3UMMA 3PNOA 5TARA 5A1TA 1TUGA 2OTCA 1IZ9A 4JVOA 4XASA 2G6TA 3N7AA 5SYNA 4E07A 4L57A 4G1MB 4E31A 1QRDA 1L7QA 2ZWOA 2DWCA 5CB8A 3R5XA 2QEXB 3DA8A 5DBFA 4DMRA 3S0JA 1P8AA 4ZVVA 5IT0A 5E7IA 4ZZIA 4LZJA 3UAGA 1C30B 2K2WA 3IAM1 1ZI6A 4CNBA 2RAUA 4FZ3A 4U02A 4EFDA 4V1CB 5ADUS 4G0UA 4PANA 4F9EA 1ZD4A 2N1BA 2VKQA 4B3GA 4GPD1 4J0EA 1I33A 4RD4A 1MU0A 3SHQA 4D9JA 5FBQB 1RNLA 4AYWA 4WOKA 3QWFA 3RB8A 4DGSA 3NM5A 4RIEA 1GPLA 1JIKA 2L42A 2FEOA 4R0NA 2EC5A 4RFLA 5H0IA 1X8LA 1F0NA 5T4FA 4HNGA 4TTQA 2NU6A 1KI2A 3OEWA 2XNJA 2CYCA 1Y3HA 2O0KA 4J8PA 4YAJA 1QM5A 4TGLA 2VQEB 4I0WB 2W98A 2WWIA 1VQ1A 4ZVOA 1X7WB 3X1KA 3FOFC 2BBTA 2HDOA 2WJZB 3EZ9A 2O8CB 1NBIA 2VJIA 1Y9ZA 4M7WA 5IAGA 3ANMA 3NETA 3LLSA 1QK4A 2NTYC 2QYHA 3A3YA 4OB8A 4UHDA 4L85A 2F48A 3QVMA 1AB6A 2R65A 1J8FA 4IHQA 5LQDA 2V58A 3LNTA 4BMVA 1OGIA 2Y0CA 3H65A 4FC7A 1YO6A 4V0LA 1P62B 1DOAA 3QUTA 4GOMD 5GZ1A 1UKZA 1AKQA 3T1YB 2ZJ3A 4CMCA 4F45A 4OV6B 2WKSA 1THGA 4FDMA 4NV1A 1JAXA 1P1FA 1U2QA 2CJWB 1RBYA 1WPXA 1VLLA 4AX8A 2XMBA 5JNWA 2Y71A 4QFBA 4UCQA 3FZQA 1M2WA 2OECA 4HYTA 5HVNA 1EX1A 3BTOA 3PDIB 3OLXA 3P94A 2E4UA 2UUBB 2FKAA 2QTRA 3SC2B 2WM2A 3INRA 5FA8A 1YR2A 4NL4H 3EJ6A 1GY8A 4JR2A 1L4EA 2ZTLA 1PX2A 1EGMB 4JU9A 3ENZA 2WTNA 2QR2A 2NUTB 2FRVA 2ODBA 2VJOA 2OLJA 3FTPA 3NALA 4GMXA 4WJKB 4YP7A 5CK4A 4ZOLF 1KFJB 2V7GA 2P90A 3F8SA 1NJSA 1BHO1 2HIHA 2HWUA 2WMNB 5B6JA 3ASYA 5T4HA 4YYEA 2J0EA 4OUDA 4UFNA 4UUMA 2CV2A 5EE5B 3NM6B 3U60B 4KPYA 3UA4A 1N2EA 4RACA 4CLEA 1XJ5A 2C29D 3L8MA 3MILA 1EX9A 3PXAA 4MO9A 5IN5A 5EJ4A 1GGMA 3TXAA 1FFSA 1QQ6A 1WUTA 5AHKA 1YE5A 2FSHA 3DDHA 5IK2D 1KYXA 1AD2A 5HE8A 4B6GA 3SICE 2OCBA 1N6KA 5LL6P 3RTCA 5EHIA 3K70B 1HMYA 1OKKA 1SULA 4ND6A 5DX8A 3NB0A 3LAWA 1QC5A 2WTBA 4GI1A 2WJ3A 4Q48A 4IF4A 4DUYB 4COOA 1QUFA 4DC0A 4DSUA 4EG3A 2BEWB 2X1LA 3T41A 1SU8A 1EVZA 2C2MA 3BMCB 2FW0A 3OT5A 2UXCB 1V0FA 1EGHA 3EAQA 3D1LA 1G0NA 1RABA 2FPUA 4E11A 1PHPA 6ABPA 3NONA 4QEZA 4YCDA 3U3MA 5JY1A 1P2BA 2WE8A 5AXCA 3SYKA 1KQFA 5HTOA 4NE9A 3QKRA 3CCVB 1M1NA 5H4HA 3H19A 3TMYA 3ZGNA 1XMSA 4D9CA 2VXYA 4DMMA 2C31A 2HU2A 2GZ2A 2NU9B 5KNCD 3GU3A 3OOEA 4YR9A 1I51A 1P2VA 5G1PA 4E2FA 2Y1WA 5M04A 2C61A 2JFOA 3PQ3A 2PT6A 1P8JA 3RU3A 9MHTA 1EQ2A 4MITA 3IULA 1JQDA 3C3KA 1XZCA 1WXFA 3FCCA 4MW7A 4BO6A 2PUJA 4RULA 2FSGA 2CV1A 1H5QA 4E5VA 3CJQA 1R9GA 1TC1A 1L4YA 5F2KA 1A3CA 3NEJA 2I0FA 2QTTA 2YR0A 4Q1BA 4BNUA 4WZAB 4C14A 3DFKA 1JNYA 4GRAA 1W7AA 4G0NA 2ZL6A 2JJ2D 3AEQB 2R7AA 2WR8A 3I0ZA 2ARKA 3TWOA 3WFZA 3O1LA 4ITUA 4PBTA 3ROMA 5B1EA 5LP1A 3MOGA 5AM0A 1VL8A 1JBKA 2IGBA 3VYRB 4CKZA 3RCBA 1HQYE 1L7BA 5AW5A 1P80A 1V1RA 2VDNB 3MTDA 1WOPA 1OFIA 2BFBA 3P5SA 4G5SA 3H97A 4R31A 4YRFA 2WFLB 4WK2B 4A9AA 1E3XA 2LCIA 5DGXA 5JC1A 1ATZA 4XZ3A 4CT4B 3G2LA 3VOBA 4W9MC 1U8ZA 1E4YA 2AN1A 1KY3A 3MCVA 3LQRA 3EHDA 5YASA 1YGYA 2R8BA 1CZUA 2CHVA 2PSFA 3D43A 2ETVA 4GVLA 3C3AA 2OXTA 2UZ1A 3TQSA 5JAUA 3KXLA 3VVCA 1K4YA 4GRDA 1L6RA 1W581 1GGNA 3A1WA 2AF4C 1ML4A 4U2KA 1D3AA 1JIUA 3C6YA 5SV2A 4IH9A 1ODCA 4P93A 1X8JA 5GZ3A 4KQFA 5L3VA 3D2CA 4Q7MB 3IUSA 4CMJA 3TQTA 1RJWA 2ZRDA 1AMUA 1ZW6A 5AJVB 4BTLA 3EXG1 4ISCA 4B8YA 3DV0A 1L7RA 4KR0A 3DKIA 1DZIA 1CUGA 3GC6A 1P4AA 5KTTA 3AEZA 3D7NA 3WAGA 3W04A 1LCIA 2PGLA 2CMKA 2WTAA 3K5WA 1Z4QA 4MS1A 4ESEA 2NYUA 2C94A 3S27A 1G8AA 1XXHB 1ECJA 4RVNA 1XWFA 3COWA 2C5HA 3D3QA 4I9GA 4GMGA 4LA4A 5I8PA 1PR1A 2XECA 3C6KA 2YASA 4AY3A 4WZEA 2QQEA 4R01A 2CHFA 5DBHX 5JWOA 1DBPA 4F6RB 5IU6A 5HF9A 2YC2C 4EUHA 2H85A 1UH5A 3CIFA 3DP9A 3X1ZA 1G6OA 1QKKA 1SZPA 4LOHA 3BZUA 3PJFA 3H87A 4U5QA 2NP6A 1YZ3A 2XSZA 2PT9A 2F3PA 4MWGA 2Q3FA 3E5MA 3P0JA 1GL9B 2I62A 1ULTA 4TTSA 1E9FA 2KBEA 1PI3A 1ZIXA 2IPXA 1JDBB 5C0OE 3AVOA 2BKVA 1P29A 2PTHA 3U4DA 3PLNA 4RVSA 2P1ZA 5JD3A 3A0UA 3ITEA 5CA1A 3KKPA 2AK2A 4ZIRB 2ZTUA 2BZ0A 3U5TA 4IVPA 3DE1X 3MT7A 4YREA 4ARZA 1ZYUA 4R2WA 3AI3A 4DIEA 4A0QA 1F8GA 4NZOA 4FM9A 2JH9A 1BNCA 1NR5A 3VC7A 4RLZA 1ZHFA 2D4AA 3T7KA 5E38A 5B2ZA 1VXOA 4EJ6A 3BC1A 3D5TA 5HGJA 3WSWA 2VJPA 2EIHA 3F7OA 3H9GA 1G3RA 1P5FA 2BSXA 1E0KA 4H4CA 1HEYA 4QUIA 3U19A 3CINA 1E2IA 1JLKA 3AW9A 3GK3A 4Y2RA 1JSRA 2Q0QA 3RUHA 4BKPA 1HTTA 3MHTA 3QUBA 5ERYA 4MJ7A 3W5BA 5J1TB 1CUYA 2VDWB 2E6UX 1W1WA 2VWPA 1GKIA 4HXEB 3S99A 4Q3BA 4U7GA 1DTWA 4PHTA 2AUMA 3DR5A 3UWKA 5FX2A 5DGCA 4B2IA 3DSRA 1JLSA 1M7GA 2A84A 2XNSA 3JRNA 1X6VA 4L4YA 3OVMA 4FEEA 4GYKA 2GAFA 1NA5A 1OTYA 1R9MA 4BV9A 2NP7A 3C3EA 1VQ4B 1G1AA 5C5IA 1BEUB 1G9SA 4HDRB 4PX5A 4DT1B 2EARA 2W7TA 5BWMA 4HSEA 2O14A 3DKPA 3JYNA 2RAVA 3QTBA 5DRTA 3II6X 5AVTA 5FULA 3CZPA 5E6UA 4RZQA 1RE1A 1VPLA 1W4CA 1JR3D 1WSWA 4M9UA 4IJWA 1J97A 3PXEA 4M88A 4YT5A 1OBVA 1XA4A 5E4YA 3Q3VA 4E32A 3NTOA 2ZSDA 1T6XA 3RANA 1DBWA 4P86A 3HRIA 1Q0ZA 4WZBA 1JR2A 2PMDA 1UDCA 2DC1A 3SR4A 2AFIE 2C2BA 4BZZA 2JG3A 5HW0A 5IZCC 4TMFA 3WGTA 3QITA 4O4JB 2ZL7A 1V47A 2QJWA 2C5LA 4G1VA 1GFIA 1SKYE 3QY0A 4HFJA 2GXQA 4YAFA 4UCWA 1QSGA 2P9EA 1GZUA 1TQ6A 4WCDA 3RSHA 5CCBA 1GQYA 1TTHA 2O2XA 2O54A 1R6DA 4L5IA 4PHFA 3EIUA 3E1YE 4OAPA 4EG1A 2E82A 4MV6A 4EG0A 3JRXA 1R4ZA 1XHLA 1C4KA 3RFUA 1I24A 2V3VA 4OFXA 1YL7A 4BN5A 3D4OA 3H5AA 3N3AC 1SUSA 4R4JA 4CN9A 3NHUA 1QV6A 3QM1A 5DI3B 3ND8A 1Y7LA 4HDSB 4C08A 3LRXA 3FUXA 2F3QA 2O6HA 1G6HA 2W4IA 2Z9DA 4RANA 5DNEA 5K0ZA 2OHJA 4JOQA 1HE4A 1KKLA 3CLUC 3HBJA 4CCYA 2RGXA 2DRIA 3J81A 1CT9A 4UCXA 1YZYA 3SD7A 3C98A 1RKVA 1M1ZA 4E3WA 1ZJWA 3IOMA 3B1YA 1YCDA 3THOA 1HFEL 2WMYA 1H9CA 4NTZA 1OV4A 3G3EA 3LT5A 3N6RA 2JLVA 1JQBA 1XF9A 1RQ7A 3FVVA 4O1MA 1CNEA 4Q66C 3VI4B 3ZJ4A 1JHRA 2VVTA 1HYHA 4D4LA 5TR9A 1XFOA 1P9WA 2HA0A 4HIZA 2X8AA 2IY8A 2ZI4A 3OZRA 4BO3A 4CIWA 1BU8A 4S1VA 1H0SA 2AHOA 1G2IA 1GSAA 4EB6B 3ED5A 1JHVA 3TW8A 4E3ZA 1CS0A 1ODSA 2HREA 1GSOA 1WUHS 2PHZA 3C5VA 1YULA 2E4YA 3PEVA 5J2UB 4YRMA 2V7QD 4PXSA 1CG6A 1PWEA 5L46A 2H6EA 5AT1A 3UJNA 2CVHA 3NEPX 4FIZA 5ITSA 1UPAA 3IVCA 2XZPA 4PRYA 2EJUA 4CEJB 4C1NA 4A8JB 1YRQA 2ZULA 3GZTB 1E1CB 3PFNA 1Q1EA 3BGDA 4QQNA 3FOCA 1E32A 3P2EA 1GL3A 3VISA 5FWXA 1HR0B 4EHKA 1TAHA 3RSQA 3EQ6A 2W8BB 4DJEC 4DIOA 2IDJA 1QHSA 1YQUA 3IV9A 3VPAA 2EKPA 4OHWA 4KKVA 3FAKA 4F86A 3EZ2A 3LXRA 3DFZA 5KYGA 1YR6A 1NVEA 2MU1A 2KBFA 1SCQA 3CPHA 5IM4F 4L4SA 1ISFA 1FUKA 1Z68A 3AB3A 4ZYLA 1QS0A 1C41A 4YJKA 2B1QA 1P7VA 4LSMA 5DFAA 3O3NB 1HV8A 4OQ4A 1SJ9A 5JCOA 4Z7OB 4MGKR 3ZCSA 3F6YA 5KVVA 1JXQA 1ZOOA 4N8EA 1OX4A 4IDQA 4LFCB 1FUYB 1P5JA 2CBGA 2QSZA 1KBZA 3ESCA 3KTDA 2F9LA 2VUHB 5AKZA 1TYEB 2V1XA 4RH0A 2I1LA 4EUKA 3K6JA 3KL2A 1H6AA 1E1KA 3U4HA 4FYKA 5BQOA 3CPWB 1PBNA 1AN9A 2ZI9A 1VJSA 2CUKA 2B4QA 3VNVA 2GHTA 2E3JA 4F3CA 1H69A 4WOJA 2X53S 2AX3A 3GJXC 2AB0A 3GLIB 4HH3C 1O0SA 3HUDA 4M0MA 1T2NA 4CMGA 3PKIA 2FV8A 2HHLA 3NC0C 1R0LA 4ILKA 4MWDA 221PA 3NXKA 4HLCA 1HX7A 4I1SA 5EE1A 1P77A 5MN5A 1R4NA 4O2AF 3UK2A 5JRJA 3LP6A 1WD7A 4B46A 1DAHA 2FVYA 1VHTA 5BRJA 2PSJA 3BWXA 2B37A 2X0KA 1K2VN 2FPGA 3HADA 4GR4A 4QYIB 2G9NA 4D3XA 4RKRA 3TE6A 1RW4A 1PFKA 3OZVA 3K0EA 4CIXA 2XVAA 1YR8A 3ABQB 3AX6A 2IYNA 2YV1A 3JVIA 3RODA 4AK9A 1NG9A 4G9EA 3ESQA 3KEQA 1M67A 1KPHA 3OZTA 4JLPA 1ULHA 1WD5A 1WXIA 1E9AA 3DBVO 1E99A 5DLPA 3MS2A 4ZP1A 1F6WA 3PC4A 4W1QA 3ZH2A 1KQOA 4DR7B 1Z83A 4F9FA 3W6UA 2HO5A 1KSHA 3L7LA 4P31A 5AJXA 1RKXA 2IYEA 2XTNA 3C3JA 1MT3A 1GU7A 2BAGA 2O2JA 1X3SA 4P35A 2P9FA 4QEDA 4P0QB 2F59A 5ICEA 5M7EA 2VDOB 1VOTA 3NORA 4IFTA 1IK4A 1NF9A 4C4RA 1M8GA 1JEYA 2H07A 2B94A 4R5HA 3ND7A 3X1WA 3WKDA 3CVOA 1T3TA 1QPBA 2FEWB 3FGNA 4N1AA 3RIXA 2P41A 4JITA 2EBWA 3THRA 2DUMA 3EEBA 2F3SA 3EVTA 3ZZTA 4LHWA 3KG2A 5TJ9A 2G77B 1V5EA 3TLZA 4NPCA 4UM9D 4QHYA 1XDUA 3EXEA 5AM3A 1R6BX 3QPCA 5JISA 3L8GA 2R00C 2C98A 3AJ9A 4YIKA 2VJNA 2PSEA 3I5AA 3RWOA 5KYYA 1YHZA 3NUZA 3OO0A 1VJTA 5EUBA 5CM2Z 4PM4A 5KOJB 2XKKA 1F48A 5AP9A 2A5LA 1AF7A 3QEJA 4DNPA 4DR3B 4KZKA 2I34A 2H2WA 1HH4A 2RI6A 5HF8A 3EXIB 4WHMA 3UGJA 1Z0UA 4EPRA 2PZEA 4NSNA 3OQBA 1NB9A 2BF7A 4NONA 2AW5A 1RI2A 2G40A 2WF6A 3KALA 4J6EA 1ZDMA 4LVUA 1HDCA 2VWHA 4Z1MA 2OHFA 5T4BA 3UT5A 4C7OA 3QPBA 1RDFA 4JK3A 2ZBVA 4FJ0A 4J2HA 3BJEA 4JEIA 3VR2D 3WDKA 1W8DA 3HC7A 4CM6A 1Q84A 4FNMA 4FW9A 1C4OA 2OXCA 3BDVA 5C4GB 4MB6A 3DAPA 2NVOA 3HDHA 1IN5A 3OZBA 4MWEA 4NJEB 4NMLA 4CLRB 3A4VA 4OPVA 2W93A 1IYZA 1JBQA 1ENZA 2XQJA 1I6MA 3OQHA 4N0EA 3GZNA 4NCXA 1SKQA 1G9TA 1TLTA 3FR7A 4O4HA 4I08A 4NF2A 1USVA 1JTFA 4B87A 1ZFNA 3EISA 3DONA 2VHXA 2EG5A 3KOMA 2PD3A 3PWTA 1J07A 4AZ3A 3PQ8A 5B5SA 3FUWA 3ZGZA 3RARA 1B8PA 1P0MA 2NPIA 1EUYA 1DRUA 2JZNA 2BTEA 1Z4MA 2MWMA 2N46A 1N2JA 3I01M 3Q8WA 1Q86D 4PC3A 3ZDDA 4KN8A 4A6EA 4CV0A 2GRAA 4C43A 2F17A 5AW7A 3K92A 4I36A 1KYIA 4QDTA 1XMVA 1NXOA 2ZWVA 2XUOA 4EPVA 2WHRA 5KAPA 2OL4A 5EJ5A 4QTTB 7GPBA 2J08A 5ALEA 2C4TA 1IB0A 2XGSA 4C6HA 5CEEA 3K8QA 1EIWA 2P11A 1QAQA 3IQZA 5D8DA 3AUJB 3LY7A 4X6LA 2ILVA 3IJ5A 2LZ0A 2V03A 1NVTA 4LYGA 3D3EA 5DGIA 4F2WA 2ICAA 2PL1A 6NULA 4QREA 5BP7A 2LIVA 1E59A 2PJDA 3LQKA 1KMIY 3A4LA 1XDBA 4RNCA 1NX6A 2DM6A 1GQ2A 1SQ6A 1BN7A 1Q77A 2QRNA 1FVXA 2RDMA 2LWIA 5KW9A 1D0SA 5DX1A 1C9DB 1O95C 4CM1A 5JI3E 5BRAA 4CMKA 2GFQA 1E1RA 4PS0A 2OESA 4PZLA 4FFLA 4F3KA 1LSSA 3CSUA 4X62B 2EGGA 4UM9B 1NWCA 4FYHA 4U0JA 4OL0A 4QYMA 1U7ZA 3T7EA 4R6WA 4BB0A 5BVGB 2R84A 3NJRA 4QKQA 1QP0A 1XZJA 1ZLXA 2B0CA 5LB4A 3Q6NA 3Q9LA 2Z3ZA 5GOZA 1F9EA 3CUKA 3DZCA 3EVDA 3QLVC 3SN6A 4E33A 4LKRA 3STHA 4IJQA 3I9NA 1NMEA 4M49A 3PNQA 4FCVA 4CLXA 2VNIA 2CWWA 2HLDA 1N1MA 3EMDA 3MG9A 1EUQA 1R8JA 1T0PA 2B5OA 2I3DA 2ISQA 2Q2QA 3OICA 3PIDA 5KQRA 3KQKA 2BBOA 1QH1B 4F6LA 5JZ9A 4M76B 1CK4A 3Q8KA 2J0VA 2QD2A 3C4VA 2YL2A 4G2TA 3GA7A 3QXGA 1EU1A 3SYNA 4MIKA 1IATA 2CKDA 3ILVA 3WQSB 5IG2A 4IFBA 4A0SA 4TN1A 1MX9A 1TQDA 2ZK7A 3NC1C 1AQ6A 1CPYA 5DM1A 5DYNA 1OYWA 4CV3A 3LW7A 3RY8A 1W4AA 3AFNA 4II7A 5M5BA 1Y6GA 3MJSA 5BNIA 1NUHA 5ER6A 1OH6A 5TMEA 1YZQA 2Q7DA 5ADHA 2BDTA 2UZ3A 2EZTA 4IXWA 3Q3CA 3BOSA 1GUDA 4JLVA 1VLMA 2BI8A 4C05A 2IZ7A 1R0CA 2Z8ZA 1MPTA 3GB9A 2C54A 4NEGA 5JH7B 1ESMA 2BGWA 2ACEA 1RXVA 1S3FA 1GUBA 1S8OA 2P2YA 2O23A 3S8EA 4I4IA 3D1VA 1W6UA 1KK2A 1UBEA 3ABRB 1YRLA 2DYIA 1ZUWA 4RHFA 3S2IA 4C89A 1E5VA 5EZYB 3SEFA 2CFCA 1YDEA 1CTQA 1EFPB 1CHNA 2ZATA 2YIVX 3ZIAA 3X1YA 2FPPA 2Z2YA 1EZ4A 1JRLA 2ANBA 2Q5FA 2UYOA 5G0VA 5JXJA 2GN4A 2NIPA 2ZTSA 3C3DA 4UOQA 3EFOA 3GLGA 5DN6A 1SUIA 4GZMA 2DCUA 2XVXA 3LM8A 4UDOA 1AKTA 5AVJA 4CM8A 2ZIXA 4OLHA 2CB0A 5BNZA 1T6ZA 2E48A 2RC5A 2PUVA 3Q5GA 4JLUA 1JYSA 4NQRA 3W6ZA 2IQ5A 4EF4A 2E4ZA 1MEJA 3TLGA 1O97D 1JYEA 3DDUA 4TKUB 4X54A 2YHAA 5AJWA 4BP1A 4DMUB 5D2CA 3TBKA 2DR3A 2AUTA 4EUSA 2JLWA 5AVRA 3B1VA 1PWXA 3QKUA 1W4BA 2EFCB 1GV1A 3D0RA 4WCVA 1WU7A 4D74A 3H6GA 4XQGA 3SSNA 4C76A 4NATA 1WVGA 3NM4A 1Y7IA 2QT0A 3H1TA 2Z2KA 3ZNQA 1SBTA 5CU7A 4IYRA 1DQPA 5I9SA 4RFSA 3SHFA 5LNK1 1TW2A 2B4TO 5JQGB 5EHXA 4G8BA 2HF8A 1FLNA 4KHZA 3P2IA 2YXPX 5HJ7A 1MKYA 5KNCH 4UBMA 2X0EA 4FMCF 1FMFA 1RKUA 3OTIA 4R2XA 5FL3A 3GEHA 4L2IB 3TIVA 4HDQB 2OXEA 2Z1NA 4KGDA 4UUOA 3UV7A 4DIUA 3E3OA 1S2IA 4URYR 4OM7A 5BMVA 4HZGA 2BISA 4PRKA 2NUAB 2JGFA 2JAHA 3C5EA 3KPWA 4HNQA 5BORA 1ESZA 3E3AA 4Z4ZA 3LQQA 3RRJA 2ZJZA 4XQ0A 4TLCA 1NL3A 1GZ6A 5JVDF 4H7HA 5BWOA 2HJ9A 3ILYA 3UA3A 1QVGB 2Q4DA 2R47A 3ER8A 1IEXA 1MP0A 3O2QB 5FPYA 5JLAA 1PL6A 2BM1A 3E5HA 2LR0A 1XE1A 4MTCA 2GPTA 2P3SA 4QNMA 5D5QA 4TKMA 3ZGVA 4RDLA 1NFQA 2X2EA 2YZMA 1P4SA 2ADMA 3FHLA 1EXNA 1H1TA 3R0ZA 2VP2A 4KMMA 1UADA 2YZKA 2NTEA 3NT2A 2YV4A 2UVDA 2IY9A 3B9BA 5ELXA 1X7YA 4J0KA 4XGNA 4C20A 2V0GA 2HRRA 2I2WA 5EKTA 3OCVA 4E15A 4GQBA 2Q9AA 1OREA 3R41A 5AKJA 3MJCA 2W0MA 3IE0A 1FUUA 7REQB 5FD8A 1EB8A 3QI2A 5CTJA 1OPRA 4NMWA 3FOZA 1AKEA 4PX3A 1KDOA 1DFIA 2I4LA 5DKFA 3LG2A 3RVRA 3EVNA 2WTMA 3M2TA 3BH7A 1ZM4A 2DX7A 4QARA 4HGNA 1DBVO 4GL4A 3AHDA 3IP7A 4ND8B 1LWNA 4XJVA 1FDTA 1MF7A 1T9BA 2OQVA 5DXAA 3WGGA 1M1KD 1ODLA 1U2PA 3EUEA 2Q5EA 721PA 4Z4QA 4JI4B 2AQHA 3IVXA 2TMDA 5JO9A 1C7FA 2X19A 4Z9AA 4B7AA 3A6HA 4PW0A 4YUZA 3B1KA 5DGTA 4DV1B 3SQDA 5BWNA 4Q4HA 1XPJA 3KE9A 2XDAA 4LDJA 4XX0A 1SVKA 2SCUB 4Q34A 3P9CA 2GBGA 1VI2A 1ZK4A 3IALA 3FWYA 5B53A 4EPXA 3HFJA 4Y1RB 3JALA 1BXGB 3HGMA 4RMGA 3UCEA 4BRWA 2VQFB 4YQZA 4BZQA 2QS9A 1UZLA 2IW3A 3M6LA 3ZWKA 4DLKA 1YFLA 3M82A 2D9RA 4FU0A 3KUXA 3P71T 4N39A 4X9XA 5FB3A 4ZYXA 2AXEA 5KCZA 1NXQA 1YR7A 2AHRA 1PDVA 2H5IA 1RP1A 1VHOA 2JB9A 5JZVA 5JXIA 3GPLA 2Z98A 3U56A 4G37A 4BAGA 2RHWA 1W2WB 4ZTBA 1BKDR 3KZKA 4FDAA 3IOCA 3EN0A 3GQVA 4IJKA 3X1DA 2WF7A 1U81A 3DVQX 1ZN7A 2DP4E 4C3ZA 3OTGA 3ZH9B 2QMZA 2ZJOA 3TR6A 2GJ9A 2WM8A 5DNYB 4ZOBA 4GBED 2B1IA 3CNBA 3QMPA 1EFHA 5A4JA 1GDHA 2FUG6 2FZWA 2ZAGA 3C3XA 3QLUC 2MINB 5CTAA 3CLSC 2GEDA 3WQHA 2MCFA 4L6IA 2P6RA 2IYXA 4J0HA 5I9NA 2HKIA 4IAOA 3H9CA 3GN1A 1RHUA 1N3LA 4BXOB 3EIEA 2VWQA 3DO8A 2Z8YA 3L8YA 4CM9A 4M1SA 3C6ZA 3H8VA 2WIKA 3HJRA 3H04A 3RPEA 4EEKA 4TYNA 1P60A 4D9HA 1ZL2A 2D5LA 5BSXA 2NTNA 2WWGA 4G9GA 4WXPA 3O93A 4LY9A 1H65A 2ZE6A 3VPDA 4KFSA 4BO9A 2R6CA 4WCFA 1A8HA 3UJ3X 5FPSA 4Y2QA 2H3HA 1TVMA 4CMIB 1B1AA 4RPGA 4TT8A 4K0KB 4CQLB 1C7JA 1E2BA 4IDBA 3KL9A 1U8EA 3N2KA 1LNQA 1PKEA 3ROQA 3EEFA 3KWFA 1FSSA 3VUFA 3NJ8A 3MCAA 1QB7A 3I1JA 2DUUA 2Q2OA 3FN4A 5IN4A 5K6AA 2Z30A 1BWPA 3Q6MA 3NT5A 2ZBDA 3DAFA 1N6HA 3QBEA 1WDWB 3C0KA 3O38A 2H4XA 4KKSA 2IHTA 5FWNA 5L45A 3T61A 3CN9A 3G2HA 4MVJP 1N5OX 1BFDA 3STTA 3VBCA 4QO7A 3NHBA 5COQA 4MVJG 1XU7A 3AUUA 5AK6A 2HCRA 2BKEA 3WK6A 2IXDA 1RI5A 3O6VA 4GBGA 3AHIA 3Q3IA 4WK0B 1YFZA 2HA5A 4OHXA 4LXIA 2WWHA 3HCBA 4MQEB 1W29A 3R6GA 1CUCA 5AWFC 5EPUA 3KTAB 4RXUA 3B13B 2P2DA 2ZBEA 5BW6B 5AKEA 1ECLA 3BIJA 1UMCA 3AILA 4PPQA 1YZGA 3D6NB 4Q9HA 1XHEA 1W48A 3OEHA 3UPDA 3VPCA 1JIQA 3EF0A 1U8TA 1QG6A 4J43A 4QWWA 3JRWA 3P20A 3O7MA 2RE8A 5DHFA 3EYWA 4YP6A 1TKAA 2B25A 1SUEA 4URHA 3RC2A 5FL7D 1S6YA 2Q2VA 3ZV3A 1CZRA 1JHOA 1QRTA 3D64A 1T0IA 3MERA 4RVDA 3K09C 2X2OA 3BSWA 1FFYA 4UMFA 2VQ6A 4OPOA 1A9OA 5KREA 2VYFA 4YUXA 4IXTA 2WTUA 3EBPA 3W5JA 2AR9A 3OZAA 3UXYA 4Z4EA 2PYIA 2XE6A 4LRXA 4AWBA 3VAZA 3KXIA 3MXTA 5DGHA 2Z04A 3ANXA 2X86A 5DTIA 4EVIA 1CUUA 4PR3A 3SBOA 3O4IA 2PUWA 2QZ4A 2VYVA 5EERA 1CUXA 1U9CA 2EZ9A 3U44B 1MVLA 1U8AA 3SS7X 4I1UA 4HUQB 2PUCA 1NF3A 1SHLA 1GG9A 2COUA 1A2OA 1PNOA 4TRMA 4YJ3B 2R8OA 3TTTA 4DIMA 4EYSA 2XCTB 1C0KA 1RIIA 3AL0C 3A9UA 3M6MD 4WN9A 1QGUA 4LNUA 1FK8A 3SJAA 2VT3A 5ALPA 2IHZA 4BCDA 1EX7A 1LLQA 4RA6A 5BQ3A 2BGLA 3U17A 1T6BY 4I8IA 5DCWA 1Z28A 4D79A 2XAAA 4X7FA 1GYQA 4RESA 3IKVA 5FYDA 4B81A 1KFKB 1TU4A 1YRAA 2E7ZA 3INNA 3U6KA 5HZAA 3F7NA 3CCRB 1PUIA 1YOVA 2UZ0A 2BDEA 1MAVA 4OLBA 1M7HA 3AZOA 1Y42X 1Z4NA 1ZNYA 2ZKIA 3USCS 4U9UA 4MV5A 3CNHA 1T8PA 5F98A 2X77A 3ZWNA 3MD0A 2RBEA 4FMDB 4IJ6A 3QF7A 5LJIA 1WOYA 5HRUA 1XEWY 2IHVA 4GUAA 3UYKA 3ZQ6A 3WNDA 3NOOA 2X5JO 4J29A 4PAOA 3PYXA 3T1TA 3EBOA 2FSSA 1QFXA 1RXSA 4Q05A