4RD0A

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gdp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVAHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd0A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd0A01
1A5TA 4GSYA 1VYUA 4G1UC 1TF7A 3SQXA 4TYPA 1XPOA 4MGZR 2BDTA 1E63A 4PR0A 5KNCA 1GSIA 3U3MA 1JPNA 1R0ZA 3KQHA 4R7ZA 5EE1A 4WW0A 1E94E 2OXCA 4C4PA 1KRHA 2W83A 2GEUA 2DCUA 1CBUA 1Q22A 3CRVA 2G88A 3B9QA 3RS4A 3CCJB 4UQOA 4DUGA 4MQBA 3TQCA 4EFMA 4DLVA 3MRSA 2RMKA 1DS6A 1BMFA 1SXJE 2KSQA 3PVSA 3OEHD 2ZR0A 2Q0HA 1QG2A 3GJ7A 4P4TA 3TR0A 2ZANA 2O8BA 2QP9X 4LUCA 1KO5A 2IUSA 3TLXA 2PMKA 2QDXA 2OESA 1KK0A 5J47A 2QT0A 3NHAA 4Q02A 4P3YA 3REFA 2QG6A 4LV5B 3WXMA 2ZU0C 1UDXA 2RGDA 1NVWQ 1EFRD 3OIYA 4FINA 1G3QA 3M4YA 4ACBA 3QXSA 1G7CA 5KU1A 2ZRDA 2XJ4A 4M1OA 2ASEA 1W48A 4TMVA 1VYTA 2JJ8A 4II7A 3SBDA 4KAXA 3HYTA 1CLUA 3ZD7A 3I5YA 2BEKA 1II8B 1QHNA 3F0TA 1N6PA 4C0AC 2QMOA 3N70A 1OPXA 4OK6A 3THWA 1N6RA 1XWIA 3PJRA 2B21A 2DR3A 2MSCB 3AVYA 1WE2A 4LJ5A 1RE0A 1KI6A 2GF0A 1Z07A 1ZM3A 2QORA 3MHPA 1YHQB 4D4JA 3DM9B 1LY1A 3NBZC 4OHZA 4N0DA 1RPZA 2A5GA 3TIFA 4HUQB 3QFRA 2XOKD 2XOKA 3K9GA 1M6NA 4YC7A 4V0LA 4URXR 1KSFX 2XJ9A 3AVVA 3QIAA 1TU3A 4GP7A 4IVRA 2ZIAA 3U7GA 1RRGA 3AM1A 4AKHA 1I2MA 3RS2A 1QX4A 1VTKA 2CE7A 1KNXA 2CK3A 2WM9B 5DE3A 3X1ZA 5TDHA 2DFKB 1YZTA 5H1YA 4PSAA 3CNLA 3U3OA 4QJ5A 5KSWB 2DPXA 1SVKA 1BH2A 3QKTA 3VU9A 4TMZA 1MR3F 5E7MA 4BPRA 2XNJA 2IF2A 3Q9LA 2AR7A 4Q18A 2P67A 3W5HA 1EG7A 1X3SA 1II0A 1UPTA 3HYRA 4ABYA 3CCSB 1M7BA 3TQFA 1M1YE 5EP3A 3ES9A 2IHYA 2V8OA 3WNBA 4M0LA 5LB2A 2QE7A 4CYMA 4FN5A 4F4CA 2C98A 2OLKA 2ZAOA 3CBQA 5HR5A 2AL7A 2OM2A 2OSBA 1XEXA 1FTSA 3H84A 1G4UR 3U61B 2IC5A 1G5TA 2Z5FA 4IDPA 4EPTA 3B82A 3Q5DA 1H85A 4FK8A 5IRCD 4YAUA 4JYCA 4M22A 5P21A 4TLCA 1Z8FA 3D3QA 3Q3JB 2ZRPA 2ZETA 3QQ5A 4I99A 4DCUA 4Y9UA 4GNKA 5CK4A 1ANKA 4TQ9A 1P62B 4RD4A 2N1BA 1N6OA 3BOSA 1ZUIA 4GP6A 2XNSA 1BS1A 3UXMA 1R6BX 2HYIC 3EAQA 3ICEA 3CNOA 4PX9A 3ZVLA 2ZRGA 4MRPA 2QL6A 3QPVA 1JPJA 1FTNA 2QAGA 3OJXA 4I1SA 3MSXA 4P33A 1LF0A 2WAXA 3QBTA 4FCWA 3T1OA 4B3DA 4BFSA 2GF9A 1NVVR 2HEIA 2KWIA 1NVVQ 2P6NA 3EIQA 1CR1A 1W36D 4QOSA 3PUWA 1BYUA 2WWIA 3KKPA 2FH5B 2WJVA 2JATA 1XDBA 4WOPA 3GLIB 1CJKC 3I1FA 3UMRA 2BM1A 2GZDA 3B1WA 3VNUA 1XMSA 1Z0KA 2FZLA 3G5UA 4OHXA 4S35A 2F43A 1R8SA 4XH9B 2XNDA 4ZCLA 4ZO4A 2NIPA 2ZI7A 4QFMA 3H86A 3K9HA 4QGAA 3VR4A 5JLJA 4H1UA 3NHBA 4HEJA 1TL7C 2NTYC 2YOHA 5FL7D 3LRPA 3NH9A 1LFDB 1UM8A 1G291 5A0FA 5K8IA 4ZDIA 2WOJA 4HLUC 4LGMA 3PEUA 4UNRA 1E9CA 1OIVA 5LPNA 1SVSA 1ZCAA 2VO1A 5FI0B 1ZRHA 1E9SA 4R71A 3QF4A 3AF3A 1VQ4B 3MAAC 4BRUA 3O8CA 2ZRHA 3RVBA 1LF5A 1KI4A 4PSKA 2CE2X 1FDRA 1MKYA 1X8JA 2Z6VA 3NBFA 1A1VA 1ZNXA 2B7BA 3GLFB 1UKVY 4JLAA 3BJIC 3RS5A 5JFGA 2X77A 3CWQA 2H1LA 1DPFA 2A5FA 1DAHA 1XMIA 3QF7A 3K8YA 2QU8A 3N2EA 1EK0A 4B48A 1WB9A 3OHMA 5C2JB 1GOTA 2BIFA 1GL7A 4C0KA 1OB5A 1GNQA 4B3BA 5ANRB 1XMVA 2EWWA 3CXCB 2P6UA 2BBOA 1VCNA 2FNAA 1J9ZA 1KO1A 1L8QA 4JJKA 1G41A 2J87A 4OQXA 1AS3A 2VP5A 2EFDB 1GUAA 2FF7A 1Z29A 2P5TB 3VX3A 4PPFA 5AN9A 4WIAA 3NEJA 5HCIA 1CKEA 3ICQB 2VNIA 4M1WA 1QVAA 4A36A 4NL4H 1DO2A 4DLSA 2AK2A 2BCGY 2F1RA 2OG2A 4LHWA 1TNDA 2VHTA 1K8RA 4MKIA 3TMKA 3EZ2A 3CRMA 3EG5A 2FOLA 2YV5A 3TKLA 4NYMR 3GP8A 3MWYW 1IN4A 2GCNA 5C4MA 4MRNA 1E1QD 3A36A 3V4FA 3HU2A 1DOAA 1HQCA 3U6KA 2CXXA 1QUFA 3EA5A 3K9NA 1EWRA 2HUPA 2IXFA 2RHMA 2WMNB 3IIMA 1JALA 3ZYCA 1E9RA 2IYQA 2IXGA 1ZNZA 1BX0A 2F1IA 2YOGA 3LX8A 3BIFA 5DLQC 1P2TA 4D0GA 4HAUA 2IYTA 5H59A 3AB3A 5G40A 2H16A 3LVQE 1NN0A 5IK2A 2GPJA 2DWPA 3VHXA 4C0HA 2FFAA 1W4RA 2NO1A 1K73D 1J7KA 2H17A 2AD5A 4IEEA 1TU4A 2J45A 5GJCA 4DC9A 3UMSA 1E6CA 1KI8A 3LD9A 4TTPA 1NY6A 2ZI5A 2ZM5A 4QGFA 1UFQA 1P73A 4DSUA 4L5BA 5JMTA 1I7PA 3GLIE 1YJ9B 2RC6A 1F48A 2RGCA 4HAVA 4JVMA 3PG5A 1M1KD 3FWYA 2JLRA 4NBSA 2KBEA 2QT1A 1HT1E 2DHRA 2C8VA 2PEZA 4ILEA 1RC8A 1W4AA 1NLZA 2JDIA 2VZLA 3KQLA 1E9DA 2WIAA 3G71B 2WJYA 2ZROA 3QXHA 1P2VA 3B1VA 3OFND 5A5GA 1H8HA 3ZD6A 1H8HD 2ZS8A 2FSFA 2F6RA 4KFSA 5FOVA 1OH6A 1EX6A 5FTLA 3K1JA 5C18A 4DSTA 4JYBA 2Z43A 4B3XA 3RRMA 1KDOA 4MKGA 3OZUA 1KAGA 4K46A 4RY2A 1GM5A 4OHYA 1IBRA 4TN1A 4LOAA 1ZU5A 3JZMA 2IWRA 3GPLA 5L3QB 2ZJ5A 2AHOA 4Q5IA 2P6RA 4QXAA 1GJRA 1FX0A 1AIPA 3KJHA 5B30A 2MSDB 2VQSA 4Y0AA 5HKKA 4EPYA 1JJ2B 2ZAMA 1W2GA 4XVRA 4JBWA 1ZNWA 3GLIA 3SJBA 2LWIA 2QSZA 1T5IA 4HB0A 1J70A 2VA8A 4Q01A 5JCZA 5GV7A 3B6EA 3A1VA 1EXMA 3LXRA 1E2LA 1XXHA 3QG5A 4KBGA 2VRWA 4LRWA 3T61A 3AKDA 2ERXA 2VL7A 4LCBA 4KV9A 1ODFA 4NTZA 2AD1A 1LV7A 1N6HA 3V76A 5JI2E 4UJ3A 3QPWA 1TVCA 1ZU4A 4DB2A 2C5LA 3CCVB 3WY9A 4Q19A 4N3NA 4LJYA 1D9ZA 1RRCA 3GD7A 3DM5A 2ZVPX 3K0CA 2CHQA 4HB3A 4ON9A 4A6XA 3THWB 5TV2A 4PHGA 1TUEA 2HXSA 1YHNA 4PHTA 3IKJA 4TT3D 1BO6A 1ZNYA 2OV2A 1R5BA 3BAFA 1OXUA 5M04A 2XTNA 4RZ2A 4TTQA 3ADCA 2VHJA 1N6KA 1T8UA 2GCOB 1IN7A 3AVPA 4IEIA 4YALA 4MH0R 4F4IA 2ZUDA 2ZE8A 3F3YA 3FPAA 3OZXA 1HV8A 2QTVB 4TSFD 3SE0A 1AQUA 1E0JA 3FDIA 4LC1A 3GJXC 1DARA 1G1MA 1JR3A 1SXJB 2ZSBA 4CEIA 3TSOA 4V0NA 2QY9A 1CF4A 2W6JD 4KYIB 5SZIA 1MO4A 3CUEF 5D3QA 1GKYA 1QBKC 5DH9A 1OGJA 1MOZA 1RRFA 2NZJA 3WRYC 1QHXA 4KHZA 5FOSA 2ZI3A 4EJSA 4LK2A 5HZKA 2YVUA 4UJ5A 3OEED 3PEVA 3A58B 2V54A 4MGYR 1VQ9B 4DSNA 3LLUA 4K81B 1KJWA 3M6AA 3VQTA 2J0SA 2WSSD 2YJTD 1GR1A 1AMOA 3QE2A 4H9GA 1UDWA 2VTKA 3A4NA 3U60B 2C99A 1OIWA 3OZWA 2BVNA 1Z63A 1DAIA 3BC1A 4C3ZA 3TW8B 4BUJA 3NG1A 3AF4A 3ZVRA 4YMVA 4AKIA 3MCAA 1XP8A 1SVIA 1G8GA 3R9XA 4MRSA 1AKEA 4OJQA 2FG5A 1OV4A 4A4DA 3QFCA 2ERYA 4LWZA 1XJ0A 4P4SA 1Z6AA 2J46A 3N2IA 1JR3D 2PT7A 4GT1A 5JSZA 3RANA 1IXZA 3LO8A 1IY2A 2PT5A 5TB5A 1N0UA 3I56B 4R98A 4QBFA 2VSXA 4GOJA 4PFSA 2P3SA 4D0LB 3UG6A 1CEEA 3ZIAD 4D4LA 1VQKB 2B7CA 1U81A 4I4LA 3L8ZA 4PC1A 5CK5A 4M2LA 1MRSA 4A82A 4M53A 2QNRA 4GZMA 2IUUA 1F2TA 2Q21A 2PZFA 1S1CA 4Q1BA 5AUQA 3T1QA 3CRW1 3UWOA 2FPKA 2RH5A 2QPTA 5F2EA 4PC6A 3LV8A 3VKHA 1NJFA 1IJFA 3C14C 2ZR9A 5DHFA 4A8JB 1A8PA 2ZS7A 3AP3A 3KZ1E 4KBFA 4IFBA 4DSOA 3VX4A 3U2QA 2BV3A 2O0JA 2X2EA 3S1AB 4HYYA 3VAAA 1D5CA 5H70A 3TNFA 3U5ZB 1OKKA 2AN9A 1S3GA 2ATXA 1CJMA 4G5GA 1YR9A 3ND8A 5FR2A 5BQ5A 2KI5A 3PITA 1P7CA 1XZQA 2Z83A 4PO8A 3T12A 4AK9A 4B74A 5CDFE 1GITA 3OZVA 3GJ8A 2WTUA 1XJQA 1GIAA 4V0KA 3AH8A 1E0AA 1CR2A 1KI2A 4ZI3A 1Q3TA 1ZC4A 4HUQA 3HU3A 3SU8A 1ZUHA 3CPJB 2FJUA 4AG6A 3W5UA 1S0UA 1F2TB 1GP2A 2YKGA 3I62A 1KK3A 3QPUA 2UVQA 1EFHA 3FFAA 1TQ6A 4ZV4A 1II9A 1W49A 3KFVA 4MUAA 2FA9A 4LHZA 3CF2A 4B6FA 2CJWB 4HLCA 3E2IA 3QSYA 4E03A 1VQNB 3UPUA 1WMSA 3FKSA 1ZC3A 2QROA 2XSZA 4AKGA 4JSTA 2ZU6A 1P6XA 3AKCA 3HDTA 3KDSE 4LJ9A 4URYR 1NVUQ 3UIEA 2HJVA 1NN5A 3W3ZB 1GG2A 3RS3A 2VH5R 4BECA 1YKSA 4B75A 2ZI4A 4GI7A 3TUZC 5LD2B 5CLLA 5JRJA 1GO2A 2VHCA 5CB8A 4IDQA 3QG1A 2HT1A 1XTJA 4EPVA 4IXNA 1SXJA 4CEIB 1R7RA 4ZKEA 5DO9A 1AZSC 3OIWA 5GJBA 1D6JA 3D8BA 3E5HA 3ZH9B 1QVFB 3ZC3A 2IYVA 2GWHA 5JS8A 4CF7A 1Z6GA 2IX3A 4Q4LA 4S2EA 2QUZA 2ZE6A 4MYUA 2OILA 1ZM9A 5FOUA 2HCBA 4HAXA 3KB2A 1CRPA 1PUJA 2PCLA 4Q9KA 3U4QA 3IO3A 3KXIA 1NIPA 1E1QA 2EWVA 1WCV1 2ZE7A 1KKLA 1G18A 1DO0A 1PJRA 3H0KA 4Q1EA 2WWHA 2ORVA 2ZPTX 3KKMA 1RYHA 4UXHA 1RFLA 3U7FB 3WP0A 1UADA 3I61A 2YWFA 2DFTA 5J4YA 2OZEA 1OB2A 1KY2A 3NBYC 2GETA 1JQJC 1OIXA 5BN3A 1KJYA 1NN3A 2W58A 4GL2A 5JCPA 3EWSA 4PANA 5DN6D 4D82A 2VLIA 1U90A 2CLCX 3OESA 1TMKA 4C9BA 5FPTA 1BMFD 1F2UB 1BIFA 4L8GA 1KSHA 4X8OA 1COWD 1Z0JA 5FH9A 5EMNA 2PIAA 1US8B 1VIAA 1Q1BA 3I4LA 3K0AB 1Q82D 4Q4AB 5LDDC 1M74A 2PJRA 2ZYUX 3QBVA 1NL3A 1WDTA 5GVRA 2I1VB 1X86B 3LW7A 3GJ4A 2V1XA 2D2EA 2R9VA 1SVOA 2YHSA 1EP2B 4EFNA 4PO9A 2O52A 3FHCB 1UEIA 1YITB 2SHKA 5FPYA 2CDNA 2V9PA 4GDFA 4JBYA 4EH1A 3K53A 2J7PD 1W47A 4TMWA 2XAUA 3TBKA 3MMPA 3JVUA 3LQQA 3AGQA 3VO2A 1ZP6A 4B32A 2ATVA 5FL7A 1MABB 1E2MA 1YQTA 1Z6TA 3FKQA 1YI2B 1HUQA 421PA 2X3UA 3RYTC 1OGIA 2X2FA 2J0UA 3AQ4A 4YQFA 3P20A 3SBEA 4IOJA 5J5CA 3GFTA 4B3CA 1YRBA 1U8ZA 2A2ZA 3GLGE 3GLFE 3NWJA 4JT4A 1E9AA 3C7KA 3D7MA 1E0SA 4FMDF 5E4FA 3TE6A 4V0MA 2VYQA 3EW9A 4YDHB 1QH0A 5FPKA 4LC0A 1FFHA 2BF4A 1N6NA 1CNFA 3RHFA 3BS4A 3KQKA 2L0XA 3G0HA 1AGPA 2ZYWX 1TF2A 2D06A 4X8HA 5EJEA 2NQ2C 3PEWA 1E1RA 2PZGA 1V43A 2PCJA 4Z54A 3ZZTA 1XEWY 2ZS9A 3X1WA 3EIHA 4Q4HB 4PQFA 4US0R 4PC3A 2DYKA 2RGNA 4HLDA 3GJ0A 2HXYA 4RZUA 5KO2A 2IYXA 1D2EA 3ND9A 3WYFA 4C43A 1Z0AA 1QHIA 1KC8D 2ZSFA 1XD8A 1E96A 3T5GA 4ESHA 3T15A 3IHLA 1U9IA 1G16A 4E5UA 4Q66C 4MYTA 4LDJA 4RKFA 3AUXA 1P9RA 4FMDB 3MLEA 4IFEA 4UXIA 4TQUS 3CMEB 5CIWA 1HYQA 4OJKA 2AWNA 2QMEA 1JR6A 2J9RA 4A0FA 3K09C 1P75A 2EU8A 3IIJA 5BYKA 1L4UA 2OCAA 4I81A 4B2IA 4CGZA 1CU1A 3RLFA 2PBRA 4D2IA 3LO5A 1G9XA 2QAJA 5B57C 1VIYA 1RVDA 4PHFA 5JECA 3L0OA 4O25A 3IDQA 4XTCS 5DI3A 4HAZA 1TEVA 2G77B 2FWRA 2V6IA 1KDRA 2PMDA 3HP1A 2NO9A 2Z4RA 1GDDA 1OH5A 2KBFA 1MH1A 1W5SA 3H1TA 1DAKA 2QBYA 3PV0A 1GNRA 4P32A 4QBIA 3BFVA 3BB4A 3WP1B 1I4DD 4TYNA 5L3SA 4PZYA 3PXGA 1YZGA 2CVFA 3CH4B 4Z1MD 1NBME 1Q86D 4G0NA 4G5RA 3AUYA 3WBJA 1UF9A 3K0AA 3W2GA 3THYB 2WJHA 2PZEA 3AVTA 2W2VA 1QGYA 4Q21A 1EFTA 4LV8B 5J40A 1MO5A 2ZRMA 3BB1A 1SHKA 1T4GA 1D1NA 1FX0B 4YMWA 3PENA 1PLJA 2ZTSA 1E4YA 1DAEA 1U98A 2EFHB 2H57A 2JAQA 5D3MB 1RJ9B 4TLAA 1RRPA 2HF9A 4EKDA 1E2HA 3BRWD 4OK5A 1EX7A 3R20A 2QBYB 4QNRA 2GJAA 3QEJA 1R5OA 2QMUA 4F7DA 3CONA 3SYKA 4Q4HA 2PEYA 5J4HA 3GJ3A 3AP1A 2XGJA 4HB4A 4G3XA 4GRAA 2XEXA 2I1QA 2ZJ8A 4B3FX 4PAQA 3CZPA 4Q4JA 4JMPA 3GMTA 4UNQA 2VP0A 1PLLA 3QXCA 1WP9A 4JLNA 3C4JA 1NN1A 2RGBA 5FBWB 3CX6A 1NMYA 3KKOA 3IBYA 3QEOA 2AXNA 4BZPA 2MMGA 1IY0A 3KX2A 1KO4A 2BMFA 4LI0A 3R9WA 4IVQA 2YC2C 3ZBTA 2C9CA 3NDPA 1BYIA 1VKJA 3GFOA 4U5XA 1VYVA 3FGNA 3MGCA 4YAWA 1FL9A 2WICA 1W46A 1JAHA 3LWNA 2HT6A 3QKRB 4N1AA 2LKCA 5KHOC 5FOXA 2DWOA 2VF8A 5H68A 1DADA 1LS1A 1OFHA 2FDCA 1A2KC 1XX6A 5FTKA 4QG7A 3BWDD 1M7HA 2EVWX 1CNEA 1XZPA 4FD2A 2BMDA 4IDOA 4JBXA 1S4QA 3CX7A 3QXJA 3IUYA 4BLOA 4DDVA 1R0WA 3HU1A 3GLFA 1XTKA 1ZM7A 3CCMB 2FGKA 5SZKB 5IK2D 5DGXA 1E2IA 2QTZA 2C9YA 3OIUA 4DEYA 8OHMA 1W36C 4ZIRA 2GBLA 1GWNA 1LNZA 5H8WA 4A8JA 1FP6A 2OUKA 2GEVA 3CB4A 5AJYA 3FVQA 1Q7YD 2Q9CA 1YR6A 3QFSA 2ZRIA 2O8FB 2IK8A 2OTJB 3OEEA 2C78A 3IIKA 1VHTA 3CPHA 4Z8XA 1S1MA 4HUTA 2OCYC 1VCMA 4JLDA 4GZLA 1D2NA 1E2FA 2F9LA 2OCPA 4RD3A 1XEWX 1Y3AA 2JA1A 4PC2A 2XXAB 5TMPA 4AIIA 1DAMA 1RW4A 2F1JA 2B8TA 2D4HA 4JLOA 4F93B 3AVOA 4NZYA 2WJGA 1X6VA 1PV4A 1KI7A 3LFUA 3FOZA 4EQ6B 3EARA 1VDZA 2EW1A 3SFZA 5FBLB 2KJQA 1KKMA 3WMEA 2RHDA 1NBMD 1NMZA 1KO7A 2V4ZA 3I72A 1VG8A 3K70D 1U8YA 5E7IA 2BEJA 1JEDA 2NGRA 2FFHA 2IYSA 1MRNA 1NLYA 2H92A 4LBVA 1SVLA 5JBQA 3Q5EA 5GJVC 2JIZD 1PZNA 3THXB 4A8JC 4HAYA 4YAOA 1QHGA 2GBLC 2G83A 1ELOA 2J1LA 4PC7A 2ZJYA 1D8TA 5JZVA 1S9DA 2FEOA 2J5XA 3CX8A 3O8BA 1YJ5A 4AY2A 1OF1A 3N5CA 1C4OA 1GNPA 5DIFA 3NVAA 2Z4SA 2V7QA 4RZ3A 3IEUA 1KTVA 2GJKA 2ZYTX 3CRZA 5GJWC 5DYIA 5BYJA 1RKBA 4BLRA 4DCSA 3VR3A 4BLTA 2A30A 1NDHA 1TQDA 4I1VA 5FL3A 1KI3A 2A78A 4O3MA 4BPBA 3GJ6A 3CC4B 2CNDA 2VHUA 1Q81D 4ZCMA 4N0EA 2ZSAA 2JGNA 4RFSB 4UXJA 5TARA 1RYFA 1NRJB 3AVUA 1V5WA 4MDEA 1R2QA 3CW2A 3T1VA 1R0YA 2V55B 2IYWA 2GVDC 4NKRA 4WXRA 4PAOA 4CEHB 1IXRC 3G82C 4I1OA 1KK2A 1RZ3A 3FTQA 2D2FA 4TYWA 1R10A 1SM4A 1RIFA 1KHTA 4Q9JA 3B13B 1GILA 2C77A 1GAWA 3AP2A 3C5HA 2O8EB 1JBKA 5KNDA 1YZQA 3CCUB 3P4YA 4JIMA 3EPLA 3BERA 2ZE5A 3G4SB 4NCHA 4DB4A 4MKFA 3PQCA 2RGAA 3P1JA 4KLNA 4A15A 1E4VA 2ZI6A 4YDSA 4BFUA 1II8A 3HR7A 2JDID 2QM7A 3CCLB 3ADBA 4DIDA 4C2TA 1DEKA 5KSZA 4LJAA 5FBQB 4QKQA 4D4KA 1JECA 4V0OA 4MRVA 3QOFA 3W90A 3CCQB 3C5CA 1KOFA 4LBZA 1KSJA 3X1YA 3GCGA 1H8ED 1OE0A 1H8EA 1NKTA 2W0MA 2ODBA 1XU4A 2ODEA 2VP9A 3I55B 2OCBA 3KKQA 3ZDQA 1NG9A 5AJVB 4XWKA 3OE7D 2PLFA 4D0NA 5KOYA 4BFZA 3JQRA 3U44B 2ZI9A 1XCGB 3CH5A 1OKKD 1IOZA 3E20A 4QJ4A 4BFVA 2JLVA 2Z0MA 2AK3A 1HEIA 1ONBA 2ZVQX 1MO6A 3DKPA 4ZDKA 4RCZA 3TJZA 3TSWA 1NSTA 2R6DA 4B44A 4TLEA 2OLJA 4G1BA 3B78A 1ZD9A 3KL4A 4JL8A 1KYIA 5CIQA 1K9MD 3IO5A 3T35A 2WAYA 2OO7A 3T5DA 3CPWB 1OHHA 4F92B 1IJEA 4OHVA 1F5NA 1O3YA 4US2R 2A5JA 1W4CA 1JXMA 2IS2A 1A7JA 1C9KA 2KE5A 2ANCA 2J7PA 2O0KA 3QKSA 2PL3A 1F2UA 1F6BA 3QFTA 3IEVA 3QVVA 2AKAB 2QQEA 4ESVA 3B9PA 4RD6A 4B76A 1FQKA 1IXSB 1JAIA 4C0JA 4EDHA 3QJYA 5TR9A 1XTSA 2CL7X 3B85A 2JJ2D 4GMXA 1U8AA 4NH0A 5KSPA 1VCOA 3NH6A 1XBTA 4L15A 4KITB 1G7TA 2R62A 5CJ2A 3NBXX 2C96A 1VQPB 3K09A 4B2LA 2FMXA 1W7AA 4U9UA 1QG4A 3CZQA 4JT2A 1XCMA 5FUYA 3ECCA 2QGZA 2GJ9A 4D6PA 2H5EA 3B1YA 4UNSA 2O8DB 2RGGA 1Q20A 4QBGB 4URZR 3RSLA 4CEJA 5G41A 3MWLA 1VQMB 4URUR 1G6OA 5FUXA 1BKDR 1UBGA 1W1WA 5K8UA 1M7GA 1VMAA 2BHRA 4R2HA 4QGHA 1T3HA 3QKSB 3BH6A 1ZJ6A 3W6NA 1NVXQ 4PO1A 1ZUNB 4BFWA 1P2UA 3VKWA 1CXZA 3PFIA 3SS8A 4P0TA 3BK7A 1Q57A 4RKEA 1Q3HA 4BLPA 3IQWA 2F9MA 1CS4C 4HDOB 2CNWA 2UKDA 1CTQA 1W87A 1EGAA 2JJ2A 2YWGA 4RVCA 2O8CA 4G01B 1FW6A 1K5GA 1M34E 1HH4A 4ZKDA 3EZ9A 2PLRA 4DDUA 2GKSA 2O8DA 4FCTA 4AF7A 5JJIA 4E09A 2C03A 2R6FA 2GK6A 4JL5A 4KFRA 1EFRA 1OH7A 3EX7C 4NYJR 2Q9AA 5F98A 2R44A 521PA 3DMNA 3LLMA 5CDFA 2XSZD 4AWXA 1U94A 1E9EA 5AUPB 1Y63A 5J4LA 2VHQA 4HAWA 4JLJA 3PR1A 4JKIA 2JLSA 2K5UA 4PQRA 2ZUCA 2WZQA 2GCPA 1XPUA 1T91A 4WXPA 1KI9A 1N5LA 2ZJ2A 1XD2B 4M9ZA 1E2GA 2FFQA 2P65A 3A4LA 1PUIA 2QTHA 2RGEA 3DL0A 4GFDA 4JKYA 2CLSA 4XSGA 4YXWA 3UK6A 4BASA 4KSBA 2BMWA 1KGDA 2AX4A 3E1SA 4TL7A 4CDGA 1H42A 5AUOB 3LAWA 4LPSA 4QBHA 3NIBA 5AWFC 3M1IA 5JWOA 5KPDA 4B2PA 1B0UA 4HDCA 3VMFA 2E1RA 3THOA 2C04A 4NMMA 4B73A 5JS7A 3VR2A 3SZRA 1VQ7B 4F91B 2GJSA 3D6TB 3ZS9A 4ASUA 4ASUD 4M21A 4JLMA 2VF7A 2VNHA 1OYYA 4X8MA 2OBLA 3K9LA 3DOFA 2KB0A 4D81A 3HR8A 3IILA 2ZRNA 1P3JA 4D80A 3IBGA 2BSAA 3ADKA 1UJ2A 3HWSA 4HLQB 1GAQA 4G1VA 2RB4A 4LHYA 1N2CE 2JJ1D 5DI3B 3WYGA 4Y9RA 2WV9A 2QEXB 1OSNA 1IN6A 3BD9A 4FWIB 3OEHA 3JVVA 2H7VA 5KDOA 3A8TA 3U7HB 4PZLA 3Q8XB 3HPRA 2O8FA 1YZNA 3TAUA 3LBIA 1KZ7B 4RFVA 1X1SA 2CHGA 3VR5A 2YYZA 1SVMA 5AR1A 4AKEA 1SHZA 4AC9A 4LHXA 3RRYA 4CVNA 1I2DA 4RSGA 3RRZA 3W34A 3VR1A 2F55A 2WOOA 2UZIR 1JB1A 2N42A 4K8OA 3P26A 4Q7LA 2IYZA 4QC2A 3EA0A 5FTJA 1OLOA 1W36B 2REXB 1UBCA 2DETA 1Q0UA 3SEAA 1FMLA 1DAFA 4CW7A 4HI0E 2GA8A 3UANA 3ZGXA 1GAJA 3GLHB 1U2RA 4KO8A 4WAUA 2GXSA 3KXKA 4LBWA 1SXJC 3EZ6A 1LVGA 2TMKA 4Q1CA 5LBIA 1XXHE 4A0GA 5KTYA 4H1VA 3QENA 1K8AD 3RWOA 3MD0A 3U3KA 1SKQA 2ONKA 1W0JA 4Q1DA 2ZUBA 4Q4JB 4TT3A 1ESMA 2VNJA 5HZHA 1G4AE 5E7JA 2HV8A 2FPLA 1XD2A 3DDCA 2ZR7A 5EP1A 2W0SA 1DG3A 1E2JA 4Q4AA 4TMKA 4XWOA 1WA5A 3PUVA 5HTKA 5FA6A 1CP2A 2QPAA 1AM4D 1XXHB 3JQPA 4U00A 2QTFA 2X8AA 2QQ0A 1XTIA 1L7VC 2WHXA 2O8CB 2WJJA 3LNCA 4DLZA 1VQ6B 2WWYA 3FB4A 4QHTA 221PA 3KUDA 5CLQA 4Q7MB 1LW7A 4A2QA 3GEEA 5AJXA 1KQSB 1QGAA 3GEIA 4JL6A 1FPMA 3CCRB 1E2NA 4DLRA 2H18A 1IM2A 4LYFA 2OFWA 4LSGA 4LZZA 1EESA 2VPPA 1KI1A 2NG1A 4LHVA 3PEYA 4OQFA 4LBYA 4WA7A 2XNCA 4KI0A 1XD9A 1G20E 3ZJYA 1KZGB 2XZPA 1E69A 1A2BA 3SYNA 2BM0A 5KYKA 4NCNA 4YONB 1G8YA 5FTNA 4AG5A 4D4MA 1YJNB 2QZ4A 1N0VC 2RCNA 2YOFA 4HATA 1OT3A 2WWFA 4JVSB 3SOPA 4BGDA 1AS0A 1KJZA 4PHHA 1T0JB 1VPLA 5FFMA 1OYWA 1QHHA 1N8RD 2X19A 3MWKA 4M9XA 4U02A 3BGWA 4BWYA 4YLGA 3FHOA 1G5PA 1YZLA 2IUTA 4OQMA 1A82A 3K70B 2FN4A 4DLUA 4NHOA 4E22A 721PA 2VNKA 3ZZUA 3OFNA 1KO8A 4IJMA 3TH5A 2DFLA 5C1BA 3L0SA 2ZJOA 1EP1B 4NU0A 1G7RA 5H5JA 3AVWA 4TQAA 2ORWA 4AI6A 5EXSA 4OQLA 1VG9B 4C0BA 2E9SA 5JRZA 4EFLA 4NDZA 4R2IA 3TUIC 3AF2A 2NO7A 2W2XA 3T06B 2QPOA 3FYHA 4JJZA 1SULA 1ZCBA 3W2HA 1DELA 3BH0A 1CJUC 1GRRA 3CKLA 2O5VA 4WVFA 4MGIR 3BXZA 4NYIR 1UKZA 3GLHA 4AURA 5K8TA 2ZRKA 1NP6A 3DVLA 3F5FA 3NXSA 4HZUB 4LJ6A 3RC8A 3CRRA 1Z3IX 4PXAA 2XNDD 2ZRAA 2FZ4A 1AQYA 4OHWA 2VSFA 1W2HA 4G5SA 1WBDA 4LYHA 3RSOA 2VP6A 1CR0A 5L8VA 1E2QA 4GMDA 3Q85A 5G3YA 4CZ2A 3AKEA 4X8LA 3D31A 4IDHA 1E2KA 1J8YF 2GCOA 2HLDA 3J81k 4M9SA 3X1DA 2HYDA 2J0UB 1SZPA 3OAAA 2JLXA 3LA6A 5FOWA 2FGJA 1QRAA 3K0SA 2RGXA 3A4MA 3RC3A 1NI3A 3ZVMA 1N6IA 3TK1A 3ZLJA 4TWZA 5BW8A 4NYIQ 1FOEB 1YU9A 1E9FA 2OAP1 1Z83A 3L0PA 1W4BA 3HPQA 1XEXB 1XJCA 3E70C 4M1MA 5EE0A 4EJSC 1KMHA 3EASA 3H2YA 1O87A 2ECKA 4NP6A 4YMUA 1I4LD 1QF9A 3MFYA 2R8RA 3WYAA 4AYTA 2BGJA 2QEQA 2BOVA 4IOLA 1KDPA 1R8QA 1ZIOA 1OH8A 2NPFA 4XIGS 3K70C 3C15C 2IS4A 2CK3D 2WWWA 2WSMA 3AEZA 4WZ6A 2ZQ5A 2ANBA 1JA0A 2ZREA 2HDNB 4A92A 3AVXA 4ARZB 2EFCB 2RAPA 1W0KD 1FZQA 2W00A 3EC2A 4B6EA 4OI4A 2FE4A 1NF3A 4L16A 3T1TA 4CEHA 2FX3A 1P9NA 4DVGA 3K0CC 3IQXA 3CF0A 3SC3A 4A9AA 2NO0A 2VIIA 1VQLB 4DXAA 3KQUA 4DCTA 1EWQA 2MSEB 3OF5A 2WPDD 4DLXA 4ITRC 2CCJA 1TLLA 2QMHA 2PX3A 3SJZA 1ZAKA 3SYLA 2GESA 1KD1D 3EPJA 3RABA 2GRJA 4BLQA 2BGIA 2OK7A 4LV6A 4QM6A 2FU5C 2CEAA 1PVOA 3KKNA 2A9KA 1EP3B 1FQJA 4XD7D 3UMFA 1KIMA 3IPYA 1TQ2A 3X1XA 2D7CA 3QUSA 5SZJA 3U44A 3K0FB 2BN4A 1Z5ZA 1GZSA 4CIDA 3TR5A 1VECA 2CVHA 1Z22A 3I8SA 4TTRA 1Q1ZA 2FSGA 5IDVA 4A0HA 2IYUA 3V4RA 2NMVA 4FW9A 4KLZA 1W5TA 4W9MC 4CEJB 1J90A 1JXOA 1QHHB 4K1XA 2YC4C 1Z06A 4V0ME 3W5JA 2IHBA 1MO3A 1KI6B 1ZMXA 3OJWA 1FNBA 4XWAA 4KSCA 4LX0A 2OFXA 1L4YA 2OTLB 5J4VA 4HDQB 1GL9B 5HKKD 1EFUA 1SKYE 4TSFA 5B58C 2WWXA 5E95A 4FXPA 1QDEA 3IHWA 1KDTA 3L43A 4BRWA 4DWJA 4XVUA 5FOTA 1ETUA 2G0NA 2Q9BA 1TADA 2RKOA 4YMSA 4MITA 3K0FA 1QVRA 3SFVA 3T34A 2FFBA 4M1YA 3Q7QA 1P72A 4AD8A 1Z08A 3W2EA 5FUWA 3BH7A 3KFXA 2XTZA 3DEFA 4FIDA 1WQ1R 4OI2A 4EPWA 1AK2A 2G1JA 5G53C 1G6HA 2BMEA 1FP7A 4ZIRB 4Q48A 3DO6A 3PUZA 3BFXA 4BE7B 3FMFA 4P31A 1AS2A 3LH5A 4KYUA 3QNUA 3PIRA 2QAGC 4W5HA 2C9OA 4HZUA 4AYXA 4KXFB 2JLWA 3IGFA 4NE2A 3FMPB 1JNYA 2A3RA 4Y0VA 4YXWD 2BBSA 2WIBA 2FPMA 1Z6XA 4WBSA 2WWGA 4IOKA 4EUNA 5F9HA 1IN8A 4IDNA 1XTRA 3H4MA 2N46A 4DLYA 5DHAA 1W34A 2WKPA 1GRNA 4TMTA 3I92A 5THXA 4MUBA 4MKHA 1Z47A 2R6HA 3WHKA 4NYMQ 3KJEA 1XRJA 3THYA 1TEXA 4XOIA 1JEEA 3P27A 1GVNB 1Z0FA 2ZSEA 3VO1A 4PAMA 3SHWA 3TVDA 4TL9A 2EFEB 2QRNA 4TL6A 3I32A 4TMXA 2JASA 5EE5B 3KJGA 3X2SA 4QM7A 5FBRB 3ZS8A 1Q12A 1KMHB 4C0LA 1LB1B 4RZXA 1ZINA 4QJ3A 1DG1G 4RD2A 4LY6A 2WSSA 1N0WA 3FPKA 5CB6A 1SKYB 1FMJA 5UKDA 1KY3A 1TPZA 3QY0A 2YWHA 4KJZA 1G7SA 2QE7D 1MABA 1M8PA 2GILA 4O2RA 1IY1A 4OQNA 4LYJA 4A2WA 2NPIA 4TL8A 2IF0A 4JLBA 3VTKA 3KB1A 1FRNA 4DT1A 3IPXA 3CR8A 1OFTA 4M1KA 2REBA 3JZAA 1E2EA 3TRFA 5E3HA 5KPJA 4C2UA 2GDJA 2OBMA 4FMBB 2Q3FA 4RFSA 4TYQA 2XB2A 3FMOB 3KQNA 4YAFA 4ACAA 3TUJC 4IVPA 1G64A 4HLUA 1JB9A 2Q3MA 1GKIA 2IT1A 2GAAA 5FTMA 1CR4A 1YJWB 4M8NE 621PA 1U0JA 2DBYA 2CMKA 2E87A 2AFHE 1CIPA 3L0IB 5AK0A 2O8EA 1IN5A 5KSOA 1MT0A 4C0SA 4ZGNB 2OHFA 3RWMB 2GVZC 3UKDA 5AUNB 5ELXA 3WNDA 1NY5A 2O0HA 4PSVA 5HE9A 1U9IC 2XZOA 4TZ0A 2GXQA 121PA 1IB0A 5IHPA 2QP4A 3RAPR 2JCSA 3B1XA 3PCRB 4M1TA 4BZQA 1QGZA 2J3EA 3V00A 4A6PA 4JLVA 5EZ5A 4C7OA 4IOMA 2QTLA 4CRWB 4EAQA 1AGRA 2OT3B 3GEHA 2CHVA 1QUEA 2XTMA 3O8DA 1TUIA 2F1HA 2W6ID 1X8LA 3WNCA 6Q21A 2IYLD 3EZ7A 1GRQA 4G5QA 2D7DA 2YZ2A 3DOEA 1G3MA 1Z0IA 3CCEB 1ZIPA 3NEYA 2NZ8A 3QI2A 5EQTA 4B43A 1VQ5B 3BBPA 3TVTA 3RS7A 3U6BA 3CF6R 1J8MF 4XJXA 1ESNA 4O2LA 5EZ6B 4M4SA 3UWKA 4MDFA 4XTRA 4C0QC 1TQ4A 4EPRA 5FI1B 2QENA 4AF6A 4ZCIA 3CD6B 1YVDA 3REGA 3DMDA 1JA1A 2EQBA 5EE3A 4EQ6A 4ZPXA 2G1KA 3ASYA 2IS1A 2QA5A 1QZXA 2FSHA 3B2EA 4TZ6A 1S8FA 3LXXA 3NTUA 4IKEA 5EP4A 1HTWA 1GKUB 4LYAA 1HA3A 1T9HA 1VQOB 3DPUA 2GTPA 4JLKA 1M90D 1VHLA 2D3WA 1QG0A 4DLWA 1OW3B 1P9WA 2J41A 3C16C 2QM8A 4US1R 4A1FA 4WZBE 1I4TD 2EYUA 3THXA 2QI9C 1L2TA 4KVAA 1P5ZB 1KMQA 1E79A 3EC1A 2JLQA 5L3SB 1D9XA 5BWMA 4Q9IA 5KUTA 1E3MA 2A5DA 2IYYA 1GL6A 4V02A 3OIVA 2HJGA 3RRNA 5JHGB 1W44A 4DLTA 3TAHA 1RJ9A 2ZJZA 3CPEA 5GVSA 1CULC 2F43B 4LPKA 1NG1A 1Z6YA 2GJ8A 4B34A 5IF9A 3RS0A 5JSZB 2FSIA 1OJLA 3M0EA 1T0HB 5TVKA 4OI0A 2HCJB 1TF5A 2DY1A 4DQKA 2ZXUA 4ARZA 1F3OA 4NPHA 5GV8A 4FCVA 3AGPA 1P61B 5JJKA 4DEXA 2WKQA 3CC2B 3A1SA 3A37A 3GJ5A 2PX0A 4FMCF 4FMCB 2JLZA 4B3GA 4DBLC 3CWZA 4L4UA 3L8YA 3ETLA 2JLUA 4WZAE 2EIXA 2AKYA 3EWAA 1T8TA 2CNWD 4A2PA 3QKUA 1T3LA 1G5RA 1CRQA 1YRAA 4BFTA 2BBWA 2I4IA 1AJEA 4EIWA 4RD1A 2DEUA 1QVGB 3AF0A 1QHYA 4W5WA 3AKYA 4F38A 4FWTA 5DN6A 1FRQA 4C7OB 2Y8EA 4IXMA 3U7EB 3VNVA 2YINC 1E2DA 4BFXA 1N3BA 1Q44A 1BX1A 4KCGA 4MYHA 2IWHA 3SDZA 5BXQC 1NNEA 3C41J 4BLSA 1ZM2A 2ORIA 4Q1FA 3R9IA 2QGNA 2GZAA 4I1UA 3EPHA 1HQYE 2GHIA 5LB4A 4NYJQ 1W0JD 4D25A 1AA9A 4XSHA 4DT1B 2DB3A 2XZLA 1E32A 2GNOA 2OEPA 3B7GA 3BE4A 4BEBA 2J0QA 1WXQA 5BN4A 3VHLB 1XE1A 4B47A 4DDTA 4DDWA 4Z1MA 1ZYUA 1HY3A 5CJPA 1E79D 1BQEA 5C4GB 1P4SA 1YZUA 3U3JA 5HE8A 3KJIA 5JEEA 4UKDA 3A1UA 1OFIA 1NMXA 5JEDA 1CQXA 1S96A 2JLYA 4P6VF 4BZXA 3R7WA 2OFOA 3CMAB 4J0QA 1ZD1A 2BWJA 1JQLB 2PH1A 2ZJBA 4URWR 2CJWA 2P5SA 2ODWA 3BFKA 5J4KA 5DNYB 1B2RA 4OK3A 2B8WA 5EUQB 2DWQA 1AN0A 2QRZA 4F4JA 2UZ3A 3CLVA 4MGKR 2VP2A 1QFZA 1UAAA 1LS6A 2DFNA 2BC9A 1VQ8B 1YR8A 2C95A 2JJ1A 5BN5A 2G3YA 1AZTA 1G17A 1FNCA 2OAQ1 5G3ZA 1FUKA 5B64A 2WMOB 4PPQA 5FUVA 4DCNA 3GLHE 4Q7KA 1Q21A 1B23P 5EP2A 1J2JA 5K8LA 3A6PC 1E9BA 1UMKA 2CLDX 2HF8A 2I3BA 2AWOA 3VU9B 3EIEA 3OAAD 4MA4A 1EFCA 5EXPA 2J0VA 2ZRLA 3WRXC 4DRZA 1E0KA 4LJ8A 1KSGA 5IT5A 2H8KA 3BB3A 3U3RA 2B6HA 3GLGB 1FNDA 1N5IA 1XPRA 3MUFA 2CL6X 2V6JA 4G5OA 2P0EA 4TLBA 1W2BB 1NKSA 2ZSDA 3NKVA 4YMTA 1Z28A 3RNLA 3CM0A 1T6NA 1WF3A 3DHWC 1A4RA 3F8TA 4DHEA 4QRHA 4DCVA 1YR7A 1JR3E 4OYHA 1N6LA 3ASZA 2CRVA 3ZVNA 3W8NA 2V3CC 1BJKA 1ZVQA 2R2AA 3WBKA 3W3AA 4Q00A 3EXAA 1E2PA 2LCFA 1G19A 1COWA 5L3QA 4TLDA 4B33A 1QFYA 1C1YA 2REOA 3KUCA 1OXTA 2CL0X 3ZIAA 5JHHB 1JI0A 2ZEJA 5L3VA 5F3WB 4JSYA 3FMIA 2VP4A 3L2OB 4EJSB 3I8XA 4Q9LA 3MWJA 4DKXA 2BPOA 2OK8A 4U7DA 2GXAA 3LBNA 3QKRA 2BJVA 2FEMA 3HJNA 2ZJAA 3K0EA 3PUXA 1G8HA 1S2MA 2BCJQ 1W35A 2V7QD 4N3GA 4CT4B 3LQRA 3LW8A 4HE5A 1G3RA 4A0RA 3CR7A 5JWRA 3W5VA 1PLKA 2VEDA 4IHQA 1FNNA 3LVRE 1P2SA 1HT2E 2VBCA 2IL1A 2IS6A 4XD7A 4UNNA 3JQQA 5DSZA 2IYRA 3VKGA 1DDGA 5FPSA 2DERA 2AXPA 2XITA 5KDDA 1G21E 1N5JA 2BBTA 4DQLA 1YZKA 3NC0C 4UAJA 4C30A 1S72B 4NCJA 1AKYA 1E64A 1NBMA 3TW4A 2ZRBA 2WBLC 5SZHB 4QGGA 3DKVA 2NO6A 4JS0A 4P4UA 2PJZA 1DVRA 3R8CA 4NCKA 3Q7PA 1ZM4A 5HXBA 1JJVA 2JIZA 4PPNA 1HURA 2VYFA 4KFTA 3OW2B 5EXTA 2VSOA 2ZRFA 1CJVC 1F60A 4BEJA 3VR6A 1Q1QA 4GOKA 5FPHA 2ODNA 4PGOA 3MG9A 4ZI2A 2XXAA 4ZGQB 1XMJA 1F20A 1R0XA 3FFBA 3I5XA 1GFIA 2BKUA 1K5DA 3AV0B 3VFDA 5C46F 4V03A 3LVBA 1X1RA 3B1ZA 3TSZA 3R7WB 1OXXK 1UBFA 2QN6A 3CRQA 4PZZA 1W0KA 1GTVA 2GZHA 2W6JA 3GLGA 4PQYA 2D74A 1XB2A 2NOAA 3SQWA 3PUYA 1FNMA 2LKDA 4QHYA 2HLDD 4AYWA 1VG0B 5EE9A 4L9WA 5EUMA 5EXXA 3W9YA 4EPXA 3EZFA 5L3RA 5LD2C 1YE8A 3S1AA 4L9SA 5HCNA 2G0TA 2QP3A 2WKRA 3A1WA 3GQBA 1EWYA 3O47A 1SXJD 5TXGA 2A5YB 4DIEA 1U0HC 1IQPA 3G6EB 2OXRA 1S9HA 2R6GA 3P4XA 3WMFA 1N5KA 2RGNC 4OL0A 3SJCA 3W6PA 4GBMA 4P4SB 2GXUA 5DISB 2YWEA 3ADDA 1Z2CA 1KAOA 3BORA 2HMAA 2QA4B 3CC7B 1UBEA 2IW3A 4RD0A 1E1RD 1SVWA 3B5JA 4JVLA 3ZQ6A 3ONWA 3U4QB 1G8PA 2ZRCA 1NJGA 1WRBA 2B92A 2Q6TA 3DZ8A 3FE2A 4Q03A 2FV8A 2V1UA 3SN6A 2F3TA 1DE0A 3SJAA 4GPTA 3SR0A 5TY0A 3R8FA 1TTTA 2F7SA 4KVGA 1ZW6A 2WVJA 5AJZA 3O8RA 1ZBDA 3E1YE 3KTAA 3W6OA 2QAGB 3MJRA 2EYQA 1Z0DA 1UKYA 4IRUB 3OE7A 2BKEA 1KNQA 3AF1A 3ZQJA 821PA 3P32A 4TYYA 3LY5A 4OI1A 1NJID 2IA5A 5CM9C 1OXVA 1UEJA 4HE6A 3I3SR 1CJTC 4UNPA 4ERNA 4LJ7A 2IEZA 5CITA 1N25A 1DDIA 4Q7JB 3NC1C 3ZBUA 3ZZ0A 2ZYVX 4HSEA 2IEYA 3UATA 1GVHA 3FJOA 4QNMA 4IW3B 5AJWA 2GK7A 5CYPA 1G8FA 2XB4A 2IXEA 3V9PA 4F7WA 3AVQA 4POAA 2C2HA 2MMCA 5F9FA 4HZIA 5KDLA 2O8BB 1DAGA 1SQ5A 1XFAA 4RCYA 1Z2AA 5DYGA 3WHLA 1DBSA 3NDBB 2GEDA 4BQSA 4W5JA 4W7SA 2EFGA 1P60A 2R65A 5B2ZA 3GFPA 4LJ4A 4MYCA 2JEOA 2J59A 1LTQA 1XNJA 3KTAB 2AFIE 2W6IA 1XF9A 4MRRA 2R6CA 3QF4B 4OBEA 4M9QA 2CBZA 5D3MA 4BFYA 5KSYA 3SI7A 1IAQA 1Q1EA 3KXLA 3B8HA 1M2OB 1MV5A 4WQMA 1DTSA 1IONA 1OXSC 5JJLA 1KK1A 4DJTA 4E07A 1OFUX 1ZD8A 1HE8B 4GOXA 4HB2A 3B60A 5JWHA 1UKEA 4ZDWA 1YIJB 4O0MA 3Q72A 1E62A 2J7KA 4JVNA 5A4JA 4B71A 1NIJA 1U0LA 2Q3HA 3CNNA 1X8KA 3QE0A 5GADl 2GQFA 3SNHA 1E99A 1JJ7A 3C8UA 4NONA 3W8RA 4DZZA 1WBBA 2WJIA 1XCPA 3L82B 4Q1AA 1BOFA 2G6BA 4Q9HA 4FI3C 2BMJA 2WPDA 4NCIA 4XVQA 4ZDJA 2IBMA 4PPGA 1K6MA 3RDPA 1E98A 2X1VA 2GAOA 1R5NA 4YHBA 1QHSA 2BJWA 2D62A 2W2TA 4B4DA 2ZRJA 4Q47A 4B35A 2B5OA 2QSYA 3CIOA 1FUUA 1G3IA 3WMGA 4JZKA 1NSFA 2P2LA 1QFJA 1XEFA 5FR1A 2F3RA 1NLFA 1D2MA 3LX5A 3SHFA 1T3SA 3EPKA 1J99A 1VCIA 4CT5A 2YNMA 2ONJA 4KFUA 1G3UA 1TX4B 1R4AA 3FHTA 4Z8YA 4RJLA 5HPYB 4Y7CA 3A1TA 4D26A 3UG7A 1H65A 4DUGD 2R6AA 3DZDA 1IHUA 3QXXA 2OBNA 4QL3A 2CCKA 4KU4A 5JI3E 3FKSD 3TGPA 4KODA 5CM8B 1HE1C 3QVUA 4OKSA 2OE2A 1VG1A 1US8A 4M1SA 4Z51A 4R9UC 3W2FA 3LBHA 5CYOA 1SGWA 3CO5A 4QHSA 1U99A 2G9NA 4JLPA 5KNBA 3I73A 5FBVB 2A7QA 3W5IA 4PTLA 2XX3A 5DI9A 3W2IA 3LDAA 4URVR 1TAGA 2ZITA 3MJHA 1OHHD 1S3SA 2RC5A 1T5LA 1XTQA 2CCGA
chains in the Genus database with same CATH superfamily
1Y81A 1V9LA 2YIJA 4LYGA 3N53A 1DFHA 1K7CA 4W7IA 4Y2QA 3L0BA 3MJSA 1T0BA 5FAXA 5MGNA 5K1ZA 3TFQA 4O5OA 2Q9UA 4TYPA 4MGZR 1GSIA 3WLSA 2YRXA 3KQHA 4R7ZA 1W76A 3H9EO 1E94E 1DIRA 1P44A 3FNRA 3FTNA 5E2BA 3A31A 1KRHA 3R5FA 1CBUA 1LK7A 1NUTA 3OUZA 1Q22A 2JZNA 5I7VA 3GN1A 7ABPA 4OXQA 4XONA 5TRDA 3CCJB 2QF7A 2BGMA 5H3LA 4JY7A 2OYRA 5KZMB 3DEHA 3UGQA 4EY4A 3K1TA 4KKVA 1I3OA 3VC2A 5IKEA 3UBMA 4RELA 1EI9A 4DLVA 5HBRA 5JOQA 1DS6A 1NUAA 1SXJE 2IZ6A 3PVSA 5BMVF 3I4CA 1KWKA 1BVYF 1FCJA 1TK3A 4XEUA 3C98A 3OPYI 4D8TA 2VF5X 3LU1A 4KEAA 2VZEA 3WGMA 4IIBA 3TR0A 2ZANA 5BMVA 2QD3A 4LUCA 2JN9A 2BZSA 2C20A 2CLEB 1A8QA 2IUSA 2JFGA 3OPNA 1TB4A 1ZH0A 4KQEA 4R2XA 1T6XA 4ZOLF 5FTWA 2QT0A 3CEHA 1BKSB 3MT8A 2FW7A 5IVHA 1V47A 1KPIA 3WXMA 4HDRB 3T99A 1TJPB 3AWDA 2ZU0C 1PFQA 4LE2A 4U2DA 2NNWB 2ACWA 3GYGA 4L78A 2X4GA 5M34A 1QIGA 4ACBA 5ADWA 2HB6A 3OEYA 3LPMA 3IUJA 4C6HA 4HWPA 2ZRDA 1ZY2A 3L4SO 2PUTA 4X7DA 1O9HA 1OAAA 1SHUX 2ASEA 2I65A 4II7A 1NQUA 4JLUA 1KJIA 2NLOA 4KAXA 3SSAA 3UGTA 1A8IA 3EUAA 1Y5NA 1IY8A 3I5YA 1WW8A 2BEKA 5IBCA 4C0AC 3JQDA 3N70A 1OPXA 3FXAA 3DE5X 2DR3A 4CCYB 3ABZA 1CVIA 1RE0A 5K0EA 2GF0A 4BJ5A 3GUCA 1GN8A 3ZNQA 3MHPA 1SN7A 1X13A 4Q1VA 1JIXA 2YJ5A 4YRIA 1KYQA 1RPZA 2GD1O 2XOKD 3RO7A 4OHOA 1M6NA 5TRTA 2YCLA 2YWDA 5EKSA 4A8TA 3OZDA 3ROKA 3QIAA 4UHCA 2NUAB 3VSEA 1AV7A 4UVIA 4AKHA 1I2MA 4LOJA 1C3VA 1JIUA 4NJOA 5E4JA 5CFPA 3KJQA 4QOHA 1VTKA 4KGVA 3DE6X 4F5DA 2UYHA 2CK3A 2XGGA 3R5SA 2WNHA 2ZKLA 4J0CA 5E4YA 4QJ5A 4CLOA 3K6JA 1U3TA 3ASVA 3K1ZA 1R74A 3N86A 4HRAA 1AHHA 4F2PA 2O5EA 3W5HA 3ASQA 2WWRA 3CCSB 2YY6A 1M7BA 4KXUA 2H2FA 3PSHA 1L6RA 3L7CA 4X44A 4CLDA 4F96A 1TVKB 1YKGA 2MR6A 2W4QA 2I2DA 4M0LA 5LB2A 3VR5D 2QYOA 4F4CA 4ZP1A 2B8JA 3V1YA 3QHPA 1GPH1 4A6DA 4WJLA 1X7ZA 1WXWA 2OSBA 3LK7A 5A03A 1G4UR 3BHJA 1CB0A 4GRIA 3U61B 3R7AA 1G5TA 3AJRA 5LP6A 2PL1A 4HGRA 3CLUC 4L3OA 4R1NA 5DYYA 1BFKA 4FK8A 1R8XA 3ONDA 3QVJA 4JYCA 5AW7A 1DUVG 1RQXA 4M22A 1UT8A 4NQRA 5FBZA 5P21A 1R5JA 3T4UA 2ZRPA 3TM5A 4E15A 4EOGA 1A4IA 4BAUA 1Y6JA 4GNKA 4XFJA 3ABOB 1AO0A 2PX2A 4RD4A 4Z4ZA 2N1BA 3OPYA 5JSYA 4BZZA 4JYAB 5BNZA 3M49A 1NZJA 5BSVA 3MTQA 1BS1A 1U6KA 1XVUA 2HQRA 3H5RA 1A7UA 2WTXA 4I9NA 4RO0A 2JANA 1TT5B 3QTLA 3ZVLA 5I48A 4GW3A 1AUPA 5AHXA 4CIYA 3QPVA 1P3Y1 2QAGA 2VI5A 1QV7A 2LIPA 3FNBA 3I05A 4MDHA 5IH7A 3EOAI 3T3DA 4DM7A 2DJIA 4FC6A 3MSXA 4P33A 3T1OA 4GOND 1D0VA 4IO0A 4X1IA 2HEIA 1D0IA 1XI2A 1NVVQ 1OU0A 5AO9A 3VYVA 1PHRA 2PQ0A 2WJPA 3VTAA 1BYUA 1W36D 2AIRA 2OGZA 3WO0A 4P6YA 4EKGA 2H63A 5EIEA 4HL6A 4D41A 2FH5B 2WJVA 4BKQA 4HWGA 4ZVMA 3GIWA 3I1FA 1GNVA 4QARA 4GKAA 3CLTD 3DT9A 2NUBA 2FN3A 4XH9B 4JYZA 2JGKA 3VXKA 1BHJA 2A5LA 2V6GA 3T3OA 1X3LA 2NIPA 1EH5A 1OWPA 4QFMA 2FZ5A 3MT9A 5EJAA 4AG3A 4BJHB 5JLJA 4DTIA 1GZ6A 4LRXA 3L8CA 1HTBA 2Y1CA 4C06A 3OCVA 4DV7B 1YF3A 3FVRA 3GH3A 3VPFA 1S02A 2GBFA 4FQ7A 4WKCA 1FZTA 2QJTA 1C14A 3E53A 3HAGA 1AUXA 3ABSB 4UNRA 1HK7A 3WGUA 5TQ2B 1VRWA 4CTOA 1SKBA 2VYVD 2F3QA 2JC3A 5FI0B 2VBFA 2LTAA 4RK6A 3MAAC 4R84A 3ULKA 1T5TA 3FZQA 5EJ4A 2A0UA 4NJMB 1YVEI 1HBJA 1LF5A 2XDQB 3LSYA 3VBCA 4JB0A 2B7BA 3KE8A 4JLAA 2H2GA 5I9IA 3BJIC 4P9NA 1C3JA 5JFGA 5F5NA 2A1TS 2X77A 3VKVA 5I45A 5JSFA 1EBBA 2KYRA 3KC2A 3OE1A 1XZEA 1DAHA 1NNSA 1Q11A 3CB2A 4JSRA 3RYIA 3LOPA 4M0DA 3IA2A 2CHEA 1Y8CA 4P7KA 3DS8A 3OHMA 4BRSA 4D5EA 4DNXA 2Q1UA 2AMLA 4OBBA 1DX4A 1JFTA 2BIFA 3WGKA 4F9GA 1N1DA 5JD5A 4AMBA 4N01A 4OJTA 5ANRB 1XMVA 3TPZA 4EY8A 2OBSA 2QW8A 3HJHA 4UBOA 2LR0A 3HB9A 4K9NA 4KQJA 3TI7A 2GRAA 3CT6A 4K7JA 3VX3A 4DR4B 4JB2A 3FDFA 3GO4A 2GHTA 1CKEA 5TIIA 3H5WA 1UPCA 2VNIA 3QKIA 3FDZA 1DO2A 4DUYB 2BCGY 4Z4WA 1SURA 2F1RA 2OG2A 2Q5FA 2P1ZA 3C7AA 1RXIA 1X74A 2ES4A 1TNDA 4L73A 2WHPB 4LHWA 2CY0A 2VPYA 5LWHA 1BU5A 1YDMA 4BMNA 2E48A 3EG5A 5KQLA 1QPGA 1KQFA 2YV5A 5K8JB 3TKLA 2CDCA 1P45A 4UUAA 1YBMA 2C2KA 5C4MA 3DC7A 4ER6A 2UVPB 4GLBA 1PFKA 2D1FA 3VISA 3AB7A 3LF1A 1XA3A 4ENTA 1SU6A 1MW8X 4WK6A 3U6KA 5DPMA 1T0UA 1CRZA 4YREA 1C80A 2RHMA 2CLLB 1H4VB 3BVPA 3R2JA 5D7BA 1E9RA 1PJQA 4H0NA 4MVXA 4ISCA 1AHNA 3H5TA 3SKVA 3VZCA 1HR0B 5KOHA 3DW1X 3OOJA 1BX0A 2C2YA 2RHLA 3H8JA 1XTBA 2XWPA 4UMFA 5DLQC 5CG2A 1RI5A 1YOVB 2B94A 5H59A 4L3VA 5DGHA 2GPJA 3VHXA 3KYCA 3HR4A 3K1AA 3QVMA 4S0XA 3IB6A 3MQFA 3HN7A 1TU4A 1YULA 2DTXA 5GJCA 2QR2A 2ZBVA 1KI8A 2IPOA 2Q27A 2QX9A 2YJNA 1NXXA 3LD9A 2IOHA 3PXDA 4QGFA 5E9JA 1P73A 3FUWA 1WTAA 4ALJA 4AECA 4DG5A 4L5BA 1U0EA 4DSUA 5JMTA 3KQPA 1JWAB 1F48A 3AV3A 3MT7A 4HAVA 5L40A 3BC9A 1J25A 4NBSA 3ZXUB 2IZ1A 1HNNA 2DHRA 2C8VA 5IT4A 4HFRA 1KDYA 1FEZA 1T3TA 1ISHA 2Q62A 4X0EA 1U0SY 1ZHFA 1ZOOA 2YZNA 3A6DA 1ND5A 4WZBA 5IC5A 3UKJA 5ESWA 3GVXA 1P2VA 3B1VA 1GSOA 1H8HA 2I55A 5DBGA 2JAPA 5IVKA 4ZICA 1T4CA 2IDMA 4ZI7B 3VPCA 5G2OA 4XM3A 2WG2A 4KFSA 1OH6A 3U1VA 1DTWB 4KPFC 5KAPA 3RQIA 5FTLA 5FWXA 2YV2A 4JYBA 3ZDCA 1RHRA 1U3WA 2Z43A 3A4IA 1H2ZA 3QZUA 1U4OA 4J9UE 4AMZA 2NYAA 3NIWA 1UUFA 4MKGA 1KAGA 4K46A 2GKOA 5IUJC 2H9YA 4OHYA 1A96A 1ZU5A 2IWRA 2E2WA 2ZJ5A 3C3WA 3QLUC 4HVAA 4I14A 1GJRA 1FX0A 1AIPA 5HKKA 1T34A 2Q4TA 4LGYA 1B74A 1C3LA 4FFNA 2JD0A 4G5YA 2I2WA 2ZAMA 1JEAA 16PKA 1ZNWA 2G70A 3AL2A 3HEAA 5AHRA 3AUTA 3PHBE 5E7QA 3SJBA 3D6VA 2PG3A 1T5IA 4HB0A 1J70A 4Y2SA 1EXVA 4E6EA 5GV7A 1JHOA 1EXMA 3LXRA 1Z12A 1G8KA 3O0DA 1R4NB 1XZGA 3GEMA 4XGKA 3KG2A 3AJ8A 5I4BA 2I2BA 5JS6A 1U2ZA 1X7WB 2AUNA 2Y1GA 3MLBA 3KSBC 1UM9A 1SY7A 1DMSA 3CG0A 3UHOA 4YN3A 1C8VB 2DIEA 4JAVC 4Y6OA 3HWRA 4N3NA 4LJYA 3URKA 2ODAA 1R0SA 2XUOA 1P9OA 2XUFA 2Y2VA 3DW3X 4LJSA 1XZBA 3K0CA 2UZ1B 4PQEA 3KEQA 4PXSA 3KHKA 2O59A 4AWBA 4PHTA 4TT3D 4X1OA 1YHNA 2H11A 3B89A 2OV2A 3ADCA 1R5BA 4JQSA 1OXUA 5CFZA 1UCFA 2J9GA 3PI6A 5IZCA 2NUPB 2VHJA 3N1UA 3UXEA 4NFHA 4RPJA 1XTPA 4HH0A 2UZAA 1N6KA 1T8UA 2EG5A 3WR5A 3G2HA 3N8IA 4IEIA 1LRLA 1ZMTA 4OP1A 2BONA 3LKVA 3NUGA 3RGGA 2ZE8A 2AZXA 2VKQA 2F1LA 3H4VA 2Z56A 2PSDA 3ZBPA 4DR6B 2DBVO 2CDBA 1MEOA 1XIVA 2HDOA 3I76A 4NBNA 6CHYA 1SXJB 4G1MB 4CEIA 1ZK1A 4E88A 1EJ0A 1KERA 2G76A 1M76A 3SX4A 3H11B 5SZIA 2QTMA 2Q3JA 5D3QA 1Q91A 3LUJA 3C4QA 1NMEA 2Q28A 3PTZA 3RNOA 4BKUA 1OGJA 4KDFA 4TSRA 1Z45A 1Y3FE 5FOSA 4MP8A 1KETA 5C7IO 4UHDA 1YIOA 4YO8A 2GLTA 3P0EA 3UWSA 1CE8B 1FP4A 4MPJA 4UMDA 3WQZA 2Y3IA 3CJRA 2OCIA 3TLZA 3CV3A 2J0SA 2RI0A 1KJWA 4K81B 3VQTA 2BT4A 2FX2A 4X7PA 1GA1A 4ARBA 1UDWA 3DZFA 1K89A 1N8KA 2Z3ZA 3A4NA 2C99A 2AG1A 4KXXA 4PZ9A 4F1JA 1C30A 2BVNA 1NJ1A 2DTDA 3BC1A 3K15A 1H6BA 2ZIWB 3ZLTA 4C07A 4BUJA 2Y1WA 1UZAA 1JBEA 1D6NA 1HI9A 5CGQB 3G2IA 3AF4A 4XFKA 3T3GA 5GZ1A 1JDUA 2I3ZA 4LY0A 4MRSA 5IBPA 1R0LA 1YS9A 1GY8A 4OJQA 2YTZA 3MQ2A 4BV8A 3PJEA 5JZ9A 4DAOA 5FLEX 4A4DA 1SBCA 4R9RA 4P5PA 3GUUA 1EUYA 1Z6AA 3Q8LA 1HE4A 5FADA 3KEWA 1JR3D 3ILYA 4UBLA 4QWMA 1E7WA 3CUYA 3LO8A 3GFGA 1SCUB 5KW9A 1RJGA 3LPCA 1FDWA 4ARCA 1N0UA 1QTQA 4R98A 1SBIA 3DE0X 4QBFA 3UNXA 4PFSA 4KRXA 4G0ZA 5DNUA 2DFDA 4Y2HA 2Q1TA 2ZQZA 1L1QA 2B7CA 1DHRA 3T56B 2HJ9A 3L8ZA 4QTTB 1ONPA 2W8BB 5LXTB 1MRSA 3H18A 1WAMA 3NV9A 3BMCA 5JLAA 4A82A 4C22A 2W6ZA 3S40A 3V1LA 5ITSA 2QNRA 3IQDB 3UTCA 1EVIA 1PR6A 1VJDA 4AX8A 1O89A 1W85B 2YIDA 3H1PA 4XI9A 2RH5A 4EECA 4MO9A 3WA6A 4J7CA 5LZ8A 1LDGA 3AB8A 1L5SA 2ZR9A 3A1PA 1A8PA 4ZEVA 2QLNA 1F8YA 1QXSA 5BT9A 4NCBA 3U2QA 3I12A 5TLSA 4ROXA 3S2IA 3TNFA 1O8BA 3U5ZB 5DBFA 2A84A 1ZISA 2ZTHA 5EESA 1GGMA 4GPZA 1XAIA 4MUKA 4WOKA 3ZCVA 2F1OA 4G5GA 5AW4A 1FFEA 4CQMD 4K86A 2KI5A 1L5KA 3TEFA 2I54A 4E33A 1P7CA 1XZQA 1UPUA 4PO8A 5AI4A 4OREX 4AK9A 4B74A 1PTJC 4IDGA 3ZIUA 1ZA1A 3AH8A 1WG8A 1CR2A 1KI2A 2W48A 4ZI3A 1ZC4A 4OLBA 3IP3A 2FJUA 1JLLB 1LRKA 1S0UA 2X5OA 2VOEA 3FKJA 3LL7A 1KK3A 3I30X 4R1LA 4X84A 2W2PA 4QFDA 1W49A 2ZATA 4MUAA 4OQQA 1A2QA 4B6FA 3HSSA 2OHXA 4HLCA 2FPIA 1RFGE 2QN2A 1VQNB 4XB2A 1EUZA 4AROA 2P8JA 2XSZA 2BFDB 1LV8A 5ECWA 4AP9A 4HUJA 1P6XA 1YU6A 3UJNA 3AWIA 1EPUA 4LJ9A 5A9RA 5E3JA 1NVUQ 5MDHA 3RODA 4FHCA 1QYVA 3W3ZB 2EKBA 1NBWB 2VH5R 4I36A 4R54A 4WKOA 3EEFA 3VPSA 2CT8A 3DZKA 2OVFA 4BNIA 2ZI4A 4GI7A 4M99A 4IYJA 2DMRA 3TUZC 2GYVA 4O1HA 5AI0A 5T3UA 1KDVA 5JRJA 3Q8WA 2RCYA 1AUVA 2UZ1A 4RJKA 5IS2A 4ZAYA 4ND1A 4F5WA 1P4MA 1RADA 4IXNA 2HT1A 5KBYA 1ECFA 3V8EA 3SHOA 5I7FA 3B20A 5JR3A 1X94A 2DR0A 1FYDA 3AYXB 4IF4A 5ALGA 5GJBA 4QUAA 1Q5PA 3K9FC 2G5GX 2ZXHA 1D6JA 1E6KA 1RI2A 2HADA 3D8BA 4YQYA 3NI2A 1N33B 1KS9A 1MTOA 3IUBA 1T3ZA 5AI5A 3JQ8A 4RHTA 5K4AA 4FDAA 5F52A 4C29A 3KOZA 2J9ZB 3BICA 1VL6A 4KXVA 1EA5A 2HI0A 4XUCA 5FOUA 4ALNA 5BSEA 4NENA 1Z4KA 3PVZA 1CRPA 2PCLA 4KOEC 3IVCA 4O1IA 3OA0A 1HEUA 2Z3WA 2Z08A 4HNGA 1QIFA 1OA1A 3H0KA 3KKMA 1VB5A 5ETJA 3WGHA 4XARA 1V5FA 3HSKA 3LC0A 4UXHA 2AEMA 1QQ6A 3GAFA 1VIMA 1JSZA 2JK1A 5AVWA 5J4YA 3I9KA 4WCFC 1H1LA 1JPVA 5IVDA 4YAGA 3BCDA 2PGNA 4I9GA 4JQCA 1ZK4A 4GWLA 2G63A 5BN3A 1KJYA 2EP5A 2W58A 1HTTA 3L04A 1IBMB 2J85A 2DFVA 4OJMX 4QATA 5D8DA 1RSZA 1QF7A 5B3AA 1TMKA 1TDJA 5FPTA 5AOVA 4B8WA 3O26A 5CXUA 3SS9X 1ISRA 4RZIA 5EMNA 1XQXA 3ZWVA 2A4KA 3K0AB 2EP7A 1ZLXA 5DX8A 4D9HA 5FQOA 1SIWA 2ZYUX 1UDCA 1SO8A 4CCSA 3STHA 4CMJA 1U0RA 2XI4A 3LW7A 3GJ4A 3OZCA 5CBPB 1ZHOA 1IHDA 1VJ1A 2WYVA 4UUNA 5KYVA 4EFNA 2OFPA 3WK8A 2H06A 1T9KA 1UEIA 2BZ0A 2I6UA 3C3DA 2CJXA 2PRSA 4JBYA 5JYBA 2J7PD 3BZBA 4RCVA 5A9SB 3PGXA 3JD1A 1GQFA 1P0PA 4G5FA 4DYVA 4HDMB 1N07A 4MWGA 4TMWA 3B3JA 3H9QA 1T35A 4EW3A 2NT3A 1ZP6A 4QU9A 3FF4A 4B32A 3DFUA 1MVLA 4AJ1A 1E2MA 1Z6TA 1HUQA 421PA 3OZ7A 5CA0A 4RA6A 2OCLA 5K0CA 3SXUA 3UMGA 4HDAA 1B6RA 2PYZA 5E6UB 3AQ4A 5L7YA 3HEMA 4Y9SA 1KA9H 2G9UA 2GN6A 1N2JA 2Y71A 4TKZA 2V5VA 1K8YB 2G67A 1RKXA 3P20A 4G5XA 4XQ0A 3ASSA 4YAJA 4IOJA 5EJ2A 2YJ6A 3GFTA 3VZRA 1YRBA 5IAAA 1U8ZA 2VHXA 3HB1A 4P5EA 5C1IA 1GU0A 3RHZA 3WLHA 1C5KA 1E9AA 4UASA 1UD3A 4JUIA 4HDNA 3TX2A 4S0ZA 4D8WA 4RHFA 3C5VA 5GGYA 4V0MA 4MCJA 3HDQA 5K3DA 1I13A 4REQA 4CR8A 5JVDA 3RHFA 4DMUB 2L0XA 2WZBA 4E46A 3PEWA 1TO6A 5ALSA 2NQ2C 4OHKA 4UE6A 1K6EA 3HFJA 3IHKA 4KRGA 4Z54A 1JPUA 3ZZTA 1U65A 5AW6A 2HM7A 2IOFA 2VPTA 2Q0QA 3MPUA 3C7TA 4Q4HB 1H9BA 5C81A 2CUNA 4QPZA 2DYKA 4HNUA 3PQ3A 4PIVA 2WSLA 2L69A 3OZGA 4RZUA 5T64A 3UN1A 2FUKA 4EG5A 2C2BA 5KO2A 2NXWA 1D2EA 5INTA 4EZEA 1Z0AA 1QHIA 1Q84A 2BMAA 2ZSFA 4YAKA 4QVAA 1E96A 4WHMA 4ESHA 5LQSA 3T15A 1WCXA 2H3EA 3IHLA 4XZ3A 3KYJB 1G16A 4G8BA 2PSJA 3OU7A 4WNAA 3PXUA 3QMVA 1V6AA 4N6NA 4BXOB 1H1LB 2I3DA 1EJ6A 4LDJA 2JEYA 3UMSA 2BD0A 1FRZA 2NN3C 4IFEA 1JU3A 1M1UA 2XLBA 4UXIA 1PDOA 4N4AA 3E48A 2FPPA 5I5GA 4JODA 1I24A 3S2SA 2AWNA 4FQ8A 3HWX1 3ZWMA 1SEVA 4A0FA 1P75A 3W2TA 3LCVB 3IIJA 4PLGA 2AJLI 3FWNA 2NYRA 3ORYA 5DTJA 4DADA 1A9RA 5H82A 3ZWQA 2XWBF 5EIWA 3USCS 4CKCA 4CGZA 1Z8HA 2PBRA 4L27A 1LSUA 3LO5A 2WABA 2J3HA 2LRHA 2QAJA 3JQEA 4C2BA 4CGYA 4K9MA 2XWJI 4J49A 5B57C 5KTMA 1PL6A 3L0OA 4TOIA 5JIBA 5JV5A 1NBOA 2JVIA 3EF0A 4IQFA 4XTCS 4GVXA 3BJMA 2G77B 2ZWIA 3W7AA 1HFWA 4B87A 3DEIA 2BJHA 3SY8A 1U8CB 1OH5A 2KBFA 4YYZA 1X1TA 4E51A 4OHMA 3P2MA 4P4NA 4BCCA 1L5FA 4QBIA 3DO8A 4JUFA 4JX9A 1I4DD 4TKVA 5ESXA 3RU7A 4TV8F 4NFSA 5L3SA 5C34B 3AL0C 4E0FA 2JB9A 3IXLA 1Z62A 3Q15C 4BB6A 1U11A 4Z1MD 4NR0A 3L6CA 1Q86D 4G0NA 4G5RA 1IEVA 4MVJP 2QTWB 4UATA 4Z2YA 1T13A 4G97A 1CF9A 1M1XB 4FYJA 1K8XB 4ETMA 1WBJB 1UF9A 3WB0A 4XOPA 3GPBA 4MV8A 1Z5WA 2W2VA 4Q21A 1QGYA 1DC4A 3MTGA 4I3HA 3NQ41 3JQ9C 5K6RA 4U9IS 2QQFA 4YR7A 5I3CA 1T4GA 1LK5A 3ANTA 1CY2A 1E4YA 3V8VA 1U98A 2YL2A 2JAQA 3IULA 3M9LA 4F12A 3F47A 1JIJA 5DHUA 4NG4A 2XCTB 1G60A 3O95A 4QNRA 5SYMA 1MOQA 3T1HB 3T3EA 4ZMBA 4Q4HA 4MXDA 2PEYA 1OAOA 3BL5A 3EG9A 1E59A 3ID6C 3BRQA 4HB4A 4XQCA 3X0DA 2I1QA 4EMSA 5BVGA 1ZWKA 3OJ0A 4JEUA 2A7XA 1ORRA 4JLNA 1O6GA 4MIKA 2B83A 4IINA 2Z6UA 1NQXA 2IYOA 5IYZB 4HP8A 2OP0A 2X13A 2V4UA 4HS9A 3DBHB 2F17A 3DFFA 4WJKB 2ZB7A 3L01A 1VYHA 1JSXA 4R40A 3PC8C 3WL4A 3VPXA 1T5EA 2OQVA 3KPWA 2J09A 2XQJA 2YC2C 3ZBTA 2C9CA 3WAJA 2O2CA 2PUJA 3A28A 1VYVA 3UTDA 4YAWA 1ORVA 5K4HA 1QDUA 1YQEA 2WICA 5EIOA 1W46A 5TMDA 3R0IA 1GAEO 4F2DA 3QKRB 4GGMX 4N1AA 2G4LA 4X54A 1W581 3X44A 3DMYA 5KHOC 1VXOA 1VPDA 4RKYA 2RKBA 5H68A 3TWOA 3RUHA 4PE5B 4IH9A 5ALXA 4OKIA 1UP6A 1ZOIA 2CFSA 4N9QA 2CJYA 4PYRA 1JG6A 2C88A 3D2AA 4OGLA 4XKJA 4XUDA 4Y30A 4YAIA 2CZGA 3T7DA 1P7YA 3QXJA 3IUYA 1UC5B 3NFYA 3S6JA 4DDVA 3HU1A 4O4IF 4A0QA 3B2QA 1JKXA 1ZM7A 2FGKA 2GAFA 4HWKA 3WOVA 2JI6A 2FEPA 2OZVA 2B4YA 2AR9A 3PJFA 4TKUB 4GMFA 5AHOA 3A1DA 1F51E 4O2BF 4UVEA 2POCA 4D3ZA 4ZIRA 1W6RA 1FP6A 2GEVA 3IVXA 4ER3A 3EFHA 1Q7YD 2Q9CA 5D86A 1YR6A 5DCWA 1KIAA 3HLYA 3ODPA 4DCMA 5IX8A 3RSGA 4JK3A 2OTJB 3OEEA 5JPCA 5K0BA 1TVKA 1CC1S 1SK9A 3BMNB 3DH0A 4GMHA 1DOZA 5DTIA 3U4MA 4Z8XA 3CESA 1MX5A 1Z0SA 2I7DA 2OCYC 3K2IA 1X7ZB 4Q05A 4HUTA 1J8FA 2BP7B 2WUFA 4H7JA 1PFVA 1D2NA 4I55A 3ZDFA 3EGWA 1X9HA 1FP1D 3ZWBA 4YT8A 3ETHA 3PRKE 4AIIA 3DCYA 4ML3A 5BY2A 2F1JA 3X2FA 1DU4A 5T6MA 3WMWA 4F93B 4IEFB 3VA7A 1L7XA 3A32A 4M36A 3UW3A 3NT4A 4EQ6B 3EARA 1E5TA 2EW1A 2XMPA 3BNWA 3AUSA 3C6ZA 1SD5A 2W6PA 3K9CA 3WMEA 4PNZA 1NMZA 5K20A 2E4AA 2JH9A 2NZYA 3I72A 1PQUA 2FOXA 3RYHB 1Z0ZA 3Q11A 8ADHA 1PR3A 4LA4A 2UUOA 3P9PA 4UAVA 1XMPA 1DBPA 4LAFA 1KU6A 5KIAA 1NQAO 1GPMA 2G83A 2ILTA 2ZJYA 3HMQA 4EGJA 1MC4A 2HSGA 2ZW9A 1KH1A 1V1MA 3CX8A 1X7HA 3FM9A 3WRVA 1PR5A 2RIPA 1C4OA 2IEGA 1Q1NA 3NVAA 1VMDA 2H7XA 1I3MA 2V7QA 1PZMA 1NATA 1Z16A 2Z4SA 2HWXA 3CZRA 3HI4A 1XRLA 3CRZA 5DYIA 4LN1A 2CB9A 3EIFA 2DQKA 1VXRA 2AG8A 2A30A 5FI5A 2AFIB 3AHCA 5D5PA 1TQDA 3U40A 4HFMA 1KI3A 2A78A 5BNWA 1FYEA 1X7YB 4WGFA 3LXMA 4JFRA 5EZYB 2P11A 1MO2A 1WVMA 2YS7A 2O3RA 2JGNA 2AYZA 4YFYA 1YMUA 4NV0A 4R81A 3AVUA 1K66A 2RFLA 3L05A 1XZDA 1R2QA 3H7AA 3VSBA 3AW8A 4Q34A 1I0IA 2V55B 3RPEA 4NIMA 5AOAA 5BNIA 3ZX5A 4PQGA 3TL6A 4WXRA 4K9DA 1LEHA 2CLHB 1SBZA 1CRLA 1P5RA 1RZ3A 3P9QA 4UDYX 2H2WA 5EKUA 4DCJA 2SBTA 4FYXA 1LW6E 1SM4A 4OSPA 5F12A 1RIFA 1IDN1 1KHTA 1H1TA 1YQQA 5F21A 2BEWA 2C77A 4TRNA 5C8DA 1VBKA 2P3QA 1JBKA 1TEHA 5A5FA 5KNDH 5KNDA 2UYGA 3CCUB 1P0FA 4BX9A 3W9UA 1SCBA 3DBVO 4JIMA 3EPLA 2ZE5A 4HNAA 1N2OA 4CKEB 4UDOA 4EHDA 3P52A 4DB4A 3P1JA 1V0EA 2X23A 3HKCA 3L07A 4FONA 4PRLA 3RC1A 4A15A 3OQPA 3QEBZ 1II8A 3HR7A 2JDID 3I9V6 2QM7A 3SR4A 2J4CA 3V7FA 3GVJA 4C2TA 3AC0A 5LP1A 4LJAA 1RU3A 4R1QA 4FYYA 4OB6A 3KPJA 1JECA 3BMNA 4V0OA 4WFIA 3ROMA 4UFOA 1YZ3A 2PD4A 3QOFA 4UNIA 3W90A 5JNSA 3BUSA 5BWCA 4I8IA 4WOJA 2VQEB 2ZIZA 3X1YA 3CJTA 2AE2A 1H8ED 5K6AC 1OE0A 1JNXX 4H16A 5AJHA 4GD3Q 4JI7B 2W6QA 2V74B 3KKQA 1M6VA 4P25A 2OCBA 4GUAA 5D87A 2XE7A 3QLVC 2PLFA 2QRLA 2XQKA 1X1DA 4BFZA 3JQRA 5E1OA 3MCVA 1Z18A 1OKKD 1IOZA 4QYSA 1M10A 3O8OA 4Y2JA 3HKEA 3RVNA 5JBIA 5JYDA 4ZOEA 2MU1A 4JQOA 5TEWA 4BO1A 1ZI9A 3LQ4A 1DKNA 2O3QA 4NC9A 1JXQA 4FILA 3A70A 3TJZA 4RPHA 3TQTA 2R6DA 1VJTA 2GBCA 5JPDA 4MJ3A 4C0WA 1SB9A 3MTEA 4E2WA 3ILVA 3TLYA 3L0CA 5I51A 1ZVVA 1K9MD 1A97A 3QTTA 5CLIA 1MAAA 1ZH2A 3HV0A 3CPWB 2WI8A 2WU8A 1J2YA 3F9CA 1YIAA 2PSHA 3JR7A 3OQ1A 3NWEA 3RYCB 1O3YA 4UARA 4BP1A 1C9KA 2KE5A 4OQ4A 3RFVA 3ZTYA 2O0KA 2ZIFA 3WAGA 2WIDA 2AKAB 3DVRX 3L06A 3SC6A 4ESVA 2JHGA 4XORA 3CP8A 2PD3A 1P2GA 2DSNA 4R7GA 3QJYA 5TR9A 3EXIA 4NH0A 3O31A 2JJ2D 5CYGA 1U8AA 4X20A 5KSPA 1VCOA 3NH6A 1W2WB 4ZZ0A 2OCKA 2R62A 3O75A 2PKYX 3BD8A 3K09A 4ZANA 2O19A 1RKQA 1V1RB 5EC8A 1JFLA 4PR3A 3T0GA 3TRJA 3EAFA 5THKA 3LWBA 1BC5A 1FSSA 1G2PA 1RAEA 2H6EA 1YQXA 1BVRA 3O1JC 1B43A 1HSZA 3IOMA 3BIOA 3MMZA 2O8DB 4L2IA 1EAMA 4EG6A 1Q0SA 5DRYA 2JEZA 2W6OA 3ODGA 1YBHA 5DN9A 4F4UA 4CEJA 3L1UA 4ZJZA 2EX1A 4W8HA 1UBGA 2B4KA 5AI6A 1YB5A 3F6EX 1W1WA 1YQUA 3RYHA 5EYPB 3PRHA 3MWEA 3O91A 3OQBA 1SOMA 1DIGA 2B4AA 4KN5A 1USKA 3AHEA 5GOZA 1KGSA 3BH6A 1BTOA 4YRMA 5CDUA 1JEYA 1EE1A 4XR9A 4LZJA 3LT4A 1NW3A 3DDNA 3O8QA 1CXZA 1IBCA 2GEFA 3P19A 2QN3A 1H5NA 3B48A 4FZJA 4KBYA 4P0TA 4RULA 5BRAA 3O3CA 2I8CA 3ZWXA 1RRKA 3FH0A 1NBAA 1DRUA 2HJSA 3VZDA 1CTQA 1IVSA 1SC4A 3ROEA 5LXTA 1UPAA 5I3ZA 3PDUA 5DTRA 3H6HA 4M89A 4BX8A 2MCFA 1L8XA 2XB9A 3VPGA 5U4XA 5DS0A 3CZ9A 4C4AA 3C1UA 2BFCB 1K5GA 3ASPA 5AHKA 2OHJA 2P1DA 1P33A 3EZ9A 1WZUA 3T7AA 5MN6A 4DBLE 4F5ZA 3NANA 3EXHC 4AF7A 1U0OC 3C3PA 1C7EA 1Y6GA 3NNSA 3A3YA 2V31A 4JL5A 4KFRA 3ILXA 4NYJR 3SZOA 5L45A 4QU5A 2R8ZA 5F98A 521PA 4XYLA 1T4DA 4C5CA 4MVJH 4MVJA 4F1WA 1U94A 3DQQA 1PKVA 1W85A 2NVBA 1TKBA 4I6GA 3HYNA 4Q9NA 3ZGZA 4PQRA 2HAEA 2WZQA 2ZUCA 2Q99A 5U4QA 1T91A 4MS3B 3TRKA 1F12A 2YUTA 1KI9A 2Z2XA 4X66B 3VVLA 3DL0A 2P65A 3O8QB 4JKYA 4KSYA 1JFSA 4XSGA 3GRVA 4BO3A 3C7CB 2G9RA 2OV6A 1FFWA 4PLPA 3SEJA 1T24A 2J5RA 4BO5A 1PZGA 2E7ZA 3JWHA 3N59A 3T5TA 4IUBS 3FLEA 4DQDA 3K5HA 5ER6A 2WVAA 4HDCA