4RD0A

Structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gdp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVAHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd0A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd0A01
4E5UA 4DDWA 2BV3A 2BM0A 4MA4A 3AGQA 1UKYA 3GJ4A 5LBIA 1II8B 4B3XA 3KTAB 5J5CA 5L3QA 3NTUA 4HDOB 4ASUA 1K8RA 3U3OA 2MMGA 4XTRA 1G8HA 1PLKA 4ZGQB 3M0EA 2MSCB 1Z2AA 2VHCA 1I7PA 1N5KA 1CR2A 4LJ5A 4C0JA 5L3QB 4DB4A 1XXHA 1EWRA 1OIXA 3SJBA 2DETA 3QKTA 1E9AA 2Z4RA 1ZUIA 4QL3A 2PX3A 5FTLA 4Q9JA 2HV8A 4NBSA 1XXHB 2VP0A 4URXR 3CC4B 4D4MA 5FUWA 3RLFA 1BO6A 2VYQA 4BEJA 2ZETA 1DVRA 4L9WA 1ZU5A 3HP1A 2Z43A 3ZQ6A 2FFQA 1EESA 1DARA 5H59A 4MITA 3P32A 4KFUA 4TYQA 5JBQA 1X3SA 3A37A 1V5WA 3WBKA 3WMGA 1TUIA 5C46F 3GFPA 5A5GA 5FBRB 4DB2A 2XB2A 1FL9A 3Q5EA 1OXVA 3VNVA 1NBMD 2ZJBA 3FFBA 2E87A 3I3SR 1DPFA 3AGPA 1GL9B 4PZYA 3OE7D 1RVDA 4A2QA 4TQAA 3M1IA 5G40A 3JVVA 4AF7A 5FH9A 3IO3A 1AN0A 2A9KA 2H1LA 2JGNA 3GFTA 4NYMR 1K5GA 4O25A 1Z63A 2VP6A 4M1WA 1QVGB 1VG9B 3NC0C 1OLOA 3F0TA 1TADA 1E69A 3NH9A 4PQRA 3BFKA 4NPHA 5EP1A 5BYKA 3THOA 3FJOA 1SXJA 2CEAA 1IN5A 2ZRNA 1E2PA 4EH1A 1G4AE 2NPFA 5SZKB 1JJ7A 2WVJA 3EA5A 1OFIA 4DQLA 5ANRB 1OHHD 3B5JA 3RSLA 1F5NA 2JEOA 4I1SA 4JLPA 1E32A 2WWGA 1Z83A 5AUOB 1SXJB 4DEYA 3PJRA 4MDFA 1TNDA 2FA9A 1T4GA 5F98A 3RS2A 3I1FA 3I61A 2IXEA 2YNMA 1G7TA 5H8WA 4RD4A 4D6PA 4IXNA 3BRWD 2GVDC 1A5TA 2IYLD 4PHHA 4TL6A 4ZKDA 5DNYB 4MQBA 5EXXA 4BWYA 3N5CA 4HDQB 2FFBA 1Q82D 4JLJA 5G41A 3TUZC 3H84A 2G1JA 3SHFA 4TQUS 1TEVA 2AK3A 1NJGA 1JI0A 2HEIA 2WPDD 4IKEA 2ERYA 1ZIOA 3C8UA 5L3SA 1YR7A 1WP9A 1E9SA 1E96A 1P3JA 2P67A 2ZI6A 3AEZA 4RY2A 2IWHA 1JR3D 5J4VA 3GLGE 3LRPA 4PC7A 3TSZA 5GVRA 4JLOA 4YLGA 5L8VA 2NGRA 1RC8A 3CNNA 2QSZA 4ZCMA 5L3SB 5EJEA 4M53A 1N6IA 2CE2X 1SQ5A 1GAQA 1AKEA 1W1WA 4YMSA 4B3BA 1ZRHA 3WY9A 1M8PA 2JLXA 5AJWA 3FMPB 3T1QA 4BFYA 4FWTA 1E2QA 2G0NA 2G88A 2HXSA 1Z0IA 2HLDD 3PUVA 3R8FA 1N0UA 5E3HA 4PC3A 3MUFA 1BMFD 1AS0A 1NNEA 4S35A 4F4JA 5JCZA 1YZTA 2C95A 5JSZA 5KYKA 2C78A 1Z47A 4KLZA 4Q03A 5A4JA 1EK0A 4JL6A 5EXSA 1QF9A 2VHJA 3CM0A 3CR8A 4HB0A 4KODA 4PXAA 4YC7A 1E3MA 3ECCA 1YE8A 2ZU0C 5CIWA 5JSZB 3MD0A 1IJEA 1NY6A 1HQYE 5FTJA 3X1XA 2PBRA 1BH2A 3LQQA 4Q19A 3EIEA 3LQRA 2VHTA 3FDIA 1QGAA 2V3CC 1P9WA 4L4UA 3W9YA 1S2MA 5FBWB 1IN6A 3C7KA 5FL7D 1HQCA 2ZEJA 4DLRA 4CDGA 4DSTA 3KJHA 5KU1A 4G1VA 3EZFA 3B8HA 4LC1A 4PFSA 3QUSA 3B7GA 4LHWA 4N3GA 4AYWA 4BUJA 3SQWA 1IY2A 3EX7C 1CEEA 5H1YA 4RVCA 4DIEA 4MUBA 1Z06A 1J90A 1TUEA 2FEOA 4MDEA 1T3LA 2IXGA 2GZAA 3PUZA 1CS4C 4QM7A 1RYFA 1GKUB 3HR8A 1U98A 2NQ2C 5FBVB 3CLVA 4N1AA 3CMAB 3BB4A 4OQLA 3TUIC 1ZJ6A 4N0DA 3MWLA 3OHMA 1I4LD 1R0YA 4B2IA 3CPWB 1XMIA 1LS1A 3CIOA 1GITA 4NYMQ 1KMHA 3NBXX 1XPRA 2OLJA 4BLOA 1XFAA 3WHKA 1CNEA 3D31A 2RGCA 2OUKA 1DAIA 4PGOA 4CT4B 1VYUA 1ZM4A 4TLEA 3TQCA 2EW1A 3PV0A 2IC5A 3CO5A 3LX5A 3W3AA 1KMHB 4DDVA 3ZVMA 4G5OA 4POAA 1YHQB 2ZRIA 1ESNA 4AF6A 2ASEA 2PCLA 1EFTA 4UAJA 3EWSA 1NMYA 1QH0A 2W6JD 3FTQA 1XEWY 1IY1A 1JBKA 5J47A 4F7DA 3VR6A 3GJ0A 2VIIA 2R6HA 4FMCB 2WJGA 2XTZA 2R62A 1DAKA 1W0JA 1ZM2A 1G8PA 3QY0A 2QORA 2BKEA 5CIQA 2WWFA 4KU4A 4TLBA 4KAXA 3EIQA 4YDSA 2OESA 2DY1A 3CCEB 1CU1A 4Q1FA 1S8FA 2WWHA 4FK8A 1N6LA 4PC1A 4GL2A 3L8ZA 1R8QA 2H7VA 4ABYA 2JJ2A 3B85A 5JFGA 5LDDC 4A6XA 2XZLA 3EWAA 1COWA 1KO7A 2ODEA 3CRVA 1N5IA 2FZLA 4A2PA 4UQOA 1K9MD 4BE7B 3QVVA 3G0HA 1NMZA 5AWFC 2GF9A 1WBDA 1G7RA 1JALA 2XOKA 3ZS9A 4D4JA 3QENA 1DO0A 3KQKA 4W5JA 4DUGA 5EXTA 3OZXA 3ZVLA 2J9RA 3L0OA 1MRNA 5HE9A 2ZRGA 4JYCA 5EMNA 4CT5A 2DPXA 3KKOA 1KQSB 2PZGA 3C41J 1ESMA 3LO5A 2ZITA 3KUCA 4GPTA 5JEEA 2YC4C 8OHMA 2YYZA 4W7SA 4Y0AA 4JLAA 2RGEA 1ZNWA 2Q3MA 3QFSA 5C4MA 4Q4AA 2QPAA 4Q7MB 4TSFA 3CWZA 3FKQA 3QKRA 3K0CA 1Q0UA 3VKGA 3W6OA 3WBJA 1WDTA 2XNDA 5JJIA 3PG5A 3AVXA 2PT5A 4C2TA 4MYCA 2YC2C 4P0TA 4Q4AB 2HDNB 1XBTA 5H68A 2XXAA 1Q57A 3NBFA 3QKRB 1Q22A 1E9EA 3BH0A 3ND9A 2VSOA 3CX7A 3TE6A 2FPMA 4HUQA 4E09A 2F3RA 1PLLA 3K70C 1NVVR 3X1WA 4Z1MD 1KK1A 4D26A 1TTTA 4GOKA 1ZP6A 4TTQA 1T0HB 2XXAB 4M9SA 4P4SA 1W4RA 1D2NA 1DADA 1DS6A 2JDID 2NZ8A 4HUQB 2IUUA 1EFHA 2F9MA 2ZE7A 3FHCB 1G3MA 2PEYA 4FMBB 1VECA 5FR2A 4JLVA 1E79D 4P4SB 1GR1A 4PHTA 1F48A 1P6XA 3SZRA 1M1YE 1S1CA 5E95A 2J0UA 4M1OA 1ZW6A 5BXQC 4CEJA 2IEZA 1YZQA 2A5FA 3DVLA 1KDPA 1AZTA 2H57A 1ONBA 2SHKA 4QJ4A 4B74A 5KSZA 2CK3D 4XD7D 4PX9A 4A8JA 4A2WA 2OV2A 2J0UB 1A4RA 4XWAA 5CK5A 4C9BA 2J0SA 2ZI4A 4CEJB 3T5DA 5KNBA 2D2EA 2FEMA 4K46A 2CDNA 3VU9A 4A8JB 3IEVA 4NYIR 1U81A 5DE3A 1JNYA 2JASA 2IF0A 4TLAA 1E2IA 1Z8FA 3T34A 3ADKA 2W00A 5IHPA 2XNJA 2D7DA 3G71B 2AKYA 4LOAA 2J45A 4L9SA 4YMVA 4TMXA 1TF2A 1JQLB 3VU9B 4DLTA 1QUEA 5K8UA 4ZV4A 2BBSA 1NG1A 1DAHA 2PMKA 5B58C 4V02A 1ZAKA 2RGNC 3NDBB 1E2HA 2WHXA 1NKSA 3QBVA 2HYIC 4Q4HA 4PHGA 4PZZA 4IDPA 3NHBA 2VH5R 3S1AA 4GRAA 5IT5A 1UEIA 4B75A 4JVMA 1KAGA 3B1ZA 3DPUA 4IFEA 2WJHA 5FI1B 2ZJOA 2OE2A 4HEJA 4Q4HB 1OSNA 1AK2A 2BIFA 3S1AB 3PEVA 3SBDA 3IPXA 4DRZA 1UBFA 1XCMA 3MG9A 4G0NA 4M1YA 1N6HA 1RKBA 3CMEB 4JBYA 5BQ5A 2IYRA 2WMNB 2HT6A 3CZPA 1NJFA 2J7PD 3D8BA 1W35A 3NWJA 4JVLA 3SN6A 4EPRA 3T1TA 1VQOB 1XF9A 3KJIA 3W6NA 3W5VA 1TF7A 3A6PC 3N2IA 5DLQC 4TTRA 1VIYA 2GCPA 1W87A 5EZ5A 1W48A 2ZRDA 4CW7A 3QIAA 3VR3A 4N3NA 4Q01A 4Q02A 1CQXA 2A78A 3ZH9B 3A1UA 2CL0X 2P5TB 1E0JA 1VQPB 2QTFA 1ZD1A 2W6ID 3H1TA 4TQ9A 5CLQA 4F91B 2ZSFA 2J41A 3LO8A 4B35A 2QEQA 3CKLA 3BBPA 3CPEA 4UNRA 4Z54A 1AQYA 2QRNA 3FMFA 4L15A 3I62A 4QXAA 4D4KA 4XSGA 5HKKD 1Z0AA 1GOTA 5AJYA 1EFCA 3IGFA 4NONA 3OIWA 1SKYE 4HLUA 2EFHB 4YONB 2GAOA 5EE3A 1W34A 2ZSAA 2GNOA 3NKVA 1G18A 1Z6YA 4IVPA 2HT1A 4RKEA 4HB2A 4UXHA 1O87A 3T61A 4NKRA 3RABA 1SVSA 2A2ZA 2P0EA 4EUNA 1QHHA 2AHOA 4LBYA 5FPTA 3W6PA 1VCMA 5EE9A 3QOFA 1RPZA 4B76A 1E2KA 1OXXK 2ANBA 4D4LA 1NVVQ 4LHVA 2ZRJA 1QHHB 1SVIA 5E7JA 2VZLA 221PA 1DG3A 3VTKA 1G5TA 4BEBA 3EPLA 1H8HD 3BC1A 5EP4A 4EJSA 1FMLA 3P20A 2IYTA 2WSMA 1QVAA 2V8OA 3RVBA 1I4TD 1IXRC 5LD2B 3GMTA 4YAFA 1QHGA 4TZ6A 4EJSB 3U7GA 3T06B 4TT3A 4IJMA 4ZO4A 1R5BA 1VYVA 2PX0A 1VIAA 3PEYA 3AVPA 3KKNA 1F2UA 4NCJA 2WOOA 4DBLC 5CB8A 1RRCA 2B6HA 2KI5A 2VP9A 3CRW1 3ZD7A 1NDHA 3QI2A 4XWKA 1N6OA 4DC9A 4AD8A 4UKDA 1KK2A 3LBNA 2AXPA 4US0R 1F2UB 1LTQA 2OEPA 5IDVA 4LGMA 3NEJA 4KSBA 2FN4A 1KC8D 1LF0A 1JJ2B 4M8NE 3RRNA 2RGXA 1WXQA 4NYIQ 1G3UA 2WJIA 1ZM7A 5M04A 2DWPA 4OI2A 3W90A 3VKHA 1P2UA 2UZ3A 4MRSA 4Y9RA 4EFNA 3PQCA 3M4YA 2LKCA 4CEIA 3GJ6A 1BX1A 4LJ4A 1QFYA 2BF4A 5JI2E 4PAOA 2MSDB 1HT1E 1MRSA 1ZINA 2VA8A 3LV8A 4EQ6A 4CEIB 3VNUA 1E9DA 1AGPA 5FOUA 3RSOA 1XPOA 2QPOA 5E7MA 3J81k 4DLYA 4EQ6B 3CRMA 3K09C 1ZNXA 4MKHA 2DR3A 1XEFA 1ZIPA 2ZVQX 2OCBA 3SJCA 2XNCA 2GK7A 1QHNA 2V55B 4LYJA 1U8ZA 3W2FA 5FA6A 3OW2B 3CNLA 3DO6A 1OJLA 1UADA 2D74A 5D3QA 3R8CA 2ZUDA 2DERA 1EFRA 4PO8A 4DLXA 4QNMA 5IK2A 3V4FA 3SHWA 1VQ7B 2VP4A 4FCTA 2IL1A 2ZRBA 2VSXA 4NTZA 4QNRA 2O8CA 2OTLB 2BC9A 1GVHA 2V9PA 4Z51A 4LI0A 2AWNA 1FRQA 4QM6A 2BMJA 1NMXA 3KJGA 3JVUA 1VQKB 4BLQA 3OJWA 3PUWA 2O8CB 3CX6A 4MKGA 4DKXA 1VCIA 4QBFA 4OKSA 3OF5A 2J46A 2JLYA 5B64A 5K8IA 4G5QA 1NLFA 4ESHA 3SJZA 1XMJA 4PAMA 3EZ6A 3X1ZA 1AQUA 4MKIA 2PIAA 2RC5A 4AK9A 4P4UA 2VF8A 5GADl 4LV6A 1WBBA 3EIHA 1J7KA 5E7IA 4C3ZA 5KSPA 4ZGNB 5F9FA 2NMVA 2O0JA 2IEYA 5FBQB 4A82A 2ZJ2A 2RB4A 5GJCA 3U7FB 3FMIA 2ZYTX 3QJYA 2IBMA 2QL6A 1H85A 2ZANA 1GILA 4NCNA 4KBGA 2KWIA 3AVYA 4V0MA 4HAVA 3OEHD 1LY1A 4TMKA 2O8FA 3NH6A 1P9NA 1FW6A 1JAIA 1QVFB 4B4DA 4LWZA 5JLJA 4NL4H 4XH9B 1G19A 5CDFE 1QGYA 4ACAA 4MRPA 1QFJA 1NG9A 2JAQA 1E64A 3W5HA 3CC7B 1U90A 2BHRA 3THYA 2QA5A 4B3DA 2O8FB 1KK0A 2VNKA 1EP3B 4U9UA 2QG6A 3OESA 5F3WB 4DHEA 2AL7A 1G17A 3ASZA 5AUQA 1GG2A 5BN5A 1C9KA 2B21A 2FH5B 3THYB 4JYBA 1SVLA 4FCVA 4U02A 3SFVA 4BRUA 3ICEA 1KNQA 3BFVA 5HPYB 1JECA 4H9GA 3AV0B 2VRWA 5GV7A 3FB4A 2ZE8A 3D7MA 3I5XA 3MLEA 1GWNA 1XB2A 3P27A 3R9XA 1D9XA 1NN5A 1X86B 4NCHA 1JJVA 1Q1QA 3WRXC 4Q7JB 4TMTA 5JWOA 1FQJA 3IBGA 5KHOC 3K70D 4WZAE 1HUQA 3LLUA 4GOXA 5TB5A 3MWJA 1XXHE 1LFDB 1Q3TA 2MSEB 2FGJA 5BN4A 1G21E 1ANKA 2OO7A 1C4OA 3CX8A 2TMKA 1XD9A 3P4YA 1M74A 3EC1A 1CR0A 1QDEA 2GK6A 1NY5A 3KXIA 1QHXA 1DBSA 4FWIB 1CXZA 4JVNA 2R9VA 2BPOA 1S3GA 2X1VA 2ZR9A 3EASA 4I1OA 2C96A 3CXCB 4EPTA 2QEXB 2NO9A 2O0HA 4DSOA 1E2FA 4KBFA 4EPWA 2E1RA 1E94E 3N2EA 4I1UA 1P60A 1OIWA 5P21A 2OTJB 3QXXA 2HUPA 2ONJA 2OBNA 1E0AA 3KB2A 4O2RA 3I8XA 3MFYA 3KZ1E 4FCWA 4G1BA 5CB6A 1YR9A 3K0EA 2FV8A 3UWOA 4W5HA 1R8SA 3ZVNA 1KO1A 5EE5B 1AMOA 1OB5A 2ORVA 3U4QA 5FBLB 5DN6D 1IQPA 2PZEA 5SZHB 3KFVA 5KUTA 4GP7A 3GEHA 3QXJA 5A0FA 2REXB 3OZUA 2C9YA 4YMUA 3UMRA 2C99A 3DL0A 3OAAD 3U4QB 4CGZA 1AM4D 2WJYA 1KI9A 2P3SA 1D2MA 3E1SA 4AKHA 1HH4A 2QM7A 4Z1MA 2ZQ5A 1ETUA 2HJVA 1E9FA 2BBWA 5DISB 3UIEA 2GEUA 2FPKA 1GKIA 1SXJE 4B3GA 1CJVC 3EW9A 4KJZA 3X2SA 2JDIA 3TSWA 3FE2A 3CCQB 1JXMA 1QHIA 1JB9A 4AYXA 3EAQA 2VTKA 4P3YA 5AN9A 3C5HA 5B2ZA 1UMKA 2FSFA 2V4ZA 4Y0VA 2RC6A 3CD6B 5B30A 3U3KA 1SXJC 5J4KA 5KSYA 3PIRA 1KHTA 3F8TA 4R2IA 4EFMA 3ZJYA 2BN4A 4KCGA 5HCNA 4GMXA 3SYKA 3CZQA 4BASA 3QXCA 3M6AA 1DO2A 3WNDA 2NO0A 4TLCA 3SDZA 4BFZA 3BJIC 1TL7C 3AUXA 4RD1A 2OAQ1 5HTKA 1M90D 4ZI3A 2JA1A 2ZS8A 4P31A 3LWNA 4A9AA 2W2VA 5BW8A 1VQMB 4K8OA 4AYTA 1X8JA 2J5XA 2XAUA 5EE0A 4RCYA 3D6TB 3DOFA 1KMQA 1P73A 1Z6AA 4R7ZA 2NPIA 2V7QD 1NN0A 3REFA 2WWWA 4NDZA 1FPMA 1RJ9A 5FPHA 3RRYA 3HJNA 1D9ZA 1G7SA 2C9CA 3BFXA 1JEEA 3MRSA 3IDQA 3C14C 4JT4A 2RGDA 3OEED 1NIJA 3BH7A 1NF3A 3VR5A 2C03A 3AP2A 1XTRA 1P2VA 5JWRA 3WP0A 3GJ5A 2IHBA 3B1YA 2Z0MA 3RWOA 4IOKA 2QDXA 2G9NA 3RWMB 3HU1A 4OL0A 1CR1A 5KTYA 1X8LA 4JBXA 2ZJZA 1K6MA 1YITB 2IYZA 3AF2A 4BLPA 1OH6A 2G6BA 1GL6A 5JJKA 3C15C 5CJ2A 1ZUNB 4RJLA 1P7CA 1UBGA 3LXRA 5JCPA 3E5HA 3BAFA 1FNNA 1OE0A 4LK2A 2QP9X 4M9ZA 2BM1A 1GNPA 3REGA 5TY0A 1FUUA 1GIAA 3C16C 1UEJA 2X3UA 1XPUA 3O8BA 2PLFA 3HYRA 5CM8B 1F6BA 4CIDA 1WA5A 1VQLB 1K8AD 5HKKA 2GQFA 1G7CA 1IN7A 1FP6A 1DOAA 1LV7A 1N0WA 2AFIE 2XSZA 4Q1BA 4QJ5A 3VHLB 4BPBA 2ZUBA 2EIXA 3LDAA 4F93B 1NN3A 1YJWB 1JXOA 2GEVA 2IYVA 1XTKA 2WAYA 1Z6GA 3DKPA 2N42A 1HY3A 1CJUC 2OILA 4GZMA 1OFUX 4NYJR 1DELA 2XTNA 2DFKB 4Q21A 4KHZA 5D3MA 1E1RD 4MYUA 4OK5A 3AVTA 3QG1A 4BRWA 3GQBA 1J8MF 2Z83A 4LPSA 1W49A 1CKEA 1GM5A 3GFOA 3NVAA 4MRVA 3TMKA 4A0HA 5D3MB 4B71A 2ZSBA 3B60A 4PC2A 5FTKA 2ZUCA 5GJBA 3RS5A 3WNCA 1QFZA 3IBYA 4OI4A 2IS2A 1OT3A 2YOHA 4Q4LA 3VO2A 5G3YA 1K5DA 2J3EA 1XZPA 3WRYC 3WXMA 2NZJA 4HAUA 1PJRA 2PT7A 2NO7A 3BE4A 1J99A 4GT1A 1NLZA 3X1DA 4DT1A 3NHAA 2FG5A 1NRJB 4TMVA 1VMAA 2W0SA 3MHPA 1TAGA 3Q72A 3RNLA 4DT1B 4O0MA 3RYTC 1P5ZB 2Q0HA 4XIGS 4MKFA 4Q7KA 4ZPXA 2ZJYA 3MWYW 5B57C 1HEIA 4QG7A 1YJ5A 2JIZA 3LD9A 1R6BX 4JLDA 4LJ7A 1G8GA 2WWIA 2WSSD 1KJWA 3L43A 5DYIA 3OIYA 2MMCA 2OSBA 1GP2A 4JKIA 2RGBA 4UNPA 1BOFA 3CB4A 3LW7A 4WIAA 4KITB 1EG7A 2R8RA 4NU0A 1B0UA 1JA0A 2Q9AA 2QAJA 5TARA 4FIDA 2OFWA 3ZIAA 3FKSA 2GBLA 421PA 4DQKA 2ECKA 3U61B 3GLHA 2QN6A 4HAYA 4XVQA 2VYFA 2QU8A 2ZS7A 5JI3E 1VCOA 1XE1A 2ZYWX 1X1RA 2V6IA 4R98A 2IF2A 1W0KD 2B8TA 2EWVA 3OIVA 3W2GA 3PCRB 1XTQA 3GLHB 3LBHA 2KSQA 2O0KA 2DBYA 4CYMA 4OHYA 1I4DD 1IM2A 4AKGA 1E1QA 4NE2A 1H8EA 2ORIA 2JJ1D 2X77A 4DCVA 3K53A 2V6JA 2WKQA 2C9OA 2KBFA 5FOXA 2QE7A 1P61B 1AJEA 1H65A 2AD5A 3E2IA 2IW3A 3G82C 3THWA 1YQTA 3OJXA 2D62A 1QG0A 2EYUA 2PCJA 3UG7A 2CLCX 2WV9A 4CZ2A 621PA 3KX2A 4LHXA 3CCJB 1XD8A 4A36A 3SYLA 3THWB 5TDHA 2YHSA 3LAWA 2IS4A 4KFRA 1WE2A 4S2EA 5BYJA 5DI3A 4DLWA 1XZQA 4IVQA 1VQ4B 3AVVA 4MGIR 2CE7A 1RE0A 2RHMA 2BEKA 3RAPR 3FVQA 3K0SA 3AP1A 4TZ0A 2BJWA 2JLUA 2CCGA 3RS4A 5DI3B 1NI3A 1M34E 1RIFA 4ZDKA 2XZOA 1MKYA 2ZI5A 4A0FA 3CWQA 1Z29A 4TYPA 1SHZA 4EKDA 5FPSA 1Q1ZA 2XX3A 4ZDJA 4ASUD 4FMCF 1M7GA 1A7JA 2B8WA 2DHRA 3L0SA 1K73D 2ZE6A 3G5UA 1TQ4A 4TMZA 2QGNA 3A1TA 3WMFA 3ETLA 1ZCBA 4XOIA 3ZD6A 1JPJA 3TSOA 5KO2A 1W36B 1JR6A 4D81A 1KTVA 4F38A 2P6RA 4LSGA 1RRPA 3A36A 4QC2A 3UATA 1AKYA 1KSHA 5KNCA 1PUJA 2H5EA 5AJVB 2FSGA 5TMPA 3KKMA 2GJSA 2OBMA 4FD2A 1OKKA 1XTJA 3HR7A 4ITRC 4AC9A 2CNWD 1UDXA 2FGKA 2I4IA 3G4SB 4QBGB 2ZYVX 3SS8A 3LVBA 2OCAA 1HYQA 1EX6A 1KYIA 5TXGA 2OT3B 1KDTA 2ZAOA 3K0AA 1ZM3A 3ZYCA 4L16A 2IYXA 2G77B 3A8TA 3ZZTA 1R10A 3IIMA 1MOZA 1S3SA 4Q9LA 3T35A 1ZD9A 4PAQA 3UMFA 1IAQA 1ZMXA 1G3IA 4IOMA 3OFNA 1Q7YD 4EDHA 1OGJA 4ON9A 1G6OA 4C43A 3DKVA 3LXXA 4ZCLA 5FR1A 3UWKA 2ZSEA 3TNFA 1Q86D 4W5WA 1U0LA 4R71A 4LJ8A 4Q18A 4TLDA 4HAZA 4PPNA 3U3JA 1EGAA 1XCGB 2IUTA 1B2RA 4LDJA 3EPJA 3DM5A 1IY0A 5ELXA 1SZPA 3TBKA 3PEWA 2VF7A 2A5GA 1SXJD 1OB2A 3IEUA 1LS6A 1VHTA 2ERXA 3T5GA 5KSOA 5FUVA 4KVGA 4U00A 5JHHB 2H92A 1YZUA 1FNMA 1AIPA 1QGZA 4PZLA 4D82A 3A4NA 3EPHA 5EUMA 1MO5A 3IPYA 4DZZA 3C5CA 2VLIA 4YALA 1QX4A 1Q81D 1TEXA 1P72A 3AF4A 2QT1A 2ZJ5A 2QPTA 1F20A 4G5SA 3DZDA 2OZEA 5FTMA 1AZSC 3HYTA 3GEIA 3DOEA 1KSJA 1VYTA 2N46A 1QG4A 3ND8A 4Q48A 4QHTA 1P2TA 4X8MA 3FOZA 2FE4A 4ZI2A 1E2EA 1KZ7B 4QGHA 4US1R 3BB3A 5EE1A 1GRRA 1U9IA 5EP2A 4M1SA 4F92B 2ZPTX 1D5CA 2C04A 3HWSA 1NVXQ 2A5YB 2R6GA 2OCYC 2W83A 4HI0E 1D1NA 1WMSA 4AKIA 1L2TA 5DIFA 3ICQB 2ZU6A 3CRRA 4MGKR 4C0KA 4C7OA 3PUXA 3I55B 2CBZA 4UNQA 1NBMA 3LLMA 2CL6X 2QT0A 2R2AA 5GJVC 1BYIA 3OE7A 2OCPA 4HLUC 1TVCA 1Q3HA 4OQFA 3QF7A 5C18A 1YHNA 4C7OB 1Z22A 2ZSDA 4DSNA 4ACBA 1GNQA 2PH1A 4FMDB 4IDNA 5KDDA 1RYHA 3EA0A 3MJHA 4HLQB 3NEYA 3Q85A 4V0KA 1UPTA 1KJZA 2QMUA 3W34A 2H17A 2HMAA 1KI7A 1HA3A 5J4LA 4B6FA 3U6KA 5JS7A 4GDFA 5LD2C 4WQMA 2BGJA 2DFTA 1XD2A 4KXFB 4RFVA 3QFCA 1KKLA 1OHHA 4RZ2A 3SEAA 2QNRA 2ATXA 2JLRA 1NL3A 4KSCA 1UKEA 3O47A 1N3BA 3OZVA 5CJPA 3L8YA 1XD2B 4U5XA 1T3SA 4KO8A 1R5OA 1NJID 2EWWA 3TW4A 3LVRE 4KYUA 4QRHA 3KKPA 5HE8A 3VR1A 5JHGB 2HCJB 2GRJA 5DHFA 3A1VA 5KSWB 2ODBA 1S9HA 2QI9C 3KQHA 2A5DA 3TAUA 4NZYA 2H16A 2F9LA 2DWOA 2WICA 4WBSA 1BIFA 2ZXUA 1D6JA 5FOWA 2AD1A 2AKAB 4OBEA 5IF9A 4LYFA 3U44A 1OV4A 1OYYA 1XDBA 1RFLA 1Z6TA 3EG5A 4JJKA 3B82A 2WPDA 2RCNA 4ZDIA 2FNAA 4PQYA 4FXPA 2D06A 1PUIA 4MRNA 4LYAA 3U44B 1N6RA 1JR3A 4HLDA 3GEEA 1FNCA 4J0QA 2CXXA 3W5JA 1YR8A 3QKSA 4Q1DA 4X8HA 4DCUA 1NIPA 2BKUA 2F7SA 2QQ0A 3T12A 4N0EA 1FX0A 1G8FA 1J2JA 1L4UA 3V9PA 5FPKA 1DEKA 4CRWB 3QG5A 3CCRB 3QEJA 3QKSB 5H5JA 5FOSA 2YV5A 2ZROA 1EP1B 2HLDA 2FSHA 1XWIA 1FX0B 1P9RA 4HE5A 2PJZA 1BMFA 1L4YA 4R2HA 3GP8A 2LKDA 1F60A 4V0NA 4GNKA 3ZVRA 4LRWA 1U94A 3L2OB 3CW2A 3TR5A 3W2HA 4M9XA 4URUR 3B6EA 2K5UA 3IIKA 1TQ6A 2JJ8A 4GBMA 4AG5A 4OYHA 4A15A 4RCZA 1JQJC 2X2EA 2DYKA 2QP4A 5E4FA 1ZNYA 2FU5C 4QGFA 5H70A 4Z8YA 1M7HA 1GRNA 3UMSA 5AK0A 1LF5A 1Q12A 1AS3A 2VSFA 1W0JD 3IUYA 3U3MA 1E2JA 2FSIA 3PUYA 4P6VF 3DZ8A 2IK8A 1S4QA 4JVSB 2X19A 4AURA 1VHLA 2FMXA 3Q5DA 5FL7A 4LPKA 1II9A 1OFHA 2A7QA 3HDTA 3FWYA 2VPPA 4URZR 4JL8A 4BLTA 2YWGA 1FTNA 4LV8B 5THXA 1G291 1TF5A 1W46A 2JCSA 4LV5B 1SVKA 4HSEA 1MO4A 1TLLA 2VHQA 2HF9A 2JJ2D 3V4RA 1C1YA 1GAJA 5EQTA 2FDCA 1G5PA 2DFNA 4Z8XA 4F4CA 5FPYA 1COWD 1OW3B 3R9IA 2IHYA 4DSUA 5J4HA 4WVFA 5K8TA 2EFGA 4Q00A 3JQQA 4M1KA 3EXAA 2F1IA 2GCOA 4XSHA 4AIIA 4MUAA 5BN3A 4TYWA 3VQTA 2ZRHA 1TQ2A 2UZIR 3E1YE 3KL4A 4HATA 1FNDA 1QRAA 2R44A 1T6NA 2I1QA 3BB1A 1G6HA 1Q1EA 2GCOB 2WIAA 3TJZA 3GJ8A 4DUGD 4YQFA 5AUNB 2PLRA 4G5RA 2QAGC 4RD6A 2BWJA 2RMKA 1LB1B 4IDOA 2CMKA 2Q9BA 2QENA 4XVRA 3SE0A 1ELOA 1B23P 2B5OA 2CLDX 4X8LA 3QPWA 2GCNA 2NTYC 1E2NA 1PV4A 2WKRA 4JSYA 4Q66C 5J4YA 5DO9A 2W6JA 2WJJA 4PANA 2BMFA 3AVUA 5CK4A 1NLYA 1PZNA 4EPVA 2REBA 1GL7A 5G3ZA 3IHWA 4C0AC 4B32A 1DG1G 2WM9B 2XITA 4TSFD 4D80A 5KNDA 4YAOA 2OLKA 1E99A 3CCVB 4V0OA 4WXPA 3A1WA 3SQXA 2XNDD 4PPQA 3P1JA 2VP2A 3NXSA 4BFUA 1IN8A 4GI7A 1F3OA 4OHXA 1JB1A 4WOPA 1OXTA 1Z0JA 2ZI3A 3H4MA 1W4AA 1JPNA 1TX4B 4YXWD 4JZKA 3SBEA 4OK6A 1VG8A 4D0NA 3TGPA 1E2MA 3OZWA 3QXHA 2NO1A 1J9ZA 1KI6A 1UM8A 3LX8A 4C30A 1G16A 2RGGA 2GZHA 3BIFA 4US2R 4MRRA 3O8DA 1CTQA 3BOSA 4D0LB 3FYHA 2CCKA 1KI6B 3PVSA 1FOEB 1AGRA 2ZRLA 4KFSA 5AUPB 3I92A 1FRNA 4ZCIA 1RW4A 1BS1A 2VP5A 4PHFA 1U0JA 2HF8A 2KJQA 2AWOA 2ZI9A 3TR0A 4DLVA 3IHLA 4FN5A 3WNBA 2B92A 2BDTA 2FF7A 3CRQA 5CYPA 4B6EA 3NBZC 4A6PA 3CBQA 2VNJA 3AP3A 4JSTA 4BLSA 3RC8A 1U0HC 2GJAA 3K8YA 1W47A 3NC1C 2EVWX 4CEHA 1NVUQ 2FX3A 2PZFA 3FMOB 3K9GA 3AVQA 1A82A 4QGGA 4AWXA 2GAAA 3U7EB 1LNZA 1SGWA 3AKCA 4HDCA 2AXNA 4Q47A 3D3QA 4CEHB 3K9LA 1R0WA 1T3HA 5LB4A 4D25A 4DXAA 1NP6A 2JLSA 2C77A 2XZPA 5TR9A 2Q6TA 4B34A 4DCTA 3E20A 1ZC4A 4YHBA 3RDPA 2D3WA 4HB3A 4M4SA 1IHUA 1TPZA 4F4IA 2OK8A 1VQ5B 2OAP1 2RGAA 2D4HA 2ZE5A 3GLIA 5HR5A 2ZYUX 4ARZA 4L5BA 5FI0B 2R6CA 3BK7A 3GCGA 2GETA 2GXSA 1E9BA 3DEFA 1GFIA 5G53C 3SI7A 1DE0A 3AF1A 2IX3A 1SVWA 2O8DA 1IOZA 3CF6R 5FOTA 4C2UA 1UF9A 3F5FA 1UDWA 1N6NA 3GLIB 5CLLA 4ARZB 1UBCA 1W5SA 2I1VB 1E79A 4Q1CA 4RZ3A 3W5IA 2F6RA 4HLCA 3TIFA 1XJQA 2RAPA 1G4UR 2FOLA 4WW0A 4MYHA 3WMEA 2F3TA 3R9WA 2O8DB 2ONKA 3CF0A 1IN4A 5LB2A 2CNWA 1OXSC 1RRFA 1TMKA 4LHZA 5DGXA 3GPLA 2J0QA 4HB4A 1SVMA 5SZJA 1G9XA 3WYGA 2V1UA 3V76A 3U2QA 2CK3A 3HPRA 4XD7A 4EPYA 2FZ4A 2OG2A 1M2OB 4BQSA 3K0FA 4URYR 2DFLA 3W8NA 1QHSA 4KV9A 1OYWA 4O3MA 4C0BA 4KLNA 4OQNA 3UXMA 4A0GA 4E07A 1OH5A 2BBOA 2GA8A 1VDZA 4M2LA 3ZBUA 2GF0A 1HE8B 3K0FB 4PSVA 1KO8A 1FTSA 3P26A 3T15A 1I2MA 3UK6A 1KDOA 4H1VA 5KDLA 2QROA 4Q1EA 2QP3A 4AG6A 1P62B 1E2GA 1WQ1R 2IXFA 1CULC 1RRGA 4DWJA 3RS3A 3O8CA 2QGZA 3PENA 4RFSA 2YWEA 4IDHA 3B9PA 4LCBA 4NMMA 4OI1A 3I5YA 1CBUA 1JAHA 1RJ9B 4DJTA 3QNUA 4B73A 1HV8A 2IS6A 4RFSB 3W8RA 2QSYA 1GJRA 3ZZ0A 1G41A 1BKDR 2LWIA 2GHIA 2W2TA 3H86A 4G3XA 3VHXA 2CHGA 4CVNA 3VX4A 2P5SA 3BXZA 4E03A 4B44A 2V1XA 2BMDA 3Q9LA 4UXJA 3CPJB 2JLWA 2P2LA 2J7PA 1DTSA 3UANA 4A0RA 1SVOA 1L8QA 3CF2A 4IDQA 4NP6A 2J59A 3HU2A 3GLFA 2R6DA 2XEXA 2Z4SA 3LA6A 5AJXA 1IXZA 4DCSA 121PA 4C0QC 4JLBA 4BZQA 521PA 3IKJA 4TT3D 3ASYA 4LX0A 1Q44A 3GLFB 4B3CA 1GAWA 1GSIA 1ZU4A 1G3RA 1N6PA 4IOJA 1KO4A 3SJAA 1D8TA 3CCUB 2W6IA 4M1MA 3VO1A 3KXKA 1TQDA 2NG1A 4PR0A 1CRQA 2ZRCA 4M22A 1XCPA 4URVR 4H1UA 3VFDA 3AQ4A 3SYNA 3THXA 4TL7A 1TU3A 1YVDA 2NO6A 4X8OA 1GVNB 4AY2A 2ZRPA 1R2QA 2D7CA 4K1XA 2WZQA 2WTUA 3R20A 4A4DA 1ZYUA 1KDRA 4BFSA 2QA4B 3THXB 3T1OA 4PSAA 1Q20A 1E6CA 3VMFA 3A1SA 2Q3FA 3BORA 3GJ3A 5L3RA 4C0LA 3RS0A 3GLGA 3FHTA 1X1SA 5HCIA 4HUTA 2C98A 1XTSA 3I73A 4DDTA 2IS1A 1JA1A 1KI4A 3SNHA 4WA7A 1ZC3A 2ZS9A 2X8AA 1XRJA 5SZIA 4CF7A 1AS2A 4JLNA 1EFUA 1EWYA 1EXMA 4QOSA 1LW7A 3GLGB 2PL3A 2VHUA 4XJXA 3KQUA 3BH6A 1WB9A 5KPDA 2DB3A 1VQ6B 2VNIA 3EZ9A 2GZDA 3U5ZB 2CVHA 2AK2A 1H8HA 2AFHE 2GKSA 4D0GA 3AVWA 3QQ5A 1GO2A 1VQ8B 2F1RA 4UNNA 3LY5A 5AJZA 2BGIA 4EAQA 4JMPA 2J0VA 1EFRD 1WCV1 2W2XA 3AKEA 3LVQE 5KDOA 1W44A 2CNDA 5IK2D 1YKSA 1S96A 4Q9KA 4GMDA 3WYFA 1YJNB 1NN1A 1KD1D 3HPQA 1UBEA 4FINA 4WXRA 2HXYA 3P4XA 3VX3A 2FJUA 5TV2A 3CNOA 2IWRA 2YVUA 4EFLA 4KI0A 3FPAA 4HE6A 4Y7CA 3GLHE 1XEWX 1BJKA 4ZDWA 4G1UC 1ZUHA 2Z5FA 3W5UA 3WP1B 1GUAA 4B47A 4XWOA 1HE1C 4IW3B 2OXRA 2BSAA 2GBLC 4TMWA 1P4SA 1SKQA 2FFAA 4R9UC 2BMEA 2J7KA 2CVFA 1U8YA 4DCNA 2C8VA 4F7WA 2G1KA 2ZAMA 4I81A 1OFTA 721PA 1XTIA 3FGNA 1VQNB 1VG1A 2QMHA 2QTVB 1CP2A 2O52A 4KFTA 5JWHA 1W5TA 3RRZA 3B2EA 2F1HA 1FZQA 2XTMA 3VR4A 5FUYA 3Q3JB 2PMDA 2KE5A 2VBCA 1E4VA 4IHQA 5EZ6B 4B48A 1YU9A 4HZUA 2ZR0A 2RKOA 4LJAA 3RC3A 821PA 4RSGA 3BS4A 1KOFA 4UNSA 4HZUB 3EZ7A 3SFZA 5JRZA 2QBYA 4V03A 3KDSE 4BFXA 3V00A 3MMPA 2Q3HA 4JT2A 1E4YA 2QBYB 4RZUA 5F9HA 2BCGY 4A92A 2XJ9A 1MO6A 1W4BA 3KUDA 4MGYR 1W4CA 1IB0A 2I3BA 4TTPA 2YWHA 5EXPA 5CITA 3QE2A 4P4TA 4FW9A 4QKQA 2OHFA 3VAAA 3TQFA 3ZQJA 1G20E 4RZXA 3N70A 2ORWA 3LH5A 2Y8EA 3ADBA 1BYUA 2R65A 4QHSA 4QJ3A 2J1LA 1UFQA 3TK1A 2GXQA 2VNHA 3EC2A 4PPFA 3ZLJA 1OF1A 1T9HA 2YOGA 2YWFA 3WHLA 3K0CC 3Q7QA 1E9CA 4HZIA 2QQEA 2AR7A 2QZ4A 3CPHA 5HZKA 3SC3A 3GJXC 3K1JA 5C4GB 3R7WA 5AR1A 4XVUA 1W36C 3ZDQA 1ZNZA 3IO5A 3I56B 2JATA 3IILA 4NYJQ 2G83A 2EFDB 2GJ9A 5JS8A 1FFHA 3OIUA 1R0XA 1CJMA 5EP3A 3R7WB 3RANA 1MO3A 3ZZUA 1W2HA 2JLZA 3KQNA 3OEHA 1Q21A 1MH1A 2YJTD 2EQBA 5JECA 2GJ8A 2ZRKA 1IONA 3JQPA 4EPXA 1CF4A 1YRAA 2PEZA 4QBHA 4XTCS 3MAAC 1KY2A 4D2IA 3MSXA 3VR2A 3MGCA 3EZ2A 1FNBA 3L0PA 5DH9A 4RD2A 3PITA 1KKMA 1NKTA 3SR0A 3KB1A 4I99A 1OH8A 1KO5A 5FFMA 4YMTA 1MR3F 1S9DA 4JL5A 1VG0B 2XNSA 3W3ZB 2V54A 3H2YA 1L7VC 1E0SA 4Q4JA 4A8JC 3A4MA 1IJFA 3QFRA 4OHZA 1LVGA 3ES9A 1T8UA 1YZNA 4JS0A 2E9SA 3K9NA 4LY6A 3QPUA 1I2DA 1S72B 3TVTA 1U99A 5DYGA 3IQXA 4YXWA 5LPNA 1A1VA 4Q4JB 4IXMA 4TL8A 4QGAA 1FP7A 2ZRAA 4JJZA 2GWHA 3QPVA 4OI0A 5CM9C 2GJKA 1XNJA 2H8KA 1F2TA 1U2RA 4MH0R 2PJRA 5C2JB 3K0AB 1SULA 2HJGA 2VEDA 1BQEA 3AM1A 2CCJA 2F43A 4NH0A 2GDJA 3ADCA 4UXIA 1F2TB 3DMDA 2QTHA 2QY9A 3TAHA 3K70B 2IYQA 4V0LA 2F43B 1T0JB 4IFBA 1US8A 1FQKA 1ODFA 1E2DA 4HAWA 3T1VA 3CCMB 2GVZC 1XU4A 1Z0FA 1DDGA 5K8LA 2BBTA 1VTKA 4ILEA 1S1MA 4MYTA 2ATVA 4OHWA 4TWZA 4OQMA 2P65A 4TYYA 2HYDA 1M6NA 1Z0KA 1US8B 1GKYA 1G5RA 3VKWA 4DVGA 3LW8A 2G3YA 2KBEA 3FFAA 1NSTA 1XP8A 2NOAA 3I4LA 2GESA 3A58B 1Z0DA 1U8AA 3GJ7A 1R5NA 3CH4B 3W2IA 2BOVA 1QZXA 1KIMA 2OFOA 1CLUA 1IBRA 1NBME 2YZ2A 1U9IC 1P75A 2QM8A 1GZSA 4OJKA 1YIJB 5DN6A 3Q8XB 3I32A 2ZI7A 3KXLA 1XJ0A 3BD9A 2VQSA 4P32A 1N0VC 1Y3AA 1QHYA 2W0MA 3JZMA 2O8EA 3OAAA 2R6AA 2ODNA 5HXBA 5J40A 3CH5A 2RGNA 5FTNA 1ZM9A 1FDRA 1MV5A 1UJ2A 4BFVA 3TKLA 2O8EB 2IA5A 2QTLA 3QVUA 3QXSA 4GFDA 1EX7A 3X1YA 2JLVA 4LJYA 1MT0A 4QHYA 1DAMA 1KAOA 2CJWA 2VL7A 4MGZR 4B2PA 2XB4A 3QBTA 1PVOA 2D2FA 2WKPA 3CONA 5CYOA 5FL3A 1SHKA 1WF3A 1E2LA 2GTPA 2WOJA 3QSYA 4RKFA 2WAXA 4PTLA 3TRFA 3TUJC 1EP2B 4G01B 3SU8A 2CJWB 2O5VA 4HAXA 2P6UA 1O3YA 2JLQA 3U3RA 2UVQA 1E98A 2GILA 4NHOA 1ZD8A 4PQFA 5UKDA 3AKDA 2QRZA 4JLKA 1AA9A 3KKQA 2IYSA 2ZM5A 3QE0A 2H18A 1H42A 3ZS8A 3WYAA 1KSFX 2O8BA 2CLSA 2CL7X 3AF3A 2C5LA 4DLUA 2N1BA 2C2HA 2ANCA 4EJSC 1YZLA 2XJ4A 3NDPA 2BCJQ 2OXCA 3W2EA 4I1VA 4NCKA 1GNRA 1KGDA 2QTZA 1ZCAA 2XSZD 4UJ3A 4ERNA 1HTWA 2O8BB 3DDCA 1JR3E 3UKDA 4TYNA 1DAFA 2L0XA 2GPJA 2ZJ8A 3QF4A 4JKYA 2OK7A 4LBWA 4LUCA 5C1BA 1YR6A 1P2SA 2V7QA 3TW8B 5IRCD 2IT1A 4YAUA 2LCFA 1KZGB 3B1WA 3HU3A 4PO1A 4TL9A 3CRZA 3QFTA 2Q9CA 3LBIA 3QF4B 6Q21A 2AN9A 4B43A 3UPUA 1WRBA 5JMTA 4AI6A 3OEEA 2AX4A 3SOPA 4OHVA 3NG1A 4Y9UA 4DEXA 1Z3IX 4NCIA 1Z08A 4O2LA 1R7RA 1QUFA 1OGIA 1CR4A 3EPKA 1UAAA 5DHAA 1DAGA 1Z2CA 1QG2A 1CJKC 3IIJA 5GVSA 4ESVA 4C4PA 2REOA 4LC0A 1A2BA 5FOVA 4FI3C 2W58A 4YMWA 3MCAA 3RS7A 4BPRA 4KYIB 2OBLA 2DWQA 4M21A 4DIDA 1KNXA 1T5IA 4Q1AA 3CR7A 1G8YA 2ZR7A 1SKYB 2Z6VA 4M9QA 4PSKA 1N25A 1XJCA 2EYQA 3AVOA 3BWDD 2F55A 3KQLA 4LBZA 2IYWA 1CNFA 2BEJA 4OK3A 2YINC 4BZPA 1TU4A 3JZAA 4U7DA 1YZKA 1YZGA 1HURA 3EARA 4FMDF 2EFCB 5TVKA 2WWXA 3BGWA 2YOFA 3L0IB 1G3QA 1T91A 1N6KA 1UKZA 2J87A 3BERA 3IQWA 4LHYA 5JEDA 2JIZD 3I8SA 5JRJA 1ZVQA 2Q21A 4QBIA 2WWYA 2GXUA 5BWMA 1W2GA 4JIMA 4GOJA 3CCLB 2IUSA 5KPJA 3G6EB 3I72A 4JLMA 1E62A 4C0SA 3ZBTA 1XMSA 2ZIAA 3AF0A 2FPLA 5KOYA 5JJLA 1XEXA 1G1MA 3TH5A 2B7CA 3FPKA 1N2CE 3ZIAD 1J70A 2ZVPX 3DMNA 3FKSD 2FFHA 3TLXA 2FWRA 5JZVA 1EWQA 2HCBA 2ZRFA 4Q9HA 1NVWQ 1E1RA 1XEXB 2IYUA 1N5JA 4QFMA 3CC2B 3MWKA 1VCNA 1Z5ZA 4I4LA 3RHFA 4JBWA 2EFEB 4AKEA 1KI8A 4DDUA 3AB3A 3E70C 3KFXA 4G5GA 2GXAA 1E9RA 3PFIA 4IRUB 1CRPA 1OXUA 4BZXA 4BECA 2CHVA 3ADDA 1E1QD 4P33A 3ZC3A 1KRHA 2EU8A 2RHDA 1H8ED 1T5LA 2VO1A 2X2FA 1X6VA 2BJVA 3C4JA 2WBLC 4V0ME 3GLFE 3B9QA 3K09A 4W9MC 1HT2E 1YI2B 1BX0A 2XGJA 3AH8A 1R4AA 3U6BA 3K9HA 1E0KA 4Q7LA 2QE7D 1KI1A 1XX6A 2KB0A 4IEIA 3LNCA 2ODWA 4IVRA 4E22A 1QBKC 4L8GA 4B2LA 3CUEF 4Q9IA 2ZJAA 1OPXA 2XOKD 1UKVY 2RH5A 1M1KD 2WMOB 3CCSB 1YRBA 1FMJA 5GV8A 2NIPA 2ZTSA 3AUYA 4B3FX 3MJRA 2CRVA 3A4LA 4PPGA 1Y63A 1II0A 1KY3A 4LZZA 1G64A 4ZIRA 4K81B 2WSSA 1D2EA 5F2EA 4DLSA 2A5JA 1W2BB 2WJVA 2ZRMA 1V43A 3ZGXA 2UKDA 1Q1BA 2DCUA 1DAEA 4LJ6A 4OJQA 1X8KA 4GZLA 1DDIA 1VPLA 2OFXA 3DHWC 3KJEA 2B7BA 3AKYA 4PO9A 4BFWA 4ZIRB 1S0UA 1Z28A 2G0TA 1OH7A 4OQXA 3B1XA 4M1TA 2QMOA 4RD3A 1Z07A 1FUKA 5GJWC 3JQRA 1RZ3A 1T8TA 4B33A 1N8RD 4DLZA 4LBVA 1ZBDA 3H0KA 1VKJA 1W0KA 5DI9A 1W36D 5DSZA 3PR1A 4RD0A 4GSYA 5L3VA 3QEOA 1GRQA 4YAWA 2QAGA 2A3RA 1GDDA 4IEEA 1A8PA 1J8YF 1R0ZA 2R6FA 3GD7A 5HZHA 3O8RA 3Q7PA 3L82B 3UG6A 1PLJA 1YJ9B 1KI2A 3B78A 2JJ1A 2QAGB 4A1FA 4YDHB 2F1JA 2QUZA 5FUXA 1IXSB 3PEUA 1CIPA 3U60B 1Z6XA 3LFUA 4BFTA 4M0LA 4WAUA 4EIWA 1VQ9B 1OKKD 5EUQB 4KVAA 3B13B 3ONWA 1OIVA 3FHOA 4HYYA 4WZ6A 2YKGA 1M7BA 4LJ9A 1JEDA 1A2KC 3B1VA 4UJ5A 5CDFA 1N5LA 2BVNA 1KJYA 1E63A 1XMVA 1SM4A 4WZBE 1QVRA 4LYHA 3TVDA 1MABA 4BLRA 4URWR 4GP6A 2DEUA 4IOLA 4PC6A 3F3YA 2IYYA 2ZREA 3OFND 4Q5IA 1W7AA 1KSGA 3U7HB 2CHQA 3QKUA 3NBYC 2OM2A 1KK3A 1NSFA 1MABB 2QMEA 2WIBA 4TN1A 4BGDA 3GLIE 1GTVA 1II8A 2P6NA 3KTAA 1CJTC 4C0HA 2GEDA 3RRMA 3NIBA 4II7A 2A30A 4ZKEA 1KI3A 3PXGA 3DM9B 2BMWA
chains in the Genus database with same CATH superfamily
1XA0A 4UDNA 4E5UA 2JRCA 2ZKIA 4DDWA 2PUJA 2VK8A 4MA4A 3ACDA 4TSRA 3IFSA 2CMDA 3DV2A 5J5CA 4C0WA 2IEAA 4ASUA 4IY1A 2CNBA 1K8RA 4LGYA 2C61A 5F2OA 5DM60 5E8RA 2MMGA 5ENVA 4G2NA 5JCXA 1PJTA 2VHCA 1I7PA 3DUWA 2D6FA 1UM9A 3RROA 1U0EA 1VBKA 3H97A 4DB4A 1K8YB 4OXIA 2VPWA 2IEIA 3SJBA 2RHTA 3QKTA 2ZJ6A 4WK0B 2WU3A 2Z4RA 2PX4A 3LUAA 1ZJ4A 4QL3A 3AETA 2IOFA 4ZI5A 3GSIA 1AC5A 3R3VA 3DEHA 2X0DA 5FTLA 2HV8A 1PR4A 4HQNA 5T4FA 2R1VB 4BNXA 2YXEA 4CIWA 3RLFA 4BEJA 1GLGA 4HNAB 3Q11A 1QIHA 1ULTA 3U19A 3ZE6A 2X41A 3KC2A 4MI6A 1MTOA 2WF6A 3FH0A 3HP1A 1HG0A 3JYPA 5T8KC 4JQYA 2HDHA 5DNAA 4KPFC 5JBQA 2I33A 4FFOA 4KE7A 4LF7B 1H5NA 1V5WA 1TFRA 5EQFA 3TE7A 3CXRA 1JDSA 1TUIA 3NDJA 2CFOA 1TM3E 2D2XA 4DB2A 1WTAA 3JWPA 4WZKA 1RJWA 1FL9A 1U2GC 1OXVA 3OMXA 1NBMD 3FFBA 3Q5EA 2E87A 4REOA 1DKRA 4EEXA 1W0CA 3ORQA 3QI7A 2BFOA 1RVDA 4LISA 4ZT7A 5JC8A 3Q3VA 1EM8B 3FUCA 1PV1A 2ZQYA 1XNRB 4LW8A 5G1NA 3JVVA 4AF7A 3BTVA 3BX1A 1AN0A 2UZ4A 3HL4A 2CN1A 3O0DA 1PBTA 3QWBA 4K0RA 3GFTA 1WS6A 1DIRA 2GFIA 1G8MA 1I0IA 4F9FA 1K5GA 1T6ZA 1MENA 4EY6A 3CLTD 2F8TA 2H5LA 3ZY6A 4X8IA 4FWBA 1TADA 3NH9A 4XPIA 1JLLB 1I2ZA 2XMSA 1K9VF 2JVIA 2OAGA 1SXJA 5DBGA 5AVOA 1JG3A 1XZKA 2Q7XA 5AOCA 5FYDA 2X0NA 5GONA 4PLPA 2P7HA 4I1SA 3ZPNA 1CS0A 3IR6A 1JDVA 1WCWA 3LI2A 3NGLA 2XUDA 2FA9A 4UTXA 5BSKA 1E5XA 1WB5A 2YRWA 4LOIA 4FFPA 5KKAA 3I1FA 4FFSA 1EVQA 5EXEA 5JXIA 3AL0C 2X1LA 4RD4A 3TZHA 2DH5A 4D6PA 3BRWD 1R1DA 3ETEA 4J90A 1K8XB 2H11A 1UBHS 2OLEA 1WOPA 1A5TA 3CJRA 4OL9A 2IDMA 2XD9A 4PHHA 4QYTA 5EXXA 2WFAA 4BWYA 1YJXA 4HDQB 3HDHA 2FFBA 1O8BA 5G41A 3TUZC 5IBRA 2Q99A 4V1CB 1U2DA 3KL2A 2DBRA 4TQUS 3GPDG 1DWPA 1JJIA 3DMPA 2OM6A 1SZCA 1V1MB 1X9HA 3ROQA 1ZH8A 2VJPA 4XM2A 5J2TB 1YC2A 4Y2GA 3MWEB 5B1SA 4RY9A 1ZIOA 4BO9A 3HSKA 3EOBI 3VUEA 4B09A 2P67A 1GYQA 1B7GO 4B0OA 1JQ5A 3IP1A 5BR4A 4JLOA 2DYIA 1ZK2A 3CNNA 4RSMA 3DE3X 4EDFA 5JV5A 4ZCMA 2G17A 1N6IA 1UIRA 3L1KA 4IXTA 5JNUA 1SQ5A 4QULA 4YMSA 3S8YA 3PNPA 5CNMA 1QH8A 2DGDA 2W71A 3FMPB 3HB0A 4BFYA 1DBQA 2G0NA 2G88A 3HEBA 3PEEA 4G0OA 1QRDA 1ZOPA 4AMVA 1AS0A 1NNEA 1KYTA 5FF9A 1QBGA 4C4TA 5G02A 5CA1B 1YZTA 5EKDA 5JSZA 3BIWA 3U13A 3B36A 5KYKA 5SYAA 4U7FA 5M7EA 4KLZA 4I4TB 4HHEA 1QPBA 1EK0A 4JL6A 4A27A 4BUCA 4PXAA 2VHJA 3IAM1 2YIJA 2WILA 5FLYA 3T0IA 1E3MA 4G0YA 1DOZA 3R6TA 4FHZA 3U39A 5DCWA 4QPZA 4YRMA 3VSEA 1M2EA 1JSCA 5FTJA 3WG9A 2PBRA 4CUKA 2BTEA 1NW6A 4W5QA 1GDTA 3NYIA 3IP3A 3OJCA 2ZQZA 3FTCA 4F11A 1CJSA 3FDIA 4WPGA 2AOTB 3ND5A 3PWSA 5LQJA 4MUYA 1P9WA 2V3CC 5HF5A 1RT9A 4E08A 4AN0A 3EVFA 3LC7O 2ZUEA 1OZGA 1UIMA 2QZ9A 2O2HA 3A8IA 1KXZA 3C7KA 3D4IA 2V03A 1AT1A 3AZQA 1EGMB 4CDGA 3KJHA 5KU1A 3B8HA 3TPCA 3I6YA 1DX6A 1HXHA 1U80A 4OUDA 3UFXB 3QUSA 4OOVA 3B7GA 1CDEA 1I7QB 3ICCA 4J4BA 4TKLA 4P58A 4Y7DA 5LP6C 4BUJA 1IY2A 1RYDA 2Q46A 1USVA 2ZSHA 5IC6A 3WRWA 5L51A 3OPYB 2PO5A 1CUZA 1J90A 1EE1A 2FEOA 4W5OA 1PL8A 1X7DA 2AJDA 2WWTA 3L1VA 2XUIA 5AVWA 4QM7A 3B7WA 3SHVA 3GRRA 1GKUB 3HR8A 1JAZA 3TEMA 3WFJA 1VHJA 3DAHA 4CCYB 3CLVA 3GWGA 3H6HA 4DRXB 1SB9A 4N0DA 1I4LD 4G0PA 2QUBA 4AQYB 3G6WA 4AM8A 1RBMA 1KQOA 2AB0A 3CPWB 1XMIA 2DJ5A 5F2KA 5T57A 5TGZA 3VTAA 1GITA 3NBXX 2OLJA 2Z30A 4N18A 1Y0YA 2M6LA 3OJFA 2VDNB 1E0DA 1XRPA 2J0EA 3ONVA 4QXQA 3WRYA 4PGOA 2MINA 3QGMA 5HRUA 4RZSA 3SK0A 3LX5A 3R0ZA 2YIMA 3WB9A 4B40A 5IKOA 4IUBS 2X9VA 4G5OA 4BNFA 4E1VA 4FFMA 3GAMA 2HBQA 2IZZA 3L77A 3FYUC 2QMYA 4FCCA 4LRQA 1P1RA 2O7VA 5D1NA 3KAPA 1XYGA 3QKWA 2NV6A 3B6JA 4UAJA 1SU8A 4N3BA 3SNKA 4Q4CA 2CXNA 1VKRA 3FTQA 4EF4A 5IS2A 3U3ZA 4P7KA 1B3BA 1R15A 3KEGA 2VIIA 2R6HA 2X6XA 4I3FA 2EL9A 2P77A 3P9SA 4QU5A 2HJSA 2HLNA 1W0JA 1AQIA 1ZM2A 2XTJA 3H9GA 2DRIA 3K7EA 2QORA 4UMEA 2BKEA 3PDWA 2A9RA 2CC2A 4MUHA 3KFLA 2FR8C 5JUWA 1H9BA 2H2IA 3H7IA 1JXAA 1Z2EA 4YDSA 1I8DA 4KOEC 2OESA 4W7IA 3REQB 1N78A 3ASQA 4JOSA 3AESB 3H3JA 1USWA 1V3VA 2PRZA 3DWGA 1S8FA 2WWHA 3ZHCA 4O4JB 2K2WA 1K0UA 3ZHZA 4X95A 1DWQA 3OM1A 5BV1A 1WSDA 4PC1A 1CUIA 1DWOA 3OP4A 2H7VA 4ABYA 4DJJA 2JJ2A 3WYDA 3B85A 5B3JA 5LLDA 4A6XA 4DJ5X 2XZLA 3ZGZA 1TKCA 1IBSA 1N5IA 1EDOA 1T25A 2OP1A 2ZAIA 2VDWB 4PTZA 1JPVA 4L72A 2V9CA 1DKOA 3QVVA 4DOMA 4U5QA 1BS2A 4J1SA 3BMNB 4RTSA 1WBDA 4X0EA 3BZUA 2C4VA 3C6BA 4UUPA 4H77A 3E9QA 2XE4A 5DTIA 4G37A 4F8JA 1DO0A 1NGSA 3C3XA 3OQVA 5AXCA 4W5JA 4QQFA 2Q6LA 1H1LA 3CF4A 5LP6F 4QWWA 2YS6A 1V5FA 1QYDA 3U7RA 4ZJPA 3QX8A 5HE9A 6AT1A 2EJVA 4BIIA 1F0NA 5D3KA 1EBBA 1X87A 1BMTA 3NCTA 3PPIA 4CT5A 2DPXA 4EX6A 3IOBA 4RV9A 4YRZA 3H2ZA 1KL7A 3F5QA 1JIIA 4M8SA 3LO5A 4OH1A 3AJ8A 1G55A 3UTCA 2R7KA 5IKPA 2YC4C 3KNZA 3LJKA 4W7SA 4Y0AA 4V0QA 1AV7A 1UJ6A 3PLAE 3EXHC 3OQHA 4CM8B 1T4BA 4DYDA 4Q4AA 1P4RA 2PM8A 3FNIA 4ALIA 5CLJA 3CWZA 1ZIDA 2X5NA 3BL6A 3K0CA 1I10A 3AHFA 4JEHA 3H1AA 3WBJA 1WDTA 1JFFA 3ZCUA 2Z08A 1QGED 2LDXA 3PG5A 5B5SA 3I6BA 1B8VA 4PLHA 5H82A 5JC1A 4MYCA 2GBCA 5HA5A 3N8DA 1ST2A 3TE6A 4HUQA 1PWYE 1QVZA 5GGYA 1PLLA 4H7HA 5JD3A 4CKWA 1NVVR 4FT4A 2DKOA 2DPMA 1NKVA 4MB6A 4GOKA 1UC5B 2XXAB 1LSUA 1K7XB 1O6CA 4P4SA 4WEOA 1D2NA 2CMFA 1NOKA 3E81A 2OYRA 1C9DB 1ORDA 2Y1XA 3PGLA 4G0MA 3A9CA 3WA7A 4AY6A 3FZNA 3FHCB 1G3MA 1A9ZA 2XB9A 1R6XA 2FF5A 4UTZA 3INYA 2HCTA 5FR2A 2OORA 4BU1A 3UWPA 3GHYA 4ZOCA 3HB7A 1N2BA 3IKVA 3DDWA 1F48A 1RHQA 2Q8QA 3L6CA 1M1YE 1S1CA 1REQA 5EMHA 4EG5A 1QDLB 5KIAA 1WV1A 4CEJA 1ADCA 4E4RA 1ULZA 2A5FA 1GD1O 1P3DA 1PDVA 2XUPA 3F6PA 4E15A 4QG3A 3DTTA 4B74A 1T4CB 3D7RA 2FPUA 2RK6A 4A2WA 2OV2A 2J0UB 3JQFC 4Z0HO 5CK5A 1X14A 1EIWA 2DWCA 1BWPA 1XHFA 3ADOA 4Q3LA 5KNBA 4W82A 5LUAA 4K46A 1CT9A 1PR9A 3DLPX 1BE8A 2CDNA 5JRDS 3RVSA 1SCIA 4BWFB 1U81A 1CK4A 3ZDXB 5I7RA 2I2WA 2JASA 4M0EA 4PICA 5ELLA 1Z8FA 3TZBA 3MMXA 2PKQP 4GBED 1F7UA 2HIMA 3RIGA 3UJDA 2J45A 3S28A 3FF4A 4TMXA 4CHTA 2H31A 4DLTA 5IT5A 2QN7A 4ZV4A 3GLKA 1L8XA 1NG1A 3B3GA 5LKRA 5BQOA 1SQGA 2AX3A 1ZAKA 3K6JA 5ICSA 3VR0A 3LPCA 3QBVA 1PJBA 4XCVA 3LNNA 4Q4HA 2I5PO 3EK2A 4QYIA 4IDPA 3NHBA 4XARA 2WINI 2ZYSA 3ADPA 3GGGA 3LZ6A 4JZYA 2VRNA 4K2AA 3U62A 3EFEA 4JJ4A 2C92A 1CE8B 4XM3A 1KZ1A 4IFEA 4RK6A 3A6EA 3KKEA 3FTEA 1VBFA 4HEJA 1OSNA 2QRMA 3JATA 1PKXA 1T9GR 2BE9A 4Q6BA 4EW3A 1G6KA 2WZCA 3IPXA 2FQ1A 5KB3A 3IQIX 3D3JA 5IVPA 4IGFA 3MG9A 5T3YA 2HBZA 1JEQA 2IYRA 4JVLA 2E48A 4U6SA 3W6NA 3W5VA 2GFQA 4LJLA 3JAMA 3N2IA 3A6PC 4DR6B 1T0PA 2GCPA 2W5UA 2XCIA 3D2BA 3AFNA 3EEFA 1W87A 5EKXA 2ARKA 5FWYB 2GTHA 5KVCA 1W48A 3U3DA 5AM2A 4CW7A 7REQA 3P94A 1CY7A 3GOQA 5JSFA 3P0FA 3A6HA 4A8TA 2VF4X 2PUTA 2ZB4A 4EB0A 1RKUA 1FTYA 4XQ9A 3ZH9B 2CL0X 1WY7A 1E0JA 1VQPB 1LZKA 2QTFA 3DWFA 4MUIA 3H1TA 2D5AA 4FQ5A 3VJLA 1MP0A 5BNWA 4C22A 4B35A 1TEHA 4KR6A 1C8LA 2ZW9A 1J06A 3CPEA 4KN6A 2AG6A 3FMFA 4L15A 4MHSA 4RJ2A 2IPMA 1ADGA 1TM2A 3CB2A 1Z0AA 1HRKA 2XVAA 1EFCA 1EXDA 5KCMA 5EVCA 4CIBA 3OIWA 4GECA 1YJBA 2EFHB 1CQZA 4FYWA 5EE3A 2ZTNA 1W34A 3DXFA 2I1LA 3NKVA 1GPH1 4DNRB 4LXIA 1G18A 1RBZA 2WUEA 3A2MA 1PK7A 3OPNA 5AYVA 5AVSA 1FYFA 4HB2A 5AKZA 1WZIA 4NKRA 3RSGA 2C2BA 1UXOA 3N8GA 1QHHA 1ZS9A 3BHJA 4XWTA 3CTPA 2HGZA 4B17A 1VOTA 4CUJA 2EATA 2I1WA 1RPZA 1O95D 5EE9A 5GQSA 1THZA 2QRKA 4RDHA 2QPLA 4ZO7A 3RB8A 4D9IA 1NVVQ 4FR5A 1H0RA 1NUQA 3AJAA 1XROA 4LHVA 5MHTA 4AS1A 1UK8A 5DZSA 1Y6QA 1H8HD 1DKPA 5BPFA 1FMLA 3P20A 4BX3A 1IPEA 2IYTA 3OZDA 3WBBA 2V8OA 4RANA 4EGQA 2WT8A 1I4TD 3EXFB 1CY1A 4HTFA 1JI3A 2Q27A 3UJBA 3RK4A 1EQ2A 1OU4A 2JFFA 4TZ6A 5HQ3B 3WL8A 1Y5MA 2I65A 3U7GA 3L1HA 2QN1A 1VYVA 1XNGA 2O3RA 2PX0A 2X4GA 3RC2A 3RAEC 3AVPA 3PEYA 4IHJF 3F8WA 4NCJA 4OYYA 5CB8A 3E9RA 4WRRA 3X2EA 1NDHA 3M6MD 1Z5PA 3C4VA 3VPCA 5JQGA 1JIKA 5LVAA 1Y0BA 1LTQA 1X1DA 1B6SA 2DPYA 2QRVB 1U04A 3NEJA 2HDWA 4RVFA 4YP5A 1PBNA 3O0TA 3P9YA 1JJ2B 4M8NE 4EEZA 4B45A 3PYXA 4UOZA 1G3UA 2WJIA 5LA6F 4OSPA 3EPLA 4BLWA 1I4OA 2XGSA 2EGUA 3JQGA 5CBKA 2DR2A 3WX0A 4Y9RA 2LKCA 4GR4A 2PZJA 4CEIA 1W5EA 4G63A 1DCFA 1NP3A 4Y67A 3MTGA 1W9MA 1HT1E 4TOIA 4UASA 2VA8A 3LV8A 2K2QB 3AZOA 5T4HA 1WJGA 2XMQA 4UZUA 1Z5UA 3NAZA 4JJ6A 1M6EX 4UCQA 3TCNA 5K9ZA 3RSOA 2QPOA 2GD0A 1RQ7A 5E7MA 3O26A 1UWKA 5DB4A 1XMQB 3UT0A 3FR7A 1RHJA 3CRMA 3FVTA 3OQ1A 2DR3A 3DE7X 1ZIPA 3GELA 2FMKA 2OCBA 3IP7A 4NBNA 3SJCA 3TS1A 3KYJB 3SYMA 3JR3A 2V55B 4LYJA 4N4AA 4R0VA 1E60A 4GPBA 3CNLA 4WFQA 2X85A 1VPEA 1V0JA 1GXSB 2FLVA 1YT5A 2H65A 1ONNA 2I4LA 1RPAA 2FW7A 2LGJA 3HWRA 4FIZA 5EMMA 1M0EA 5CVDA 1J8VA 4HUJA 4BNTA 5K3FA 4K87A 4IFIA 4JUBA 2B8JA 4FQ7A 1O54A 3E8XA 4MEBA 4QNMA 3VHRA 5IK2A 3PDIB 4ZXFA 1E18A 3V4FA 1C1DA 2FMIA 3WIEA 2YASA 2IL1A 3GEGA 2VSXA 1L4EA 3NFRA 4LZAA 4NTZA 2YMQA 5LC1A 5KEIA 1MD9A 4CDMA 1LVUA 4ZI7A 2AWNA 4AZWA 1YBHA 2BMJA 3KJGA 4EARA 3DCJA 3AB7A 3JVUA 2ZGVA 4WCFB 4BLQA 4P7GA 4MKGA 5G4KB 3S8MA 1OZFA 1VCIA 3OF5A 3ZGVA 1B6TA 1N2CA 3H9UA 4CDNA 1MAWA 4C88A 2VCYA 5B64A 5BURA 3FSGD 1NLFA 4LEIA 5HM8A 1XMJA 3X1ZA 4R4JA 5GADl 2QI9F 3RS8A 2I7CA 2PIAA 1GCOA 3CUSA 1UPUA 2FG7C 3ENQA 3HUDA 3PEFA 1XI2A 2YV4A 4GLJA 4LMPA 1IDN1 1NVDA 4GZ5A 4HNRA 3TOCA 1Y1PA 3LDFA 1FS4A 1R8JA 2JD0A 2DHCA 4N0PA 4Y8VA 4REQB 1ZK0A 4FLMA 5CT9A 1ABBA 2WDPA 4X07A 4B6QA 2IEYA 5JAOA 4PLVA 4D57A 4PR3A 4PY2A 2RB4A 5IX8A 5EWMB 1KZHA 2ZYTX 4HQOA 4MUXA 3AG5A 3OURA 5BNIA 1H23A 4DNFA 4X41A 3MMSA 3GVPA 4B7ZA 2AUTA 4C5BA 5C8ZA 4C3VA 1VE7A 2J9ZB 3ZDYB 3AVYA 1ZG3A 4MHTA 3BN3A 2BTQB 4RVUA 1LY1A 2QRGA 4TMKA 4R9VA 3NS7A 1K7YA 4GX5A 3AI7A 1DQYA 1SHJA 5JLJA 1G19A 4AMUA 4ACAA 2B6NA 3NOQA 1H69A 1JEAA 4MK4A 3EEQA 3WL3A 3W5HA 1L5QA 1UEXC 3UJAA 5KWVA 1CUBA 3AG6A 3LCMA 4NK5A 3THYA 1FFWA 2VNKA 1KK0A 2HZBA 1UKAA 4X3CA 3OOHA 5FLXA 3OESA 1H0SA 4HDSA 3ILVA 3ASZA 5AUQA 3WGKA 5D8DA 2AI3A 1Z7BA 4EW2A 1UXKA 4JR1A 4ZTUB 4JYBA 1SVLA 3I6MA 4MCIA 5AI6A 1C80A 1G66A 4S2UA 1DTEA 1EB8A 3ST7A 1E4EB 4YQEA 3KHTA 1S5PA 2NU6B 1P1IA 4H9GA 3AV0B 5BN5B 2GF2A 4M1ZA 2ZL6A 4D9FA 4YB8A 3D7MA 1XB2A 2J32A 3P27A 3I5MA 2Q7OE 4TV9F 4A91A 1E5LA 1NN5A 1X86B 4Z7JA 1JJVA 1RRVA 1YVUA 2XRMA 1RWKA 4BO6A 1TD9A 3NHFA 1RADA 3EA4A 3IBGA 5JWOA 1AE1A 1GDHA 4WA8A 5HGXA 5TB5A 5K09A 2JHAA 1I4EB 3K05A 3MWJA 1XXHE 1Q3TA 4DDMA 3VTFA 5HFJA 1VXOA 4RUKA 4DC0A 5AVTA 1G21E 2OO7A 4JFRA 2ZZFA 2FRDC 4Y2HA 3U31A 4BGEA 4C14A 1G38A 1I30A 2QZPA 1DEHA 1BH6A 1KVQA 3BCDA 1M74A 3LLSA 2FMFA 3EC1A 3OZBA 3R3UA 3OCCA 4K86A 2C7RA 5HIAA 2CZCA 4Y98A 1P5HA 3DOJA 4HQ0A 4ISBA 5HS6A 5BN4B 4WADA 3WLRA 1CXZA 4D5EA 3HXMA 1H1TA 2OAEA 3CXCB 1ZPDA 2NO9A 4EPTA 2O0HA 1IZ0A 4YO7A 2XUHA 3G2QA 3WV5A 3FOCA 1E94E 5J2UA 4I1UA 3O83A 3PQEA 4YFYA 1FS6A 1OIWA 5P21A 1RPNA 4KGXA 2WWVD 2OBTA 2ONJA 3X3HA 2IUEA 3I8XA 4RIIA 2MYNA 1WTHD 2OFFA 4G1BA 4W9NA 4KR0A 5A3QA 5CB6A 2JGEA 3MK31 1TMOA 5CYGA 1EX1A 1STOA 2OZPA 1ADJA 1B8OA 1I2BA 1MIOB 2ZWAA 4W5HA 4ER0A 1T2AA 3KEFA 5FBLB 5ESXA 2XXBA 5KUTA 3QJGA 1KAHA 3M9XA 2OHJA 4GP7A 3OU7A 3A1PA 1HTTA 3K9BA 1HM5A 3QXJA 4D8UA 3DC7A 3L8CA 2ET6A 4UQPA 3UMRA 4YMUA 5HTOA 1BEUB 1Y4UA 4CGZA 4MW1A 3ASRA 1AM4D 2GNPA 3ZTWA 3E1SA 2F4NA 5DKFA 4AKHA 3COPA 4R2KA 3IJEB 2JLBA 2JFYA 3CHYA 1M83A 1F5SA 1GGFA 2FW8A 1E9FA 2HJVA 4IIYA 5EHGA 5I4CA 1XYYA 2GEUA 2FPKA 1GKIA 3OQOA 1R4ZA 3EW9A 1LPPA 2GLXA 2JDIA 3EIFA 4ETIA 3L1UA 1R9NA 5FUMA 1JXMA 1QHIA 1N0IA 1E3TA 2PUGA 1FSSA 5AN9A 3C5HA 3HCOA 4QUIA 1Z4IA 2JCYA 3TLJA 3HNRA 5A04A 4U2FA 1QR2A 1TYEB 2V4ZA 3KEMA 4YEDA 3VKUA 3MJSA 3V7NA 3PQ4A 2FHPA 3U3KA 1CEYA 4R8SA 1SOVA 4D3SA 3ENNA 1TC1A 3AR5A 2M98A 4HKTA 4Y1RB 2WMDA 4OGFA 4R2IA 4L08A 3VC1A 3ZJYA 4BO0A 2RHRA 1F17A 4KGVA 3TNLA 4C7VA 3L79A 3G59A 4DZRA 4DR7B 3DAPA 5JH7F 1W1UA 1TIPA 3CZQA 3JARB 3EODA 1SWWA 4MUKA 3HXKA 4M83A 3ECAA 1J5EB 4GLLA 4BASA 1T1JA 5JAIA 2HSWA 2YNMC 4K3VA 3RUPA 3ABIA 1UWLA 1O96A 3OA0A 5JMOA 1VA5A 1WCIA 1B42A 3UHJA 1NW5A 3BJIC 1TL7C 3PWZA 3ETNA 5TRDA 4MV7A 3OMWA 3W4IA 1YJAA 2O1EA 1MQAA 3CA8A 3ZNPA 4BL5A 4OQQA 1FFGA 2JA1A 4D9BA 2FMUA 1DKQA 1P2BA 2G8NA 3AU9A 3DW3X 5AKEA 2VWGA 4K8OA 5BW8A 1PZFA 4PX2A 1O89A 5D6NA 3REFA 2NPIA 1V0FA 4MW7A 3RJZA 5KYVA 3LVFO 1WXEA 1NC3A 3CPSA 2CFCA 3DEIA 1XHLA 2GAIA 1GUZA 2RJ3A 4RPLA 3RRYA 4YPFA 4F8EA 3EHEA 1QRSA 4IWXA 2QB5A 1DIOB 5EPOA 4Y6RA 4TRRA 4C1NA 4CU2A 4LHEA 1IZ8A 4O33A 1L5VA 2C03A 3AP2A 3PA2A 5JWRA 4NQZA 1HI9A 3COZA 3PIIA 4DQVA 2W48A 4ZAYA 4ZOAA 2AT1A 1PQWA 2IHBA 2X4LA 3B1YA 2GN2A 4PS1A 5TQVA 3S44A 3UJ3X 3NDRA 3RIEA 4CR7A 3RWMB 1VLMA 5CDUA 1QZ3A 2DR0A 3D4OA 1SNYA 4OL0A 5IYWA 1TK9A 3TL3A 2AMYA 4RA6B 4R2LA 1IJKA 2G07A 2R6R1 3JV7A 3WHPA 2IYZA 4RULA 3F6RA 2JFVA 5B1DA 1C7JA 3I9OA 3C15C 4Q9DA 4NLLA 5CJ2A 3MT9A 5TX7A 3DVAA 1XELA 1P7CA 3GLRA 4P7JA 4FGWA 4YASA 3P2OA 3KIPA 1V9CA 1ZAYA 1E3JA 4ZEOA 3E5HA 4ZHQA 3P0HA 1JN0A 2V7WA 2WHPB 5KKNB 3VJRA 4PLTA 5A62A 1QH8B 2QP9X 3DE4X 2BM1A 1Y89A 4LK2A 3A4IA 1E20A 1L7OA 1KDZA 3REGA 2OC9A 1NBWB 1VDMA 2RHLA 3SOZA 4TXNA 3O8BA 1JIVA 3F46A 3HYRA 4BMSA 3QVKA 3MIIA 3VPBA 4C6TA 3NIGB 4MR9B 2P3MA 1WA5A 2Y1EA 3K0KA 2GQFA 1FP6A 3F74A 1UOOA 2NYAA 2K6GA 2C2WA 3MTAA 3VHLB 4GPIB 4BPBA 4RZIA 1RM5A 3SC2B 4EF5A 4ZVSA 1PDWA 2GEVA 1W93A 3Q12A 3GLQA 4YCBA 2N42A 4Z4YA 1AUXA 1HY3A 2OILA 4HS9A 4RH3A 4CUZA 4EW1A 1TLFA 5HZGA 3BILA 2XTNA 2DFKB 2C31A 4OUKX 3QVJA 3U81A 2RDMA 2ZTUA 1IBCA 3K96A 4OK5A 2HHCA 3QG1A 5D3MA 3GQBA 5ERGB 5B3AA 3P9NA 4LF5B 1I6MA 3OPOA 5CLHA 3TZEA 2YXPX 1GM5A 2P9YA 3JCZA 3GFOA 1W9XA 2ZJFA 1HQDA 4ZV9A 1U2QA 5D6OA 1FJHA 1PFYA 5AVZA 4CM9D 4PRZA 1VGRA 4PC2A 1ECLA 2ZUCA 3D4LA 5ECYA 3MS4A 4V38A 2GHTA 1CY0A 1FUYB 1JU9A 2QKYA 3KQMA 4CCYA 4OI4A 2AE2A 5J2TF 2EX4A 4RTOA 4V3BA 4D41A 3VO2A 5G3YA 2OR3A 3PNQA 4FDAA 3QLVA 5H80A 2NAFA 4BAGA 3VOSA 1BN7A 3JPWA 2HHJA 3I9V1 4GT1A 4GI2A 4OXXA 4EY3A 1JEJA 3P9ZA 3RVNA 4UM9B 1NRJB 1GQSA 3EGCA 5IANA 2BFDA 3RVJA 5KNBH 3FVVA 1FJ2A 3IX7A 1J49A 2RI6A 5BNTA 4A2CA 5HIKA 4RADA 3LM8A 3RNLA 4DT1B 1JF8A 1KORA 1P5RA 4BCDA 4C4YA 1OA0A 2ETVA 2LNDA 5TLSA 2Q0HA 3B89A 4XIGS 2WE7A 5B57C 4M88A 4LY9A 1HEIA 3MOIA 4D4GA 3ESAA 2JIZA 1KDVA 3LD9A 5CA1F 1R6BX 3CVWA 5CNJA 1YDMA 2O59A 1YRHA 1KJWA 5DYIA 3CKMA 4I4TF 4JKIA 4RFLA 3T4EA 1X0XA 1XWFA 2PBLA 4UNPA 3LW7A 3CB4A 3SJUA 5TS2A 5IVIA 3ZE1B 2OKGA 4BKMA 3D3KA 3PBKA 2ZYGA 5EC8A 4L28A 3UEOA 4BVEA 5FRDA 5JPIA 1XTZA 5TARA 2OFWA 5A1TA 4DQKA 1QFMA 2ECKA 3U61B 5JBNA 4WCVA 3UHOA 4FC7A 2VYFA 2VZEA 2FVYA 2QRPA 1VCOA 4BXOA 1XE1A 1JQEA 2YIVX 5JSKA 4EECA 2OC4A 5CTJA 3TZQA 3D0RA 4YP9A 3AOEA 3DFFA 3AEUB 4L2IB 4L8YA 5A7GA 2MIIA 5C8DA 2FSVA 2NUPB 2KSQA 1VBMA 2NSHA 1I32A 3N07A 4ES6A 1UDRA 4CYMA 4OHYA 1M5UA 1I4DD 2WUWE 4AKGA 1E1QA 3DA8A 3GPIA 4NE2A 4NZPA 3JD2A 1U4NA 3WK6A 1Z2DA 3TR6A 4M86A 5H0IA 2JJQA 4UTOA 1NUSA 2JJ1D 2ZWIA 3COYA 3JYQA 1B43A 1BFDA 3A1EA 3CG0A 3K53A 3V4ZA 2C9OA 3WLFA 5CFOA 1A5SB 3AIOA 2WZBA 2Z98A 3HU5A 4Z0TA 1WOYA 3IDSA 3PS9A 2G76A 2ZBPA 4FT2A 2P11A 2AD5A 4OXNA 4V2IA 4YY3B 1AJEA 1V6AA 2BGUA 2IW3A 2DTDA 2I54A 5LCXA 1OWPA 2D62A 1J20A 5FAKA 3FETA 2CLCX 3I42A 2O1SA 5J1TB 4OAQA 4LWQA 5HKBA 3CCJB 1XD8A 1GPKA 3SYLA 3TRHA 2Q5HA 1BSVA 5TDHA 1N5MA 2J5RA 2YHSA 1T1IA 2IS4A 2G4LA 1ZRMA 3GBVA 3ETGA 3LSTA 4Q24A 3PSAA 4S2EA 4R41A 1ZHOA 2AA3A 1VQ4B 3ICOA 5E4TA 2VJMA 4OB7A 4AECA 1RI5A 3F4KA 2BEKA 3M1LA 3RAPR 3FN4A 4JV5B 3K0SA 3N2GB 1O8CA 5H4GA 3OTIA 3G0BA 2CCGA 3RS4A 1M2VA 3NHZA 4O02B 5DI3B 3X0DA 1M34E 4UTRA 1OGYA 1A9QA 4ZDKA 5THKA 3L9WA 2ZI5A 1Z2OX 3E3MA 4E11A 1SHZA 4AZVA 3ZWOA 3KR2A 1KMMA 5IDWA 2JBWA 1V11A 2VH2A 4BMXA 1A7JA 5DK4A 2R5WA 1WF6A 2V7EA 3JASA 3RSCA 2PUDA 1L5MA 3JQ8B 2WV7A 4MS3B 4FSHA 3F71A 2QL9A 3G2NA 3QPAA 5MGNA 4I55B 1NYLA 3VYRB 1M1ZA 1L5YA 1G20B 3MWDB 1VF7A 3G5UA 4ZAFA 3TFQA 3ETLA 3MJEA 3BMOA 3DDUA 1T9KA 1SA0B 4RPIA 1JPJA 4XOIA 1R6UA 3NHYA 5EHNA 1IZZA 5JD6A 2ZM6B 1W36B 2PSSA 4Q7EA 1KTVA 4RLFA 3ZZ1A 1N32B 5K0CA 4NJEB 2OHVA 4AJNA 4YLYA 1RAGA 1P91A 4JP8A 3A36A 1FUIA 2HA6A 4QC2A 2JGMA 3UATA 5J58A 2ZCVA 3CZ4A 1KSHA 4JY7A 2UYGA 2FSGA 5TMPA 3H2HA 2IHUA 4X65B 4YAJA 3ZK8A 2WTXA 2OBMA 1C0IA 2G04A 3GHHA 4FD2A 4FEYA 4FYVA 2EG9A 4LDAA 3WYCA 1E3LA 4B5KA 4EZBA 5C5DA 3WAGA 3B1FA 1LDEA 1YVRA 3HUFA 3KELA 4HDMA 5I8PA 3SS8A 2OCAA 2WG1A 3GT0A 3LNTA 1GG8A 3ZQKA 1EX6A 1KYIA 4NG4A 3BD6A 1NJ8A 4D9KA 4HEHA 4F4FA 2IYXA 2OVBA 3A8TA 1R10A 4ME6A 1XAHA 2C07A 4FNMA 3HY6A 5TVGA 3ZTTA 4DQXA 3ANNA 4RY8A 4EDHA 4ROXA 2PVSA 2YUIA 4O5AA 4ON9A 4KKVA 3PQ7A 1PJ4A 2WYUA 4R68A 5EA2A 4LDRA 2H1OA 3QK7A 4J0CA 1PJ6A 4N82A 1ABEA 1NQAO 2FEWB 3O31A 3NHKA 4NR0A 4KZPA 3SYTA 4Q18A 4OGGA 1IPHA 1I6LA 3CH6A 3L93A 1A7AA 4XORA 1EGAA 1PUXA 1RM0A 1B2RA 3M8KA 4DK0A 2H1HA 4NMHA 4RORA 1Q14A 1ENZA 3D1LA 3UY4A 2ZWOA 3QJ5A 1GTSA 1EJ2A 3E3OA 1KWGA 2IHVA 3TBKA 3LTNC 3OT5A 1R4NA 1IH8A 4CLOB 1LQTA 5ALJA 3SE7A 4MTLA 2O7QA 1QJ4A 1X7WB 1YV9A