4RD0A

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gdp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVAHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd0A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd0A01
2C95A 2GCOA 4CF7A 1G20E 2VYFA 2CCGA 2FFBA 1ZM3A 1ZNZA 2MSCB 4TYQA 1MKYA 3QKRA 4PZLA 3W6OA 1YKSA 5E7IA 5L3SA 3O8CA 2DETA 1D2MA 3O8RA 5CITA 3RRZA 3QPUA 2BGJA 4HDOB 1JB1A 1PZNA 1G8YA 2W6JA 2PIAA 2ZJAA 1XEFA 2DY1A 1FX0A 1US8A 4KXFB 3CKLA 4XVRA 2FFQA 4FMDF 4QXAA 5DN6D 2NG1A 2ORVA 1TADA 3V4FA 2AXPA 1N6IA 1S72B 5DI9A 1T8TA 1Q86D 1EP2B 4KU4A 4TQUS 4NYMR 4FCTA 2ANBA 2ORIA 3C4JA 1QHNA 1L4YA 1TNDA 1WCV1 1N5JA 1GTVA 3H1TA 3L8ZA 1EWRA 1BX0A 1GRNA 1R2QA 1VKJA 3ADDA 1F3OA 2C8VA 4N0DA 3GJ5A 2G77B 2GETA 3RAPR 4ZI3A 4UXIA 1XCPA 3LD9A 3RRYA 4GRAA 4RZXA 1P2VA 1W4BA 521PA 1M2OB 1ZINA 2GRJA 3QFSA 4NU0A 1NVVR 5C46F 1HYQA 1S8FA 4QHYA 1F60A 5TXGA 4I1UA 2AKYA 2ZI9A 1Z0IA 1W4CA 1DDIA 4C0JA 2XNJA 3AM1A 1E2EA 1G64A 5AWFC 2C78A 3A1VA 1JB9A 2VNHA 2ZE5A 3CH5A 2YWGA 2OLJA 2QL6A 1QG0A 3BS4A 3BB3A 4Q7MB 3LBNA 5GJCA 5IK2D 2R6GA 1G16A 1VQKB 2D74A 1E2LA 1W49A 3MLEA 4RFSB 4XH9B 4M1YA 2N1BA 1S9HA 1VCMA 1IHUA 3B85A 2NMVA 3CRVA 2OG2A 1XTJA 5HCNA 3BWDD 2JLVA 4Y9RA 1RVDA 4XSGA 5CM8B 4YHBA 3IKJA 4RD3A 2A5DA 2DWQA 4WBSA 4OK6A 3LQQA 4I4LA 4DCVA 2NO7A 2RGNA 3IILA 5C4GB 3OHMA 1PVOA 4CEJA 4UKDA 1NVUQ 1P9WA 4LJ9A 2ZE6A 3HU3A 4KLNA 2QE7A 3QFCA 4EPTA 4XWAA 1VIYA 2WM9B 4OQXA 4ZPXA 3LAWA 5EE0A 4NONA 1G6HA 2Q3MA 3O8BA 4HDCA 4D82A 4KSCA 4IJMA 2DFKB 5EE3A 2VHCA 3TVTA 3PUWA 4TSFA 1LNZA 3Q7PA 1R0YA 4FD2A 3EA0A 4KO8A 2WOJA 4PHTA 3UWKA 1JA0A 1W1WA 3SZRA 1AZSC 1GWNA 3C16C 3GLHA 4YONB 4P32A 5BW8A 4JT4A 2C04A 3RS4A 3K0FB 1JA1A 1NMYA 1VDZA 4V02A 4V0ME 1W0JD 1NBME 1Z6GA 1GITA 1RYHA 2PMKA 2OEPA 4XJXA 1FQKA 4O3MA 4PC2A 5FR2A 4ZDJA 4TMXA 3PIRA 3HPQA 1RKBA 1RW4A 3LW7A 1XCMA 1RYFA 4YMWA 1DAEA 2AFIE 5IHPA 4AKHA 3BB1A 3UANA 4BFUA 2QTVB 3W9YA 1CR4A 2ZRBA 3QOFA 2QDXA 1TF5A 4JBYA 4D26A 1N8RD 1IN8A 5J5CA 1VCIA 3CX8A 4JSYA 4TL9A 4URVR 5LD2C 2GXQA 1FRQA 4M0LA 3I61A 2PT5A 3CCEB 3NEJA 2AK2A 1DAFA 3BBPA 2QPOA 3QJYA 1VECA 3G5UA 1KY2A 3EC2A 4Q9LA 3WYGA 2JLWA 4CT4B 4PAOA 4AKIA 4G3XA 4DSOA 2EYUA 5BN5A 1AQYA 2XB2A 5KSPA 1M34E 4IW3B 1NSTA 3MWKA 3K9GA 5KSOA 3GLGB 4Q4JA 1XEXA 2QA5A 2FA9A 2W6ID 4B3FX 2XZPA 3SFZA 5K8UA 2JJ8A 3PCRB 4PC7A 1Z0JA 5E7JA 1UEIA 1Z83A 3QXXA 2P6UA 4V0KA 3R9IA 1ZIPA 4Q1DA 3SJAA 3FMFA 3AP3A 4Q9KA 3I3SR 3L0PA 3CX7A 1F20A 2ZU0C 4LYJA 1EGAA 3NC1C 4C7OB 4EQ6A 2IHYA 1FNDA 4KYIB 3ZDQA 4B48A 1CJTC 3DO6A 2AFHE 3QF7A 4Q4HB 4IEEA 3U2QA 4Q4JB 1SKQA 4LHWA 4M1WA 2E9SA 4LJYA 4RFVA 2WSMA 2IYRA 5HCIA 1T5IA 4U5XA 5IK2A 2LCFA 1ESNA 2YWFA 2YYZA 3V76A 5JWOA 3T1TA 3QKSB 4FI3C 1KY3A 3CRQA 5GV7A 2O8BA 3KKNA 3A4NA 1G3MA 3QSYA 5JEDA 1G7SA 2IYXA 3IO5A 4JVSB 4Q01A 5JECA 1KJZA 4JMPA 1U98A 2CHVA 5EP3A 3OEHD 3LO5A 3QVVA 1XD9A 2JLSA 1CJUC 4Q00A 2G0NA 3BXZA 3TUZC 3OE7D 5CLLA 2Z5FA 2QE7D 4JL6A 5FOWA 3A4LA 4BASA 5CDFE 2GESA 1G8HA 2WJJA 4BLRA 1N6KA 4D4LA 3R8FA 3B1WA 1NN1A 1II8A 3KB1A 4KJZA 2D2FA 1MO6A 3AGQA 3DZ8A 4QHTA 4A15A 4WZBE 3SU8A 4B2LA 1SXJB 3FJOA 3K70D 5FPSA 1CBUA 4LBWA 4A8JB 3GLHE 2IWRA 2QZ4A 3WBKA 4L15A 4KVAA 2QMEA 3THOA 4F93B 2ZSEA 1IJEA 1KI6B 1SHZA 2NO9A 5AUPB 1SKYB 1AZTA 4L9WA 2P3SA 4PX9A 1NVWQ 5LB2A 4F4IA 3OAAD 1CRQA 3JZAA 4RZUA 4PQRA 1RRCA 2FPKA 3I56B 4M1SA 1NN3A 1GNQA 2NPIA 1H8ED 4TL6A 4BQSA 4K81B 1YR7A 4DLZA 5DN6A 2F43B 3WMFA 4HI0E 4NCKA 4DQKA 1P9RA 1DELA 5FTKA 4MDEA 3X2SA 2W2VA 1OH7A 1PJRA 4NTZA 2QT0A 2BVNA 2C9CA 5L3QA 4BE7B 4A8JA 1OXTA 2ZVPX 2GHIA 1GL6A 1ONBA 4G1UC 1MH1A 5EQTA 2Q9CA 3ZQ6A 5DISB 5BN4A 1G4UR 1SGWA 2BEKA 4YC7A 1AS3A 4AK9A 2IS6A 1BOFA 1SHKA 3FGNA 1YRAA 3T5DA 4QFMA 1ZCAA 3TR0A 4URWR 1YIJB 3BFKA 3P20A 1KD1D 3S1AB 4TL7A 1ZNWA 2W58A 2V4ZA 4LUCA 4OYHA 4Q02A 1DEKA 1G4AE 2EFEB 4XTCS 2BBOA 4LX0A 3ZBUA 4HAVA 1HUQA 1YZLA 4A6PA 4RVCA 4ASUA 3TVDA 3ZH9B 3MRSA 4Q21A 1M90D 2GZDA 5FBQB 1S0UA 1Z47A 1I4TD 1H8HA 2QEXB 4US1R 4NYJQ 2Q3HA 3CPEA 4EUNA 3ZZTA 2VP9A 5E4FA 3TIFA 2VHJA 5C18A 2YWEA 2VEDA 4JBXA 4IDNA 1QDEA 2IW3A 3LDAA 2WJIA 4PFSA 1MOZA 1G6OA 5KDDA 3U7FB 2QRZA 4CYMA 1CF4A 3SJCA 4GZLA 1EXMA 3U3OA 1NSFA 3W5UA 1KK3A 2N42A 1XXHB 4TYWA 4KAXA 3CW2A 5FBLB 2GK7A 2WJVA 5J4KA 2FN4A 2ZPTX 3TJZA 3AF2A 3B60A 3Q85A 3R8CA 5DI3B 3R7WA 4IFEA 1UADA 3CCQB 1X6VA 1PLJA 3AP2A 3NH6A 3GCGA 2W2TA 5G3ZA 4NYMQ 1DO2A 2XTMA 3QPVA 1VYVA 1KAGA 4MRNA 3B6EA 1FTSA 3HYRA 1Q81D 4NL4H 4RCZA 1H85A 3DM9B 4DXAA 3ADCA 1NJGA 4DUGA 3U3RA 3TGPA 5FUXA 1X8KA 1ZD1A 4GSYA 3CH4B 2Q9AA 2IYLD 4QGHA 4BFZA 1H8HD 3TSOA 2OZEA 3AKCA 1QRAA 1U0HC 2O8CA 3CCRB 3I4LA 4FINA 3GJ0A 3AVXA 2Z4RA 1OW3B 4BLSA 3H2YA 5JRZA 2AL7A 1XTQA 2X19A 4M1OA 3C5CA 4I1SA 1GUAA 3BH6A 2MSEB 1K5GA 3GLFE 4LHZA 3EARA 3M6AA 4E09A 5BWMA 4EPRA 1P3JA 1XXHE 2WAYA 4UNQA 3W8RA 5KTYA 2YC2C 4CEJB 3RC8A 2G1KA 1H8EA 1Z0AA 2ZQ5A 3AKDA 3U3JA 2NO0A 5JRJA 1UKVY 1ZC4A 3DPUA 3EXAA 3TUIC 1KMHB 3CNLA 1IY1A 2DFTA 4JLJA 5JHGB 1P60A 2QI9C 2HXSA 4MUAA 4OBEA 1KTVA 4C0BA 2PT7A 3KKPA 4IEIA 4DLVA 4HAYA 2WTUA 2WZQA 1R0XA 3ZLJA 3PUYA 2GQFA 1E2NA 1VYUA 2YJTD 5FOVA 2BBTA 2PZEA 4A2QA 2VP6A 1W87A 3NHAA 2BMWA 4P4UA 5KNCA 5CYOA 3K09A 2CCKA 4JLKA 2QPAA 3MCAA 4LSGA 3QXJA 2ZJ8A 2OCBA 1Y63A 1GVHA 3PVSA 1S2MA 1QHHA 2D2EA 4PR0A 1JAHA 5F98A 1Y3AA 2F6RA 4LYHA 1UM8A 3I92A 1DDGA 1JEDA 2IYVA 1T0JB 1G5RA 1D1NA 1R4AA 1RRFA 1AN0A 5SZIA 5SZHB 2P67A 3DMNA 2VF7A 3NVAA 3ADKA 1JXMA 2C9OA 4IDQA 4QG7A 5BYJA 3D31A 5E7MA 4XWKA 1BH2A 5JZVA 5UKDA 1GVNB 1SVWA 4TMTA 3DKPA 2IUUA 2CL6X 1KK0A 3FPKA 3SEAA 4DVGA 2B7CA 6Q21A 1H65A 5B57C 3QG5A 4LHVA 3RS3A 2HUPA 4FMCF 1J8YF 4CEHB 2QGNA 3HJNA 2GJ9A 1NJFA 4BZXA 3VR1A 4Q4AA 5EXSA 4WZAE 2GBLC 2GEVA 4HLUC 1KRHA 4JLNA 1TF2A 1VMAA 1D5CA 1F6BA 2XJ9A 5FTJA 1MABA 4R2HA 3L0OA 4NHOA 3T34A 4H1UA 1SVSA 3NWJA 2O0HA 1WB9A 1F48A 1EG7A 3DM5A 3EIQA 4B32A 5IRCD 2OO7A 2ZI4A 3L0IB 2ECKA 1Z6YA 4KODA 5SZKB 4HSEA 4G1BA 1XJQA 4BPRA 1OXVA 1US8B 1FX0B 1ZD8A 4Q7KA 1ELOA 1IONA 5GVSA 4C0QC 2B7BA 2QY9A 4OL0A 2QNRA 2Z83A 4HAXA 3PENA 1E9FA 4Q9IA 1FPMA 5IF9A 4EH1A 1G19A 1G17A 3X1ZA 1JR3E 4BWYA 1ZC3A 1XZQA 221PA 2F9MA 4FCWA 2AXNA 4BRUA 3BERA 3H0KA 4JLAA 1PUJA 2EFDB 2EYQA 4OQLA 3VO1A 2GTPA 5F9FA 1EP3B 2V3CC 1OH5A 2WKRA 4MKHA 4PO1A 2L0XA 3A36A 4QBFA 4F7WA 3TNFA 2VSOA 2H18A 4TTQA 5JLJA 4G1VA 1NKTA 3Q7QA 1S4QA 4FCVA 2KI5A 2YZ2A 3GLGA 4JKYA 1NN5A 1IY2A 2ODBA 1UF9A 1M7HA 4IDPA 3TR5A 3SOPA 1W35A 1A2BA 1VG9B 1A82A 2H8KA 3CIOA 4B2PA 2A5GA 4MRRA 1E2QA 1IXSB 4LC1A 1KZ7B 4QM7A 2A5JA 4RFSA 1GKYA 1J9ZA 1WQ1R 2CBZA 3CRRA 3HU2A 1AJEA 2EU8A 3LRPA 5CJPA 5EE5B 5EMNA 1OGIA 1JPJA 4HLCA 4M21A 2GNOA 1SXJD 4F7DA 3KJHA 3RSOA 5J47A 4M9ZA 1KO5A 2RGCA 2R62A 3OIVA 3K0CC 1D2NA 1KI9A 2EWWA 5M04A 1UBFA 1DE0A 3EC1A 1Q22A 1KMQA 2J0UB 1AGRA 4GMDA 2YKGA 1OT3A 2ZYWX 4KVGA 3E1SA 2J9RA 2O8EA 3EPHA 3QNUA 4AYWA 1NMZA 1W47A 3GEEA 1JQLB 3EWSA 4A1FA 1CU1A 3SR0A 1XPUA 4N1AA 4TTPA 1LB1B 4OK5A 1FNBA 3X1XA 3MGCA 4DEXA 2XTNA 4B76A 3U7HB 2F43A 1CQXA 4QL3A 2BGIA 4RD6A 2ZUBA 1KGDA 4JVNA 1VQ8B 3W3AA 5HTKA 3WP1B 3CZQA 4AYTA 1R5BA 3ETLA 1II0A 2ZTSA 5JFGA 4ZKDA 4K1XA 3QKTA 2R9VA 2D62A 4PZZA 3GLIB 2CE2X 5JWHA 3KQUA 1S3GA 3B9PA 3VKHA 3H84A 1FMJA 3GFPA 1VG1A 3RDPA 2C5LA 2EFHB 3BFVA 1ZYUA 3QY0A 3B2EA 2P2LA 4HE6A 4A82A 2IEZA 4A8JC 1A2KC 1L4UA 2WKPA 1XCGB 1S9DA 4ON9A 4A2PA 4PO9A 3RVBA 4XVUA 1Z08A 3FMOB 2BV3A 4QGGA 1QHXA 1RJ9B 2BBSA 2FE4A 4RKEA 3RYTC 4OK3A 1EWYA 4B75A 2XEXA 2RAPA 2ZRJA 2W6IA 1XMVA 3CNNA 1YR9A 1NL3A 3GQBA 2ANCA 2EW1A 2WWFA 2OK8A 1LF0A 3PV0A 1ANKA 1ZUHA 4H1VA 4EJSC 3W2FA 4LJ6A 1CULC 1PLLA 1OB2A 4LV6A 2VP5A 1W2HA 4L8GA 3OESA 2AK3A 2ZJZA 4LY6A 2Q6TA 1XP8A 3HR7A 3R20A 4KBGA 1LTQA 1GFIA 4WVFA 2ZS8A 1I2MA 3QXHA 3FKQA 4KBFA 4XVQA 3TMKA 1NNEA 4J0QA 3CC2B 3K9LA 5GJVC 1KJYA 4DSNA 4YAWA 4YXWA 3W5HA 2CL7X 3DZDA 4MYCA 1Q12A 4PZYA 4B3GA 2BMDA 2ZREA 4URYR 4LCBA 1I4LD 4AF6A 2OTJB 3QIAA 5DI3A 3QUSA 1M6NA 3BGWA 4EQ6B 4TMWA 5GADl 4C7OA 2D06A 1R7RA 2R2AA 3DOEA 2ASEA 2QROA 3SI7A 4BLOA 3QE2A 2GXAA 4ZGNB 2BMEA 3LH5A 4YLGA 3WXMA 1WE2A 5DNYB 4UQOA 4MRSA 2O8CB 3OEHA 1FNMA 4M2LA 1KDOA 3P27A 2F55A 1A5TA 2B8WA 4DDUA 1QHIA 4M1TA 2CLSA 2RC6A 2NO6A 3OE7A 3RS2A 5HE8A 2VO1A 4TMVA 1KO4A 2VIIA 4KLZA 4C0HA 3ICEA 1T3HA 1J2JA 4UAJA 2A30A 3EW9A 1W5TA 4DQLA 2FEMA 2YWHA 1UPTA 1M8PA 1KHTA 3FMPB 4Z54A 2O52A 2CE7A 2QAGA 3B9QA 4NE2A 4UNNA 2RC5A 5H8WA 2H92A 2RMKA 3THYA 3OZXA 2ZANA 1FP6A 4KFUA 4LOAA 3K70C 2A3RA 2BEJA 2NO1A 4HAWA 3G82C 3THWB 5KDLA 2FEOA 5P21A 5G40A 1QBKC 1GOTA 3OIYA 2PLFA 1DBSA 1U94A 1TF7A 4RZ2A 2OBNA 4DEYA 4Q18A 4FN5A 3KQNA 1CIPA 2VHTA 1OKKD 1P72A 4DCSA 5HZKA 4O25A 5TARA 3MFYA 4CEHA 2GILA 2RGNC 3BK7A 4PHGA 4CZ2A 3G4SB 1Z0FA 2N46A 3BC1A 5D3MA 2JIZA 1BO6A 1E96A 2Q0HA 1XMJA 2J7KA 4TT3A 5KSYA 4PANA 3MD0A 5H70A 3EIHA 3CZPA 2BJWA 1DAMA 2G6BA 5L3VA 4WQMA 2ZJ2A 1JECA 4Q9JA 3FOZA 3W5VA 5KNBA 5TMPA 3K8YA 2WSSD 3KFXA 4PO8A 1EESA 2W0MA 1DG1G 2QQ0A 3HP1A 4RD4A 3A1WA 1TEVA 1I4DD 3A58B 3I1FA 4JLPA 4JIMA 4W5WA 2ZROA 2XAUA 4LJAA 3W90A 2FF7A 1HT1E 4MQBA 1VQ9B 2BPOA 1R8QA 4AY2A 3VTKA 1Z2AA 5THXA 1IQPA 3CMEB 4B71A 1XRJA 1FOEB 2ZS7A 3B7GA 3ND8A 5LPNA 1GG2A 4DRZA 2R6DA 2RHDA 721PA 1YVDA 3VFDA 3BH7A 3M0EA 4N0EA 3SYKA 2FSIA 1YHNA 2C9YA 421PA 5TY0A 4CDGA 4ASUD 3G6EB 1KSGA 4E07A 4NP6A 4D2IA 3CR8A 3PEVA 3BD9A 1UDWA 2B8TA 4CT5A 4U7DA 3I73A 3TW4A 4ZDKA 1W7AA 4OQNA 4AG6A 1JR3A 3FMIA 1ZD9A 2ODWA 2J87A 1XTKA 1NIPA 4X8OA 5JI2E 5FH9A 1E2JA 2RGAA 1NI3A 3C7KA 2X77A 4R9UC 3I32A 5KPDA 2F7SA 1YITB 1HURA 1KO1A 4LJ4A 1WMSA 3AF1A 3KKQA 5IT5A 3CC7B 1IAQA 4Y0VA 5JSZB 2HF8A 5F2EA 1HA3A 1OYYA 1N2CE 2BWJA 2FZLA 1W5SA 4JLOA 3CCJB 2GBLA 4HLUA 2QTLA 1YR6A 3LVRE 4JBWA 2E87A 4LJ8A 3WP0A 1XWIA 2C2HA 1WDTA 2HF9A 3ICQB 1KKLA 2WSSA 4Y0AA 1F2TB 3O47A 2H16A 4A9AA 2BCGY 1OIVA 3KZ1E 1NDHA 2REOA 3VX3A 5FBVB 3QKSA 1E9RA 3IPYA 3WMEA 3FVQA 1G3RA 3TK1A 3A4MA 3I8XA 4KFSA 1SXJA 2BMJA 4Q5IA 3J81k 4TWZA 3IBYA 3QQ5A 3GJXC 4D81A 4R71A 1ODFA 1XTIA 4LJ5A 5G53C 2KWIA 3PEYA 1E2MA 3OFND 4GMXA 4NMMA 3TUJC 4AF7A 1J7KA 1OXSC 4NPHA 4PHFA 2D7DA 4Q1AA 3VR3A 1NN0A 2I1VB 4U9UA 2FG5A 1GAWA 2ZUDA 5EE9A 3EPLA 5JJLA 3B1XA 5FI0B 1U9IC 3PEWA 1TQ4A 3UMSA 3E2IA 1N0WA 3CNOA 2UVQA 1WRBA 2WJHA 2PMDA 5JEEA 2BHRA 1W4RA 4DLXA 3SHWA 5JJIA 1U0JA 2R8RA 1M1YE 2EWVA 4HAUA 1UBGA 2GAAA 3GJ7A 3W34A 2PZGA 2DFNA 3NDBB 4R2IA 3WRYC 1NJID 3K53A 4PAMA 4D0GA 5BXQC 1YZUA 2A7QA 2JJ2D 3T61A 4PC6A 4ARZA 1OKKA 1FW6A 3P1JA 3KX2A 4EFNA 1T3LA 1HE1C 3AKEA 3K0EA 1CR2A 1DS6A 2REBA 1YZGA 5AJXA 3LVQE 4IHQA 1ZM2A 1E0JA 4IOJA 2AWOA 4L9SA 4LRWA 1SKYE 1KZGB 4KFRA 4E22A 3PQCA 1XJ0A 2CDNA 2ZJBA 3QPWA 1ZP6A 5EJEA 1QUEA 1RFLA 1E4YA 4II7A 3T1VA 4CGZA 2ZI7A 4RSGA 4D0NA 2R6FA 3FHOA 1SVIA 2ZRCA 3A8TA 1TMKA 1GR1A 4GOKA 2O8EB 1NY5A 3L8YA 1SVOA 1E69A 3EZ2A 1UDXA 4G5OA 2O8DB 4ZCIA 3O8DA 2ATVA 1Q0UA 1I2DA 2BDTA 1W48A 2ZXUA 4V0NA 3VR5A 3UG7A 3G0HA 2ZYUX 3CLVA 2E1RA 3NTUA 5FOSA 4IOMA 1C4OA 2WPDD 5EXPA 2PCLA 3FDIA 4YMVA 3W6NA 1R6BX 2HCBA 2QTFA 4EPXA 2V54A 1ZAKA 1DAKA 2GZAA 4QGAA 4AI6A 5TVKA 2HLDD 4NZYA 4IOKA 4D4MA 1TQDA 4DLUA 2MSDB 1Z5ZA 4IVRA 4B6EA 2CHGA 4YXWD 1PUIA 2HT6A 5CM9C 1VQ4B 4HZIA 2ZU6A 1KI6A 1K9MD 1E2FA 2F3TA 2OESA 4FWTA 3D8BA 2GJAA 3EAQA 4FXPA 4EDHA 3EPJA 2FSGA 1JAIA 1YJ5A 2JLXA 4R98A 3EZFA 3LFUA 5FA6A 1A4RA 3P26A 4YDHB 3RS5A 4HB3A 1KI7A 4IXNA 1P4SA 4Q1EA 4QC2A 4Q7JB 2CMKA 4DCNA 1BQEA 3X1DA 2ONJA 5B64A 2HJGA 2FGKA 2REXB 3LVBA 3ZQJA 1II8B 4C2UA 2GCOB 3TQFA 1GKUB 2IS2A 1CTQA 1M7GA 2V55B 3GEHA 1QVGB 2BM0A 2FFAA 3NEYA 1ZBDA 4EJSA 2FH5B 5KSZA 3A6PC 1ZM4A 4K46A 1AKEA 1E79D 3BH0A 4JZKA 1V43A 3KXIA 2F1IA 1GZSA 3CWZA 4URXR 3OFNA 3AVQA 4DIEA 1EX6A 2JA1A 1TAGA 4V0MA 1BS1A 4TTRA 4L16A 4BZQA 2QBYB 4PPFA 5DYGA 2QM7A 1IBRA 5GVRA 4EIWA 3LLMA 2BC9A 2HLDA 1JJVA 621PA 4B74A 4DLSA 2PBRA 4A0FA 4OHVA 2NOAA 3EX7C 3F5FA 4L4UA 3UMRA 3T1OA 3THXB 1PV4A 1P7CA 4LJ7A 2HDNB 2D4HA 2DEUA 2Z6VA 4XSHA 3IIJA 3UPUA 2RGEA 4Y9UA 5AJVB 2JIZD 2VHQA 3I55B 2WV9A 5KO2A 3NBXX 1T3SA 2J46A 2ZRHA 4LV8B 5JBQA 1XTRA 4WW0A 4PQFA 2EQBA 4NH0A 4POAA 4BEJA 4YQFA 2WJGA 2X2FA 1HQCA 2ZRFA 1D2EA 3CPWB 1E0KA 3V00A 4AG5A 3ZVNA 1CJMA 4QRHA 4OJKA 2A78A 4DCTA 1Z28A 2NGRA 2VP2A 3IIKA 3I72A 1TEXA 3MMPA 1E9EA 4TQ9A 3VR6A 1L2TA 1O3YA 4XTRA 4A6XA 5HPYB 1FUUA 4HE5A 1DAGA 4EPYA 1MR3F 1N5IA 5JS7A 2P5TB 1OYWA 2B21A 5AUNB 1XE1A 3P32A 5CIWA 2QORA 3BRWD 1AQUA 2R44A 1RIFA 1CNFA 2A5FA 4EPVA 5J4HA 3JQPA 2WVJA 3A1SA 3LBIA 5AN9A 3PITA 4DLRA 4A4DA 4WXRA 3GLIE 1OE0A 2F3RA 2PEZA 2WPDA 3PJRA 5F9HA 3KKOA 3ZVMA 1JBKA 4GZMA 1KI2A 1JI0A 4Q4AB 4YMUA 3ZVRA 4MDFA 1IN7A 2CNWA 2GVZC 3GMTA 3UATA 1Z22A 4BGDA 4W9MC 4DSTA 4F4CA 2QP3A 2RH5A 2P65A 5KU1A 1AK2A 2WAXA 4JVMA 1EFTA 3KDSE 2IYQA 5CJ2A 4CEIA 1GM5A 2IYYA 1CJKC 3T15A 4JLMA 3SBDA 3L82B 2CJWA 5K8IA 3QF4A 2VNIA 4OKSA 2WHXA 4C2TA 3W5JA 2OBLA 4B4DA 2VF8A 4IXMA 5FI1B 1U8YA 821PA 3PXGA 1ZM9A 2IF2A 2V1UA 2J45A 4RD2A 4QNRA 1KO7A 1YZKA 3K70B 3REGA 3VQTA 3K0AB 4IFBA 5EXXA 2OE2A 4GL2A 1E64A 2WWXA 1Z0DA 1QVRA 1D8TA 3E1YE 2QTZA 2LWIA 1UBEA 1J8MF 3DOFA 2IYWA 2WWGA 1KIMA 3KJIA 2ZRMA 4D4KA 1GNPA 3MAAC 1FL9A 3LW8A 4PHHA 2G3YA 1FZQA 2PZFA 3SS8A 3ZS8A 5J40A 1E4VA 1YJNB 5K8TA 2CXXA 1P2TA 4PPGA 5FBRB 2JDID 1E9SA 3FHCB 3W2EA 3QG1A 1XF9A 1CJVC 1DOAA 2AD1A 3MJHA 1HV8A 4NCNA 2JJ1D 1S1MA 1S96A 4QJ3A 3I5XA 2FPMA 1G8FA 4JT2A 3SFVA 4NYIR 4LYAA 1SVKA 1OIXA 2WICA 5AUQA 1II9A 2GWHA 1KAOA 2RCNA 2PX0A 4G01B 4EJSB 3AEZA 4NDZA 1SVMA 2MMCA 2QTHA 1R8SA 5CYPA 2ZE7A 5FUVA 3UXMA 4BLQA 4GP7A 2VQSA 4RCYA 3L2OB 2IK8A 2JAQA 2RGGA 2H1LA 3NBYC 4OQMA 4C0LA 2QA4B 2G88A 4YMTA 1KDRA 4BFTA 4B3DA 5KHOC 5H68A 4GOJA 2FSFA 3GLGE 2D3WA 5JS8A 3DDCA 2J0VA 4YAOA 4HYYA 3NBFA 4NYJR 4C30A 3UMFA 1UEJA 1G3QA 2PJRA 1KSFX 5G3YA 2RGDA 1VQ5B 3OJXA 2ZRLA 3CPHA 3VKGA 3ECCA 1W0KD 3VR4A 4IVPA 3WYAA 1BIFA 3PFIA 4QJ5A 1GSIA 2IUTA 2FX3A 2TMKA 1S1CA 4DIDA 1EP1B 1Z2CA 1Z07A 3AF4A 4US0R 4DLTA 1COWD 1G21E 1GL7A 2IUSA 3VNVA 1KYIA 2JDIA 4ARZB 2ZM5A 3CXCB 1BMFA 1LFDB 4MGYR 4ZV4A 4WAUA 2HMAA 4ZDWA 1W2GA 2ZJOA 4C0KA 2NZJA 2FFHA 2PJZA 4TYNA 2QBYA 3FE2A 4M53A 3CCLB 2CNWD 2QMHA 4Y7CA 4DT1B 5GJBA 2WMNB 4KI0A 4TLCA 5A4JA 3FFAA 4ZCLA 2BIFA 2A9KA 2ZE8A 1Z3IX 4YAFA 5BN3A 1G8PA 4CVNA 1J90A 4TT3D 2OCPA 4DWJA 1LS6A 1QHGA 4LBZA 3KFVA 3QE0A 4ABYA 4BEBA 3TAUA 3OZVA 4PC1A 1MO4A 2LKDA 1N6LA 2PL3A 5H5JA 3OZWA 3P4XA 1ETUA 1QZXA 4MGKR 5EP1A 2ZSBA 3MWJA 4NCHA 2IYZA 2GK6A 2YOFA 4L5BA 3TH5A 4U02A 2LKCA 2QMUA 5DSZA 5FBWB 4Q1FA 3TQCA 2G0TA 4PPNA 3U7GA 1JQJC 2VH5R 1N0VC 2ZYTX 3W3ZB 3TAHA 1T4GA 2PEYA 4MYUA 2WMOB 5DIFA 4Q03A 1OXUA 3OZUA 1QHSA 5DLQC 1AS2A 1ZRHA 3EIEA 1E1RA 2JATA 2F1HA 1Z0KA 4GT1A 1VCNA 1ZCBA 1YI2B 1DO0A 1Q44A 1XMIA 2BF4A 3MWLA 1GKIA 4M9QA 3IPXA 2VZLA 1HEIA 5KSWB 2I3BA 1FUKA 2KBEA 2UKDA 4JLDA 3EZ6A 5FUWA 1D9ZA 1JR3D 4B35A 4JLBA 2ZI6A 4NYIQ 3U44B 3TBKA 3L43A 1J99A 3IUYA 4LPKA 3RRNA 4TL8A 4C4PA 2W0SA 3AVYA 4ZIRB 2ZRAA 4JJKA 3SYLA 4G5SA 5EP2A 1KI3A 2AR7A 3LA6A 3PR1A 3WHKA 4MITA 1OXXK 8OHMA 3CWQA 2P6NA 3EPKA 2CCJA 3LX5A 2JLQA 3EZ9A 4Q9HA 2JASA 1C1YA 1KK2A 4HLQB 1XJCA 2R6AA 5A0FA 3WHLA 1TU3A 1K5DA 1G7RA 2KJQA 2VBCA 3H86A 2QAJA 1N0UA 4WXPA 4V0OA 4W5JA 2BBWA 4LC0A 3EG5A 4JL5A 3SE0A 1OV4A 5TR9A 5EP4A 2J5XA 1JEEA 1X8LA 3AF3A 5L8VA 2GEUA 1XEWY 4ZIRA 1P75A 2ORWA 2IBMA 2XSZA 1UKZA 4KFTA 4PPQA 2GXSA 5LBIA 2OAQ1 3U3MA 4PTLA 3T1QA 3ZBTA 3KUDA 1E1RD 3E20A 5C2JB 1G1MA 2BMFA 2XOKD 2C03A 4AKGA 5DH9A 1HH4A 4B2IA 5FTLA 1NVXQ 3QBTA 1R0ZA 2VYQA 1GDDA 3U4QB 1U99A 2QMOA 1NKSA 1W0KA 2V1XA 4CW7A 5B30A 1Q1ZA 4G5QA 1YQTA 4NKRA 3W2HA 4X8LA 2WOOA 2OCYC 4AURA 1W36C 1KJWA 3IHWA 3CR7A 4C3ZA 5H59A 1B0UA 1KI1A 2ZJ5A 4DB4A 1BMFD 1WBBA 4Q48A 1MABB 1WP9A 4O2RA 2GA8A 2JJ2A 2ZEJA 4TQAA 5TB5A 3KB2A 1EFCA 3FYHA 4MYTA 2OFWA 2ZRKA 5HE9A 4LHXA 4DB2A 2FOLA 1E94E 4MH0R 3NC0C 2XNSA 4MRPA 1RPZA 4S35A 3U6KA 2CL0X 4H9GA 2QUZA 2X2EA 3VO2A 2Q9BA 3AUXA 1E9BA 2G83A 5FPTA 2IS4A 2V6JA 1W34A 5TDHA 2R6HA 1E0AA 4RD1A 3K9NA 4QNMA 1TPZA 2O8FB 4URZR 2IXFA 4NCIA 1RZ3A 3GPLA 3TLXA 1A8PA 2DPXA 5LDDC 1P2UA 1DVRA 4MGIR 2ZJYA 2OT3B 5C4MA 3Q5DA 2V9PA 1HE8B 2O0JA 4P4SB 4RKFA 3OJWA 4TLDA 1FTNA 4B3BA 1Q57A 1Q21A 3KUCA 4RZ3A 4HB2A 2H57A 5HZHA 3KTAA 1YJ9B 2QP9X 4TN1A 1DPFA 4EFLA 2BOVA 3X1WA 3KXKA 1K8AD 4M22A 4CIDA 4HUQA 2CVHA 4LBVA 2YC4C 1X86B 1XXHA 2VPPA 3X1YA 2VHUA 2VTKA 3AVWA 1X1SA 4C9BA 2OFOA 1NIJA 2J41A 4QHSA 2BM1A 5IDVA 3ZIAA 2KBFA 3AP1A 4GOXA 4AWXA 5AJZA 4MUBA 3A1TA 4OI4A 1U81A 5B58C 4E03A 1LY1A 3C15C 1Q3TA 2VA8A 3QENA 1AA9A 3LXXA 1NG9A 3FTQA 4HDQB 1KK1A 2ODNA 3FB4A 4DZZA 2AHOA 3GLHB 3SJZA 3WY9A 3CUEF 4HEJA 1QF9A 3QEJA 4Z1MA 5SZJA 2DB3A 1E2PA 3EZ7A 1Q7YD 2CHQA 2OLKA 2W83A 1E99A 2J0QA 1QVFB 4UJ5A 4EAQA 1E0SA 1W36D 3ZYCA 1EWQA 2V7QD 1G3UA 3M1IA 3N70A 3NKVA 3RS0A 1FQJA 2CRVA 3KJGA 4A36A 5B2ZA 4TLEA 5GJWC 3T5GA 1KDPA 4DBLC 2XXAB 4UNSA 1G41A 4X8MA 2JLYA 4YMSA 1E79A 1JPNA 1LW7A 3QF4B 5J4VA 4EKDA 3CCVB 2RGBA 2FGJA 3FWYA 4LBYA 1QG2A 3W8NA 2WWHA 4V0LA 2XOKA 1TQ6A 3NBZC 5AJWA 4ACBA 3THXA 1YZQA 1CS4C 1QFZA 2VP0A 2IX3A 4QM6A 1HT2E 5FPHA 3MG9A 1BJKA 4TYPA 2GVDC 5KYKA 1CLUA 1P5ZB 2WWYA 4PXAA 2Y8EA 4DC9A 4AC9A 2VNKA 1AS0A 5FL7D 3AQ4A 3HU1A 2HYDA 1R0WA 2ZRGA 1EK0A 4TLAA 3AH8A 1FDRA 1HTWA 1KSHA 2WBLC 1TLLA 4Z1MD 4N3GA 2PX3A 1JR6A 1FFHA 2J1LA 3DHWC 1Z6AA 5EUMA 1BX1A 1Z8FA 4KV9A 2CVFA 1CRPA 1ZJ6A 3JVUA 4QKQA 1VQLB 1TVCA 1OJLA 4TYYA 2KSQA 2EFCB 3MJRA 4JL8A 1W46A 3GJ3A 4GNKA 4BFSA 5BQ5A 1GRQA 3CRW1 1TQ2A 4DLWA 4M4SA 1G291 1DARA 3AVTA 1OPXA 5JJKA 1Z6TA 3CB4A 3ZJYA 121PA 3Q8XB 3KQKA 1IJFA 5FTMA 5JSZA 5CB8A 4B47A 4BZPA 3GP8A 4LHYA 3HYTA 1QFJA 4AD8A 5F3WB 3ZZ0A 4JS0A 4KITB 2JLUA 2OV2A 1XU4A 1Z06A 5G41A 3KL4A 2FJUA 4Q1BA 5DHAA 2HEIA 2J59A 2Z0MA 1YZNA 3C41J 3CO5A 2FMXA 3RRMA 3WNDA 1P61B 1VTKA 2ODEA 4PQYA 3T35A 3L0SA 1KNXA 2OILA 3D7MA 4AKEA 4NCJA 2NZ8A 3DMDA 3OEED 1R5NA 1MRSA 3FPAA 4LGMA 4RJLA 3WYFA 4QBIA 1ZMXA 2ZVQX 3VNUA 1N25A 1IXRC 2SHKA 2IA5A 4W5HA 3NH9A 4BPBA 3F0TA 4QOSA 1GIAA 4FK8A 5A5GA 1E9CA 3Q5EA 1UJ2A 3TSZA 3SN6A 1G7CA 1BKDR 4A2WA 4A0HA 4B73A 4TMZA 2FDCA 4MKGA 1ZM7A 2X3UA 2B6HA 2QRNA 4XD7A 3UWOA 4JYBA 1MO3A 2IEYA 1JNYA 1JJ2B 4G5RA 1OIWA 1QHYA 1TX4B 3QFRA 2V7QA 3SNHA 3NIBA 4CEIB 1F5NA 5FPKA 4NBSA 2XSZD 1G9XA 4FIDA 2HJVA 2OTLB 2CLCX 2XZOA 3VAAA 5BYKA 1XMSA 5EZ5A 3KJEA 4GBMA 5AUOB 2AN9A 3CPJB 1N5KA 3MWYW 4PAQA 3N5CA 1T6NA 3RC3A 3D3QA 4AIIA 4AYXA 5D3QA 4DCUA 1VHTA 1OGJA 2FPLA 3WBJA 2IXEA 3LV8A 3UK6A 4A92A 1VQMB 1ZU4A 1QX4A 2I1QA 4URUR 3CONA 3T12A 4B33A 1GAQA 5CIQA 3AVPA 2JJ1A 3OEEA 4MYHA 4O2LA 4B3XA 3CCSB 5AJYA 1K6MA 2VRWA 4GPTA 5FOXA 1IN5A 1N6RA 4MKFA 4M1KA 1TUEA 4BFWA 3B5JA 3OF5A 3R9XA 3KQLA 3FKSD 3IBGA 3OIUA 2ERXA 1QGAA 2ZAOA 5HR5A 1E9DA 4QBHA 3AKYA 5KUTA 3TW8B 4IVQA 4BRWA 1U2RA 2W00A 4LYFA 2R6CA 1F2TA 1UKYA 2IXGA 4WIAA 1VHLA 1GNRA 1WA5A 2O5VA 4LK2A 1Z63A 2GDJA 3ASYA 3LBHA 2BSAA 4XIGS 5JHHB 1A7JA 1JALA 3ES9A 2ZR9A 3LNCA 5AR1A 2K5UA 4BFXA 1TU4A 3BAFA 5JWRA 1XBTA 1IB0A 3F8TA 2ZIAA 3W2GA 3WNCA 1BYUA 2QSZA 4O0MA 1NBMA 2ZI5A 2ZRNA 3V9PA 1CNEA 1K8RA 5LD2B 4ZKEA 1NLZA 2OM2A 2XNDD 2DWPA 1QG4A 2KB0A 1YZTA 3MUFA 5JCZA 3SQXA 4OQFA 3H4MA 2QG6A 4QGFA 3OW2B 1COWA 1N6NA 2ZUCA 2HXYA 2BKUA 2EVWX 3EWAA 4D80A 3K0SA 2O8FA 1IN6A 3NHBA 4OHXA 4ITRC 1U9IA 1FP7A 4MKIA 1L8QA 1ZUNB 5KOYA 2HV8A 3IO3A 5CK4A 3DVLA 3R9WA 1KSJA 2J0SA 4OI0A 1CKEA 4Z8XA 4P3YA 5FOTA 1JJ7A 1AMOA 4BFVA 2ZYVX 3W6PA 3C5HA 1ZUIA 3T06B 5ELXA 2IF0A 2FV8A 2W2XA 3C14C 2CNDA 4Q4LA 1T9HA 3ZD6A 3S1AA 3V4RA 1JXOA 4UNPA 2VNJA 5DYIA 3W5IA 2JGNA 1PLKA 3Q9LA 4IKEA 2WWIA 1M74A 5ANRB 3I5YA 4HZUB 3GJ6A 4HZUA 5HXBA 3QBVA 1D9XA 2NTYC 1XEXB 3TRFA 1G5PA 1O87A 2IC5A 4A0GA 1K73D 1ZIOA 1OSNA 2CLDX 1DADA 2H5EA 2IYTA 2Z43A 1QHHB 2ONKA 1M1KD 4ILEA 4M9SA 4F4JA 2H7VA 1WBDA 1TTTA 3WNBA 1VQNB 5FL3A 5JMTA 2ZSFA 1NBMD 3EA5A 1YHQB 1XPRA 4ZI2A 3E5HA 1MT0A 4DJTA 2DERA 3SQWA 4FMBB 2C98A 2QEQA 4I1OA 4FWIB 1E98A 4I99A 3ZS9A 3CD6B 3A1UA 4FMCB 2VSXA 4TZ0A 2V8OA 2QAGC 1RRGA 3BJIC 4S2EA 1NG1A 4OHZA 3IQXA 3CCMB 2X1VA 1KDTA 3AVUA 3HR8A 4MRVA 4UXHA 1V5WA 1J70A 3QI2A 1GILA 3GD7A 1B2RA 2XNCA 1MRNA 4DHEA 1GP2A 5FFMA 5FL7A 1WXQA 2XZLA 3BORA 4US2R 3JQQA 3D6TB 1XD8A 2PH1A 4ZCMA 1Q1EA 2DBYA 4R7ZA 4B3CA 1P73A 5L3SB 5EZ6B 1F2UA 1NP6A 1XD2B 3BOSA 1IN4A 4P0TA 3KKMA 5E95A 3VU9B 4P4TA 3P4YA 1E2IA 2KE5A 4OJQA 5CLQA 5FUYA 3VHXA 3VKWA 4V03A 1GJRA 3CBQA 2CK3D 2VSFA 2OXRA 4IRUB 3IEUA 5CB6A 1E2KA 3NXSA 4Q19A 1GAJA 4IDHA 4OHWA 3LX8A 5DE3A 1OH6A 1CEEA 3B1VA 4F38A 2VP4A 2WWWA 2QENA 4FW9A 4JSTA 2WJYA 4GFDA 4BLTA 3LY5A 3SJBA 1RE0A 3WRXC 3RS7A 2C99A 3RLFA 1Q1QA 2H17A 1IY0A 1QFYA 3WMGA 5J4LA 3K0FA 2XNDA 4PSVA 5FOUA 3R7WB 4HB0A 3W2IA 4YALA 4HB4A 4PSAA 2EFGA 4JYCA 2Z4SA 4D4JA 1RRPA 2YVUA 4B34A 3PG5A 2J7PA 1XPOA 1X8JA 4GDFA 2IS1A 1QH0A 5CK5A 4ACAA 2YHSA 1XZPA 3ZVLA 3THWA 2QN6A 3ZGXA 1YJWB 1D6JA 5FPYA 3CRZA 2GCPA 2OUKA 2BCJQ 5K8LA 2YOHA 1RJ9A 3AV0B 1E9AA 3K1JA 1A1VA 1B23P 5FTNA 1UAAA 4Q47A 5EE1A 1Q3HA 1N6HA 1YR8A 1VQOB 3QEOA 4Z8YA 2GF0A 2NQ2C 3QKUA 4Q1CA 3VX4A 3BFXA 1E32A 4UXJA 5DHFA 4Q7LA 1DTSA 1G5TA 1UFQA 1VIAA 2CEAA 4LWZA 2RKOA 5HKKD 4XD7D 4BFYA 2P6RA 1CR1A 4D6PA 1ZW6A 1IM2A 3UG6A 1OFTA 4BUJA 3HDTA 2MMGA 3HWSA 1CXZA 2ZR7A 3GJ4A 3KQHA 3G71B 4HAZA 5GV8A 1N3BA 3PUVA 4KCGA 2I4IA 3ZC3A 3IIMA 2V6IA 3IQWA 3CC4B 3MSXA 4QJ4A 3IGFA 1WF3A 2YOGA 2DHRA 3AB3A 4P31A 1AGPA 2R65A 4D0LB 4KYUA 1ZNYA 3N2EA 1ESMA 1YU9A 2QP4A 1P6XA 4UJ3A 1UKEA 4MGZR 3IDQA 4ESVA 1P9NA 1SXJE 2EIXA 1E2HA 3AGPA 4P4SA 1KMHA 1KNQA 1NF3A 1ZNXA 4GP6A 3RSLA 3RWOA 3ZIAD 1U90A 4CRWB 4LV5B 2YNMA 3TKLA 1ZU5A 2A5YB 2G1JA 3ONWA 2AX4A 1LV7A 3I62A 2J0UA 1KQSB 2GJKA 3OIWA 5DGXA 3QKRB 1N5LA 2ZI3A 3K0AA 4WOPA 5TV2A 2OK7A 2C96A 1QGYA 2OSBA 2PLRA 2ZRPA 3GLFA 3U6BA 3FKSA 3GLFB 2GJSA 4Z51A 3AF0A 2ZRDA 3U44A 2W6JD 4U00A 1W2BB 2BN4A 1NMXA 4D25A 2Q3FA 2WIAA 1OFUX 5JCPA 3SC3A 3GFTA 3QXSA 1SVLA 4ERNA 4DDTA 2DWOA 2ZAMA 4ESHA 1W36B 3Q3JB 3A37A 5LB4A 2FSHA 5E3HA 3MHPA 1EFHA 2FNAA 3DEFA 2VL7A 4FMDB 3U3KA 4LI0A 3IEVA 2AWNA 3B78A 4DDWA 1U8ZA 2HCJB 2G9NA 4XWOA 3CF0A 4YAUA 1R10A 3U7EB 4X8HA 4G5GA 2OBMA 3F3YA 1YE8A 2WIBA 1OLOA 1SZPA 1VCOA 2IYSA 1OFIA 3B13B 2IL1A 1VQ7B 2C77A 1KO8A 1NY6A 1AIPA 4HATA 2J3EA 4TLBA 2XXAA 2HYIC 1VG0B 4G0NA 4PSKA 1Q20A 2OCAA 1NRJB 2F9LA 1W44A 3NG1A 4Q66C 1KC8D 4JJZA 4QBGB 5KNDA 1OH8A 3THYB 1CP2A 3QXCA 2J7PD 2FZ4A 3VU9A 3ND9A 1EFRD 1G7TA 4I81A 1E3MA 3AVOA 1E63A 1HY3A 2ZSAA 2JLZA 3JZMA 1ZVQA 3BE4A 3GEIA 1UMKA 1NLFA 1KI4A 1SQ5A 4JKIA 4YDSA 2CJWB 5C1BA 1GRRA 3FFBA 4GI7A 3DKVA 4RD0A 1Z6XA 3M4YA 5EXTA 5H1YA 3OAAA 3SHFA 2ZITA 1W4AA 5CDFA 3CRMA 3N2IA 3JVVA 2GAOA 1XDBA 3SYNA 3IHLA 1VQ6B 4P6VF 4M1MA 3LXRA 2ATXA 1VPLA 3ADBA 3BIFA 1Q82D 3B8HA 1XX6A 3U60B 4B43A 2GPJA 4OHYA 1OF1A 1AM4D 1E62A 1Z29A 1NVVQ 1DG3A 2P5SA 1GL9B 4HUQB 3B82A 4W7SA 2XITA 4LPSA 3FHTA 1OB5A 2F1RA 1IXZA 1KOFA 1OFHA 2JCSA 2YINC 1E1QD 4A0RA 4DT1A 4TMKA 3I8SA 3KXLA 3TSWA 1M7BA 1DAHA 1FMLA 3B1ZA 4KHZA 1QGZA 4DSUA 1Q1BA 4HUTA 1VG8A 3RNLA 1L7VC 2GKSA 5EUQB 2O8BB 3ASZA 1BYIA 4ZGQB 4M8NE 4B44A 4N3NA 4JLVA 2IWHA 1GO2A 1LVGA 1XNJA 1VYTA 1UBCA 4K8OA 1HQYE 1RC8A 4TSFD 1T8UA 3U5ZB 2F1JA 2P0EA 1FNCA 2VLIA 3CCUB 1DAIA 2OAP1 3PUXA 4DDVA 2HT1A 1SULA 1G8GA 3GJ8A 5J4YA 2XTZA 3JQRA 1OHHA 4JVLA 1S3SA 1W0JA 3ZD7A 3QFTA 1E6CA 3GFOA 1F2UB 1SXJC 2QM8A 3DL0A 2YV5A 4DLYA 2CK3A 4XOIA 1YRBA 4BECA 3PUZA 4OI2A 2BKEA 1E2DA 1G3IA 3RWMB 1EX7A 2OFXA 2FWRA 1FRNA 1T0HB 5L3QB 4WA7A 5D3MB 1T5LA 2JLRA 2NIPA 2ZRIA 3U4QA 1CR0A 1C9KA 2AKAB 2GF9A 1LS1A 3GLIA 3SDZA 2DR3A 4TZ6A 3VMFA 4DKXA 4E5UA 2QT1A 1EFUA 2QSYA 2DFLA 3LWNA 3CMAB 2B5OA 1U0LA 4EFMA 2FU5C 1U8AA 2BJVA 2GXUA 3AUYA 2O0KA 4BLPA 3VR2A 4M9XA 3LQRA 4B6FA 2GEDA 4PGOA 3KTAB 3QVUA 4I1VA 1VQPB 3TE6A 4IDOA 1MO5A 3LO8A 3REFA 3E70C 2WKQA 3RABA 3ZZUA 3RHFA 2B92A 2GJ8A 4DUGD 3Q72A 1R5OA 1XD2A 4RY2A 2RGXA 3C8UA 2DYKA 4P33A 4WZ6A 1X1RA 2IYUA 2O8DA 1LF5A 3NDPA 2QPTA 2QU8A 1EFRA 2Q21A 4MA4A 2XJ4A 1OHHD 2OXCA 2ZR0A 5DO9A 1E2GA 3B1YA 4C43A 1XTSA 4Q4HA 1MV5A 1T91A 4F91B 2A2ZA 4C0AC 1XEWX 2RB4A 1AKYA 3SBEA 2GZHA 4LZZA 3K0CA 5FR1A 3CF6R 1IOZA 5L3RA 2ZETA 2IHBA 5HKKA 2D7CA 5JI3E 3RANA 1P62B 3CM0A 2AD5A 2ZSDA 3LLUA 1P2SA 3K9HA 2JEOA 3VHLB 2XB4A 1I7PA 1XB2A 3PEUA 4LDJA 2QQEA 2PCJA 2XX3A 3HPRA 2GCNA 2QAGB 4C0SA 4IOLA 3CX6A 3EASA 3CF2A 1QVAA 1N6PA 1N6OA 1FNNA 2RHMA 2UZ3A 4KSBA 1TUIA 1KKMA 3AVVA 1NLYA 1QUFA 2QGZA 1E1QA 1SM4A 4ZDIA 1TL7C 1XFAA 4PC3A 1G18A 4OI1A 5KDOA 5AK0A 3U61B 1H42A 5KPJA 2ZS9A 1X3SA 4EPWA 2IT1A 4UNRA 2XGJA 2DCUA 3UKDA 2X8AA 2OHFA 2UZIR 4F92B 4ZO4A 1KI8A 3UIEA 3BB4A 4HLDA 3K09C 2NPFA 2ERYA
chains in the Genus database with same CATH superfamily
4RF5A 3R6JA 4XIFA 4FP9A 4BN0A 3D2AA 2Q45A 1UXOA 2VYFA 4RTSA 2FFBA 4KRFA 1W9MA 2IU4A 1ZNZA 4W1RA 3AERB 1H2ZA 3DR3A 2BGRA 1VBFA 1IQRA 2AFIB 5L40A 4P26A 3TZCA 1GNTA 3QPUA 2CHEA 4JJ4A 3OPYA 2W6JA 1OYVA 1DIAA 5DV9A 1ODSA 3B12A 4KKXB 4QYMA 3DF7A 1J9GA 1KS2A 3O4RA 1US8A 4KXFB 3KSUA 4AICA 3AOEC 1D6NA 3P9IA 1IH8A 3C4VA 3JWGA 3B7PA 4IQGA 3R5TA 2NG1A 3G02A 3VISA 3WHPA 3ZCTA 5DN6D 1TO2E 4XZ3A 5AKHA 2AXPA 2IHKA 4F3CA 1S72B 1UBNA 1ZL2A 5DI9A 4UTNA 1JMYA 1EP2B 1RRKA 4TQUS 2QPLA 1S2GA 3FNFA 1QHNA 2R66A 1WCV1 5T7BA 4WA8A 1O6CA 1QPGA 4PY2A 3GV0A 1PJBA 2HLPA 3MBKA 1BX0A 1GRNA 2CYBA 2DVMA 1QKIA 1M8KA 3HCDA 5JCOA 3AFIA 3K4QA 4YIKA 1P2GA 3OMLA 1F3OA 2H1SA 3LOPA 4O4LA 3GJ5A 4MRMA 1LRJA 3HLTA 1QIEA 2WC1A 5I3CA 3LD9A 1C3OA 3AOEA 1OTYA 4D3ZA 1CSEE 3B3JA 4DREA 3WGIA 4R9VA 4L0QA 4AS2A 5IJXA 2DAPA 2JH8A 3CUUA 3WL7A 3K2IA 2AKYA 1NHWA 3L8CA 3WB0A 1W4CA 3QFHA 2KHZA 3AM1A 5A9SB 4B80A 5A1JA 1TM1E 5AWFC 1XZ8A 3A1VA 4J2OA 2HGZA 1J1IA 2JLCA 3R7FA 2VNHA 1PQWA 4FT2A 2ZE5A 5FO0A 2YJGA 2X7JA 3CH5A 3RFCA 1QG0A 1NNSA 3CP8A 2OCKA 4GQAA 5GJCA 3ZQKA 3G9QA 5M29A 3A6GA 1VHJA 1KARA 4UU0A 4L4RA 4RFSB 5E4JA 5T67A 2WP8J 3QEBZ 2NAPA 1VCMA 2CWDA 3KNZA 4LW8A 1TLTA 4YT2A 3CLUD 4XSGA 4B3IA 3HZRA 4B83A 2R7KA 4KWTA 5G1NA 4D4GA 4OK6A 4QOEA 3H1EA 4I4LA 4XRRA 1FA9A 2RGNA 1EWVA 4Z4SA 3F98A 3G49A 3OQHA 4CEJA 1NVUQ 1P9WA 2Q07A 4MWBA 1SUIA 4KLNA 1ULTA 4XB6B 4YRDA 4KKUA 2V5UA 3NM4A 5FF9A 2OFPA 4BMDA 1I7NA 5AH0A 1I7SB 1VIYA 1IB6A 4Z49A 2KLHA 2YUIA 3ICPA 3PGA1 4YT4A 2MINB 4LE0A 1P39A 3RVLA 1VL6A 3LCJA 2PZ8A 1WEHA 1O5IA 1TOAA 4FNAA 1QCCA 1G6HA 4D82A 4HDCA 3MQFA 3JATB 2XB8A 3EH2A 3IEMA 2B4AA 4KTTE 4AUKA 5LQRA 3QX9A 4HPJB 2AI1A 4HC4A 3DB1A 2WTMA 4IQ0A 2RARA 1JQKA 3JASB 1LNZA 3Q7PA 4MR7B 4MMYB 4Y8VA 4CLEA 5I6DA 5JZMA 4Z4ZA 3PNQA 4ETMA 4DLLA 3WGHA 4QU9A 4UEOA 2AVNA 3ANSA 5BW5A 5K6RA 1U0OC 1SAYA 2DFDA 3C16C 3A3BA 4YONB 2P9CA 4S1TA 1N2ZA 1OZAA 2C04A 3M89A 1C0KA 1KS9A 1NMYA 1P7WA 2QX9A 3HI4A 4V02A 3SZMA 1HLGA 2FVYA 4LQ4A 3WC4A 1UJBA 3TGLA 1Z6ZA 1O95A 1DHTA 5FR2A 4TMXA 1Y80A 3PIRA 1H0KA 4DA9A 4AG3A 1TT5B 2IEAA 2AQHA 1DAEA 2AFIE 4M7RA 4FNMA 1H05A 5H3LA 2HR1A 4PSUA 4AKHA 1J07A 1GSAA 4F5EA 2ZRBA 2CN1A 4GD3Q 1BN6A 1TF5A 4IS2A 1N1EA 4JBYA 1YB2A 4ZQGA 4FDMA 3UZUA 4D26A 1FS5A 1UJ5A 3IAAA 4KQ6A 5NULA 4B4OA 5LD2C 1FRQA 4M0LA 1HMPA 2WMDA 3BJMA 3ICOA 1I6KA 3QJ5A 2QJWA 3L4SO 1DAFA 3TTYA 5CLHA 3QJYA 4CF5A 1P4JA 4BO1A 2H4YA 2EYUA 1AQYA 2GJPA 1YMVA 4I8XA 3U81A 4IW3B 3T9EA 3TKYA 3VYWA 3K9GA 1U2QA 5K8CA 5KSOA 3ZJUA 1ARZA 3UO8B 4EFKA 2OR3A 1VJ0A 2CEKA 5KNCA 2Q0QA 1AMUA 1C0EA 2XZPA 3SFZA 3U9TA 4N12A 3Q9UA 4ZWNA 3WLTA 5AK5A 4J7CA 5K8UA 3NW9A 4PC7A 1Z0JA 4JH0A 3CR3C 1UEIA 1Z83A 4BOYA 1BXRA 3HZHA 2JBAA 1VLLA 1DX6A 3INTA 4KZPA 3GFVA 3GVXA 2FSUA 4OHUA 3SLKA 1RJWA 3DTTA 3JYPA 4JHXA 4K6MA 1NDQA 1G8KA 1OX6A 2OKCA 3IDFA 4WE3A 1C9MA 4NG4A 1CRLA 3IT0A 1F20A 1XVVA 2C4MA 1FNDA 3TNDA 4X7CA 1ISFA 3BMQA 4LHSA 1Z35A 1SUEA 4IEEA 4YIHA 3PRJA 4I5GA 4BMYA 3UTDA 4BC0A 2ZK7A 2WSMA 2IYRA 5E38A 3TTTA 2QTRA 5LD2B 1ESNA 5KS2A 3K71B 3QKSB 3I9FA 4PYRA 4KYTA 4EG1A 5GGYA 1NJ1A 4KBYA 2VBTA 2HGSA 3W7VA 5JEDA 3WJAA 5CVVA 1I5RA 5JECA 1LTKA 5LFAA 2H2FA 1YFZA 3HYLA 4RJKA 1U98A 2CHVA 1VB3A 1U1DA 1FYXA 5EP3A 4AUEA 2JFYA 3TOZA 3OEHD 5IN4A 3DMRA 1K7CA 1F51E 2PUJA 2GHRA 3LKZA 1B8PA 1IZ9A 1WVGA 1T8RA 3DP7A 3KVOA 4RDIA 4AJ1A 4AL4A 1LRLA 3E2PA 3TUZC 2HPVA 3CF4G 3R3ZA 5CLLA 3GD5A 3IAHA 3EN0A 2FMIA 3C43A 4OB8A 5IVDA 1RM5A 4GECA 4K9SA 1LPNA 5EWMA 1D2HA 3R6LA 1HE4A 3O75A 2FXIA 3R8FA 1MN6A 2X4IA 1D1SA 3K5HA 2D2FA 4GWGA 3L4BA 1EFPA 4QHTA 4A15A 3SU8A 4B2LA 3P71T 5CUQA 2GZMA 3T4UA 5G3ZA 1QBGA 1QRDA 4TXMA 1J39A 4MVJG 3NIWA 2DFVA 5JSQA 1N33B 1AHPA 5FPSA 2PRKA 3VVLA 1GZ3A 3HN2A 4K9MA 3CPSA 1VE9A 5EMHA 4J0DA 4KVAA 2D13A 5ALDA 4YJHB 4CM7A 2LGJA 4FHEA 2CUTA 4IJ6A 3DLCA 2FZVA 1BPLA 1S7CA 3L1HA 4U7FA 3THOA 3EYAA 3TEJA 5BPFA 1NYLA 1SKYB 1Z12A 3KPJA 4L9WA 2P3SA 3VNSA 1NVWQ 3PDUA 4MW6A 2UYCA 1CRQA 3JZAA 1RQ7A 4X1KA 2CHFA 1RRCA 2FPKA 4OGFA 4M1SA 5CVJA 2C7PA 1H8ED 1V9SA 4Y2JA 1QFMA 2J08A 4XDZA 3ANTA 4DLZA 4F4CA 5T6BA 4MUGA 3WMFA 4HI0E 4CPDA 4DQKA 1KIAA 5E6RA 3K05A 4PLPA 5FTKA 1OH7A 4K9PA 3PEEA 4U8GA 2BVNA 4AJ9A 4NAVA 2A1UB 4P2BA 4ZARA 3ZHBA 3D6HA 1FFXB 4G1CA 4Y1GA 3EE6A 4AS1A 4OQ4A 3EDQA 4BRZA 1MH1A 4WBXC 1VF7A 2FPSA 4LDRA 3NANA 5TIIA 1HT0A 1FFBA 2UXDB 4YC7A 1SGWA 1TM5E 2X4GA 3GMSA 1V8FA 1C3XA 2XBMA 3V8RA 1BOFA 3TR0A 2BGNA 2W11A 1X7YB 1YIJB 3ZY6A 5BYBA 1KD1D 1VBNA 2NTNA 4TL7A 3S1AB 3SYMA 4F56A 4XTCS 2VZ8A 2GR9A 2CJFA 1GPDG 5J1TB 3EY9A 4ASUA 3GHYA 4RVCA 3U7RA 3HDYA 5F7ZA 3A3GA 2CKDA 2GZDA 3A31A 3K73O 4TUYB 4WINA 3T5BA 3Q88A 2ZXIA 1Z47A 1I4TD 2REQA 4HGOA 4E7OA 2F00A 4GXRA 1RAIA 4U2KA 3WV5A 1F4LA 4OOXA 1GNSA 2QF7A 3IE2A 1FMTA 2VJDA 1IOVA 3A3YA 2CJXA 2LZJA 3FDZA 2I62A 5C18A 3WLAA 1OBCA 2PKXA 2DXIA 2H06A 1QH8B 4UATA 5BSYA 4JBXA 2WFZA 3V4LA 2OPBA 4FYHA 3SZLA 4CG1A 4CMHA 3KQOA 3W9UA 1YK1A 4J1NA 1GZ6A 1RI5A 1U3WA 1ATZA 1EUYA 1TJPB 4GZLA 4QWWA 5FWYB 5K20A 1CF4A 4H3KB 4TYWA 1YFJA 1XKQA 4BP8A 5FBLB 1N57A 2GK7A 1CFZA 2QD2A 2P6OA 3KJZA 2VPXA 3P7MA 3Q85A 2ID8A 5IYNA 2E48A 3DBVO 4IFEA 3Q9NA 3C3YA 1CY2A 2A33A 5BQPA 4BBJA 4Y2XA 1A2QA 2P2NA 1BROA 1JFLA 5AKZA 3GCGA 2X0DA 4E31A 1QYXA 4NYMQ 1L8OA 2O0MA 4XM3A 1DO2A 2BFMA 1SVUA 4INPA 4J1SA 4P98A 4D1YA 1JLSA 4GLBA 1J4AA 3KE9A 3HYRA 2I78A 2ONZA 1E5TA 3LQ2A 4CKCB 2PLWA 1VSTA 4J4TA 5TQJA 2WU0A 3ADCA 3Q6NA 3R0ZA 2ZL7A 1NJGA 3MJVA 4I14A 4W82A 1FSZA 4JB8A 4Y9SA 3U3RA 1WXEA 4BQEA 1GYRA 4GSYA 1EZZA 2Q9AA 4QGHA 5GONF 1D0IA 1S2NA 3EUEA 2ZWPA 4DNXA 1LV8A 3CCRB 4PG6A 4FB4A 3RSFA 1TW3A 3GJ0A 5TMBA 2PXCA 3STVA 5BNWA 3MTBA 4KACA 4PM4A 4B31A 1XU9A 3B1KA 4M1OA 4A26A 3F2VA 3HO8A 4WOKA 2ZT5A 3H2SA 2DPYA 2LV8A 4Z7JA 3BCDA 4BYGA 1M67A 4G0WA 3VOAA 3L6DA 4LSWA 2MSEB 4XX0A 3GLFE 3OTOB 2AZMA 2PTGA 1ISIA 3OH8A 4E09A 1WCIB 3WWOA 1W85A 5BWMA 1XXHE 3FWHA 1BZYA 3LIPA 1HNXB 1CUSA 1TGVA 3USES 1H8EA 1R0SA 2ZQ5A 3L41A 3U3JA 1HDOA 2NO0A 2N3ZA 1T26A 1ZC4A 3IMEA 3EXAA 4CMJA 4CU2A 4JLJA 2DFTA 4QDTA 2R4QA 1ONPA 7REQA 2PD6A 3KAJA 3IQHX 2HXSA 3DYIA 3QEMB 2C2YA 4DR3B 2PUDA 1QTQA 2R48A 4IGAA 1VHQA 4E21A 1XRQA 2NUAB 2P90A 3ZLJA 2WZQA 1R0XA 3NKLA 4QFDA 3HKCB 2C3MA 3U3DA 1J8VA 1E2NA 1RRVA 1YRLA 2JGAA 2YJTD 3FOWA 4MGHA 5A71A 3VPSA 4CUZA 4YJ2F 2PZEA 2V6MA 2VP6A 5ED4A 2BMWA 4P4GA 3ZWPA 5CYOA 2PUBA 4C4ZA 2QKYA 3MCAA 1W76A 3PVSA 3GB9A 1NJSA 3WS7A 1D4ZA 1XWFA 1KWKA 3PR3A 1IK6A 4HGNA 3BIXA 3ZHYA 3QX7A 1JEQA 5A5FA 3I92A 1JEDA 4NE9A 2IYVA 1V95A 4YI5A 3DNMA 4MKXA 2XZTA 1RRFA 4ZV7A 2IEGA 1DC8A 1AN0A 1NTOA 1LLUA 2H48A 1IWPB 2P67A 1ODLA 4JMQA 3DMNA 5F1YA 5C1DA 2Q1TA 3ZJTA 1HRDA 4YJ3B 2PUWA 2C9OA 3IUBA 4IDQA 4DG8A 4FGZA 1YO6A 5E7MA 3BD7A 2PU5A 4XWTA 4XWKA 3DKPA 3IUPA 3SIPA 2GKGA 1KK0A 2NUTB 4S1PA 1FSSA 3O73A 3UWSA 3PGKA 4CHTA 4DVGA 3EXFA 2HUPA 5D7NA 2EQ5A 3HBMA 2WD9A 3YASA 4QU8A 3DL2A 3L1UA 3LP5A 3WOVA 2QGNA 4P3IA 3COVA 3E7XA 3EXIA 4INJA 2EHDA 1TYCA 4P1ZA 4Q4AA 2C1XA 2DOGA 2GBLC 1BE1A 2PRZA 4IMJB 2XJ9A 3T34A 1P9LA 2QAIA 3L0OA 4IQ4A 4H1UA 1BEUB 3M9WA 4R2HA 1WB9A 2VG8A 4GBGA 2ZI4A 3SSMA 1RT9A 3VVMA 3DOOA 5SZKB 4JENA 1C3EA 3V34A 4TV8B 1IULA 2IKSA 2PBFA 2H7YA 2WYVA 1FX0B 4BZWA 1XTTA 4KMMA 2IBTA 1E7YA 1PT7A 2W90A 5C0OE 4OLFA 1Z5GA 4F3RA 2B7BA 4CLRA 1SQ6A 4EGCB 5JUWA 3NX4A 4KB5A 3ZK8A 3JPWA 3FZNA 4K6FA 1NR1A 1PZFA 1ZD3A 4XLZA 4TV9A 1XNRB 3PENA 1PG0A 4ZEXA 2AOTA 3H1FA 2I3DA 1E9FA 3T5TA 3TDKA 1ZOOA 4DMKA 1WXHA 4TTIA 2Z04A 2I7DA 3RVQA 3MSCA 4AFNA 3DEKA 5TJHA 5E9AA 1M0EA 2WHPA 4KN6A 2D6FA 3DV9A 1ZC3A 3K15A 1W73A 4KJXA 1C0LA 3NYWA 4BRUA 2YWXA 4JLAA 4EA8A 1XAGA 3A6FA 4OQLA 1Y3IA 3VO1A 1UP7A 4NMWA 1UDBA 5F12A 1HYEA 4CDRA 5D1HA 2XNKA 2QD5A 3NP9A 4QBFA 3RSCA 5TGTA 2H18A 2RHGB 1Q16A 3EQ9A 5A4DA 2PWPA 3EEYA 5F1OA 3GDHA 3BTVA 3HBFA 4CQNA 5CG1A 1S4QA 3KPUA 1F1JA 4FCVA 4EARA 2KI5A 5IMSA 4JODA 2Q7XA 3EEOA 3H13A 1DRJA 3DW1X 3RB8A 5LOVA 4P80A 1JFFB 1VLHA 4R2WA 2ODBA 3ICWA 1M7HA 4O4LF 1B6GA 2IDMA 3SOPA 2WJWA 2V96A 1OR8A 1JAXA 1N5OX 3U7QB 1RE1A 3NYRA 5LXTB 1M9NA 1G98A 5KWVA 5K3FA 5I8WA 4IS3A 3CIOA 4GKAA 4TGLA 4ZOLF 1PWYE 3Q2KA 4POOA 1IXSB 4CDNA 4JJEA 5DT9A 2F48A 1H2YA 1R5JA 3HM9A 2A5JA 4RFSA 1GKYA 2IP4A 1O6BA 4RDKA 4TZKA 2BGKA 2Q4OA 3CRRA 4R31A 5CJPA 4HX5A 4I1RA 1OZFA 2PU7A 1V8ZA 4KXNA 3FCCA 3L8EA 1F8FA 5BV8A 1IBLB 3O3OB 4ZT4A 1SXJD 4F7DA 3KJHA 3RSOA 3TTXA 3U4IA 1EVEA 2H2GA 2X5NA 3EEQA 3V80A 2GT1A 4R40A 4JHLA 3MMNA 1UBFA 1AUPA 2P2YA 1PR2A 1UK9A 3AI3A 3K3PA 2H00A 2VK4A 3T9BA 4DCGA 4EUKA 1Y5MA 1OT3A 5B3AA 1Y0BA 3I23A 3PF9A 4LCJA 5THQA 3QBDA 4RF2A 4W9RA 4UVEA 3EPHA 1B74A 4LOIA 2G1AA 1FEZA 4NG5A 1U65A 1DBIA 1Y1RA 4K87A 2NZUG 2XRYA 1GT91 1ZK0A 1WCIA 1TKRA 3B6MA 3BGOS 3X1XA 3CUTA 1UODA 3L6UA 3PHIA 3FFWA 3HY6A 3VPCA 5JYEA 2FVGA 2FUKA 2ZUWA 4JVNA 3R76A 3A3NA 1ZIYA 3MXOA 1BDBA 5L7WA 4KO3S 2QQFA 2WUGA 3ZDDA 1W19A 4Y6RA 1J2UA 2RHCA 2BFDB 5IDXA 5K3BA 4CIYA 1ZJJA 4C7VA 5K0CA 4KR3A 1P0CA 1EQUA 4P5PA 1PR3A 3W79A 5GZ6A 4TTAA 1S3GA 1DOZA 1AQIA 1FJGB 1CUVA 1FMJA 3VKHA 1DV2A 4YRMA 4ZVOA 2C5LA 3CEHA 3REQA 4YB8A 4HE6A 2BM9A 3OZ7A 4A8JC 1RLMA 4FSHA 1DLIA 1KMMA 4GI1A 3NNNA 1S9DA 3GVPA 4CMIA 3GYGA 3QLJA 5ALLA 3GGJA 3GRCA 3ENKA 4OB6A 1JEQB 1ORRA 2BBSA 2FE4A 4D0SA 4KNYA 3QFFA 5DNEA 2P4EA 2ZRJA 2WT4A 4NMLA 1VKZA 4R3NA 4RADA 1NL3A 3QW4B 4M0EA 3ZDBA 2WWFA 3MA0A 1PBTA 2XD4A 2Z5GA 4DR4B 1ANKA 1ZUHA 1GZ4A 2WWRA 4EJSC 3W2FA 3L79A 3ZCUA 1RAAA 1PLLA 1BEEA 4DMUB 5JQGA 3PXCX 4L8GA 2YN2A 2X13A 2AK3A 2CFIA 2ZJZA 3OESA 1PTJC 4LY6A 4DARA 2HK6A 3LI2A 3DEAA 1AHNA 2C07A 3JR7A 4WVFA 4HH0A 1EHYA 5H02A 3QXHA 2RK6A 1NNEA 3LQ1A 5KYXB 4BQNA 2R00C 3DMTA 3N7TA 4NARA 4DMGA 2C7QA 1VLMA 2A5LA 1C3OB 3PS9A 1LDNA 2XQFA 3RUPA 1DZ3A 1E3DA 1XELA 4FX2A 4DSNA 1X14A 2A9OA 2PZBA 2CL7X 2FR0A 3DZDA 4MYCA 1Q12A 4YO7A 4CFZA 7ADHA 3A04A 4B17A 2XWBF 3KRTA 3KVYA 4ZRMA 1C3JA 1FUIA 1L7BA 1S7GA 1X9GA 2B6NA 2NZVG 2XOEA 1KTIA 3HM2A 2AF4C 2W2QA 3BQ9A 4TMWA 2NSHA 3SZ3A 5JZ9A 1MX5A 4FFWA 1JWBB 1R7RA 2R2AA 3HJGA 1EX1A 4XQCA 1DJQA 4TYMA 1UFVA 4KVZA 1IPFA 2XMSA 4UVDA 1C30A 4UQOA 4H4EA 2VSYA 4MLCA 4N8SA 3RBAA 2VT6A 4M2LA 3TLCA 4TRNA 1A5TA 2HZBA 3NGXA 2HQOA 2F55A 5EKDA 1T5SA 3OJEA 3GBVA 1RQRA 4EUSA 5D2CA 5HE8A 2VO1A 4TMVA 3ET4A 5A05A 4C0HA 3EH1A 3WRVA 2JRCA 3ITKA 1W5TA 1USWA 1XZIA 3NZEA 2CLOB 4C4XA 4DQLA 5JH7A 1JU9A 2HADA 4K86A 5G0WA 1KHTA 4ODIA 3Q1KA 1AHIA 2O52A 1QGOA 1U28A 2CE7A 2QAGA 2ZQZA 4QXQA 4GR4A 4B9EA 5AIBA 2H51A 4BJ6A 4B85A 5H8WA 2OGSA 5CA1F 3IFSA 4OJNA 3THYA 3P5SA 2VYCA 3OZXA 1EUDA 4Q3KA 4CMEA 5AVWA 1E6KA 3L0YA 4CKXA 4DLTA 2QTVA 4Q3CA 2IS2A 1MJ5A 2O3UA 2IPMA 5AHOA 4BVLA 5AVZA 2PLFA 4CMAA 5F73A 4X0CA 1TF7A 4FDTA 2CNKA 4DEYA 4Q18A 2ENWA 3AEUA 1R4NA 5HZKA 3MFYA 4NS1A 1FW8A 1HT3A 4PHGA 3ZIDA 2N46A 3F7OA 5D3MA 1BO6A 1MX9A 2I80A 5TF0A 2OD2A 1PX2A 2J7KA 1G6KA 2X1HA 4GRIA 1CYEA 1H6CA 3OU7A 5FFFA 5CCXA 2PAFA 1JSLA 2G4CA 1EDZA 2UV8A 2G6BA 5CLGA 2LR0A 4N40A 3NETA 3QWFA 2H9YA 1ORDA 4XLTA 2ZJ2A 1M1NB 5T4FA 3UT6A 5CVUA 4EAAA 2WSSD 1EESA 3KWLA 1BNCA 3H87A 5ETJA 3W9BA 1S2OA 2QQ0A 4RD4A 2Z2JA 3ZY4A 1I4DD 2O7QA 3A58B 3S68A 4W5WA 1XRSB 2ZYSA 2ZROA 2DULA 2XAUA 1C7FA 3L84A 4KI7A 4LJAA 2AJCA 5HKBA 1H1TA 4OUKX 3H9JA 2YBEA 1CUJA 3D54D 2E85A 3ILYA 4QECA 3WYNA 4E5VA 1XRJA 1FOEB 2ZS7A 3B7GA 3VSAA 3WLNA 3FTNA 2RHDA 4CUJA 1YVDA 2QRQA 2YN0A 1VA5A 5JCJA 2TMGA 1E8MA 3M0EA 3RTGA 4CLXA 4JEHA 3UMFA 4EB8A 3HA3A 1NQVA 5TY0A 4CI0B 4H7JA 1CPYA 4EW6A 1F0NA 1W9XA 1UZMA 4GXQA 1ECFA 1U0EA 2VJCA 3HYSA 4P86A 3CR8A 5T3UA 4D2IA 3BD9A 2B8TA 3FBGA 4DC0A 3I73A 2FFRA 1DAOA 3GT4A 5CB4B 1MA3A 1N36B 1RKVA 1NIPA 1KAEA 2C0CA 3RODA 4BMXA 5JI2E 2UVPB 4WI1A 4G4JA 5DP1A 4R9UC 4UCXA 2F7SA 3BJZA 4YXFA 5CEEA 1Y82A 1IL0A 1ADBA 3KR2A 4N49A 2XGMA 3KKQA 4AMYA 4QTYA 1ORIA 4ZAYA 3R3SA 4P34A 2JFUA 3FPBA 3KHSA 1FSGA 2EF1A 2JGDA 1JGTA 2YWRA 4E33A 5JMTA 4HLUA 4FEEA 2QTLA 4JBWA 4PX5A 3WP0A 2E87A 4KE9A 4UQPA 3QWIA 2D9RA 2SBTA 3CZRA 4K2HA 3ICQB 3ZCXA 3ESAA 4OLBA 4TV8F 5ALKA 2H16A 2YQ4A 1SK9A 5E1MA 1KP2A 1PJ3A 1FXWA 1U8EA 3KZCA 5JXIA 2YY7A 4PAGA 5IH3A 4BJ3A 2P2DA 4Y6GB 3KYDA 1X7ZA 1OWPA 3OQOA 3FVQA 1G3RA 3OZEA 5ALRA 3A4MA 1PK8A 1IFXA 1NBAA 1WSAA 3DXFA 1R27A 2C2ZA 1IIBA 5L45A 2X6RA 2ILVA 4NMHA 1BVRA 2KYRA 4QDKA 4N3BA 2WB4A 3BXHA 1DJNA 4LJ5A 5G53C 5HIAA 1TD1A 4O63O 4L5JA 4YMGA 1U2PA 4Z7QB 4KHPB 4XM0A 4AF7A 1J7KA 1OXSC 4QYIB 3V48A 3WQZA 4RORA 3D26A 1BX3A 3B38A 4AY4A 2NLOA 1BVYF 4X07A 1V6AA 2O4CA 1JDNA 3AIMA 3RGWS 4H0FA 1NFQA 1P91A 1GAWA 3GVLA 1D2AA 1QYVA 2JGMA 2ROQA 3FSEA 3B1XA 3IBSA 3M1YA 4X93A 4D6XA 3PEWA 1TQ4A 2E5WA 1N0WA 2D59A 2UYYA 4XKJA 2UVQA 4XYGA 1WNTA 4G7WA 1WZUA 1XQ9A 2WJHA 4MV1A 4QLAA 2A1TS 5HA5A 4CKCA 4RJTA 2WIFA 1U0JA 1NXQA 2EWVA 2DPMA 3GJ7A 4ALNA 1KBQA 2DFNA 1CQIB 4XJSA 3WK4A 2ZIWB 4Q24A 5JANA 3K53A 3WWEA 2MR6A 2BYTA 4G8BA 2A1UA 2JJ2D 2NXWA 3T61A 5BXQC 1ZEJA 4ND7A 4ARZA 1FZTA 2VPYA 1N07A 3FUCA 1Q1GA 4BGEA 1VL5A 2I4LA 4ZYTA 2VTBB 1CR2A 2REBA 3A8KA 1TK3A 4BO7A 4JQSA 1Y33E 2EXXA 1I1NA 2AWOA 4R3WA 4A10A 1HE3A 3PQCA 3MTIA 2PMCA 4Z53A 2I6QA 3GVIA 3Q7SA 1Y8RB 1ZP6A 4MWTA 2O07A 3O92A 3K6SA 5EWJA 1QAMA 1RFLA 1E4YA 1U1EA 4OJYA 2PVCA 4FYVA 3SMVA 4XWOA 1R64A 3CVYA 2XDWA 4U7PB 4H18A 1Z3CA 3FHOA 1BXRB 5JNRA 1JHYA 1N5DA 1NY5A 2ZSHA 4GGOA 3RFVA 2C9ZA 3TBFA 2Q4EA 4WNAA 1HYGA 2FPGB 4I55A 4Y2QA 4ALKA 4F71A 3G2JA 3KOZA 5ENZA 3SGLA 3D8TA 5IBCA 4KQ2A 1WSDA 2ZAGA 3F3KA 3E9DA 4I9NA 3C3MA 3RKSA 4ER3A 2ATVA 4JMLA 2C1EA 1Q0UA 2RBKA 4OP2A 1ST3A 1A7KA 2BKAA 4L50A 4UCWA 3T3DA 2ZXUA 2O19A 1I5EA 3KQSA 2ZYUX 3A9UA 3CLVA 3QMWA 1L4NA 1WUKS 3LUFA 1L1FA 1MW8X 4JJ8A 2WPDD 4UAVA 5JIBA 5IM5A 1PGQA 5B53A 2BGTA 1E7MA 1JU3A 4CV1A 4YMVA 5CD9A 3CCFA 1FXWF 4GVLA 1QIFA 1XF1A 1YDEA 3B7WA 2MSDB 2VT7A 4B6EA 1Y7PA 4YXWD 3CVWA 1L5GB 5LMUB 2ZU6A 3VI3B 1T1RA 3PC8C 3D8BA 2UZAA 4FXPA 2ZTMA 4BTLA 4OEHA 4EDHA 1QGDA 4QUKA 3EPJA 1EX9A 1YDWA 1L5HB 3AHJA 3EZFA 4AZ3B 1KR5A 1A04A 1DWOA 5IAOA 3P26A 4RPBA 1VMEA 4O33A 3FHLA 4JFRA 1VHOA 1A5BB 3GQVA 2G36A 3U3ZA 2GEFA 3JQAB 2G70A 5EJIA 1J06A 4Q7JB 4MI3A 4LDPA 1PVVA 4OSPA 3X1DA 4OP7A 4WTOA 4ZVMA 3NTLA 3IMCA 3OPNA 3ZQJA 1GKUB 3C6KA 3WDKA 1P4MA 3EDRA 4ARUA 1N8TA 2BGGA 4DR2B 4EJSA 2FI1A 3IESA 3NEYA 4IDBA 3CZ9A 1OAAA 3FTDA 1CY8A 3IVGA 4GUDA 3ZNQA 1ZM4A 4K46A 2PK3A 1I10A 1YB7A 3BH0A 4LXTA 5EUCA 1V43A 2X5XA 4ZVNA 3CWZA 3KR0A 4RVHA 3O1JC 3BRWA 4URXR 3UJNA 1YCDA 1EX6A 1PT6A 1YOBA 1QTIA 2I22A 4DIEA 2Z6QA 1RMQA 1GTZA 4L16A 2BGUA 3OQIB 4P08A 4PPFA 1XQVA 2XHEA 3CVUA 2XDAA 1IBRA 4U9HS 1DZIA 1RWKA 4WBNF 4YLYA 3KZOA 4YREA 2NACA 1JFSA 4DLSA 2D1YA 3SICE 4GOND 2CNBA 2NOAA 4R2XA 3PUMA 3PT9A 5DNVA 3DGEC 5F7JA 2D00A 1AX9A 2ZB8A 3K92A 3LDHA 1FX1A 5IJ0A 2NADA 3H05A 3NC4A 3L18A 4XSHA 3RUFA 3RYCB 3UPUA 1A72A 2LP4Y 4YCAA 5AJVB 3I55B 1GXSA 1UDCA 3ELWA 1K4YA 3OZIA 1JW9B 2JG3A 3B52X 2GSDA 4DC1A 3F5SA 5JBQA 1XTRA 2JCGA 4BEJA 1P7VA 4D9NA 2X2FA 4H1WA 3ABRB 3M6VA 4Z4FA 1NBWB 4OFBA 1E0KA 3INYA 4JI0B 4MV5A 4LJRA 5EHIA 3ZK7A 1GLGA 1HDCA 1NJ5A 1HO3A 1WMFA 2A78A 2NGRA 3CLRD 4LXYA 3KDAA 1RP1A 3EVEA 3C74A 1O97C 1SOMA 2H07A 4OG2A 2W2MA 4KW7A 4OYLA 1WXIA 1JBEA 1URPA 3EPRA 5MN5A 1L2TA 3W5BA 1L5KA 1GZUA 1U9CA 1L6RA 1FUUA 1SHJA 3KJXA 4CM8A 3WRYA 5BW4A 2D2IA 1WF6A 3FG9A 5A7HA 4LA4A 1SRQA 4QYSA 2E4UA 4JY7A 4KRXA 2AXQA 3P32A 5KTMA 3Q6QA 4EHDA 1O94C 1AQUA 1SUAA 4HIZA 2A5FA 4Z4TA 2HBYA 2P4QA 5CVTA 4OXIA 1ECPA 2WVJA 3KXDA 3LBIA 4EHHA 2CMGA 1IVYA 1UK6A 4NEQA 3PITA 1BGWA 1C3LA 5JD5A 4DLRA 4UAGA 1PSWA 3DTYA 2X53S 1TCUA 1Q77A 4WXRA 4AO8A 1F8GA 1OE0A 2F3RA 2WPDA 1WB4A 2WF8A 3DXXA 4DK0A 3PJDA 4WKPA 4Y6LA 1RABA 2BCEA 4GZMA 2F8LA 4REQA 2IVFA 4YMUA 1K63A 1IN7A 3L8GA 2CNWA 2GVZC 4I4TA 4Y2HA 1T4CA 2HJSA 3QU2A 3UATA 2SICE 4EL5A 1Y42X 1CQJB 1GL3A 2RH5A 3F97A 1Y1SA 2VUTA 4R1OA 2WAXA 5BWCA 1OTHA 2KPOA 3P96A 3OPYB 4EW3A 5CJ2A 3T7KA 1GM5A 3V8NA 3OQ1A 1CJKC 4GH5A 4ZFNA 3DUFA 2IPLA 4K7JA 4AMUA 2BFPA 3NRBA 4A0SA 4MWSA 2VNIA 2C0PA 3MMXA 5EERA 1H2FA 5BWNA 4NNJA 4PR3A 2GM3A 5LZ7A 4CIXA 3UBTA 3USCS 5EJGA 2X14A 1H66A 2CFRA 3OQMA 1SQGA 4F8EA 4I1YA 4RD2A 3U13A 1KO7A 3B1FA 3HKCA 3VQTA 4IFBA 5ES4B 3WJ2A 3FXAA 1UD3A 5FFNA 2OE2A 3BXXA 5GINE 2EKBA 3U4DA 2WJ3A 2VN8A 1Z0DA 5DSXA 4ESOA 2FWIA 1LDYA 2BFNA 1EXNA 4JELA 2WWGA 1KIMA 3CQ9A 3T1HB 3T3MB 4DV5B 2EKZA 3EWNA 1T1GA 2AEFA 3VH2A 4QAJA 2G3YA 4BKPA 4I1IA 5DHQA 2YDXA 4X84A 3V8PA 3IQFA 5FBRB 1OY1A 1P2TA 2I4MA 3SBXA 1G2OA 4NJMA 3NS7A 1XF9A 4M9CA 2D5AA 4NCNA 2FEPA 3QUAA 3PD0A 1S1MA 4L4XA 4GMHA 4K6GA 4JT2A 3KUXA 3KHKA 3M6IA 1P9OA 1SVKA 5L95A