4RD3A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gdp and pi
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 103
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd3A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd3A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd3A01
2ZITA 1DAEA 4F7DA 2HT1A 3WY9A 4KCGA 4OQFA 2BMJA 1IN5A 1J8YF 2MMGA 3TAHA 4LBZA 3B82A 3U6KA 1CBUA 4DB4A 2ZANA 3ONWA 5AJVB 1COWD 2C95A 4TYYA 2I4IA 1H85A 1W5TA 2W6IA 4I1OA 3WRXC 2FFQA 4NL4H 1X8JA 3BERA 3D6TB 2P0EA 2Z6VA 1CQXA 5GADl 3A37A 4B3XA 4CYMA 2NMVA 3SN6A 2VQSA 1OPXA 4JVLA 4G3XA 4NE2A 1W1WA 3PCRB 3IHWA 2FEOA 2REBA 1MO6A 4II7A 2ODEA 1L4UA 1L4YA 1E99A 2R65A 2QBYB 1ZM3A 3VR1A 5B57C 4B3GA 4B76A 2IYWA 2CK3D 4UXIA 1XU4A 3LBIA 4RZXA 3U3MA 1VCNA 4FD2A 3ZBTA 3CCVB 3WRYC 2GK7A 5DYIA 3KFVA 3A1SA 3AUYA 4HLDA 4AC9A 2QA5A 3ZQ6A 4NYIR 4CDGA 4DWJA 1Q1QA 1QVGB 2ZIAA 3K9NA 3LNCA 1QHSA 3PEYA 1ANKA 1G5TA 1NLZA 2OBNA 4G5RA 3AQ4A 3EPLA 2VL7A 3KJGA 4IHQA 4UXJA 2RCNA 2GK6A 3AVTA 1JQJC 3MD0A 3JQPA 5TV2A 1IBRA 3I5XA 1Q22A 1U9IA 4LCBA 5KSOA 3ZQJA 4BGDA 1E9CA 1FOEB 4RZ3A 2JDIA 4XVUA 4KSBA 1Q86D 1PLLA 1U8YA 3GLFE 5G53C 2BBWA 2GPJA 2GZHA 5EZ6B 4AF7A 4C0SA 2KI5A 1LVGA 2D62A 3T35A 3OJXA 2KJQA 3R7WA 1UBEA 5FBVB 5TDHA 4URUR 5BYKA 5E7IA 3TSWA 4D0NA 1M8PA 4TYPA 1GRRA 2J46A 5J5CA 4O3MA 4JLVA 3MWJA 1VPLA 3MGCA 3C5CA 1FMLA 3SOPA 5CLLA 3KJIA 5FOXA 4UNNA 5HE9A 4BLQA 4ZDKA 4KJZA 2OK8A 2DB3A 1CJKC 5JHGB 4B43A 1YZQA 5C2JB 1EP2B 2C2HA 4V0MA 3THOA 4TMZA 3Q8XB 3SFZA 1QBKC 3CF0A 1R0WA 3FTQA 4DIDA 1VQ8B 2ZI4A 4HUQA 4BEJA 2ZS9A 3B13B 2A5FA 3RDPA 3GP8A 5KYKA 3A8TA 3KFXA 1KSGA 3QXCA 1D2EA 1P72A 4NH0A 2G3YA 2V7QD 1O3YA 1KKMA 3MWYW 2AK3A 2PIAA 1GJRA 1M90D 1OHHD 3QFCA 2WM9B 4X8OA 1EWYA 1FQJA 3K1JA 1Q0UA 1R8SA 1Q1EA 4DHEA 4G5SA 3FOZA 4EPXA 4Q66C 5TB5A 1FP7A 4B35A 1VECA 2D7DA 2WOJA 3SJCA 4OL0A 2ZYWX 5LDDC 5AR1A 2O8EB 3Q9LA 3CC2B 3U44B 3I92A 1U94A 4CT5A 5JLJA 2JATA 2JEOA 3V4FA 3CM0A 1KTVA 1E0KA 1HY3A 2J0VA 2OXCA 3SJBA 2XEXA 5HKKA 4HI0E 2BV3A 4P6VF 2AFHE 5EXPA 2IW3A 3M0EA 1JXOA 1E69A 2ANBA 5KHOC 3ZDQA 5GJBA 4OQMA 4M2LA 3T06B 2R6CA 2IWRA 4LYFA 1N0VC 2JCSA 3HR7A 1KK2A 2ZS7A 3ZVNA 1IN6A 3THWA 1ESMA 1G21E 3MFYA 2CEAA 4Y9RA 2YC4C 5EE0A 3U3KA 1R2QA 1JALA 1YU9A 5FH9A 1XRJA 1D9ZA 3ICEA 2O0KA 2DFNA 1EWQA 4KBFA 5TY0A 1A2KC 5J4HA 1G291 4GT1A 2QPOA 2MSDB 1NN0A 4MYTA 2PCLA 2JASA 1H8HD 3OFND 2ZVQX 5J47A 4HDQB 3TNFA 4ARZA 2CBZA 3CWQA 4HLCA 3NH6A 2MMCA 3A1VA 4DDTA 1IAQA 1DEKA 4NCKA 3I73A 1W4AA 3IILA 1KGDA 1S8FA 1GRNA 1KY2A 1VQ6B 2VHQA 1G8YA 3MMPA 3PUWA 4QGAA 3IBYA 1E2DA 1NMZA 5IF9A 4M1WA 2VTKA 4D6PA 2GWHA 3AKEA 5LB2A 4D4MA 1FDRA 1BKDR 1R10A 4V0LA 3TSZA 4ZKEA 3RS7A 2FN4A 4TTPA 2ZU0C 3Q7PA 1NY6A 3B1WA 1ZRHA 1HYQA 3CF6R 4URWR 5FA6A 1NN1A 2WJYA 2ZU6A 1TQ4A 4YONB 1S3SA 1F6BA 3CPHA 4B4DA 1F2TA 1GIAA 5CJPA 5JS8A 6Q21A 3LQRA 4E03A 3JVUA 2C99A 2ZPTX 2IS1A 4KFUA 2OTLB 3MWLA 3SI7A 4L15A 2F1RA 4HAZA 4B3CA 1E1QD 3TQCA 3ADDA 2ZRNA 1K8AD 1MRSA 3AB3A 1CJMA 1EFTA 2R6GA 4MDFA 1H42A 2ZI5A 1WQ1R 1X1SA 3H1TA 2QE7A 3WYAA 4R2IA 2GESA 2VH5R 4AF6A 2XJ9A 3DL0A 5P21A 5DNYB 4JKYA 3TW4A 4WAUA 1TU3A 3QG1A 3IBGA 4OI4A 2HUPA 1KY3A 3VHLB 1SVOA 1KKLA 2UVQA 4DSTA 3T15A 4OQXA 1I4DD 2J7PA 2ZUCA 3ZGXA 2EFDB 2FFHA 2QBYA 2QGZA 5DLQC 4FI3C 4W5WA 3RAPR 1FP6A 4HE6A 2Q9CA 4YC7A 3TLXA 2H16A 1UKVY 2GHIA 1T3LA 1OYYA 1QRAA 3HP1A 2FSGA 1I4LD 3W8NA 2IYUA 4BQSA 4C30A 1RZ3A 3TH5A 2XNCA 4A0GA 1HEIA 4BWYA 3O8CA 3QOFA 3NXSA 2H5EA 3FE2A 1KZ7B 2QTFA 3R20A 2ZE8A 1KDPA 221PA 1ZBDA 2W58A 2GTPA 3P32A 2VEDA 5DI9A 1G18A 4QC2A 4OK5A 3IQXA 1XP8A 5DHAA 3FMFA 2Q3FA 1G8FA 3GLHE 3A1TA 4PSKA 3HYRA 5E7MA 4DCUA 1FNDA 1P2TA 2A5DA 4DDWA 4TL8A 1JXMA 2CL7X 2H8KA 2VA8A 3H4MA 1M1KD 2YC2C 3LAWA 1II0A 2HV8A 4FWIB 3QE2A 2ZE6A 3MJHA 4IEIA 2H1LA 1UPTA 5FPKA 3NTUA 3LRPA 3QIAA 4TTQA 4YMSA 5BN4A 1HQYE 2HCBA 4FK8A 3H0KA 3NDPA 3SYLA 1FRNA 1QFJA 3BS4A 2A5GA 4PTLA 4NYJR 2QMEA 4HLUA 3SZRA 3CXCB 2WJIA 3P1JA 3UXMA 3WHLA 1KOFA 4Y0AA 2OTJB 1G5PA 4LPKA 1DG1G 1ONBA 3CMEB 1S1MA 5AJYA 3C7KA 4DEXA 1TQ2A 4UNPA 2JGNA 2ZUDA 1F2UA 4IOJA 1CJTC 4EFLA 2ORVA 1GITA 4P4UA 4Q7MB 1Q1BA 1S9HA 3NC1C 2A5JA 3GD7A 4KFRA 4QBIA 2XZLA 3U7EB 3FVQA 2O0HA 3ZVMA 3B1YA 2QMOA 1P2VA 1NJGA 4XTRA 1P9NA 4Y9UA 3AF1A 2ZI3A 2N42A 3BB1A 3I32A 1G3QA 2PLRA 1IN7A 1EGAA 2WPDA 3ZVRA 4BFWA 1X8LA 4ZGNB 2DYKA 3PFIA 3OIVA 4U7DA 1KI1A 2ZRLA 5JHHB 4HYYA 5L3SB 1QF9A 1H8ED 5IK2A 5FR1A 5D3QA 2NGRA 3TQFA 4TSFA 2ATXA 3GLFA 1SXJE 4TQ9A 4V0OA 5CM8B 2OUKA 3NBZC 5GVSA 1WXQA 4DCTA 1GWNA 3K0AB 4D4KA 3CRRA 1G4AE 3OIWA 2EVWX 1GAWA 4Q5IA 4ZPXA 3GPLA 3WMFA 2X2FA 1HV8A 4RJLA 3BH7A 1CP2A 1AN0A 2OESA 3CONA 4Q4AB 3AVUA 5L3VA 3LW8A 1WRBA 2ERYA 1XPRA 4OHZA 1KMQA 4WXPA 5DIFA 2VO1A 2DR3A 1G7RA 1BYIA 3CPWB 4G5OA 4C0AC 5J4LA 2AX4A 2F1HA 1VIAA 2RGAA 3UMRA 2HXSA 4M8NE 4Q7KA 4KI0A 3KZ1E 4M9QA 2P67A 1Z2AA 4ACBA 4M1OA 2D2EA 5JECA 1YI2B 1MR3F 2QP4A 1NNEA 4Q00A 2ZUBA 3U7FB 5JSZA 4ESVA 4TZ6A 1N8RD 3F8TA 8OHMA 4IVQA 4JLKA 2GCOA 1OXUA 4JLJA 2XGJA 4DSNA 1AM4D 4KVAA 1EFRA 1VG9B 3GEHA 3I4LA 3QVUA 4EJSC 1GVNB 1ZNYA 1R8QA 3UG6A 2JJ1A 2GJAA 1A1VA 1TQ6A 2CNWD 1KRHA 2QRZA 3PUYA 2AD1A 4LV5B 5CIWA 1YR7A 4IDHA 4UQOA 4RZ2A 2VNJA 1T4GA 2DCUA 3VHXA 1EP1B 4CEIB 5G40A 3GEIA 1NI3A 2AR7A 3DEFA 2RAPA 3O8BA 2HLDD 2RHDA 2VP0A 3PVSA 2K5UA 4LV8B 1VMAA 3X1XA 4TYNA 4EKDA 3BAFA 4IXMA 1E0AA 3D8BA 1MABA 1W2GA 1XJCA 5EXTA 3ZZUA 3OZVA 3B7GA 5AJXA 2RGEA 4URYR 4CF7A 2WBLC 4DBLC 3GFOA 1P4SA 4V03A 4WZBE 3RWOA 3B85A 3SFVA 1BQEA 3KKOA 1D8TA 4LDJA 3AEZA 2WKRA 1J99A 4EPYA 3P27A 1E4YA 4TT3A 1CR0A 1A4RA 1TADA 3SNHA 5LD2C 3TGPA 2PBRA 2DFTA 1E1RD 4G5QA 1UEJA 3RWMB 4B74A 3VR3A 1OFIA 1HQCA 1W4BA 4K1XA 5AK0A 4BLTA 2IF0A 2JLUA 2ZR0A 2EYUA 3SS8A 5K8IA 1QDEA 4QGGA 5G3YA 4BLOA 3RS5A 1Z6TA 4C0LA 1P9RA 5EE5B 1E98A 2IYTA 1IONA 1ELOA 1KJYA 2RGGA 1CNFA 1E32A 1A8PA 1Z83A 3JVVA 2WJGA 3UWKA 3VKWA 1OIWA 1Z0JA 3I55B 2IC5A 3ND8A 4J0QA 3WBKA 1HT1E 4E5UA 1OKKD 3E20A 1Q20A 3NHBA 1D2NA 4EJSA 2QSZA 4URXR 1ESNA 3NKVA 5H68A 3CR7A 2ZRFA 3ASZA 4XIGS 1VG0B 3DOFA 4BRWA 1KJZA 4P33A 1GR1A 1Z6GA 5SZIA 1M34E 1VHLA 2BHRA 3I56B 3PR1A 3OZUA 4GOKA 3SE0A 3ZD7A 1GAQA 3W2GA 1A2BA 4U5XA 4JT4A 2QTLA 1OFTA 1UM8A 1T0JB 2HYDA 3LWNA 1T8UA 1XXHE 1QGZA 3HDTA 4Q02A 4WZ6A 4ZIRB 3QG5A 4LC1A 2NTYC 4KYUA 2WJHA 3W6NA 2H7VA 2XOKD 1XTIA 2QROA 2GF9A 3ND9A 2YYZA 3W5IA 3IUYA 2ZJAA 4R2HA 1FX0B 1OLOA 5H5JA 3TR0A 4QXAA 1Z22A 1EXMA 1LFDB 4TLCA 4W7SA 1KO7A 5HZHA 1Q57A 4BFUA 2IA5A 2OCPA 1GOTA 4GMXA 3L2OB 4UNQA 2JIZA 1HH4A 2QAJA 4B2IA 1WF3A 1II8A 2Q3MA 3KTAB 4B3DA 2RC5A 2I1VB 2J59A 4C0BA 4BE7B 2WJVA 3EIEA 4ZI3A 3JZMA 1TU4A 3TRFA 1W2BB 3A4MA 3GCGA 2C9YA 2XXAB 1NBME 4RD6A 1KJWA 3AKYA 5EXXA 3KQNA 2HF8A 2VP2A 4GL2A 1V43A 3PG5A 4PAMA 2F1JA 1T0HB 4Q4JA 5EXSA 1KMHB 2ODBA 5D3MA 4B2LA 1SXJC 4JJKA 5FUVA 2W6ID 1ZU4A 3UG7A 2ZETA 3SDZA 5CM9C 1PJRA 2WJJA 4TL6A 2W2VA 1JJVA 3NBYC 2OAP1 4CEJB 2FWRA 4GMDA 4A0RA 1DPFA 4PR0A 2XITA 4DC9A 1E63A 1AA9A 4FIDA 3K8YA 3I5YA 3AGPA 3GLHA 1G3MA 4QNMA 1P7CA 4DLSA 1YZLA 5C46F 1KZGB 1NIPA 2J9RA 1PLKA 4LHWA 1BO6A 2AHOA 1Q7YD 2IT1A 3V4RA 3QNUA 1FQKA 1Z28A 3QSYA 3LX8A 3LVRE 2WZQA 2Q0HA 2IL1A 5CITA 3KJEA 4KV9A 1JQLB 5C4MA 4AD8A 2R8RA 1KO8A 1SHKA 5EE1A 5TVKA 1TEVA 2GCNA 2IX3A 1MT0A 3C8UA 1CR4A 4LJ9A 2UZIR 4QHYA 3K0AA 2G0TA 3QEOA 2J0UB 5TXGA 4GSYA 1KI6A 2X77A 4HAWA 2ORWA 3CBQA 1J70A 4BRUA 2H18A 3X1YA 4DLTA 1VQLB 2JA1A 5LB4A 2R6HA 4RKEA 1NJID 2NQ2C 2QM7A 1TF2A 2H17A 5JWHA 5JWRA 2O8CB 1SVWA 1U0HC 3ZVLA 4DLZA 1EX6A 3C14C 3OHMA 1SVLA 3ICQB 1II9A 1QFYA 2CE7A 2JDID 4JBYA 2QTZA 2V4ZA 4M9XA 5A5GA 1LF5A 4NYIQ 2HYIC 4IDQA 4FCVA 4IKEA 4KYIB 5J4KA 3CX7A 3VFDA 4N0EA 1LB1B 2GVDC 1N6OA 1SXJA 1ZM9A 3UKDA 4DCNA 4F92B 1CS4C 4MDEA 5H8WA 1EX7A 1A7JA 2P6UA 4M4SA 1GFIA 4QJ5A 4NTZA 3D3QA 1MH1A 121PA 3KXKA 4Y7CA 4YALA 4RFSA 1W2HA 4HZUB 2BVNA 2GILA 1PLJA 1P60A 4E09A 3CCLB 1OH5A 2WAYA 3EXAA 3WNCA 1SM4A 3QPVA 1W36B 4OK3A 1E3MA 1KDRA 1TX4B 2OFOA 2QQ0A 2HT6A 4CEIA 3W8RA 3GJ0A 1F3OA 1P61B 1AK2A 5KDDA 3QKRB 3B8HA 5KNDA 3NHAA 3AF3A 3SBDA 4A1FA 4MUBA 5CLQA 2A30A 1BJKA 1AKYA 4OI1A 3QQ5A 1JECA 1K8RA 4JBWA 3QEJA 1LNZA 3R8FA 1E4VA 5FBRB 1QVAA 1WE2A 1W44A 5EP2A 4NZYA 1US8B 1ZUHA 4MRNA 5GJCA 4CRWB 4EPRA 2PEYA 1TNDA 4KFSA 4PZYA 4L16A 1FTNA 3W6OA 3MJRA 5BQ5A 1YZTA 4AG6A 2O52A 3EASA 3QJYA 4A0HA 3EPHA 1W87A 3OZWA 1RRCA 1BX1A 1CJUC 4QRHA 2AKYA 2ZRCA 2N46A 4B3FX 4XSGA 2F43A 3W34A 2FFBA 1VQ5B 4CGZA 1S0UA 2XTZA 4P4SB 4D26A 4BFXA 4UJ3A 3I62A 2GF0A 1XDBA 3LA6A 1JI0A 2WVJA 2DFKB 1OFUX 2WWXA 3QFRA 4QKQA 3CO5A 5KSZA 5KPJA 1ZU5A 5HKKD 3K9LA 1G4UR 3FFAA 4Z8YA 1T5LA 3MG9A 1UADA 2IYYA 1XTKA 1CR2A 1KC8D 4B71A 4WXRA 2XNDA 5F98A 2VP9A 5C1BA 4R71A 4IVPA 2PJRA 5IRCD 2QP9X 2BEKA 2FOLA 2ODWA 4H1UA 1AS3A 1W7AA 3G4SB 5FTJA 4TQAA 5IHPA 1NLYA 4E22A 4XVRA 1DAGA 2YJTD 1ZVQA 5HE8A 3R9IA 1AKEA 2QNRA 1XJ0A 3C41J 1CTQA 2BMWA 3PEVA 4PPNA 1NVXQ 4HB3A 5FTNA 5B2ZA 4AKEA 2O5VA 5JI3E 4JSTA 4WW0A 1ZM7A 1UMKA 4MRVA 3BB3A 4ZIRA 4IJMA 1GNRA 1S9DA 2ZYTX 4KHZA 3AF4A 3GFPA 3B2EA 4DJTA 3Q7QA 2OHFA 3ADKA 3CRQA 3A1WA 3EWAA 4TLDA 4G01B 4OQLA 3DPUA 2V9PA 1VCOA 4Q1AA 2IS4A 2FMXA 1DOAA 1E2EA 2BMEA 4US2R 1E0JA 4OQNA 3NDBB 5K8UA 2QT1A 4EH1A 1G19A 4PQYA 4C4PA 2VZLA 521PA 4PC1A 1X8KA 2O0JA 4B34A 4CIDA 1IXSB 2OK7A 2CHGA 4C2UA 1OYWA 2Y8EA 1NRJB 3IDQA 2FX3A 1QG0A 3KTAA 4TLEA 3DM9B 4Q03A 2GZDA 5EQTA 5EUMA 1Z8FA 2Z43A 3SR0A 5CB8A 4YAWA 5E3HA 4PX9A 4Z54A 5HXBA 5FR2A 2A7QA 2LKDA 3KB1A 3VNVA 2W2XA 3KDSE 3P4YA 1XXHA 3AF2A 3EZ7A 1MOZA 4OHXA 1KMHA 2Z5FA 3CR8A 2C9CA 3CRVA 1BS1A 2BWJA 1QHNA 4LZZA 1T91A 2QAGB 5JRZA 3SC3A 4IRUB 1DAMA 2QE7D 2YWFA 3ZC3A 2H57A 2WWHA 2Z4RA 1TEXA 1KIMA 2IXGA 3U7HB 3LY5A 4OJQA 4CEJA 4XVQA 4G5GA 1W46A 1YKSA 2I3BA 5EP4A 3AKCA 3VR4A 3Q72A 3F3YA 2WKPA 3LO8A 2J7PD 1W36C 4PO1A 3K9HA 4C0KA 4DB2A 2PH1A 4Q01A 1OH8A 4OHYA 2ZR7A 3KKPA 1G3RA 1XMJA 2XAUA 4JLPA 4C0HA 3FHCB 4LYHA 4AYXA 1IN4A 3H2YA 4F91B 5JJKA 3RLFA 3CCMB 3KB2A 721PA 1NBMA 2FGJA 3GJ3A 1OE0A 1Q3TA 3VO1A 2VP4A 3NH9A 4WZAE 3DMDA 2DETA 1NDHA 1GNPA 4Q7JB 4G1BA 1NLFA 4R9UC 3VNUA 1BOFA 3K09C 1W34A 2HXYA 4HB4A 2OLJA 2AKAB 4EFMA 1NN5A 1Q3HA 1GRQA 1QVRA 3A1UA 4GPTA 2GAAA 2V1UA 2HDNB 4EQ6B 4YQFA 1XD2B 2NPFA 2OE2A 2F7SA 3RRNA 3PJRA 2GRJA 3LLUA 2BGIA 4F7WA 2BJVA 5TMPA 5DSZA 1C9KA 4HE5A 1QH0A 1Y3AA 2O8DB 1G8GA 3W5UA 4WIAA 1U2RA 5L3QB 2QL6A 2ZI7A 4NCJA 1VDZA 4HATA 3AP1A 1CULC 4KBGA 4HAUA 4JJZA 3OAAA 3EX7C 1ZC4A 3RS2A 2KE5A 4QOSA 1AGPA 4IDPA 4FINA 1JEDA 3REGA 4C7OB 1RJ9B 4Z8XA 3W2HA 621PA 2VF8A 4MQBA 3OE7A 1QZXA 2DHRA 4US0R 1FMJA 2HMAA 1R0YA 5JJLA 4MYCA 3THXB 2TMKA 1XWIA 1ZINA 5FL7A 1E2QA 1Z0DA 2WWIA 4MKHA 1CF4A 1WA5A 2QRNA 2VSOA 3BK7A 4HZUA 2ORIA 2QPAA 1KAGA 4PHFA 4QHTA 3A4NA 4Q47A 3BFKA 5DE3A 2B8TA 1KI8A 2WSSA 2XNSA 2IYQA 2CVHA 3LXXA 1TF5A 5CDFE 4X8HA 3PQCA 2MSEB 2WHXA 1E2LA 1YR9A 3O8RA 1GDDA 4A15A 1XPOA 2DEUA 4NYJQ 4QG7A 1KK0A 2V6JA 2WPDD 5BN5A 1X3SA 4QJ3A 4O2RA 4GBMA 2R44A 4TMKA 4FCTA 1FTSA 5IK2D 4HAXA 2CJWB 3GEEA 4TSFD 4Q4LA 4V02A 3FMOB 4LHYA 1NMXA 2VP5A 3CCRB 3K09A 2IHBA 1F20A 1TL7C 4KITB 1XZQA 1N6RA 3KKMA 1G20E 1Q1ZA 3HPRA 4M22A 3LX5A 1KI3A 4HLUC 3L8ZA 5H70A 3ZIAA 3VTKA 1G7CA 4A4DA 4B3BA 5KDOA 1UBFA 3TJZA 1L2TA 4O25A 1VTKA 1KDOA 2IEZA 5FUWA 4ASUA 1UF9A 5DN6A 4X8MA 2V8OA 3CC7B 1IOZA 2ZSBA 1JEEA 3B60A 5J4VA 2XSZA 3RNLA 3U3OA 1GKYA 2QM8A 3F0TA 3L0IB 2ONJA 1XEXB 1NN3A 1UDWA 2BDTA 4H9GA 1HT2E 1TLLA 2BCJQ 1YITB 2GXSA 2IS6A 2PL3A 4JVNA 4LBYA 1T6NA 3T12A 5SZHB 3IIMA 4LX0A 2ZSEA 3MLEA 1B2RA 2OBMA 3UPUA 1Z07A 3E70C 2QAGC 2IHYA 2XTNA 3L0SA 4W5HA 3RRZA 1EFRD 3VR2A 1ZUIA 2C98A 3CX6A 1EG7A 2ZS8A 1J90A 2R6FA 3G5UA 4NU0A 2JJ1D 3MSXA 2VP6A 4EIWA 3GJXC 4F93B 2AWOA 3SJZA 4L9WA 1RRPA 2YZ2A 2C5LA 1E9FA 1UKZA 5FOUA 2BC9A 3BGWA 4LHVA 4DSUA 2EU8A 1UKYA 3CCSB 4X8LA 2QI9C 1R0XA 3C15C 3DZ8A 3QF7A 4DQLA 4KFTA 4A36A 5K8TA 4ZCLA 3CNLA 3L0PA 5KPDA 2G6BA 3CWZA 1MO5A 4GP6A 2H92A 1DDIA 3TMKA 2IUSA 4ZDIA 1T5IA 1TQDA 2V6IA 4PZLA 2AFIE 4NMMA 2IUTA 1E2GA 4A8JB 1AZTA 2R2AA 4U02A 4US1R 3DVLA 2RGBA 3RABA 1OXTA 3UMSA 2GXQA 3AVYA 4P32A 3FHTA 4TT3D 3UMFA 3CCJB 4CT4B 4BFSA 3AVWA 1P2UA 2R6AA 3BJIC 4AIIA 1E79A 2VRWA 4NCIA 3RC8A 4FMBB 4LJ4A 1BIFA 2WWGA 3AVOA 1HTWA 3HR8A 3QKSB 4Q9IA 1G41A 3PITA 4XTCS 2B21A 4PC6A 4DQKA 5UKDA 1SKYB 4PPFA 1RKBA 1DBSA 3QENA 4EDHA 2JLZA 2FEMA 3G0HA 4WOPA 4L9SA 2ZRAA 1JR3E 2FH5B 3SHFA 3CPEA 3O47A 4MKFA 4DLYA 2QAGA 4HAVA 4B47A 1N5JA 1DADA 1LV7A 2PLFA 3OJWA 3K0FB 3PUXA 3ZS8A 1XCGB 3KQKA 1G9XA 2BMDA 2G88A 1XEFA 3WMEA 1Z6XA 1DAIA 1YHQB 2NO7A 1YJWB 1OV4A 5FOWA 4CEHA 2JAQA 3BH0A 1VG1A 1JBKA 1TAGA 1JNYA 3QXHA 4Q9LA 1KYIA 1SVKA 1E9DA 2EWVA 3OZXA 1JPNA 2YV5A 3RS4A 1Z6AA 3PIRA 2NO1A 1M1YE 2OM2A 1XE1A 2X3UA 5C4GB 4DUGA 4A2WA 1XTQA 2O8EA 2ZREA 2F9MA 1ZJ6A 3U44A 3REFA 1VG8A 4TZ0A 3PEUA 4DDUA 1R7RA 2BF4A 1YRBA 2O8FB 2GQFA 1IHUA 1ZMXA 5GV8A 2VBCA 4RVCA 2VHUA 4D4LA 3I61A 4GZMA 1R4AA 1P73A 2ZRKA 2MSCB 2BKUA 1CIPA 5FTKA 4BLSA 1XD2A 2GVZC 3I8SA 1I7PA 3N2EA 1SZPA 2BKEA 3IO5A 4AI6A 1Q21A 3IEVA 3KL4A 4N3NA 2RGXA 3TAUA 1CLUA 2JIZD 3Q5EA 1FNBA 1IXZA 4Z1MA 2O8DA 1W47A 2F9LA 5L3QA 3EWSA 2BEJA 4TQUS 3DO6A 4BZQA 4M1YA 1NSTA 1HE1C 1HE8B 1XF9A 5JI2E 1IQPA 4OI2A 4WQMA 4MKIA 3D31A 3IHLA 2QY9A 1Z0KA 3AP2A 3X1DA 2ZJZA 3QKTA 2C9OA 2P3SA 4ZGQB 3CIOA 4BASA 4C7OA 2QTHA 2J5XA 4Q21A 5KNCA 1O87A 1XBTA 1PVOA 2ZXUA 2ZJOA 4MYUA 4A6XA 2JLWA 3S1AB 2O8BB 4GFDA 1W0JD 3L82B 5EE3A 4FW9A 1D2MA 2GETA 4JLAA 3THXA 3VR6A 2BBTA 2OCYC 3OESA 1VQKB 2IYXA 2IWHA 4URZR 1U0LA 4GOXA 1N0UA 1Q44A 1E2NA 4JYBA 2IF2A 5DI3B 1RC8A 2FNAA 3LV8A 2ZRHA 3RSLA 1V5WA 1W48A 2G1JA 1G16A 1NJFA 1SULA 3LFUA 3OEEA 1RW4A 2W0MA 3QBTA 2CL0X 2GJKA 4LOAA 4NPHA 5B64A 1VKJA 1DARA 1EWRA 1U8AA 4Q4HB 3X2SA 1G6OA 3GLIE 4TWZA 3Q3JB 1JB1A 3KQUA 4H1VA 1M6NA 4LYAA 2W83A 4KLZA 3OW2B 1JAHA 3FPKA 2BOVA 2CJWA 4D0GA 2C96A 3HYTA 4DT1B 2QORA 1K6MA 4M9SA 2Z83A 3W2EA 1T8TA 3T34A 2RGCA 1YZNA 3K70B 3VKHA 3RS0A 2WV9A 3VO2A 1G6HA 3IPXA 1KSFX 4FWTA 2YVUA 3ZZTA 3RVBA 2Q21A 5L3RA 1KI7A 421PA 3VX4A 2IYRA 3TE6A 3BC1A 2AL7A 1E9EA 1OSNA 1D5CA 3KXLA 4QHSA 5CDFA 1EESA 2EFEB 3QXJA 4JVSB 3FYHA 4DCSA 3CMAB 2JLVA 2FFAA 2HF9A 3MRSA 3F5FA 4PHHA 3U4QB 3ZD6A 5E7JA 2J3EA 4S35A 3GLIB 1GAJA 2UKDA 3H86A 1E6CA 3LH5A 2XNJA 5J40A 1FUUA 2FU5C 2VNKA 1SXJD 4ACAA 3OEHA 3V00A 4TLBA 1XMIA 1XTJA 4TYQA 3UANA 1GKUB 5JFGA 4Y0VA 1D1NA 4OKSA 1FZQA 1WB9A 4O2LA 2E9SA 4IDOA 4AKIA 2P6NA 3EW9A 1YIJB 1RIFA 2BCGY 1JJ2B 2ZE5A 4GRAA 2FZLA 3IIJA 2EW1A 2JLSA 2NO6A 1NVVQ 1W4RA 4OHVA 3ADBA 1RRGA 1UKEA 4LJAA 5JEEA 1E9SA 2QT0A 4QNRA 5L8VA 1BYUA 2CVFA 3U6BA 1ZAKA 3DOEA 4NDZA 3U7GA 1I4TD 2JJ8A 1NY5A 4LY6A 4B75A 4F4CA 1BMFA 1F60A 1AGRA 3GJ4A 3LQQA 2ZRJA 2VNIA 5JRJA 3SYNA 5DGXA 3T5GA 4IOMA 4MKGA 1OF1A 2WTUA 1RPZA 2IYLD 4F38A 2FJUA 3RANA 2PZGA 4NP6A 1CU1A 5GVRA 1S4QA 4D25A 1KQSB 2WICA 4A8JA 4ERNA 2GDJA 3V9PA 1NKSA 2QUZA 4TL7A 4PC3A 1AS2A 2C04A 3QXSA 4HDOB 2EWWA 1IY2A 1W0JA 2DPXA 3BXZA 1W49A 1HUQA 3I1FA 1LS1A 4A82A 1K73D 3WP0A 1PUJA 4NKRA 3QFTA 4HAYA 1TUEA 5EP3A 4P0TA 1QHHB 3AVQA 5F2EA 2YOHA 4PSVA 5FI0B 5FBLB 5AUPB 5JCZA 2Q9BA 3K0EA 5EP1A 4B73A 5FTMA 3KXIA 3RYTC 3B6EA 3NVAA 5FBQB 2HJVA 1ZNXA 2ZJ5A 3MCAA 1YZGA 5FBWB 1Z0FA 4P3YA 4XSHA 1TPZA 2HCJB 2XNDD 3BOSA 4UNSA 1DAFA 1X6VA 2IYZA 2VNHA 1DG3A 1Q81D 2FPKA 3FKSA 5L3SA 3GMTA 3VAAA 4DLUA 1CXZA 3SYKA 4LSGA 3EPKA 2XB4A 1DTSA 1J9ZA 2ZRIA 3CUEF 3HU2A 1GVHA 4NCNA 2ONKA 3B1XA 1TUIA 3EZ6A 4YDHB 3CRZA 5IDVA 4RD4A 1DVRA 4JKIA 4PQFA 4D4JA 3CRW1 4JLMA 5KNBA 2EFGA 1XNJA 3GJ7A 4NONA 3LXRA 1E96A 1YE8A 4Q4AA 1AJEA 1EP3B 2GAOA 4LI0A 2QP3A 3T61A 1F5NA 1GUAA 2REXB 1Z0AA 2ZI9A 3MWKA 3W6PA 3KKQA 3HWSA 5TARA 3UWOA 1P75A 2QPTA 4EPVA 2FZ4A 1EFHA 4TN1A 1FL9A 1ZNWA 1ZM4A 3WNBA 1LW7A 1NVVR 1JR3A 2O8FA 1VQMB 3FMIA 3RSOA 3OF5A 2ECKA 1CRQA 3VX3A 3IQWA 4DLRA 1GL9B 2WOOA 5DHFA 2RH5A 3C5HA 3ZLJA 2PX0A 2GEDA 3N5CA 1DAHA 2IBMA 3W5VA 2C03A 3RS3A 1DO2A 1XCMA 1YJ5A 3A4LA 5EZ5A 3KX2A 3JQQA 1OB5A 2W6JA 1PV4A 1C4OA 3THWB 3W3AA 4PQRA 1UAAA 2QTVB 3B1ZA 2RMKA 1N6KA 2FA9A 4ZO4A 2B7CA 5KSWB 4GZLA 2PT5A 4A92A 3LLMA 3TR5A 4B6EA 1Z0IA 3C4JA 3M4YA 2GEUA 1NIJA 4AYTA 4EPTA 3VU9B 2RGDA 2XJ4A 3S1AA 3QPWA 5HPYB 1SVSA 2D4HA 1R5BA 5KUTA 1UDXA 1ZM2A 1IN8A 3AGQA 1UBCA 4BFZA 1Z08A 3DM5A 1LTQA 1ODFA 4L8GA 1P5ZB 3E2IA 3X1WA 1PZNA 4KLNA 1AIPA 4LJYA 1NG9A 3DDCA 1XEWY 1CRPA 2D06A 2PEZA 3QKUA 4JS0A 4ESHA 3TUIC 4PHTA 2GKSA 3BORA 2OT3B 2ZAOA 3LBNA 5DISB 2BM1A 2NZJA 4YLGA 5B30A 1DDGA 4N0DA 5F3WB 2AXNA 2IXEA 4IOLA 1NBMD 4PFSA 2P65A 4MITA 1ZP6A 4Z51A 5FOTA 5GV7A 1M7GA 1P9WA 5SZJA 4N3GA 1F2TB 1R0ZA 5JCPA 2X2EA 2GZAA 2W00A 1G5RA 1OH7A 2P2LA 2CDNA 5HTKA 4WBSA 5FPSA 4K46A 4PPGA 1N5KA 3CLVA 1E94E 3T1QA 2ZJ2A 1VQ7B 4IEEA 2VYQA 1AQYA 2RGNC 3EC1A 2BPOA 4C43A 1ZCBA 2D3WA 2KBFA 2OG2A 4PC2A 5CJ2A 2FSFA 2WWYA 2P5SA 2ZYUX 3NG1A 5FPHA 4M53A 5H59A 3L8YA 4F4IA 1YRAA 3U4QA 1RYFA 3OAAD 2FSIA 3GLIA 3A6PC 3WHKA 2OCBA 1EFUA 1FRQA 4Q1DA 3OE7D 1QG2A 4BLRA 2RHMA 3FJOA 4YAFA 1H65A 2AN9A 2CHQA 2XX3A 3NEYA 4Q9HA 1KNQA 1KD1D 5FL7D 1RE0A 1S1CA 2YOGA 2X8AA 5HCNA 1TF7A 4ITRC 2OZEA 4BFYA 2LWIA 1KNXA 5THXA 1NMYA 2WSSD 3TBKA 1FX0A 3TKLA 1W36D 5GJWC 3HU1A 1OIVA 2QSYA 5H1YA 4OBEA 5AN9A 2EQBA 4LGMA 4RZUA 3OIUA 3EG5A 4LYJA 4PHGA 4B32A 3SU8A 3AUXA 5JBQA 3B9QA 1JR6A 2HJGA 2ZSFA 4AWXA 4PO9A 4YXWD 1CNEA 4I1UA 2KSQA 4XH9B 5LBIA 1QGYA 1ZUNB 2QN6A 3IO3A 3TUJC 4DZZA 2ZSAA 2P6RA 2DY1A 1UFQA 3IIKA 2XXAA 1VQPB 2GBLC 3TSOA 2VIIA 3G82C 2CCJA 3ZIAD 2D7CA 2V55B 3B5JA 5TR9A 3TIFA 5BN3A 3R9WA 1N6NA 4UJ5A 3KUCA 4NBSA 2RGNA 4ASUD 2J87A 2WWWA 4HUTA 5DN6D 1SGWA 1D6JA 3ES9A 3LBHA 2ODNA 1F2UB 2XTMA 4XD7A 1DS6A 4B2PA 4BPRA 2XSZD 1Z3IX 4HB0A 4P4TA 4M1KA 5ELXA 2GEVA 2XB2A 5F9HA 4MRSA 3BIFA 4JLDA 4QGFA 1Q12A 1QHHA 4ZV4A 2GXUA 2WIBA 4Q1EA 5FOSA 2J41A 4E07A 5JWOA 4JZKA 2ZJYA 3IPYA 1XMSA 2IK8A 4XOIA 4RD1A 5JMTA 2ZSDA 5KSPA 3HPQA 4FCWA 3MAAC 2VHCA 3WYFA 4LHZA 4IVRA 1KSHA 4ZCMA 5LPNA 1JA1A 1VIYA 2OILA 4IDNA 4BPBA 4LHXA 5FPTA 1ZYUA 3GLFB 4C0JA 1OXVA 3BD9A 1FNCA 4AURA 4PZZA 5GJVC 4PAOA 4EUNA 2B7BA 2F1IA 4GP7A 3DMNA 3FPAA 2QENA 2JJ2D 2NZ8A 2J0UA 4I4LA 3NC0C 3K53A 2E1RA 1XEWX 4W5JA 1AZSC 4TL9A 4YMWA 2JLXA 1NL3A 4PC7A 3C16C 2GJSA 2PJZA 4MH0R 3NBXX 1DAKA 2CCKA 3MHPA 2PZEA 2Z4SA 3AF0A 1COWA 3A58B 4DLVA 1DE0A 4AY2A 5EJEA 2ZRBA 3GLGE 3T1VA 4YHBA 4Q18A 2O8CA 4AKGA 2LKCA 2A9KA 2CNDA 2ZEJA 1BX0A 4QBHA 2ZYVX 5CYOA 2GXAA 1QHYA 3B78A 4LBVA 3SQWA 2GBLA 1KO1A 1AMOA 2NPIA 1CR1A 2B92A 4LK2A 4O0MA 1K9MD 4ILEA 1E2FA 1SHZA 4A2PA 4PXAA 4DCVA 1UEIA 5FTLA 5JSZB 5KTYA 2OLKA 2FE4A 3ECCA 2GCOB 2KWIA 3CRMA 1XZPA 2ZRPA 3QE0A 1VCMA 2CK3A 4ON9A 1E79D 3U61B 1NVUQ 3GFTA 4KU4A 2XZOA 1KK1A 1KDTA 1QGAA 4LV6A 2B6HA 4Q1BA 2YWGA 1OT3A 4B44A 3DHWC 3KUDA 4JSYA 3QI2A 1S72B 3SHWA 4BECA 3L43A 4YAOA 4WA7A 1LS6A 4D0LB 3KJHA 4IFBA 2OXRA 2FG5A 2LCFA 3GLGB 3IKJA 2PCJA 4UNRA 1GSIA 3T5DA 2V54A 3DZDA 4PGOA 1GL6A 5AJZA 3VU9A 1YQTA 1GP2A 3FKQA 3QKRA 4FMDF 1G64A 3CZQA 1N3BA 2QEXB 3UIEA 4LRWA 2AWNA 3RHFA 4RFVA 3N2IA 3PV0A 1GL7A 3ZBUA 3PUZA 2YWEA 4BFTA 2F6RA 1YHNA 1MABB 4RCZA 1MO3A 4YXWA 5CK4A 5EMNA 4OI0A 1FPMA 4AKHA 1R5NA 1VQ4B 1I2MA 1US8A 2BIFA 1E2KA 4U9UA 1KSJA 4XWOA 1QUEA 5EUQB 2BBSA 1QHXA 1KK3A 4LUCA 1XTSA 2GJ8A 4CW7A 2OFWA 4U00A 1ZD8A 2IXFA 1E2JA 3ZJYA 4DIEA 4DDVA 2RC6A 1I2DA 1TMKA 2V1XA 5BW8A 4DUGD 4IOKA 4YMTA 1M74A 2WWFA 4P31A 4ZCIA 1E0SA 2FGKA 3DKPA 1IY0A 2UZ3A 3FFBA 4P4SA 4CEHB 1T3SA 3QBVA 1N6HA 1KHTA 3W2FA 3G6EB 3BRWD 4BEBA 1IJEA 1G7TA 4RD2A 4C9BA 1MKYA 2FSHA 2QA4B 2JLQA 2F3TA 3T1TA 3VQTA 1OIXA 1NG1A 4TYWA 1U0JA 3KQHA 1B0UA 3W2IA 4KXFB 3CCUB 4Z1MD 4JYCA 3X1ZA 4XWAA 4HZIA 1YVDA 4M21A 2BSAA 2YOFA 4EJSB 2BMFA 1Z2CA 1ETUA 5DO9A 4JL6A 3I3SR 3LDAA 1JPJA 2R9VA 3QF4B 2CL6X 3D7MA 2AK2A 4JL8A 2V7QA 5HZKA 1OGIA 1Z6YA 4UAJA 1ZIPA 3CNOA 2JJ2A 3QY0A 2DWPA 4XWKA 3ZYCA 1OHHA 3CKLA 1T3HA 2ZJBA 4TMVA 2IUUA 1XD9A 1FW6A 5KU1A 2OO7A 3NEJA 3BB4A 3EIHA 1SKYE 1Z29A 4DXAA 4B33A 1G1MA 1LF0A 3E1SA 3G71B 3TUZC 3ADCA 4RCYA 5HCIA 3B9PA 3W5JA 5K8LA 3B1VA 4Q1CA 3TVDA 4D81A 1M2OB 1NF3A 1XTRA 1SVMA 3Q5DA 2D2FA 3KKNA 1UJ2A 4IFEA 2C8VA 3K0SA 1MV5A 2GJ9A 5KSYA 1VYTA 1JA0A 3OEED 1ZD9A 2JLYA 3WP1B 3P4XA 1VQOB 4I1SA 4MYHA 4OK6A 1M7HA 5LD2B 1AS0A 4PSAA 3AKDA 3ASYA 2FDCA 1XMVA 2DWOA 1W5SA 4TMWA 1E2PA 1II8B 3BFVA 1F48A 1E2HA 4Q19A 1YJ9B 4QGHA 4GDFA 2FV8A 4ZDWA 4I81A 2ZTSA 2ERXA 1BH2A 2CLDX 2GNOA 4Q7LA 2CRVA 2YKGA 2QG6A 1VYUA 1YR6A 1SQ5A 5FPYA 3LO5A 3WBJA 2GA8A 3LW7A 3CCQB 4LJ7A 4Q4JB 4A0FA 1QHIA 5D3MB 1HA3A 3W3ZB 1H8HA 3OFNA 1SKQA 2E87A 1TTTA 1WMSA 1PUIA 4I1VA 3QVVA 3W9YA 1RRFA 4JBXA 1AQUA 4C0QC 4ZDJA 2W2TA 4HDCA 4TMTA 3CH4B 3CX8A 2Z0MA 4K8OA 1VCIA 3FWYA 4A9AA 2IYSA 2RB4A 1YJNB 1KI2A 1S96A 3GLHB 4QBGB 1XPUA 2PZFA 5C18A 1W0KD 4IXNA 3EAQA 2ATVA 4HSEA 3CPJB 1L8QA 5EE9A 3AVVA 3OEHD 1QG4A 3AM1A 1J8MF 4TLAA 4MGZR 3TVTA 4AG5A 1LY1A 5BWMA 4M1TA 4KSCA 1P3JA 2VYFA 2FPLA 5JJIA 2Q6TA 1IXRC 1XFAA 2ZROA 4EPWA 4LJ6A 3SJAA 2REOA 5AUQA 1S3GA 1K5DA 4LPSA 4MGIR 4EQ6A 4FMCF 4N1AA 5AUNB 2ANCA 3E5HA 2CLCX 2A2ZA 3SQXA 1E1QA 1KI6B 1WBDA 2L0XA 3I8XA 1GTVA 3ZH9B 3AP3A 3EIQA 4C3ZA 3VMFA 1P62B 3GQBA 4C2TA 4KVGA 5CK5A 5E95A 2WMNB 1GZSA 1BMFD 3DKVA 1N6LA 2ZRDA 2QEQA 5G3ZA 1KO5A 2VPPA 4LJ8A 3KQLA 2N1BA 3H84A 2ZI6A 1J7KA 1WDTA 1W35A 4A6PA 3RRMA 1N0WA 1KI4A 1U8ZA 2VLIA 4JLBA 4KAXA 1DELA 2WAXA 3TK1A 1TVCA 3CW2A 2G83A 1OB2A 5G41A 1IJFA 1JJ7A 4JMPA 3PXGA 1RJ9A 2NIPA 1QHGA 2ASEA 1SXJB 3IGFA 4D80A 1N6PA 3CZPA 2X1VA 1S2MA 1N5IA 1E62A 4YMVA 5CIQA 2YWHA 4DVGA 4QFMA 5F9FA 4OHWA 3THYB 3LD9A 2PT7A 3UK6A 2R62A 2V3CC 4RFSB 2GCPA 1JB9A 5JS7A 3EZFA 5CB6A 2OCAA 4M9ZA 3WMGA 4QBFA 3AV0B 2WSMA 2W0SA 1MRNA 4ABYA 4B6FA 3BBPA 4FMDB 2OBLA 2IYVA 3BFXA 3GLGA 2F55A 1Z06A 2DERA 4JIMA 4NYMQ 4W9MC 2EYQA 1CJVC 1T9HA 2VHTA 3FKSD 4JLNA 4OJKA 4DKXA 1CEEA 4G1VA 1NSFA 2OSBA 4KO8A 3RRYA 3PEWA 3WYGA 2G77B 5IT5A 1B23P 4GNKA 2AXPA 2FF7A 4M1SA 3CD6B 2YINC 1Z63A 2A5YB 4UKDA 4A8JC 4TMXA 3PENA 3HU3A 3M1IA 5JEDA 4DLXA 4DRZA 2VF7A 2NO9A 3LVBA 4IW3B 1RVDA 4ZI2A 2C78A 1G7SA 1N6IA 2F3RA 1E9BA 3JQRA 2F43B 1OH6A 2BGJA 3R8CA 3GJ6A 4LC0A 1KO4A 2YNMA 1L7VC 1GILA 5FOVA 1EK0A 5JZVA 3FDIA 1QFZA 1JR3D 2CMKA 3K9GA 3Q85A 5FUXA 5KO2A 2AD5A 4OYHA 2CCGA 1XEXA 5J4YA 3CCEB 1VHTA 4S2EA 3M6AA 3AVPA 3SEAA 2R6DA 2ZRGA 4BZPA 4D82A 4FN5A 1W0KA 2Q9AA 1Y63A 1M7BA 3K0CC 2ZQ5A 2DFLA 3IEUA 2G0NA 3HJNA 4V0KA 3P26A 2A3RA 2B8WA 1X86B 5BXQC 2ZAMA 3CF2A 4CZ2A 1VQNB 4M0LA 2W6JD 4YMUA 5CYPA 1ZD1A 2IS2A 2VSXA 4PO8A 1H8EA 2CE2X 2VSFA 3CH5A 5FFMA 2CXXA 3QF4A 5DH9A 1N2CE 1NKTA 3QFSA 1OW3B 1SVIA 1DO0A 2CLSA 4Q1FA 3U60B 2JLRA 2ZVPX 3FGNA 1XD8A 1QVFB 1OXXK 5E4FA 1FNMA 4BFVA 1KAOA 1OGJA 1VQ9B 1EFCA 3CNNA 4AYWA 5AUOB 3U2QA 4QJ4A 1YR8A 2WMOB 2PMKA 1A5TA 4POAA 4ZKDA 2J45A 4B48A 3FHOA 4UXHA 2VHJA 4LWZA 2HEIA 4L5BA 1NP6A 2G1KA 4MGKR 4V0ME 4DEYA 4LBWA 1R5OA 3A36A 1E9AA 2BJWA 4JVMA 3EPJA 2X19A 1U81A 1UBGA 1G3IA 3W5HA 2G9NA 5BYJA 1G3UA 4G1UC 4NCHA 4R7ZA 4F4JA 1GM5A 4NYMR 5KDLA 4WVFA 2ZM5A 5AWFC 3NWJA 3CB4A 1JAIA 3EA5A 2BN4A 1FFHA 5FUYA 3R7WB 1OJLA 3VKGA 1G17A 1ZCAA 3QKSA 4G0NA 3K70D 1QX4A 3AH8A 4HEJA 4D2IA 4DLWA 1KI9A 4MRRA 2CNWA 2QMUA 1E9RA 1OFHA 1X1RA 5B58C 1E2MA 2OFXA 1Z47A 1XXHB 1RFLA 1WP9A 3O8DA 2J1LA 2DWQA 2KB0A 3GJ5A 3K0CA 3NBFA 2WIAA 4BLPA 2QGNA 4RSGA 1MO4A 4L4UA 3W90A 3ZZ0A 2HLDA 3P20A 4RKFA 1K5GA 4JL5A 4QM7A 1QUFA 2OEPA 821PA 3K0FA 1G8HA 2I1QA 4HUQB 3UATA 3BE4A 3T1OA 3EC2A 1WCV1 3CC4B 2OV2A 3TW8B 4R98A 3QXXA 2C77A 3EARA 4JT2A 4V0NA 2PMDA 2DBYA 2SHKA 5A4JA 5A0FA 2IEYA 1N5LA 1NVWQ 2KBEA 5FI1B 4MGYR 1IY1A 5HR5A 2P5TB 4RY2A 1YZUA 3LVQE 1C1YA 2B5OA 2EIXA 3U5ZB 3WNDA 2XZPA 4EFNA 2QZ4A 3NIBA 1E1RA 3MUFA 3RC3A 3N70A 4FMCB 5M04A 4DSOA 3V76A 3K70C 1A82A 1G8PA 1P6XA 1XX6A 4GI7A 5DYGA 4A2QA 3EZ9A 2FPMA 4LJ5A 2ZJ8A 3U3RA 4Q9KA 2J0QA 1IM2A 1ZIOA 4FXPA 2RKOA 3VR5A 2Q3HA 4URVR 2NG1A 4XJXA 2ZR9A 1GNQA 4MA4A 4YAUA 4CVNA 4QM6A 2D74A 2EFCB 4HB2A 1OKKA 4JLOA 4MUAA 4BUJA 1RYHA 2WKQA 4AK9A 3R9XA 4PANA 2PX3A 1N25A 2ZE7A 1ZNZA 2CHVA 4Q9JA 1Q82D 2BBOA 3U3JA 1R6BX 4HLQB 1GG2A 3JZAA 4GOJA 2J7KA 3FB4A 1HURA 1U98A 2BM0A 3I72A 3QPUA 4QL3A 3EZ2A 3L0OA 4K81B 3ZS9A 2QU8A 4I99A 3AVXA 5ANRB 4ARZB 1ZC3A 1WBBA 2O8BA 1D9XA 3WXMA 3FMPB 1VYVA 1W4CA 4XD7D 4EAQA 2EFHB 3THYA 4Q48A 3ETLA 2NO0A 1XCPA 1GO2A 3QUSA 2XOKA 2A78A 5DI3A 1GKIA 3OIYA 4NHOA 4PPQA 4M1MA 5AJWA 4RD0A 1E2IA 4YDSA 5KOYA 5SZKB 1FNNA 1ZW6A 2QDXA 2J0SA 1XJQA 1E64A 1IB0A 4Q4HA 1J2JA 3BH6A 1U90A 3GJ8A 3BWDD 4PAQA 1CKEA 4TTRA 2QMHA 1YZKA 3E1YE 5FL3A 1FUKA 2QQEA 3PUVA 1XB2A 4DT1A 3J81k 1U99A 3EA0A 4RD3A 1P2SA 1U9IC 2OAQ1 4MRPA 2ZRMA 4BZXA 2YHSA 1OXSC 3SBEA 2NOAA 4KODA 1Z5ZA
chains in the Genus database with same CATH superfamily
5BMOA 2ZIWB 4Q6BA 4F4UA 1FW8A 4W1PA 5EIXA 1EBBA 1IN5A 3NWOA 4Z99A 3WQRA 1J8YF 4W9NC 2ACKA 4WFKA 4LBZA 3R75A 1MQAA 3ER9A 2UYYA 3HR4A 5ALHA 4H31A 1COWD 4IXTA 3GMSA 3LQYA 2GKGA 2YHUA 3HB4X 1M1UA 3G5TA 4QTTB 4MW2A 3BERA 5D5QA 2I2AA 3PFFA 5B6IA 1LNSA 2GK4A 2P0EA 5CTAA 1CE8A 3VU9A 3A37A 5G4KA 2NMVA 2VQSA 4JVLA 4G3XA 5HKAA 4WACA 1MP0A 4H15A 5ALLA 4L27A 4RHXA 2REBA 1K3UB 1MO6A 3FVWA 1NUTA 4F45A 2ODEA 5AJHA 3KB8A 1L4YA 2MYNA 4HSGA 1KWKA 5E6SB 5GIOE 5G1NA 1J5PA 3IERA 5D6NA 5DJ5A 3TEMA 1ZM3A 3H2IA 4B3GA 4CDNA 5AW1A 2VTDA 4L8LA 4ZC8A 2C0QA 4UXIA 2WC1A 5FULA 3LBIA 1Z15A 2B1GA 4BX8A 5AD1A 1OASA 1TKCA 4RJIA 5CCBA 5CLJA 2ENWA 1CD5A 2WUFA 3JVIA 3HL4A 3LDGA 3AUYA 4DM3A 1LW6E 4J29A 1CX9B 3HUFA 4LCEA 5B1SA 4HYEA 3T1NA 1NW8A 4XWWA 4P7BA 5CTJA 4LE1A 2PGAA 4GE3A 4JUIA 3E5NA 3PEYA 5GONA 3OT1B 1S2LA 2Z2JA 2V58A 1T5HX 3SQNA 2LRHA 1ZY2A 4ZOAA 3I01A 1N78A 3HH8A 3ZG6A 3KJGA 3U4GA 3W77A 3LVFO 1OC2A 1EK6A 1JQJC 1YR3A 2Q8PA 2QRUA 3MD0A 1CRZA 5TV2A 2OCDA 2VJDA 3SXUB 2QX4A 4CFSA 1OLXA 1Q22A 1U9IA 2IXDA 2P3MA 4LCBA 4OP1A 4RF2A 3MJ4A 3QLTA 3V1UA 3ZDDA 1USGA 2H11A 3NBUA 1N2ZA 1R50A 4KPUA 4UD6A 4XQEA 4D0RA 2P2ZA 4RZ3A 4OOEA 2EF0A 5ER6A 4KSBA 4BKOA 4MR7A 2F00A 4Z9FA 1DINA 1MAAA 4DZRA 1VL5A 1HDIA 2Y4NA 1J5EB 2R8YA 1ZGCA 1GSAA 2QTAA 3GY0A 2YHAA 3INNA 1WPXA 4LK3A 3H3JA 3NCHA 5AK3A 3DD1A 4E0FA 4ZEMA 5BR8B 4C0SA 2KI5A 1LVGA 1ZITA 4IJVA 1N2CA 3WL8A 5KYUA 1XA4A 2ATIA 2KJQA 5HFJA 2CV0A 2HHHB 4PZPA 1UWCA 1M8PA 1KFJB 1RJFA 3HJTA 1W1IA 3MWJA 4C4TA 3MGCA 3I6BA 4REOA 2VYNA 2FLWA 4PZEA 5CLLA 3ASSA 1TB4A 4EF4A 4FZVA 3LQ2A 4J1TA 3DE0X 3IHTA 4MVYA 5EJAA 4BLQA 4ZDKA 3DB2A 3GLKA 5JALA 2COEA 1BJRE 2WU3A 3M6UA 3P2KA 3BD8A 4B43A 1ODTC 2QQ5A 3ECSA 1FJXA 3WICA 2BDEA 1GCUA 3HZHA 2GH1A 2YQZA 4MZXA 3OUUA 4QDKA 4PZ9A 3SFZA 3VYUB 5JSFA 3FTQA 1UZAA 3WRYA 1BE1A 2ZI4A 4H6WA 3ABRB 1R0SA 4HUQA 4BEJA 1W9MA 6GPBA 3DMGA 4LF5B 3GP8A 5KYKA 1FTGA 1ZMBA 2INGX 3AKZA 5EJ5A 3MCVA 5DW0A 2QIPA 3VYWA 2QTTA 5BWOA 5E6TA 1CZKA 4G97A 2V7QD 5I7VA 1O3YA 3UMCA 2AK3A 2PIAA 3AXSA 3DGFC 4RTSA 1FQWA 3QFCA 2WM9B 3I09A 3HLYA 1EWYA 3CZ4A 3LJKA 4WXEA 4YJDA 1Q0UA 3BMOB 4OKIA 3KKLA 4RVGA 5TB5A 1MTOA 4FFBB 5CH3A 2ZUVA 2D00A 1AQIA 2XUKA 2ZYWX 5LDDC 1LX6A 1YT5A 2QR3A 3U44B 5KB3A 5GOZA 1U94A 5C37A 2E89A 2FW7A 3RAEC 2JATA 1PG0A 1V8PA 2NZXA 4RPCA 4HDRA 2W2PA 3OU7A 1S7GA 4U0JA 1E0KA 3GLUA 1HY3A 2C84A 4FZJA 2OXCA 4FR5A 3BZUA 5CGQB 1QK3A 2O7NA 1VI2A 2P9QA 3R3VA 1FP1D 2D1FA 3ISJA 1A7AA 3SSNA 4JX9A 2A1UB 2IW3A 3M0EA 1E69A 1RAGA 2Q7OE 3KETA 4WLEA 1TO1E 2Z5GA 1UC5B 1VHOA 3ZNPA 4BNKA 5KHOC 4M2LA 2R6CA 2ZIFA 5MFZA 1KK2A 2ZS7A 3T56B 3DMPA 3PVZA 2XMZA 5CAEB 1OZGA 3GNTA 4IIXA 4NAHA 3U3KA 3E8MA 1NURA 5IJWA 1H1LB 2JD0A 2HRDA 3BK2A 1C9DB 4TM7A 2PMEA 1RXUA 3TMYA 4DWOA 3OBIA 5ESXA 3QX9A 5AKEA 5TY0A 1S2DA 2IYEA 2MSDB 1TM3E 3R0QA 2PCLA 3WK4A 1S4MA 5HXAA 1H8HD 4X6XA 3TNFA 2FPWA 2WD9A 3OOEA 3P2MA 3WGTA 5A6SB 4KBYA 4M49A 4ANFA 2DFPA 2WVGA 4DDTA 1EIWA 1JDBC 1EVQA 3R6WA 4WESA 1P7YA 2ZYGA 3R7DA 1L5NA 1PV2A 4JYMA 5TS2A 5I4KA 2VBSA 2B94A 3V4ZA 2IZ7A 1BFUA 1LDNA 3LF2A 1VQ6B 3QPAA 2PWZA 2VHQA 3FZNA 5CYGA 1VSUA 5IF9A 1SXPA 4D4MA 2VTKA 3ZY4A 2G07A 1Q50A 2GWHA 4TLMB 1GGHA 3E18A 1JVBA 4P5PA 3WFIA 1U63A 1BKDR 4D8UA 2ZZMA 2NTVA 4V0LA 3I6IA 3PQ7A 4JNKA 5JDCC 4UDNA 3RS7A 3TSZA 1U5CA 5ES4B 4MUHA 4XJSA 3EUWA 1NY6A 3DUWA 4URWR 2ZU6A 4DOMA 1TQ4A 4EITA 3RYCA 4HHEA 4CU5A 5EKXA 3CPHA 3T7SA 4B4DA 1LBQA 3A2NA 4ITVA 3SVTA 4LXTA 2P3LA 4GEKA 4MPDA 3QVSA 3UJ9A 4AMUA 5EKSA 3NATA 3UNXA 1JEYA 4E03A 3JVUA 2ZPTX 1MA0A 3VDMA 4L3VA 4ZYVA 1NUQA 3MWLA 1JAXA 4QDOA 1L8AA 4L15A 2F1RA 3DQQA 4HAZA 4NENA 5IVDA 2VZ9A 1GPUA 1K8AD 4ZJUA 5CGZA 1LLUA 1FNSA 5BQXA 1OC4A 4BC1A 4N76A 3C1AA 2YZNA 4CQLB 4MDFA 3S44A 3RK4A 1H42A 2ZI5A 1QJ4A 1BZYA 2XWJI 4MIOA 4P82A 5HG0A 1F9AA 1AU9A 2QE7A 4R2IA 4JI8B 4G4SP 4AF6A 2OXIA 4JBLA 4D6YA 3BJMA 3LL7A 5ESRA 3S5JA 4BO1A 4UUMA 1ZVVA 2D5IA 2IHNA 4OI4A 1MNAA 2HUPA 4LZLA 4MQEA 1OWLA 1C9NA 1LVUA 1XVVA 2OY0A 3VHLB 3IQGX 3R41A 3T15A 4C22A 1J39A 2Q4OA 4OQXA 1I4DD 3K8OE 3KFLA 4JHLA 1LI4A 2FK8A 2QGZA 3BM5A 4MXDA 4ND5A 4NR0A 4RYDA 4W5WA 2XY4A 4UBMA 1UQTA 1WBJB 1KEWA 1FP6A 3OQPA 2Q9CA 4ZZ2A 2JIRA 4YTEA 2AKEA 4YC7A 4WL0A 2HSEA 2ZM6B 5DGDA 2Q9UA 4RMIA 3FCXA 5D5HA 2FSSA 3RASA 2XVAA 3ZZMA 3NKLA 5AW9A 1EBUA 3BGIA 3A6EA 2I0FA 4FHGA 4NBRA 5BSVA 3KJXA 3NXSA 2EP8A 5EQFA 1U2SA 2JGJA 4GRDA 3RGGA 3EQ6A 4CMJA 1ZBDA 1H1DA 2A9OA 3I9MA 3JATA 4QC2A 5EN4A 3BC9A 5DHAA 3S70A 1GTMA 1G8FA 3GLHE 4PSKA 5LOVA 3UJ7A 4LTNA 3HYRA 4AG3A 5DTJA 3VZRA 4EMTA 4JP2A 3GJTA 1KRWA 4DDWA 2QSJA 1JG6A 2F8MA 5K03A 3H4MA 2XDAA 1N2EA 2W6QA 3KYIB 4FWIB 1A5BB 1KQOA 1B0PA 4QZVA 4IEIA 3HE3A 5FPKA 1UJNA 1WOYA 3A3BA 3LRPA 4O2BB 4HDMA 4JGIA 3DWFA 2VQFB 1EVYA 4FK8A 1QFJA 3BS4A 1IIRA 4X5OA 1Y5NA 3DC2A 3QW4B 4HLUA 4NJMB 3ZK8A 4C4RA 3P1JA 3H2SA 3DFZA 1KOFA 3HN7A 3KXDA 3PSHA 1Q0PA 1G5PA 4LPKA 1IAVA 3VSDA 1Y98A 3C7KA 3AOEA 5HF8A 4DEXA 4CM6A 1TQ2A 4YUAA 3IBTA 2ZUDA 3UFXB 2YNMD 4D8WA 4Q7MB 4P86A 1Q1BA 2XZLA 2ORED 1Y82A 3BWCA 3E58A 3PNYA 4IMIB 4NBWA 2O0HA 3SSOA 2EZ8A 3N2LA 2DKNA 4R9SA 4ZTUB 2ZB8A 4KXQA 3RQSA 4R2MA 2D0IA 5TT1A 2YJ5A 5ULLA 1NJGA 1KPHA 5IBPA 2DBZA 2XEDA 2Y4OA 4OVKA 2VUUA 3DFUA 3UAZA 2W9XA 2GYVA 4NZOA 3S4YA 3UC9A 4UTVA 5JNTA 2PLRA 4X41A 4D9EA 3ORSA 1X8LA 4ZGNB 2DYKA 2D0PB 1RABA 2XUOA 1KI1A 1YA4A 5JHHB 5L3SB 4UUQA 5IK2A 5D3QA 3TQFA 1PNQA 3F90A 2VT2A 4YRBA 4IQ8A 4KWIA 4QAQA 2OUKA 5GVSA 1WXQA 4WK6A 2H7YA 3S3TA 2ADOA 1UJ5A 1YCDA 1E5LA 3QLVC 5CRIA 3W05A 1VMDA 3CV3A 3ZBPA 5AM1A 4ZPXA 3MJFA 5CH5A 3LTNC 4JGGA 5J63A 2AOXA 4RJLA 3RUAA 1TTQB 4CKWB 3WWDA 2XUHA 3MCWA 4UMDA 1AUVA 1CERA 1J5XA 1J00A 2P6OA 3LW8A 4PYOA 2V3WA 3TW6A 1HM5A 3TZHA 5BSYA 1GG8A 1JX6A 4IH4A 1KMQA 5FEMA 4UZUA 1GD1O 2AJCA 3IYLW 2YNMC 4G5OA 1R5JA 2AX4A 2O7QA 2PUJA 2QW8A 4NEQA 2RGAA 2V6FA 5CCXA 2PLWA 4C4ZA 4N3AA 3T0IA 1X7XB 3UOWA 2G25A 4RELA 2DP4E 3ZKAA 3PNKA 2E4XA 4G0YA 4ZVQA 2GZSA 3K94A 5TEVA 2WZPP 1JEAA 2YY6A 3C48A 4M1OA 1NW7A 4BX3A 4D8VA 1MR3F 2QP4A 5JECA 4PLPA 2IHKA 4K05A 3U7FB 1R88A 2DH5A 2RHJA 4MR8A 1V0FA 2ACEA 4PNHA 3I9KA 1N8RD 3NHZA 1R8YA 5JCXA 3QVGB 2I1WA 4WWHA 1D2RA 3AM4A 3ANMA 1ULSA 1OVMA 2C58A 3HA3A 4FSHA 2RKWA 4L3WA 5CX1A 5AKLA 5JO9A 4WBNF 1VG9B 5ICCA 3I4LA 4DGQA 5IVKA 1GVNB 1T9CA 4OEHA 1RBMA 1T36B 5BV2P 2F4VB 1NI4A 2XGOA 4RNDB 5EWLA 1A1VA 2OMEA 1Y6FA 1M0TA 4LV5B 4YYZA 5D86A 2VUSA 3EF0A 3NT5A 3OCZA 2C5BA 5JYBA 4LJRA 4ND1A 4TKOB 1QP0A 2P35A 2Y0EA 1CEYA 1NI3A 1Q11A 2PUEA 1JKIA 2RHDA 3PVSA 4YY3B 4RQTA 3X43A 4JNCA 4EKDA 4RULA 4GZ3A 3BAFA 1DU4A 2J6HA 1S7CA 1Z8NA 4MTLA 3GRAA 1F0NA 4FDAA 2H5LA 3WK5A 4CIWA 3QTBA 2CZGA 1D6MA 2XBUA 4ZHQB 5J23A 5IYRA 2MINB 2VWGA 5AVVA 3LPDA 4LNUA 4V03A 3BCRA 3AZQA 4WZBE 5CYFA 2HBRA 5FKJA 3SFVA 4DBLC 1BQEA 2IKSA 3O2NA 4L7QA 3F5QA 4LDJA 3GVLA 1HYBA 2ID8A 2V03A 2WKRA 4QXOA 1TCAA 4P4NA 4NQZA 4EPYA 3W5AA 1H3EA 1TADA 1V39A 3KHUA 1XN4A 4X84A 4UTPA 2Y0DA 2ZWVA 3QYFA 1VKRA 2PBRA 3QX7A 1JQKA 1W2WB 2VRCD 2O14A 3ORHA 5EHQA 3HO1A 4I7EA 1OFIA 4CEHA 1MEJA 1WMFA 2ZR0A 1U9ZA 1M1XB 5I7SA 1Z2DA 4GM1A 1FCJA 1Z6TA 4C0LA 4A36A 2OHHA 5BSUA 5IAOA 1Z5UA 2WQZA 1KJYA 1T8RA 1Q5PA 2RGGA 3L8MA 4G5HA 4HDSB 3WISA 2EKBA 3ETJA 5D8DA 2WJGA 2P8JA 3UKOA 4G6ZA 4QFBA 4ZT5A 3UUEA 5EMKA 4M0PA 3UXHA 3L7JA 4BGUA 1OIWA 2GZ3A 3IKMB 4IJ5A 1L5QA 1Z2OX 3GHHA 1ODLA 4UBIA 5HK9A 1OKKD 3M33A 4I5FA 5IAJA 4EJSA 3BILA 3EZLA 2I80A 3O84A 4F4FA 5F9MA 1VG0B 4QOEA 5CD1A 1PT6A 3OOCA 2OC4A 5DEIA 5I7HA 1V5VA 3MWGA 3OZ7A 1KJZA 5H9WA 3V55A 4G2NA 4I1YA 1GRVA 1XAHA 1RZVA 2VAWA 3ZHRA 1CF9A 3N6VA 1VHLA 3PR1A 4J4BA 3I56B 4GQNA 4LE0A 4MZDA 4MW7A 5BN1A 3ILYA 1GAQA 3W2GA 3ZD7A 5FADA 3Q6RA 4P2NA 2GD2A 4JT4A 1OFTA 1T0JB 2HYDA 4ODIA 4TV8A 3HDTA 4ZIRB 1QGZA 2AGVA 3NDIA 3L6EA 2GPAA 4DR5B 2XF8A 3QG5A 1F6DA 2WJHA 4B46A 1H6DA 2WFLB 4UNIA 2ECFA 2C7PA 3O3CA 2VHYA 4V0RA 3B5EA 4YJ3B 5ALMA 2IDZA 5BUCA 1Q0TA 1K1EA 1MJGA 5KQLA 3RIHA 2ZJAA 3KYCA 1FX0B 4JT8A 4M60A 3U3DA 1K27A 2WYIA 4QXAA 1WMEA 1KHHA 4L76A 1AXGA 1M5UA 1VHEA 4Z49A 1WOOA 2Y1EA 2WD8A 5HZHA 1QPZA 4RMNA 5DTIA 1GOTA 1HMYA 3FSGD 2C2KA 2Q99A 1OFUA 1C30A 4EB6A 1STOA 4HGPA 4IJUA 4BB5A 4DDKA 1HH4A 4PBSA 4DILA 3QY9A 1KXZA 2Q3MA 3DDNA 3KTAB 4LYGA 3T4XA 3J80A 2WJVA 3CMMA 3EIEA 2C2GA 3JZMA 2A6PA 1PJ5A 1GTZA 3HRHA 2VYCA 4LF4B 3UT6A 4ETIA 4ENUA 4RD6A 1XWWA 1KJWA 1U5BB 5DLYA 3G79A 1Z3CA 1Q7RA 1K89A 3B53X 4N5MA 3M5WA 1JMKC 2VP2A 1JE1A 2P8SA 4PAMA 5LZ5A 1KMHB 2P9EA 1SOUA 4PYLA 4H7DA 5D7BA 1KIFA 3GELA 5F52A 2P69A 1ORWA 2FLKA 3ICOA 4CXMA 1IK4A 2G06A 4MVWA 1P7PA 4UVIA 1JJVA 3VTZA 3VZQA 4YHHB 4I8XA 2GZMA 3GCXA 4FDVA 3ZCSA 4C6RA 3ZGZA 3HBNA 3FG9A 2D1RA 1J20A 1PL0A 3AR8A 2V65A 3JSAA 4FIDA 2COUA 2Y1CA 1XZDA 3K8YA 4P3KA 3I5YA 1L8OA 1QSGA 2MSWA 3LXMA 1F7UA 1LLCA 3W1WA 1G3MA 1DWUA 1HBJA 1KYVA 2IEBA 1I18A 4QNMA 1V5EA 4TKZA 5AXBA 3MA0A 3FPSA 4RC9A 3PLNA 2O48X 2R00C 2IT1A 5D6OA 2XDYA 1RWMA 1FQKA 4RJTA 1A2OA 2XBLA 2YRXA 4CL8A 2FR8A 4F2GA 4RE6A 5K20A 3CUVA 4Y2GA 2OGSA 1MENA 2J9GA 5IJ9A 2XVYA 4E15A 3IBFA 1X39A 1HDYA 1SHKA 3AUTA 1K66A 3Q38A 3GFSA 4II3A 2IX3A 2X6WA 1M1NB 5ENZA 2R5WA 1A96A 2Y2UA 4R40A 3K0AA 1GDHA 2FR1A 1K7FB 1IWOA 1JG1A 1HO3A 3QEOA 2JRLA 2AF3C 3Q9SA 5I9BA 2TS1A 1O95C 5CP8A 3SJPA 4HTFA 2V5AA 2WJWA 3KUKA 3CBQA 3RSQA 1J70A 3NTQA 2H18A 2XWSA 2G4VA 3BL8A 3N8IA 2E1BA 4DCCA 4D5GA 1BWSA 1RQGA 2JA1A 3A10A 3FYSA 3EMBA 4YMIA 4F8EA 1NYRA 1Y48E 1D1SA 2YHIA 1XK7A 2H17A 1VJ1A 1PHPA 1TCUA 4G25A 3AX6A 5JWHA 4GU5A 3UT0A 3A4IA 1EX6A 1JGTA 3C14C 3OHMA 4XCVA 1WTAA 1QFYA 3E3MA 2CE7A 3MB5A 3UUGA 4DLLA 1RPJA 4M9XA 3I45A 1UOEA 4X7BA 2VF4X 2X9GA 1USUA 2IOQA 2OWEA 1GQ2A 2FRDA 2HYIC 4IKEA 5GZ3A 5J4KA 3RC1A 2EKPA 3N8HA 2H1SA 3PJFA 4RK7A 2B78A 4GBJA 4TUYA 1M76A 5BMVB 3TEJA 5JZMA 2AJLI 4K6KA 4E13A 3PP8A 4FB5A 1CS4C 4MDEA 3R44A 2NO4A 2J6IA 4C04A 1I3MA 1M6EX 1LWNA 3CUYA 4C1NA 2M9MA 2D2VA 1SUBA 2FW1A 4NTZA 2OBRA 2JLBA 121PA 3KXKA 4EF6A 5I9LA 3OIFA 4X00A 1DXYA 5FYQA 3LUBA 4GX2A 4R1PA 1YJAA 2VYND 3GOQA 4OG2A 3TQIA 2IH2A 2WAYA 3R6KA 3EXAA 5JH7A 1SM4A 4M46A 3ORYA 1W36B 4U7JA 4EHFA 4IPTA 4CEIA 3RHZA 3IQIX 1LLFA 2WYOA 1WCWA 5C1DA 2P4SA 3SOZA 1QIEA 3PLAE 5KNDA 2DX7A 3AF3A 3P9CA 3ZDXB 1U0TA 3RUCA 1XRSB 1SBNE 4JLUA 1BJKA 1C8VB 4G1CA 4OI1A 1FIUA 1ZAYA 1JLLA 3C4VA 3QEJA 4JBWA 1WPCA 3WGMA 4W6ZA 3R8FA 5I3ZA 4WE3A 1WE2A 3BQMB 1W44A 3DB1A 2HSDA 3D4PA 4NZYA 4CDMA 4EPRA 3FPBA 3R7LA 1TNDA 1ZZGA 3W6OA 5MHTA 3FCAA 1TJ5A 2HQBA 2XOXA 1WZCA 2VDOB 2ZJ1A 4RMJA 4NCBA 3N0WA 2R79A 3QJYA 4A0HA 4B31A 1RRCA 3B1KA 2HSWA 4BGEA 1DKPA 4A6DA 2JZOA 1UBLS 2ZRCA 1KY4A 3OCXA 3BE5A 3C5VA 1GPJA 2JHGA 2Q5QA 3IV7A 4S12A 4B3FX 1SC4A 2WT4A 4A16A 4XSGA 3D8UA 4QTXA 2FFBA 1PQ4A 1POXA 1S0UA 5LLSA 1J56A 2XTZA 3JQFC 3T7JA 1S8AA 4P4SB 4DMCA 3NUGA 1FYDA 1J2UA 3D3KA 5IUKC 1R9NA 1XI2A 1FB5A 4NMXB 1PFGA 4R3NA 4CKCB 4QM6A 5A7FA 3QFRA 2AA3A 4Y6LA 2CB0A 2JHAA 2CXUA 1K6IA 1L4MA 2HF7A 3CVOA 3FOFC 5EJMA 4Z4FA 5DGIA 3TLEA 3RSSA 1ISPA 3TTUA 1ISIA 4CWAA 1RZRA 1DQPA 2SKDA 3ONDA 5FP0A 5AESA 1UADA 3AY6A 4ZT4A 1MORA 1BX3A 4B71A 1HETA 1AQLA 4UDXX 2XNDA 1GV0A 4RA9A 3BFJA 4HK4A 1XG5A 2I2CA 2FVYA 2GNPA 4ZOQI 1I7QB 1LRJA 3EH2A 2QP9X 1JDJA 3WA7A 4RVDA 5AM2A 4ARIA 4R2JA 2FOLA 4M8LA 3K35A 1H94A 4FB4A 3F73A 3F3MA 1OTYA 5IHPA 3DMYA 3EGOA 2GD0A 5DKFA 2VATA 4DMUB 1Y7HA 5HE8A 4RXUA 1QIFA 1XDUA 1SHJA 1UR5A 2VDRB 3CUUA 1CTQA 1UMDB 4QOGA 5TEWA 2PX2A 1PR5A 2ENUA 3KU4A 4Y9DA 1KDZA 1E58A 1B0ZA 4CKEA 1NZFA 5IKEA 3B2QA 5TNXA 1UKAA 4R1OA 2BFCA 1NF2A 1XU7A 3HP4A 4DDMA 2ZYTX 3E3NA 3DFKA 4P5EA 3V7NA 3F2VA 3KLMX 4MW5A 3Q7QA 3LOPA 3ADKA 4L0QA 3RT1A 4B45A 2V6BA 3A1WA 1IQ0A 1QK5A 4WK4B 2LGJA 4GZ5A 2XTJA 3DWIA 3D59A 1UWKA 1ZUD1 1IOVA 1DOAA 1E2EA 2BMEA 2H2FA 2Q62A 2H4FA 2H4YA 1K9SA 3NDBB 1Q1GA 3QZUA 3UW3A 5K8UA 2Q46A 5EIBC 3GP5A 1Q95A 1D0VA 3UHPA 3QE9Y 4E46A 4R0MA 1MB2A 2NXNA 3WGLA 3L4BC 5GIPE 5HDQA 3F4LA 3NHFA 3ID6C 4Q3CA 1OYWA 2B5WA 2Y8EA 1NRJB 4AYXA 2FX3A 5D1HA 3WDSA 3DM9B 1HKUA 1O5IA 3DC7A 4C7VA 3OFJA 3DDYA 2VR1A 3QYPA 4YROA 2HIHA 3P2JA 4UQPA 3BTOA 3U31A 3COWA 3NM6B 4WUTA 5FR2A 2NZ2A 2LKDA 1JPUA 2W2XA 4KMRA 3QUBA 4AI6A 1XXHA 3AF2A 3FAKA 4DAEA 3D6AA 1UCFA 2Z5FA 4R8RA 5BYAA 4N41A 5A5DA 2BUAA 1AXRA 4KW7A 3LMKA 5JRZA 4NRDA 4JYPA 2JFQA 1DAMA 1RJWA 2QE7D 3LF1A 5LBTA 4BMNA 3DVQX 4KOEC 5U1PA 3GR6A 4IHKA 2XECA 3EK2A 1PFKA 4Y2QA 3ROZA 1W46A 1YKSA 1QX3A 1YQEA 2ZTVA 2UZ0A 3H18A 4EGFA 2Z9BA 3RFTA 2WKPA 3O0TA 3N39C 2BH2A 1AY0A 3FWPA 3V7YA 5KJFA 1XIVA 4OQPA 4PO1A 1W36C 2GCIA 4A8PA 4C0KA 1KEEB 4II2A 1NU8A 4FD3A 3PNSA 3EXHC 4C0HA 3O9MA 5KTNA 1TJ3A 2I3ZA 2C20A 4JLPA 3FHCB 4JK3A 4O33A 1QCYA 4J9UE 4YI5A 2GPTA 3ZD8A 3ML1A 5CLHA 1QIKA 4JB8A 3RLFA 1TM5E 3MOSA 1PTKA 4X06A 2FGJA 2ZJ7A 1OE0A 1JSRA 1K28D 1Q3TA 1UWVA 1W9HA 1XA0A 3VO1A 2VP4A 1JTVA 1KFBB 1KY5A 1YQQA 1NDHA 1EGVB 2X8BA 5ERGB 1JJBA 4X6YA 2FSVC 4G1BA 5I8ZA 4C5CA 3NYRA 1VP9A 2G1AA 3LUGA 1RM4A 2OLJA 4CLDA 4DQ0A 1XMOB 1KZYC 3ESAA 1Y9JA 1GRQA 1PNOA 3A1UA 3RK0A 4C7BA 4EQ6B 2EWMA 3BGOS 1XO1A 4HVLA 3OOJA 2ZSUA 8ABPA 2GRJA 1XP5A 3PJRA 4ND4A 2IHUA 3JWIA 4DVJA 2GJPA 1PX2A 2BJVA 4OFBA 4KKXB 3S2ZA 3MOIA 5TMPA 1Y3AA 1CSEE 3CEPB 2O8DB 3W5UA 3C6MA 5LMCA 4U2FA 1GNTA 3VDNB 1VDZA 1CULC 2ZJFA 1XRNA 5AIAA 2ZIZA 1RI4A 4HADA 4BAZA 3RSHA 4JJZA 3OAAA 5AFSA 1D04A 1AGPA 4IDPA 3USZA 3IP3A 2PSJA 4DDHA 3E23A 4CM4B 4IJKA 1NPDA 1T1JA 1BW9A 3AFIA 5AHKA 3I01M 621PA 1MBZA 4RGBA 1A50B 1RLTA 4ER7A 3OE7A 4OMUA 1OR8A 1QZXA 2ZIXB 4O5AA 4JOBA 2HMAA 3RJTA 4B79A 4EZBA 1WUIS 5CT5A 3OSZA 2TMKA 4HEA6 4OHPA 1HLDA 3C70A 1HX7A 1VQ1A 3LSTA 2VSOA 2QRNA 4I9HA 4D3FA 1CUAA 2QPAA 1KAGA 3U7HB 4Q47A 4L6IA 5H82A 4FC7A 3BFKA 5DE3A 2B8TA 1INLA 1KI8A 1ORDA 4BQOA 4DSZA 3V8RA 2CVHA 1TF5A 3ON5A 5K0TA 2MSEB 3DEKA 4N49A 3SKXA 1E2LA 2OAEA 1PVDA 4MCJA 1GDDA 2RJOA 2VZ0A 1YK1A 3EDCA 4RLQA 4TKMA 3RYHB 4TKUB 3T5BA 3RIMA 4NYJQ 4A15A 3VR6H 5EXEA 5BN5A 1X3SA 4O2RA 1Q91A 5LJLA 2R44A 4HMOA 3SVLA 5IK2D 1C1XA 3KQSA 3JVDA 4HAXA 4POOA 1CZNA 1ENPA 3V34A 4DJFC 4XDGA 3JQGB 3FMOB 3P0FA 1FLVA 3CCRB 3SF8B 4UU8A 1P3DA 4WGFA 4B6JA 1AOXA 3KZVA 4NS4A 5K0FA 4KITB 1DIOB 1AK1A 4ICIA 1J1UA 2GFHA 1Q1ZA 4LE2A 3HPRA 4JY7A 4HWRA 5B55A 3OZIA 4HLUC 4JEHA 3GVPA 1G7CA 5FI5A 1UBFA 5I3CA 1LBSA 1MOPA 4O25A 1KDOA 3WX0A 3DT6A 3QUAA 4ASUA 5F78A 3P2OA 1UF9A 5AQ1A 3GEDA 4X8MA 5B7GA 3CC7B 1IOZA 1X1BA 2ZSBA 4HBZA 5J4VA 3WIOA 2DZDA 4K86A 1U7OA 4URFA 5AVSA 4MS3B 1FLNA 2BZGA 4JQYA 3U3OA 3H04A 2QM8A 4DK0A 1FUEA 4J7AA 4AO7A 1XEXB 3EBOA 1NN3A 2NN3C 2BDTA 1CY1A 1TLLA 2BCJQ 1M2KA 1T6NA 1XJ5A 5E6SA 5JAQA 4EK9A 5AVZA 5ESWA 4LX0A 5HZMA 2IBSA 1AV7A 2D3TA 3WRVA 4XARA 1Z07A 3GSIA 3QLUC 2RHLA 1XELA 3WLKX 2Q7XA 4BTVA 5CDSA 2IHYA 3L0SA 3L6CA 4Q3LA 3K5HA 2ZJ6A 1NMEA 4J16A 2Z8XA 2GDZA 1QQTA 1ZUIA 1UJ6A 2C98A 3CX6A 4PAWA 4MUKA 4J1SA 3WWEA 4CGYA 1SD5A 1EXVA 3ZGOA 2Q5CA 3GJXC 4I9UA 4M7OA 4E5UA 1RADA 3DWGA 3QVJA 1TGVA 2AWOA 2O05A 2YXDA 3RJZA 4N8DA 4BS9A 5HSGA 1E9FA 3OT1A 1DQYA 2OQRA 1XEAA 1ML3A 5FOUA 1PJBA 2O6LA 2DVMA 3CCSB 1QLWA 3IURA 4E5DA 1R0XA 3AUKA 3QF7A 1TT5A 1C5KA 3D81A 3KCNA 4GSLA 4JITA 4KFTA 3SE7A 4J07A 4EDFA 3CNLA 4NAVA 2GASA 2BHNA 2A9JA 3DDSA 3EZYA 3UMJA 2G6BA 2H92A 1NR7A 4Z0HO 1PJ4A 4IICA 3ENZA 5B12A 4DUZB 1TQDA 3TQSA 3DAHA 3IS3A 3W7VA 4KL8S 1Z0UA 3KAPA 5FD8A 4UVHA 1N9GB 4A8JB 3SIXA 2VUIB 4US1R 3DVLA 4INJA 2RGBA 4NU5A 3UMSA 2OB2A 4CV0A 1IZ0A 1VBFA 3TKYA 1Q1NA 5IMBA 3UMFA 4B87A 5L4NA 3AVWA 3BJIC 2R6AA 3JD3A 2QUBA 3IQHX 4AIIA 5IPFA 4QARA 5ECWA 1WP4A 1HSOA 1LPPA 3CZRA 4ZQCB 2DBVO 5EINA 1BIFA 2JIBA 2EJWA 2X0KA 4IZIA 5E9AA 4C05A 2Z57A 4ESOA 1CS0A 1CQIA 4M9CA 4O63O 3ELWA 4CPDA 1DBSA 3G0HA 1LPSA 2Z30A 3CA8A 2UVDA 4WOPA 3RRFA 2M6LA 2ZRAA 5LMUB 4O4JA 4RDLA 2Z6QA 1YXMA 2NYVA 3JYQA 4JB3A 1QANA 3CPEA 4A3SA 1C4KA 1J1IA 2ASVA 1MCZA 4MV8A 4B47A 3PQEA 2JAPA 1DADA 4DUPA 3T3GA 4EX7A 2PLFA 1Z7BA 2D0DA 1NSYA 3ST7A 3UV6A 3TIIA 3HADA 3NDRA 3PEEA 5HNKA 2O0MA 2VDUE 4EA6A 2HTFA 4M87A 4OLBA 3RSGA 3T4EA 2JAQA 3PC3A 1L7XA 4N6NA 1JMYA 1JBKA 1UIMA 1JNYA 3BMOA 1SVKA 2HHCA 4NSNA 4CM1A 1JPNA 5AK6A 3SJ7A 1KYQA 1ZEMA 4NG5A 4ERXA 4HX2A 1VJ0A 3U44A 3REFA 2HPVA 3KEMA 3L7NA 4EM6A 3PEUA 4EBFA 2X0NA 2BF4A 1YS9A 1VBKA 1XOIA 4FEYA 3BSWA 2V31A 4XQ0A 1U4NA 4ZQHA 4PCUA 4AM8A 4D4LA 3W5DA 4N54A 4G89A 2ZRKA 2MSCB 1O94A 3DXXA 1KE1A 1U3DA 1MAWA 1NMQA 1PTJA 2WPNA 1XLVA 2JGDB 3DWEX 3N2EA 4EAAA 4B5KA 2XLBA 3E3LA 2A1UA 3MSCA 1I8DA 3U4HA 2RGUA 2X5JO 1X7ZB 4N3NA 2BE7A 2AW3A 2RGXA 3NHKA 1CLUA 5IF3A 3IDOA 2HPAA 1OROA 4Z4EA 1PL7A 4Z1MA 2FSPA 5LDGA 5JBNA 4GDMA