4RD3A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gdp and pi
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 103
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd3A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd3A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd3A01
2E87A 2ANCA 2GK6A 4K8OA 5C18A 3U61B 721PA 4TLCA 3SS8A 2UZ3A 1AIPA 4WZAE 2J41A 4ZPXA 5JS7A 2QPAA 1T8TA 3B1ZA 3CC2B 2OZEA 2PEZA 4CEHB 3EZ6A 1E1RD 4IOKA 1M1KD 4CVNA 2Z83A 4QFMA 1FPMA 1PZNA 1SXJB 4LZZA 4KXFB 2JLSA 4P0TA 3VTKA 1I4TD 3LBNA 5E7IA 1KQSB 5HCIA 2QE7D 4ZIRB 1BO6A 2H8KA 2J9RA 2H16A 4UJ5A 5TVKA 3O8BA 4HLUA 2FFQA 3PIRA 1R0ZA 2BMEA 2J7PA 3KL4A 1BOFA 4MKIA 4TQUS 3TJZA 3TH5A 2QAGA 4NCIA 3CF0A 1AKYA 1UEIA 1ETUA 3IKJA 4IVRA 2QAGB 4MH0R 3TE6A 3EA5A 2QEXB 4FXPA 2VNHA 3CKLA 3SYKA 4D82A 1JPJA 1FL9A 4A8JA 1GDDA 1AQYA 1TL7C 3RANA 4D4JA 2ORIA 5CYPA 2QNRA 2PL3A 1I7PA 5L3SA 1V43A 4JJZA 3E20A 4XOIA 3OAAD 2D7DA 1RC8A 6Q21A 4NYJQ 1GKIA 3CNNA 2BOVA 2Q21A 2QRNA 1JB9A 3RS2A 2D74A 1VDZA 3TKLA 5IF9A 4IXMA 2VNIA 1XEXA 4MGIR 2FSIA 1Z63A 2J45A 3KJHA 1W0KD 3CMAB 4MGZR 1DELA 3B82A 1S72B 2B21A 2H57A 3A8TA 5HTKA 1KMHA 3MGCA 3NEYA 3W6PA 4EQ6A 4V02A 1ZM9A 3V4FA 2PLRA 1KMHB 4EQ6B 1BJKA 3NTUA 2J0UB 5EP2A 4IXNA 1XF9A 1OB5A 2QP9X 4LI0A 2OTLB 3GEIA 3CH4B 1Z2CA 1Q12A 3JVUA 4LCBA 4B76A 1EG7A 2GZHA 3ZLJA 3AVUA 3QKTA 1G1MA 3ADKA 4Q9JA 2ZXUA 4HLDA 4MGYR 5JCPA 3A1VA 1GVNB 4YONB 2CXXA 1QRAA 4JT4A 4OQXA 5JMTA 4XWAA 1EX7A 2ZRKA 3NBFA 4UXJA 3VKHA 5EP1A 2XNDA 5CDFE 4Z51A 1S1MA 4JLOA 5FOVA 2VEDA 1E0SA 3VR5A 4OI0A 1D2MA 3NH9A 3MLEA 4PPGA 3ZBUA 4H1UA 4FW9A 4P4SA 5FOSA 8OHMA 4FCTA 4OI4A 2ODWA 2GEDA 2BMFA 5GJBA 4NYJR 1FQJA 2B7BA 1IN6A 4GT1A 3U3KA 4AK9A 3SZRA 1E2PA 4Q4JA 1DVRA 1KSJA 1N5IA 2W6ID 1KI7A 4JL5A 2O8CA 2CE2X 3LAWA 5FOWA 2O8CB 5KPDA 4AIIA 3ZZUA 1OYYA 3FMOB 5FTKA 1XD2A 3REGA 1YKSA 1Z6XA 5CK4A 2DETA 2E9SA 2FZ4A 1KJYA 2NPIA 1WMSA 3CF2A 3BFVA 3FHOA 4US1R 4Q1DA 3LX5A 3NHBA 1E79D 1VQ4B 2JDID 4K1XA 3KQHA 1SXJC 4HE5A 5EE1A 3AVPA 4KFRA 1GKUB 2ZI9A 3L82B 3EPHA 1WQ1R 2REOA 2FOLA 1QH0A 3C4JA 3AP2A 4F7WA 3LX8A 2VYFA 1G9XA 1N6OA 2OE2A 1CEEA 5EZ5A 4KJZA 2VP9A 4EFLA 3W9YA 1X1SA 3K9HA 3QOFA 5JJIA 3D3QA 5J4YA 1R5NA 1RVDA 5DISB 1H65A 5DGXA 2NG1A 1YR8A 2F1IA 2G83A 3IILA 1E94E 1TX4B 1Z0KA 2AR7A 4M1WA 1VQ6B 2ZR9A 1T0HB 2P3SA 4ZI3A 4Q5IA 2PMKA 1MKYA 3TRFA 2BPOA 4DLWA 2R62A 4RD4A 5JBQA 3RC3A 2YWFA 3KB1A 3RS3A 1BX1A 3ZIAA 3K8YA 3C16C 3O47A 1P6XA 1B2RA 3CMEB 3ICQB 2C03A 1CJMA 2VA8A 2V8OA 2AK3A 1N0VC 5FOUA 2VQSA 5F3WB 1CRQA 4OYHA 3QVVA 4M1OA 4M9XA 1SHKA 1AN0A 1XCGB 1KZ7B 3CONA 5EE5B 5FBLB 4M4SA 4E07A 5JRJA 5TR9A 1UKZA 3THWA 4URVR 1BX0A 4NCJA 1U9IC 4UKDA 1XBTA 2OO7A 1PUIA 1VQ9B 1KDOA 4Q00A 3EC2A 2YC4C 2AKAB 2OFOA 1NSTA 3IO3A 3IHWA 5BXQC 1E1RA 4GZMA 2CL6X 2IYZA 3L43A 3IPXA 2VIIA 2IF2A 4HYYA 3WYGA 2CK3D 4M1KA 4QNRA 2ZRMA 3VU9B 1ZD8A 3K70C 2HV8A 4QM7A 2DR3A 1E3MA 1T9HA 4JZKA 3P20A 4OJQA 4FWIB 1AGRA 2RGDA 3LQQA 3SQXA 4B3XA 4JKIA 2BSAA 2XZPA 3TNFA 4M1SA 3TSWA 2FSHA 3BD9A 4MRRA 1FRNA 2WWFA 3PG5A 4MYCA 1ZU4A 4QBIA 1QG0A 4II7A 3OJWA 1FTNA 1NVUQ 3K0CA 1Z6AA 4B32A 4BLPA 4RZ3A 3VX3A 4ZCLA 3FDIA 2CJWB 4G5SA 4LJ8A 4P4TA 1W4CA 2ZEJA 1F2UA 2YWHA 1LS1A 4Q9HA 2AHOA 5B57C 2I1QA 2ZAMA 1QBKC 4F4CA 3L8ZA 3R20A 3PEVA 4D0GA 2IYTA 2YWGA 2I4IA 4EPRA 5D3MA 5LBIA 1OT3A 4YAFA 1II8B 1AS3A 2F1JA 5HKKA 3QPUA 3JQQA 3CCQB 5LB4A 1W0KA 1VYVA 4YMWA 1S96A 4DSTA 5DSZA 1UBFA 2G77B 4EFNA 1OIWA 2G6BA 1DG3A 3CRQA 3GLHB 2RGXA 4EUNA 1GIAA 5HZHA 1IJFA 4L9WA 3VR6A 2ZUBA 1EESA 3X2SA 4V0KA 2DBYA 4ASUA 3I4LA 3FOZA 3NG1A 4C43A 3M1IA 2A78A 1VMAA 4JLDA 5C2JB 4ACBA 3AP3A 2J46A 2JAQA 2MSEB 2J7KA 3LDAA 5EXTA 1NNEA 3QG1A 1AGPA 3HWSA 4JLKA 1Z3IX 3IDQA 4TLAA 4B4DA 3NBXX 1R8QA 1NMXA 3WHLA 2JLQA 1E0AA 4G1BA 3CF6R 1K8RA 2V7QD 4WA7A 2WIBA 3DO6A 1GVHA 3MJRA 3IEUA 4URZR 3T5GA 4HDQB 3R7WA 2JGNA 4CYMA 1BH2A 4DEYA 2ZVQX 4U02A 1DPFA 4A82A 3HYTA 1HURA 1M6NA 1XZPA 2O8FB 1J9ZA 1KNXA 2WSSA 1D2NA 1XD8A 1D1NA 1TQ2A 2P6UA 2QMHA 4JMPA 3AF4A 5GV7A 1D6JA 1U98A 5JWHA 4AYWA 3OW2B 2QTZA 1IBRA 2IYRA 2QUZA 3A4LA 2OLKA 3K0AA 4UXIA 4GDFA 1E9EA 1Q3HA 4UNQA 2Q3HA 4H1VA 1PV4A 4GFDA 2JLXA 3CO5A 2GBLA 2VP4A 1DDIA 4JLMA 4EPXA 4ZDJA 1K9MD 4RZ2A 2PX0A 1E2HA 4C0AC 3KKQA 1ZU5A 3I56B 3LFUA 4TTRA 1UDXA 2IYSA 1ZRHA 1G7RA 3F0TA 3NBYC 2GVZC 2GPJA 2A5YB 1QF9A 2ZYTX 4A1FA 3IQWA 2WPDD 2OTJB 1U0JA 3EAQA 2Q9AA 2MSCB 2PT7A 3BXZA 4WW0A 2W2VA 1ZAKA 5EQTA 3ZC3A 2X77A 1NN1A 2FGJA 3N2IA 4CT4B 4AKIA 2B8WA 1XJQA 4DLTA 1IN5A 3W2FA 1QFZA 5KSYA 4AWXA 2VO1A 2OUKA 3E5HA 3QNUA 1VQ5B 1JPNA 3ZVLA 2Y8EA 1UAAA 3W2EA 3K0FA 4LJ6A 1WCV1 3W6NA 2GWHA 2WHXA 3QEOA 1JAIA 3BIFA 2YJTD 1G18A 2KBFA 1XTIA 3DEFA 4DLVA 1KGDA 5JJLA 2IUSA 1C9KA 1GUAA 2WJHA 1SKQA 1E2DA 2JASA 2ZREA 3C5CA 3KJGA 1FNDA 2A9KA 2FEMA 2C99A 3U6KA 2BCJQ 4Y9RA 1KSGA 4BECA 5JCZA 3PEWA 2DERA 3CR8A 1KZGB 4RCZA 4HAXA 3FPKA 3CPWB 1P7CA 2NZ8A 2VP5A 1G5PA 1KI6B 2OFXA 4HATA 4CDGA 5A0FA 3KUCA 4PZZA 1ZM7A 1XDBA 2O8DA 5JI3E 5DN6D 4TMTA 2WKRA 4XWKA 3TUJC 1FP7A 3TR0A 4KHZA 2AN9A 3PQCA 2BN4A 2V1XA 2GQFA 4F4JA 2EFDB 1YZUA 3TQCA 3X1YA 1G6OA 3L0SA 4Q4HB 1SQ5A 4QNMA 4TWZA 1W36B 4RKFA 4U00A 4PAOA 2HLDD 1S9DA 2N46A 1BIFA 1JR3A 5BWMA 4LBVA 1Z2AA 1ZP6A 4B47A 1SKYB 2OESA 3ASZA 1A2BA 1HEIA 2FA9A 2YHSA 2EFCB 1X1RA 3FKSD 5DYGA 2CK3A 1RIFA 1DDGA 3FKQA 1BYIA 2GXQA 4Q1EA 2R6FA 2CVHA 2KB0A 1OJLA 2GNOA 2O52A 5JHGB 4RCYA 5G53C 4OBEA 4LBYA 4L16A 2ZAOA 4G1UC 5J40A 3TUIC 4UXHA 2D4HA 3EWSA 4D4KA 4KLNA 4A2PA 4AD8A 4AG6A 4NBSA 3GJ8A 4LC0A 4G5RA 3RRZA 2PZGA 3VR2A 2J5XA 4CIDA 3SYNA 3IQXA 4Z54A 3B1WA 1YZTA 4YQFA 1YI2B 4HZIA 1NVXQ 5F9HA 4DCUA 1D9ZA 2A5JA 5E7MA 4B71A 1BMFA 5CJ2A 5GJCA 4M9QA 4JBYA 3CCMB 4MRSA 1M7BA 5AJZA 4B34A 5BN4A 3GLFB 3B5JA 2FSFA 3GFTA 3GJ0A 4L15A 4IFBA 4FWTA 2BBSA 3JZAA 1FRQA 1G17A 3QBTA 3AF0A 3UMSA 3TW4A 3T5DA 1NBMD 2GJSA 2YC2C 1G291 1GWNA 3ZJYA 1Q0UA 1KO1A 3WNCA 3CCJB 2YV5A 1R8SA 3LQRA 1E9CA 1M90D 3MWKA 4DZZA 1VCMA 5EXPA 3U7GA 1N6HA 1P2SA 4C30A 4TYPA 3ZS8A 4TYYA 2Q3FA 1EX6A 1M7HA 4ITRC 4KAXA 3CX7A 3MCAA 3OESA 4Y0VA 4D4MA 2BJVA 4YMSA 4Q7LA 4MGKR 4M21A 2QTLA 1FMJA 2AXNA 1E1QA 1ZW6A 1E9DA 2OCBA 3OZXA 2J7PD 3O8CA 5IRCD 4FD2A 3JVVA 1SVKA 3A1UA 1U90A 3BOSA 3FPAA 3B8HA 4NYIR 3VFDA 1Z08A 1KYIA 2B6HA 3KDSE 1DAGA 1QGAA 2XJ4A 4QJ4A 3RSLA 1F3OA 1TAGA 3OFNA 4LYJA 1RZ3A 3CRZA 1ZYUA 5FPTA 2LKDA 2ASEA 2VHQA 3RSOA 2QBYB 4ERNA 1T5IA 2IEZA 4RFSA 4BRUA 2ZRNA 4GRAA 4NL4H 4DT1B 3UPUA 521PA 4QHSA 3GLIB 1PVOA 4RFSB 4Q9KA 1NMYA 1XPOA 2XNSA 2A7QA 5DE3A 3IIKA 2RCNA 4A92A 3MJHA 3O8RA 4A6XA 5KO2A 1OH5A 5H68A 3Q8XB 1KK3A 5KSPA 1UEJA 4LOAA 4BUJA 3K9LA 3WNBA 2RGNC 3R9IA 3OZVA 5EMNA 2X3UA 3AVVA 1UF9A 1NVWQ 4FINA 4V0NA 2V55B 2VHTA 1R7RA 1FZQA 5KNCA 1W36C 3AM1A 5L3QB 4MYUA 3BAFA 3DM5A 821PA 3W2IA 3BC1A 1TNDA 4A2QA 4OHWA 5CK5A 3HDTA 2OAP1 2W6JA 3I61A 4PC1A 3ZH9B 5G3YA 4FCVA 1MH1A 3EW9A 4ZKDA 4N0EA 2WPDA 1Q81D 3KQKA 4WOPA 5G40A 2WJGA 3BJIC 1G4UR 1Z0JA 2V4ZA 3EARA 4KSBA 1GL9B 3A4NA 4UJ3A 1N6RA 2NTYC 4YAUA 5FPHA 4PHTA 5DI3A 2IYXA 5CIWA 2JLWA 4O3MA 4EJSA 2BHRA 4CZ2A 5DI3B 2ANBA 2ZI5A 1DBSA 5THXA 4JL6A 4EJSB 4C2TA 3AEZA 4DDTA 1BYUA 2XXAB 1JB1A 2QTFA 4C2UA 3QXXA 4KFUA 5FBQB 1K6MA 4LDJA 1V5WA 2MSDB 3U2QA 1DO2A 2ZRFA 3TSZA 2JA1A 4D4LA 5JRZA 3CZPA 2OLJA 2QM8A 2FWRA 1UDWA 2KBEA 4LYFA 4R2HA 1T6NA 1CQXA 1OXUA 4Q21A 4A4DA 4EPYA 5K8TA 2CNWD 4IJMA 1YITB 2C95A 4TTPA 4E09A 4ILEA 1IXSB 2CLSA 3K0EA 1XMSA 4PO8A 5E4FA 5SZJA 1TADA 1X8JA 4OQFA 5C1BA 3X1ZA 5DLQC 4B3GA 1VQLB 2QP4A 4NCKA 2BM0A 5AN9A 2P0EA 3EPLA 1E4YA 2ZSEA 3A1TA 5FUXA 3GLGB 1KI8A 4Q9LA 2I3BA 2V54A 3QY0A 4D80A 4DB2A 2IS2A 3PJRA 3CCRB 2ZTSA 2DB3A 3VO1A 3WMEA 1M34E 2FSGA 1ZUHA 3OE7A 3QFCA 1UBCA 1NN0A 2G1JA 3FYHA 3P1JA 5AJYA 4PZYA 3Q72A 4FMCF 2L0XA 1W49A 1NF3A 4B2IA 4PAQA 5LB2A 2F6RA 2FN4A 4W9MC 1A4RA 1HY3A 2GXSA 2AKYA 3THXA 4BQSA 4PR0A 2WM9B 2C5LA 3H84A 1NLYA 1NL3A 3AB3A 2DHRA 3KXKA 1GKYA 5SZIA 5BN3A 1E9AA 4HUQA 4XJXA 2AD1A 2DY1A 4DHEA 4DLZA 1KRHA 2CHQA 3NC0C 5CB6A 1XCMA 4R98A 1CIPA 2CDNA 4UQOA 2VHJA 4PC2A 3L2OB 3LVQE 3VR1A 4DWJA 1KOFA 5JEDA 1E9FA 1G3UA 5JI2E 1YZNA 1KDRA 2NPFA 1WP9A 3MRSA 1AQUA 4S2EA 1TQ4A 2C9OA 3KXLA 2OEPA 3HR7A 3ONWA 1RKBA 4QHTA 2ODNA 3FTQA 3MG9A 3UK6A 3AUXA 1A2KC 2BMWA 1J8MF 2FFAA 3WYAA 4LWZA 3ZIAD 5BN5A 3OEHA 1VPLA 4ZGNB 4D81A 1N5JA 1JQJC 1HQYE 2F43A 1Z0DA 1QUEA 4IVPA 2EWWA 2IC5A 3DKVA 3MWLA 2ZU6A 4GOJA 2FPLA 1U8YA 2A3RA 3ICEA 2ZRBA 3CRMA 1M7GA 3I1FA 3UKDA 5GVSA 3CWZA 2ZJYA 4LV5B 3B13B 4BZQA 3LH5A 2WKQA 3PUXA 1ZNZA 4PZLA 2B92A 3LW8A 4JLPA 1SVOA 5J5CA 2D2EA 4EDHA 1VTKA 2JJ1A 4GZLA 2ZM5A 4XVUA 2OBLA 3CD6B 5DH9A 4NTZA 5CDFA 4MQBA 1N6KA 3DVLA 1P60A 1OLOA 4DCVA 2RC6A 3P27A 2H92A 5P21A 4RJLA 3FGNA 1IHUA 1ZD9A 5B30A 4NONA 2ZJAA 1Q82D 4Q1FA 2WZQA 3U3OA 4PPFA 1YZQA 1FP6A 5K8LA 1YU9A 1Q1QA 2P2LA 4KLZA 3U44A 1ONBA 3TGPA 1XRJA 1VG8A 1GOTA 3CCUB 2QT0A 4PANA 4A8JB 2OSBA 1N0UA 1LFDB 2Q9BA 1AKEA 3E1SA 4KO8A 4E03A 1UKYA 5AUQA 3TLXA 4FIDA 4AKGA 2ZI4A 5L3SB 2VSOA 3BB4A 4HI0E 4TQAA 4Z8XA 2PLFA 1A7JA 2WTUA 3BH6A 1FOEB 1XMJA 3BGWA 1G3RA 3RS5A 3KUDA 2DWPA 2GEVA 2JJ8A 5HKKD 1XEXB 3W8RA 2R6HA 2R6DA 4DXAA 4HB2A 5JS8A 4JLBA 2K5UA 3CCSB 2KE5A 2VBCA 2ATVA 5CLLA 1L2TA 1YJWB 1XD9A 4O0MA 4EPVA 3OZUA 1QHIA 1EP2B 1IM2A 5KDOA 4Y9UA 2FX3A 3H1TA 4HB3A 3DKPA 4Q4AA 4TLDA 2ODEA 2UZIR 4OQNA 2GJKA 4US2R 2G0NA 4ASUD 4Q4AB 1VQNB 4C0QC 4NP6A 2AFIE 1Q20A 1LTQA 4RSGA 4S35A 1GAQA 4ARZA 2RMKA 5LDDC 1Z83A 2QMOA 4LHZA 4ARZB 4HDOB 4YMTA 1GM5A 1J7KA 1W4RA 1G5RA 2RGGA 4PC7A 4F92B 3VHXA 1HA3A 1T3SA 4LPKA 1KJWA 1NN5A 2A5GA 2Q9CA 4DLYA 2ZRLA 1GAWA 3T61A 3UMFA 2R6CA 2IK8A 1NDHA 1ZM4A 1TF7A 3RAPR 4QGHA 3RRNA 4WXRA 1U99A 1Z29A 3CX6A 3P4XA 4M1MA 1Q21A 1NMZA 1COWD 4P4SB 4MRNA 3KQUA 3PR1A 1IQPA 1M1YE 1GR1A 4JVNA 2HXSA 1IXZA 2FPKA 3HU3A 5FL3A 4TL8A 3WYFA 3D31A 2BEJA 2VL7A 1G3QA 2WSSD 2ZRIA 1C1YA 4Q4JB 1SXJE 2CNWA 1RW4A 1P9NA 1AM4D 1OKKD 5FPSA 2O8BA 4QJ3A 1KI2A 2QRZA 1ANKA 3CX8A 4G01B 1XD2B 3TK1A 4FN5A 2O8BB 3MHPA 1Z6TA 4M22A 2EIXA 2AL7A 2QEQA 4LRWA 5KPJA 2ZPTX 1W7AA 5KNDA 3WXMA 1FUKA 3V76A 4DSOA 1GTVA 3TW8B 1QVRA 4Q4LA 1Q3TA 2ZE6A 4URYR 1W47A 2WMNB 3CPJB 4DDUA 4ESVA 3B9PA 4QG7A 5J4HA 3GEHA 5IDVA 2BMJA 1E2MA 3HJNA 3K53A 1H8EA 2QGZA 5CYOA 1YJ9B 1KSHA 4A0RA 4W7SA 3CXCB 4Q9IA 3FE2A 4US0R 3SR0A 2CCJA 4RD6A 4HAWA 4PSVA 4HAVA 1P62B 4TLEA 5HE9A 1Z28A 3HPRA 5BYJA 1G8FA 2O0HA 3QENA 2QAGC 1ZUNB 1OFUX 2EWVA 5EXXA 1P2TA 4ZV4A 1Z0AA 3VMFA 1ZCBA 2XTNA 2GA8A 5FUWA 2DEUA 4X8MA 3K1JA 4A8JC 2OHFA 1XTRA 3DOEA 3QSYA 4LHVA 3TVTA 1CR0A 3W3AA 1KY3A 2ZIAA 2ZUCA 3CBQA 1NJID 1CJUC 2FE4A 4FMCB 4PPNA 4HSEA 1XTJA 1JAHA 4DRZA 3Q9LA 4PGOA 1CBUA 2X8AA 1OH8A 1EWYA 1X3SA 4B48A 3MAAC 3U3MA 2JLYA 2H7VA 3CPEA 4K81B 4NPHA 4BASA 4Q7JB 2CMKA 2ZRCA 4XTRA 4QL3A 2QY9A 5H70A 5JZVA 3BORA 4PC3A 5AJWA 2ZSDA 2C9YA 4PHHA 1RYFA 1SHZA 3TR5A 3PUWA 2GCPA 5AWFC 3LO8A 2WJJA 2WAYA 4XH9B 1T3LA 4DDVA 3THWB 1RRPA 1VHTA 1K5GA 1JR3D 4NYMR 1DG1G 3FHTA 2GF9A 1P9RA 4TL9A 1FX0A 4ZCMA 1II9A 3QBVA 1GL6A 3FMPB 3LRPA 4GBMA 4GP7A 1QGYA 1UBGA 3V9PA 4Y7CA 3MMPA 1SZPA 2HJVA 3U5ZB 4XVQA 4GMXA 1VCOA 4HAUA 4YC7A 3T12A 5H5JA 1VQMB 1F2TA 3EASA 2ZQ5A 5TB5A 4G5QA 2SHKA 4PHFA 1E9RA 2R6AA 1ZINA 3BRWD 4LPSA 3SJBA 1Z06A 2XOKA 3UG6A 4BFUA 4C0LA 4N3GA 5FH9A 4NZYA 3S1AA 1XTSA 4OQLA 1D8TA 2R2AA 3SHFA 4MDFA 3L0OA 3S1AB 4PQRA 3DL0A 1S8FA 3I32A 1W4BA 1SULA 3EC1A 1FMLA 1W2GA 4QKQA 1KK2A 1KC8D 1XE1A 4IEEA 2IWRA 4B6EA 1BMFD 4AKHA 1OIXA 1G7CA 1FNCA 2PCLA 4W5JA 3HPQA 1F2UB 5ANRB 3MSXA 3LA6A 4D2IA 4IDNA 3QVUA 1S3SA 3DDCA 3A1WA 5D3MB 1JA1A 5CB8A 3ZD7A 1JI0A 2GCOA 4CF7A 2V6JA 3TUZC 2GCOB 2ZSAA 3VR4A 4OHVA 5JLJA 2FPMA 4DCNA 1AZSC 3U4QA 4GPTA 4MRPA 3B9QA 4KBFA 3WP1B 1G19A 3MWYW 3U4QB 4YHBA 1MV5A 1N6NA 1LW7A 2P67A 4M1TA 2IXGA 2OT3B 4KFSA 2QU8A 4IOJA 1VHLA 1G7TA 1KAGA 2VLIA 2J3EA 1PLKA 4YXWA 3B2EA 2IEYA 4OK3A 1E1QD 4EPTA 3PUYA 2IYVA 3EA0A 4DSUA 3L0IB 1CNEA 2RHDA 1YJNB 1NRJB 1JXMA 2R8RA 4MKFA 1GNRA 5FA6A 1UM8A 3WBJA 4LJYA 1LF5A 5GADl 3IHLA 4AI6A 2ZJ2A 2EYQA 3B1YA 3CM0A 4W5HA 4ZDKA 4WZBE 1NLFA 4NHOA 3OFND 3AGPA 4E5UA 3M0EA 2A30A 4DDWA 1ZCAA 1EFTA 1CTQA 1U81A 4C0SA 3I3SR 1GO2A 1LF0A 3W90A 2GJ9A 1W0JD 5C4GB 3THYA 4V0LA 1COWA 1O3YA 1QHSA 1WF3A 3T1TA 3LV8A 3LW7A 3J81k 3R7WB 2BKEA 4B33A 2YINC 3LBHA 5JECA 2ZR7A 2JLZA 4C7OA 1FQKA 3GJXC 3ZZTA 5JEEA 1KDPA 3KFXA 1OIVA 2VHUA 2ZU0C 1D2EA 1XJCA 5J4KA 1OKKA 3AVOA 4TTQA 5AR1A 1F60A 3EIHA 1KY2A 1OPXA 2C98A 4JYCA 4B74A 2RC5A 3K0AB 3ADBA 2GZAA 4HB4A 1GAJA 2R65A 1HTWA 1G7SA 1XWIA 4QHYA 3NVAA 3AF1A 3P4YA 4R9UC 2V6IA 221PA 2BCGY 4DQLA 1QHHA 2W6JD 4OHYA 3SEAA 2GTPA 1JR6A 1JNYA 2X2EA 4URUR 1TEXA 1DAMA 4DKXA 2VF8A 4PXAA 2BM1A 2NOAA 3LXXA 2HDNB 3QEJA 4PFSA 3WMGA 4A0GA 2ZANA 4B3FX 4DB4A 1YHQB 2PZEA 2W58A 2Q0HA 3I62A 2QTVB 4LGMA 5JSZA 2WV9A 1E2FA 1UKVY 1I2DA 2JIZD 2OXRA 4JL8A 5KTYA 2NMVA 3G6EB 1TUEA 3LO5A 1G8PA 1EWRA 2P65A 2VSXA 5H59A 4A2WA 4V0ME 4I81A 5KDDA 3OIVA 3K0FB 4HEJA 3PVSA 3R8CA 3K0CC 621PA 4A0FA 2AWOA 4TZ6A 1VQOB 2R44A 5FL7A 1L4UA 3AQ4A 1SVSA 3C41J 3H2YA 4V03A 1OFIA 1YZGA 1U8AA 2QA5A 3GLHE 5HCNA 2WICA 4YMVA 2OK8A 1EFHA 2FF7A 2JATA 1XTKA 4NCHA 3T1OA 3VKWA 4WXPA 5FR2A 4QGGA 1AA9A 1G3IA 3W2HA 1E2NA 4MDEA 3M6AA 2CHGA 3TIFA 2CCKA 2H5EA 3OHMA 2JCSA 2DPXA 4WIAA 3UG7A 2O8DB 4UAJA 4R71A 4P6VF 1DAEA 3QXSA 1XJ0A 1ZNYA 4RD0A 1QHNA 2ZRGA 3C15C 2VYQA 1W4AA 1YJ5A 1IJEA 5FTLA 3CC7B 3OE7D 4GP6A 4XSHA 4QC2A 1QFYA 2C96A 2FNAA 1M74A 1OB2A 3A4MA 3X1DA 1IAQA 1KNQA 3QKRA 4POAA 3BB1A 3EZFA 1XZQA 5LD2B 3QKRB 1T5LA 2HCBA 1ZBDA 1E69A 3W5UA 2Z6VA 3AF3A 1XPRA 1VECA 4FCWA 3DZDA 1A1VA 4PC6A 3GFOA 1UPTA 2N1BA 1DAHA 1IB0A 4NYIQ 4BFSA 3W8NA 1E2JA 4A36A 4KODA 4TMZA 1JEDA 1I2MA 2IX3A 3W2GA 4PPQA 1KJZA 1QHXA 3MD0A 4TL7A 5SZHB 1TLLA 4NU0A 2FJUA 2TMKA 1JJ2B 2WWWA 1TQDA 4LC1A 2V9PA 4Q1AA 1S0UA 3AKDA 4ZGQB 1N5LA 4R2IA 5L3VA 2ZR0A 3OEHD 4MKGA 4Q66C 1WRBA 3PENA 1YRBA 3GJ6A 4XSGA 1XB2A 1S1CA 3CNLA 3KJEA 4PQFA 4HUTA 1Z47A 3T06B 1W1WA 3JZMA 2QAJA 1WB9A 1TQ6A 2ATXA 2GBLC 2PEYA 5H1YA 2GVDC 3I8XA 3RS7A 4P3YA 2X19A 4XWOA 5B64A 3GQBA 1IY0A 3B60A 2PJRA 3DMDA 2JJ1D 2YOFA 3SNHA 2BIFA 2EYUA 3NDBB 4PTLA 4A9AA 3P32A 4JLNA 2ZITA 2ERYA 4BGDA 4ZO4A 1EP1B 4TYNA 1JECA 4TSFA 3CRVA 2X2FA 4MKHA 5K8IA 1CLUA 2J0VA 4KSCA 1QGZA 4MRVA 1CJVC 3SQWA 1ZMXA 3VQTA 1CU1A 1WXQA 4UNPA 3SFZA 2V1UA 4I1VA 2GKSA 4Q1BA 2IXEA 3LD9A 1X86B 2YOGA 4Q7KA 1W35A 2XNCA 1RJ9A 1OGJA 3Q85A 1W0JA 3RLFA 3B1XA 2BDTA 3UIEA 2QPTA 2C78A 1OXXK 5L3RA 2Q6TA 1P4SA 1X6VA 1RYHA 1R5BA 3ES9A 4CEIA 3OIUA 4CEIB 2QMUA 1SKYE 1IN8A 1KMQA 1TU3A 3CCEB 3RYTC 1CULC 2ERXA 2XZLA 2A2ZA 1W34A 3OZWA 1NI3A 2VP2A 3F3YA 1E9BA 1FFHA 3G5UA 4JSTA 4PQYA 3CH5A 3IGFA 1OXVA 2RGBA 4IEIA 4OKSA 3DPUA 1QUFA 2XTMA 1YVDA 421PA 5FTNA 2ZRAA 2C04A 1U8ZA 4F38A 4IDOA 3R9WA 1G21E 1OF1A 4YDSA 1G8GA 4C0HA 4TYWA 3O8DA 2OXCA 1NIPA 3FFAA 1YZKA 3QFRA 3N2EA 1NG1A 2OBNA 1HE1C 2OILA 1DE0A 2O0KA 1XEWX 2LKCA 1FNNA 3CB4A 3B7GA 3GEEA 5JJKA 5FI0B 2QT1A 4PAMA 1QFJA 2OCYC 3GLFE 2J0QA 3U6BA 2ZJOA 4QM6A 3K09A 3KQNA 3QKSA 2F9LA 4Q19A 2IXFA 1MO4A 2JIZA 1GJRA 1GZSA 3ZYCA 3WRXC 1KK1A 1G8HA 1KAOA 2C9CA 2DFTA 1IOZA 2OM2A 2WKPA 4B2PA 2CCGA 4AURA 1XXHA 4DLSA 2YOHA 3AUYA 3IIJA 3T35A 1XXHB 5EJEA 1NJGA 4IVQA 1SVWA 4Q02A 2UVQA 1VQKB 3K70D 3QFTA 1DAIA 1OV4A 3C5HA 3KKPA 1MRSA 3BBPA 2O5VA 4OI1A 3ZVRA 2WJVA 2YYZA 4JS0A 4YMUA 4URWR 4XVRA 2IYYA 2Z43A 2DWQA 4JLVA 1ESNA 1NY6A 2PX3A 2XSZA 2BV3A 3KTAA 4BFVA 3A6PC 1W2HA 4LV6A 1UADA 4BLRA 5AK0A 2ZJ8A 2IHBA 1MT0A 4MA4A 1T4GA 2NO6A 4B3BA 2CEAA 1H8ED 2XTZA 2RH5A 5L8VA 2GZDA 3SOPA 2HJGA 1QVFB 1FW6A 1EWQA 2Z0MA 2QMEA 4U7DA 3EG5A 3X1WA 2DFNA 3GLIE 1W46A 3KXIA 1DAKA 5DO9A 3Q3JB 4Z1MA 4DUGA 2CBZA 1HE8B 3THXB 3CUEF 3OEEA 5EE9A 4DLUA 1IONA 3U7HB 2OK7A 3FMIA 1JA0A 4HUQB 5EE3A 4M8NE 1X8KA 2QG6A 3TAHA 1WA5A 4LJ9A 4OK5A 2EQBA 5EZ6B 2GJAA 3FMFA 4LX0A 2QL6A 1QDEA 1RRFA 4G5OA 3DHWC 1VKJA 3ADCA 3ZDQA 2QN6A 1KDTA 1ZNWA 3H0KA 2JLUA 2YWEA 1E63A 2ONKA 2ZRHA 4PHGA 4DVGA 1E96A 2HYDA 2GCNA 4B75A 1LVGA 4IHQA 2LWIA 5KYKA 4CEJA 1WE2A 2RGEA 2Z4SA 4FMBB 2YZ2A 4DBLC 2P6RA 3B6EA 4CEJB 4V0OA 2VTKA 1SVMA 1QHGA 2FZLA 4DSNA 3QI2A 3H4MA 2F43B 4YAOA 2GETA 2RGCA 3QUSA 4LK2A 2F9MA 3D8BA 3V00A 3SC3A 2ZRDA 3ND9A 1E62A 4G3XA 1XMIA 2DFKB 3TMKA 1R10A 4IKEA 2NIPA 4U5XA 5JWRA 3DOFA 2QSYA 4IDPA 4LBWA 3KX2A 3T15A 3ECCA 4LYAA 5KNBA 2CLDX 1OHHA 2KI5A 4JVLA 1W87A 5DHAA 3REFA 2BC9A 1FUUA 4QXAA 3RS4A 1US8A 3U3RA 2NO7A 1XPUA 2PT5A 3CCLB 1ZVQA 2XB2A 3SE0A 4NCNA 2CL7X 4RY2A 5KOYA 1LNZA 4Q47A 4DLXA 3LWNA 1JJ7A 4D6PA 1L8QA 2WOJA 4RZUA 2OG2A 3KKMA 2XOKD 4EJSC 3QXJA 1N0WA 4CEHA 1F5NA 1ZNXA 4OJKA 3U44B 3U3JA 1SXJA 1UKEA 1BQEA 2N42A 4CRWB 4ZIRA 3RABA 5KU1A 3GLGE 4I1UA 4EAQA 1TF2A 5FBWB 1D5CA 2HCJB 2G9NA 2KWIA 1GRNA 4BWYA 1CP2A 1NKSA 5EP4A 3TBKA 3CCVB 3QF7A 3RWMB 4L9SA 3HU2A 2PH1A 3QKUA 1J8YF 2W0MA 4KBGA 4I4LA 1W5SA 2EVWX 1XNJA 3EZ9A 4KCGA 3WY9A 3GMTA 2CE7A 1Z0IA 2P5SA 4U9UA 3NIBA 5GJWC 1GL7A 2ZE7A 1P9WA 3D7MA 4C3ZA 3ZBTA 1ESMA 2ZYVX 5FOXA 4YAWA 1CR2A 2XX3A 4UNNA 1XFAA 4B73A 5BQ5A 4DC9A 1SVIA 4G1VA 3B1VA 1KIMA 1ZUIA 2NZJA 4TMXA 2JLRA 4TLBA 1VQPB 1E99A 2X1VA 2DCUA 4YXWD 1S9HA 2NO0A 5E95A 3WRYC 4KITB 3WNDA 5HPYB 3QPVA 3KB2A 2VPPA 2WAXA 3QJYA 3OIWA 4JVSB 5KSZA 1YR9A 1MR3F 3LBIA 2YKGA 2BEKA 4L5BA 5FTJA 3AVYA 2ZETA 2P5TB 2J0UA 3TAUA 2J0SA 4O2RA 3MWJA 3PCRB 3KKOA 1G64A 1U9IA 5TMPA 2BVNA 1YRAA 3BH0A 1E2LA 1G16A 2F1HA 1YHNA 1EP3B 1MABA 3BE4A 5IT5A 2AXPA 3DZ8A 1NBME 3I72A 1MABB 3NXSA 1AK2A 3AH8A 1R2QA 2VZLA 1FTSA 1W48A 2QSZA 4DIEA 1PJRA 121PA 2FMXA 2GDJA 1P75A 4URXR 1P72A 4CW7A 3K70B 2XITA 1W44A 1KI9A 1VG9B 2RB4A 4GSYA 4I1OA 4PSKA 3ZQJA 1FNBA 1CNFA 4DLRA 3AVXA 1VIAA 3Q5DA 3WHKA 4TMVA 3RDPA 4TL6A 2WWHA 4M53A 4TT3D 2AK2A 4TN1A 2W2TA 3I92A 4KV9A 2XAUA 4W5WA 2QDXA 3QE0A 1TEVA 1ZC3A 4KI0A 4RD1A 2DWOA 2ECKA 3AKCA 4NYMQ 3ZZ0A 3ZVMA 4XTCS 4OHXA 2XZOA 2VP6A 3F5FA 1ZC4A 2GRJA 4UNSA 1AZTA 5BW8A 2FDCA 2BGIA 4HLUC 4D26A 4IRUB 1GITA 4JLAA 2IUUA 3EXAA 1Z0FA 3BFXA 2FGKA 5UKDA 1S3GA 5FOTA 4MUBA 2RAPA 3CZQA 4DEXA 4BZXA 2ZI7A 1N6IA 5LPNA 1M8PA 2ZSFA 1VQ8B 3GJ7A 3ZQ6A 1EK0A 3JQPA 1DADA 2IYUA 1RE0A 1ZM3A 1QG4A 1R6BX 1ZD1A 1O87A 3LNCA 1ZJ6A 2IL1A 4H9GA 1P73A 1W2BB 5FL7D 4BFZA 2ZE8A 1Z5ZA 2ORWA 5B58C 2F1RA 2HT6A 2PZFA 5E7JA 3FHCB 3RRYA 1FDRA 1B23P 1QHYA 3IPYA 1XP8A 1K8AD 4AKEA 2PIAA 1LB1B 1DEKA 2UKDA 4Z8YA 1DAFA 3RS0A 1W5TA 3KKNA 1YIJB 4GOXA 4FMDF 2CRVA 5HZKA 5DYIA 1GRRA 4KYUA 2WMOB 5F2EA 3U7EB 2ZJ5A 1CKEA 5K8UA 5AJXA 4LHXA 2V3CC 1HQCA 4LJAA 2KSQA 1CXZA 3GD7A 1KI3A 3FFBA 5EUQB 4JSYA 1R0XA 3RWOA 1P5ZB 2BWJA 1N6LA 3PUVA 3W5VA 4BLSA 3C8UA 2CLCX 3LLMA 4G0NA 4LHYA 3W5IA 1I4LD 5CJPA 4FK8A 2HYIC 1PUJA 2CHVA 3N5CA 4F91B 2ZE5A 3EX7C 4BE7B 2OFWA 3OJXA 3B85A 3RRMA 2ZI3A 3KZ1E 4JKYA 4AYTA 1NIJA 3BK7A 2I1VB 2GEUA 1FX0B 4LJ5A 4X8LA 4LSGA 5TY0A 1CR1A 3EIQA 1J70A 4M0LA 1XMVA 3NEJA 4BEJA 4DCSA 2ZS7A 3CPHA 4NKRA 3SDZA 3A36A 3SI7A 1W36D 3H86A 1PLJA 1F2TB 2OAQ1 1E2GA 3T34A 1NP6A 1VIYA 3M4YA 3OIYA 4L4UA 5DIFA 4A0HA 4B35A 2XNJA 2J87A 4KU4A 1II0A 4KVAA 4O25A 1KO5A 2GILA 2WVJA 3NWJA 3UANA 1CJTC 1E2QA 3CRRA 3NHAA 3EWAA 3W6OA 4LHWA 3EPKA 2F7SA 3VU9A 1OGIA 2QI9C 1GNQA 1CR4A 1E4VA 2QE7A 1HH4A 1YR6A 3AKEA 4OL0A 5DHFA 2GJ8A 2A5DA 1VCNA 2WIAA 5J47A 1CF4A 3QE2A 3MUFA 4BFTA 2G1KA 4YDHB 1TTTA 3FVQA 4PO9A 4RZXA 1GNPA 1NG9A 2ZRPA 2D7CA 2Q3MA 5BYKA 4TZ0A 2VNJA 5IK2D 3A58B 3C14C 3E70C 1A8PA 4Q7MB 1OFHA 1KKLA 2HEIA 1E6CA 1OFTA 2ZUDA 2CJWA 2CVFA 1Q1BA 3VNVA 4PO1A 4AYXA 3OAAA 2ZSBA 4CT5A 3CLVA 3X1XA 1N3BA 3GPLA 4ZCIA 5H8WA 3EZ2A 2FU5C 1YZLA 2VF7A 4ACAA 3GFPA 1MO5A 3BS4A 5GJVC 3UXMA 1II8A 5FR1A 1RFLA 4V0MA 5KUTA 1P3JA 4TSFD 1GRQA 3RVBA 1JALA 3THOA 1IXRC 3I73A 1J2JA 1TUIA 1K73D 3G4SB 2FV8A 1KI4A 4BLTA 4NDZA 3EZ7A 5GVRA 3GLHA 4ZDIA 4CGZA 1AMOA 1VYTA 4MITA 3QFSA 2QQEA 5JFGA 2DFLA 5CIQA 1Z6GA 1Z6YA 3AP1A 4KVGA 4TQ9A 1QZXA 3CNOA 2WWYA 1OXSC 3QG5A 1A82A 1E0JA 3GJ5A 3THYB 1T91A 2VNKA 1Q22A 3FWYA 1P2UA 1S2MA 3BH7A 1JEEA 4RKEA 1XCPA 3G71B 1IN4A 1ZIOA 1TU4A 2ODBA 1JJVA 5FFMA 4EFMA 1EXMA 1Q86D 1OW3B 2PCJA 3QXHA 4C7OB 1J99A 1Z22A 2QP3A 1T8UA 4GNKA 4WBSA 1F6BA 1KHTA 1OXTA 1NN3A 2YVUA 2REBA 3UWOA 4BRWA 3BB3A 3PFIA 1Y63A 4XD7D 2GXUA 4D25A 4P33A 4Q03A 4LY6A 5B2ZA 4M9ZA 1E2IA 4P4UA 1Z8FA 3BERA 2B5OA 1MRNA 4LJ4A 4GMDA 1LS6A 2C2HA 4JLJA 4TT3A 3PXGA 2BF4A 1U0HC 2EFEB 2NGRA 2PBRA 3VKGA 1YQTA 2O8FA 5FUYA 4BFYA 2W6IA 3VHLB 5KSOA 2ZYWX 1QHHB 4GOKA 1YR7A 5G3ZA 1R0YA 2OBMA 3WMFA 1E2KA 2YNMA 1TF5A 3IEVA 1KTVA 2Z5FA 3A1SA 2REXB 4LUCA 2EU8A 4WQMA 2ZJZA 4DJTA 3JQRA 4HE6A 2D2FA 5CITA 2IF0A 5FTMA 5JSZB 1E79A 3NC1C 4HLCA 4HAZA 2JDIA 3PUZA 4LBZA 4KYIB 4EKDA 4OQMA 5J4LA 5C46F 4B3DA 1I4DD 1TMKA 4JBWA 5FUVA 1T0JB 3L8YA 5AJVB 1R4AA 4O2LA 3IUYA 4Q01A 1D9XA 5DI9A 4RFVA 1J90A 1G20E 2O0JA 2H18A 1QX4A 3AVTA 4MYHA 2HF9A 3ADDA 4R7ZA 3DM9B 3Q5EA 4L8GA 3SJCA 1G6HA 3E2IA 1SGWA 3Q7PA 1EFUA 4JVMA 3W3ZB 3CWQA 2WWXA 3AVWA 2GF0A 2WWGA 2R9VA 3V4RA 3AVQA 1Q7YD 1RRCA 2XSZD 5ELXA 1NVVQ 4A6PA 4BPBA 5SZKB 5TDHA 4AF6A 2IWHA 1BS1A 1H8HD 2GHIA 4X8OA 5A5GA 2HF8A 1DTSA 4OHZA 4AG5A 1Q44A 4C9BA 3AGQA 5GV8A 4HDCA 2FEOA 3PEYA 4C0BA 1KI6A 3FJOA 1R0WA 3GP8A 3UWKA 4D0NA 3ZD6A 5EXSA 4TMWA 4Z1MD 4Y0AA 4IW3B 1G41A 4DUGD 2IBMA 4FMDB 1DO0A 5AUOB 2HXYA 3OEED 1VQ7B 2RGNA 3TSOA 4IDHA 3C7KA 3SHWA 1OYWA 1JQLB 5J4VA 1WDTA 2QM7A 4AF7A 4Q4HA 2XEXA 2RGAA 4ESHA 3E1YE 2WWIA 2RHMA 3T1QA 5HR5A 1NKTA 4NE2A 2OCAA 5CLQA 2ZYUX 1DARA 1OH6A 2JLVA 2PMDA 4N0DA 1JBKA 2B7CA 1H85A 3TVDA 3F8TA 1G5TA 5AUPB 1KKMA 1OH7A 3RC8A 4I99A 1DOAA 4EIWA 4JJKA 1NSFA 3D6TB 4BEBA 5AUNB 1RRGA 4EPWA 1E2EA 3LY5A 2VSFA 1VG0B 1U2RA 1HT2E 1E0KA 4IFEA 1Q1ZA 2BKUA 2NO1A 5TXGA 3G0HA 3WP0A 5C4MA 3BWDD 4IDQA 1MO3A 1VCIA 2W0SA 1WBBA 5IK2A 1L7VC 1KSFX 3G82C 4EH1A 1HV8A 4P31A 4D0LB 1EFRD 1NVVR 2D62A 1P2VA 3CC4B 1S4QA 3W34A 3U60B 1F48A 2JJ2D 4HAYA 4QJ5A 2FFBA 2IA5A 5JWOA 3KFVA 1R5OA 2D06A 3GLFA 1ZIPA 2IHYA 2QROA 1OHHD 4HLQB 4YALA 5TARA 4B3CA 3I8SA 2R6GA 2BGJA 2EFGA 2Z4RA 3W5HA 2GAOA 1KI1A 5EE0A 1RPZA 4OK6A 2NQ2C 2F3RA 1GILA 2IUTA 2FFHA 5FBVB 4QGAA 5A4JA 4M2LA 3IBYA 4WZ6A 2J59A 1E98A 1Y3AA 4KFTA 4RVCA 4AC9A 5EUMA 1N8RD 2IS6A 1JXOA 1N5KA 1WBDA 1CRPA 1E64A 3TQFA 2C8VA 3OF5A 4IOLA 5FI1B 2QENA 1SXJD 1U0LA 5F98A 1KO8A 4BPRA 2ORVA 2IYLD 4C0KA 5JHHB 4DIDA 3RNLA 2IS4A 2XGJA 1VG1A 1QVAA 4UNRA 1ODFA 1RJ9B 2AD5A 2QORA 3PITA 4IOMA 2GAAA 4DCTA 2IYQA 2HMAA 1GFIA 2NO9A 3I55B 1LY1A 2XB4A 4Q18A 1Q1EA 2W83A 2WBLC 4ZI2A 1KO4A 2QZ4A 2QPOA 4N1AA 2DYKA 1JR3E 4MYTA 4ZDWA 1XEFA 3HP1A 3CR7A 5E3HA 1AS0A 2IYWA 4PSAA 4QOSA 4XD7A 4C0JA 1H42A 2QBYA 2V7QA 3IIMA 1ZM2A 4K46A 4P32A 1KK0A 3T1VA 1MOZA 4DT1A 3SJZA 3GLIA 2XJ9A 3DMNA 3EPJA 3IBGA 3Q7QA 1XEWY 2H17A 5CM8B 1F20A 1N25A 2MMCA 3AF2A 4HZUA 2F55A 3NBZC 2AX4A 2VRWA 3PEUA 4HZUB 2OV2A 4JIMA 5LD2C 4BFXA 4LJ7A 2HT1A 3HR8A 1NY5A 3HYRA 4NH0A 4F4IA 1HT1E 5IHPA 1AS2A 1XTQA 4J0QA 2J1LA 2D3WA 2WJIA 4JBXA 1FNMA 5L3QA 1KD1D 4I1SA 1IY1A 2QQ0A 1GSIA 2CL0X 4WAUA 3ZS9A 3P26A 3QKSB 1YE8A 1HUQA 2MMGA 2GK7A 4JT2A 4N3NA 1N6PA 3LXRA 2GXAA 4NMMA 1IN7A 3SN6A 3QIAA 1AJEA 1IY2A 1UJ2A 4ON9A 4Q48A 1OSNA 2E1RA 4F7DA 4Q1CA 1U94A 4QBGB 4RD3A 2G3YA 4MUAA 1G8YA 3UMRA 1ELOA 1OE0A 2WOOA 1G3MA 4B43A 3A37A 3L0PA 4ABYA 1UBEA 3I5XA 2BBWA 2ONJA 1CJKC 1Q57A 2QTHA 5KHOC 2PJZA 5KDLA 1K5DA 3WBKA 3AV0B 2XNDD 5M04A 5DNYB 2ZROA 2ZVPX 2ZS8A 2VP0A 2IT1A 1KO7A 3SJAA 3QPWA 1LV7A 1VYUA 4YLGA 3U7FB 2XXAA 2W2XA 1MO6A 1PLLA 3SYLA 1TVCA 4GL2A 2EW1A 2AWNA 2QGNA 3AKYA 2O8EA 2KJQA 3IO5A 2ZS9A 5G41A 2C77A 2VHCA 3NH6A 3SBDA 1HYQA 2O8EB 4AY2A 3KTAB 3ND8A 1GP2A 1H8HA 5FPYA 3SU8A 3KQLA 4BLOA 3KJIA 4B6FA 2FG5A 3LVRE 1BKDR 3QXCA 1QG2A 4PX9A 3UATA 2G88A 3RHFA 4TYQA 4WVFA 3SBEA 3GLGA 1XU4A 2OCPA 4X8HA 2AFHE 3VX4A 5KSWB 3K0SA 5DN6A 3N70A 2BMDA 4HB0A 4BZPA 2WSMA 5HE8A 2ZRJA 3CRW1 3PV0A 3K9NA 3ETLA 2G0TA 2BBOA 2BBTA 3FB4A 3MFYA 5F9FA 3SFVA 4RD2A 2ZI6A 3BFKA 3ZGXA 2HLDA 2H1LA 3CIOA 3R9XA 1A5TA 1NLZA 3LLUA 2JEOA 5TV2A 3LVBA 5FPKA 2LCFA 3FKSA 4A15A 4DQKA 2EFHB 1G4AE 4BFWA 4G5GA 3K9GA 2RKOA 2IW3A 4C4PA 2B8TA 3NKVA 1X8LA 1GG2A 1XX6A 4QRHA 2GESA 3QQ5A 3HU1A 2A5FA 1SVLA 3I5YA 1DS6A 2CNDA 3VAAA 2HUPA 3ASYA 1C4OA 2P6NA 4B44A 3VO2A 4OI2A 5HXBA 4GI7A 1EFCA 3GJ3A 5CM9C 4ZKEA 4LV8B 2F3TA 4TMKA 2ZJBA 1TPZA 2WJYA 3NDPA 1UMKA 4QBFA 3VR3A 1QVGB 1P61B 1EFRA 4JYBA 4F93B 2IS1A 1UFQA 3GCGA 4LYHA 1SM4A 4XIGS 4B2LA 1N2CE 2JJ2A 1M2OB 2QA4B 1Z07A 3VNUA 4E22A 4FI3C 3B78A 1E32A 4M1YA 3W5JA 1XXHE 1EGAA 1NJFA 3CW2A 2VH5R 4M9SA 5EP3A 3ZVNA 4QBHA 2FH5B 1US8B 3QF4A 4QGFA 3R8FA 1NBMA 3GJ4A 1T3HA 1E9SA 3QF4B 1B0UA 1CS4C 1L4YA 2W00A 3EIEA 5D3QA 5FBRB 2BJWA 3K09C 4BLQA
chains in the Genus database with same CATH superfamily
3HB7A 2E87A 2ANCA 3KBBA 4DPMA 3HGQA 2ZB7A 5FWYB 4CKXA 2QPAA 1HF3A 3B1ZA 5AKEA 3KKEA 1E89A 4XGQA 3QVGA 2AZDA 2XE8A 4RDHA 1AKNA 4MQMA 4CVNA 4QFMA 1PZNA 1SXJB 3IAM6 3VTKA 1FYWA 4DEYA 2WLTA 5EHQA 3KCQA 3RVKA 4EX7A 2EX0A 3G1TA 3Q2KA 1GEEA 2H16A 2XWBF 1X8XA 2OV4A 4QE3A 1J00A 1V5GA 2C82A 4DMRA 2MYPA 3AR3A 1KWKA 1BOFA 3MT9A 4MKIA 4TQUS 3Q2IA 4CV3A 3TH5A 1YL6A 2PVSA 1WUYA 3RUFA 2X40A 1T9DA 4MH0R 3MQ2A 4HRAA 1ETUA 3HDVA 5EQDA 3TE6A 2R68A 4I4TB 5EWLA 5JCOC 3CWCA 1ZLYA 3DEYX 4A8JA 3AUUA 1FLDA 1YUBA 4MB6A 5EKXA 2HA4A 3VDRA 4WBNF 4DQDA 3K16A 3U48A 4ZEMA 2BEWA 5CYPA 2PL3A 1P2BA 3AUKA 1E6WA 5L3SA 4G6ZA 4XOIA 3AI3A 3HM9A 2D7DA 1YKFA 1YS6A 4GKKB 2NZYA 3QWAA 3EEQA 5LDHA 2BFDB 1YRLA 3GZJA 2OM6A 3L06A 4ZVNA 4OFZA 1JB9A 2PVPA 3NYQA 4XPZA 4J0HA 1M2KA 3RS2A 2A9FA 2AZ4A 1H2RS 2FUG1 2LBPA 3DSRA 4IV5A 4IXMA 2JJMA 4EF5A 1P0MA 2MWMA 1WOOA 1XEXA 1XA4A 2QJTA 3MQ4A 2HV9A 4MWDA 4QDKA 2F3PA 3SFTA 1GQ2A 1ZI9A 3CMAB 1QK4A 1F6WA 2JBAA 4S0XA 1LXCA 2B21A 4NVRA 2VC2B 2VXOA 4EMTA 5EIOA 4UEQA 1KMHA 3MGCA 4EQ6A 3UGQA 4V02A 2ON6A 1R15A 1EQAA 2HA5A 2IDZA 4C07A 1ZK0A 1XF9A 3ZR4B 3EVGA 2B0JA 3EY9A 1C3VA 1AG9A 1XAGA 2J5BA 3B5IA 3NBUA 1D2AA 4IDDA 3VBEA 2NU6A 3WLNA 4LI0A 3T1YB 3GEIA 5T7BA 4RVOA 1Z2CA 1IRIA 1OX4B 1Q12A 2I8LA 5KBYA 4EYKA 4GXTA 4HDMB 1HKHA 3ZUPA 5ELLA 1G1MA 5AK3A 3FUUA 4BATA 2VBVA 2IH4A 4MGYR 2YR0A 3O3MB 1JZSA 4N54A 1HZZA 2HXGA 3KKZA 4YONB 3T4XA 1WCIB 4Y2QA 4EG6A 3RKRA 1ODJA 3WSTA 2PX4A 1AO0A 1EX7A 1X1BA 2F1KA 3NBFA 4PGHA 3IMEA 3T7SA 2HA6A 3BGSA 1UPCA 2B3DA 3ZDFA 4RVGA 5E6UA 3VJMA 3AV3A 1ZLXA 4Z51A 4P83A 4MHTA 1SQ6A 4UDYX 1CDZA 3MMZA 1BROA 3VR5A 1ORIA 1T24A 2GHQA 3LBAA 3PGKA 3ZBUA 4P4SA 2B4QA 3UTDA 4EBFA 4OI4A 2OSVA 4LZLA 4QUBA 3X43A 1ID8A 3H42B 4NYJR 1FQJA 4UULA 2B7BA 4GT1A 1D1SA 2ZTNA 3IV7A 4TQGA 3U3KA 4B87A 1E2PA 3JWHA 5CBPB 1SBTA 3DT9A 4QYSA 3JYLA 3L0CA 4WASA 1IB6A 4JL5A 3PDHA 2O8CA 4EEZA 3Q7IA 2VATA 1ZMRA 4U2FA 3SIWA 3ZDRA 4EQZA 4KXYA 1NNUA 3D54D 1BD3A 2GN2A 3G88A 3NR2A 3PRHA 4Q0MA 4ZEVA 5C8ZA 1ILEA 3MIZA 2FG6C 4I8XA 4KQWA 3R1IA 3PUKA 4US1R 4RFLA 2HQRA 4Q1DA 1UIMA 3ZE7A 1YZFA 1TYDE 4LGCA 2CYAA 2JK1A 5DLEA 3KBOA 5B12A 3R6KA 1RNLA 4JI7B 1VQ4B 4QASA 1SXJC 5TT1A 1EXWA 4HE5A 2JRLA 4WZKA 2FPPA 2NYUA 3KQSA 3MCUA 2QAIA 3ER9A 3EPHA 2CSUA 1WQ1R 2X41A 2HRDA 2GEBA 5AK6A 3DTTA 3PWSA 4M7WA 4WJKB 1QH0A 4ZD6A 3BM5A 3MHTA 1Q77A 2BYTA 3LX8A 4K26A 4IJWA 4PBTA 1N6OA 1YRYE 2WILA 1RDFA 4KJZA 1XQ6A 2VXYA 1XZGA 2P4SA 4O02B 2VDOB 2B4TO 3MAGA 3NVKI 3GMSA 2ZYSA 3P9XA 1H65A 4ZI7B 3OQHA 2FPIB 4V2UA 2X0FA 1FDSA 5L4NA 4CLRA 3EGXA 4F97A 3IULA 3ASRA 1NPYA 2FZCA 2QNIA 1UIRA 2O3SA 4XQ9A 5A9SA 2OECA 3I4CA 1VQ6B 3N5KA 4EJFA 2HLHA 4CM9A 3TIXB 4ZI3A 3JD2A 3Q6MA 1M2GA 2HLNA 2PMKA 1ZY2A 4B6PA 2Q8PA 2GZRA 4K9DA 1VL1A 4BZWA 3KB6A 1YB4A 1NFFA 2VBSA 1FYXA 4IHJA 1BXRB 4ETWA 1BX1A 3JR7A 2QPLA 2AHRA 1GL3A 3O47A 4I2NA 4K28A 4FXOA 4DLLA 1WW3A 3ESAA 2IPNA 1LPMA 2HHJA 3LUAA 4GM1A 3TLGA 4ATNA 1GUZA 1K86A 3Q9UA 1CJMA 2VA8A 5AO9A 5FOUA 3N2GB 4OYHA 1BQ3A 1HDEA 3KWFA 3SD7A 1HORA 3CONA 5IKMA 5FBLB 1F4PA 4F8YA 5MFPA 4BX8A 2GYUA 1KEKA 5TR9A 2HPAA 2V65A 1N9GB 5FHQA 4URVR 2E2WA 1MAVA 4Q3CA 3VZDA 1XGKA 4DF3A 5B3LA 3INRA 1THZA 3K6JA 2BSQA 2AE2A 4UC0A 3RUEA 2AKAB 2OFOA 2Q2WA 4KGDA 2ZBFA 3JYOA 1ZO8A 2AC2A 2Z57A 2X6XA 1G8SA 3ERCA 1MEEA 2EEPA 2IHNA 2QYSA 3IPXA 2VIIA 4JOBA 2IF2A 2YTZA 3VU9B 2UXBB 4F21A 4IILA 1T9KA 1ISFA 1MG0A 1JIXA 3OZTA 4U39A 2HA3A 2HV8A 2X22A 3I2GA 4F2WA 3K70C 1GPNA 4W7IA 2DTEA 1JG3A 1I18A 2QF7A 2XBLA 3ICPA 2F1LA 3IEPA 1E1YA 3R5JA 5AESA 2C2GA 3CCBA 1P7ZA 1NBHA 1WXHA 5H0IA 2XF8A 5ALJA 1E5XA 3HP4A 1K66A 5JYCA 3UPDA 2QLBA 1I7NA 2PWPA 3KZVA 3TSWA 3OQMA 3PG5A 1T3TA 4ZI5A 1ZU4A 4QBIA 2W4MA 4II7A 5EEHA 1CJSA 1FTNA 4XLHA 1Z6AA 4BLPA 3ZXYA 4BMDA 4V1CI 4L27A 1L5ZA 4BMOB 3FDIA 4G5SA 4LJ8A 4P4TA 1PRYA 5B1YA 1ZQ1A 1W4CA 2ZSHA 4C1NA 2VYVA 4ZMSA 3ISXA 2ES4A 3KR0A 1K08A 1USIA 1OWOA 4LF4B 4KV7A 4YV1A 1F2UA 1Q50A 3D64A 5FA8A 3LYHA 3F8SA 3R5TA 3PEVA 3X1KA 2YWGA 1AQJA 3LHIA 2AMVA 2V7VA 2HCFA 5JVDF 5IPFA 1AXRA 4BKUA 1II8B 1AS3A 2XWPA 5IDYA 5HKKA 3QPUA 3GOHA 1RU3A 1QG6A 3H97A 2NP7A 4V0QA 1J8VA 1WLYA 2BP7B 1ZESA 2N1MA 3SZUA 4B3JA 3AY3A 4OLJA 3PA1A 4ZQFA 4Y2YA 4C5AA 1NNI1 1Z13A 2G77B 4GICA 1OIWA 5EJ6A 3PHJA 1Q83A 4WOBA 1SKUA 2B5WA 3DXFA 3GHHA 1DG3A 3GLHB 2B4RO 1KVUA 1D07A 4FOTA 1JT2A 2J3QA 2K2QB 4PYOA 3CUKA 4I5IA 1YFJA 1H9BA 4DREA 2PY6A 3E5RA 1WLSA 1BEZA 2PRZA 3DVSX 2OG1A 4GYJA 3QKIA 2ZSIA 1QRSA 3ETJA 2AOVA 3I4LA 3ITEA 3FOZA 1CZNA 3M1IA 4TRNA 5K0FA 1VMAA 1A5AB 2EBWA 1EK1A 5E0OA 5KTMA 2Y1XA 3QY9A 1T35A 1TKAA 1FYVA 4MVCA 5IZCC 2JAQA 3GR6A 1WB4A 4ZV7A 1OVMA 1HMPA 5IASA 1M73E 3EVNA 1XDGA 1XTVA 2ECPA 5D86A 4I36A 1Z3IX 2OFFA 5CDGA 4MR9A 2O7VA 2JLQA 3WHLA 5DX8A 4WA7A 2E89A 2H54A 4BNLA 3ACCA 1H4VB 3PQ5A 1GVHA 2PFKA 1OLXA 3ZG6A 1LRLA 1T2CA 3HLTA 3LDFA 3M6UA 2ZJFA 1ZOOA 3RE1A 3T5GA 4HDQB 5AW2A 5LYJF 4JGGA 2C4UA 3WGHA 3S1SA 4V24A 1MF7A 4PFQA 3GG9A 4MV7A 3V8QA 5BWLA 3WA6A 1V6SA 2FWJA 2YVQA 3KE9A 3LHSA 3R44A 2O8FB 1ESZA 3CHYA 2WZDA 1K28D 2A14A 1D2NA 1XD8A 1TQ2A 2FHPA 2JS7A 3NE5B 2HPVA 1RPAA 2QMHA 2VAXA 5GV7A 1U98A 1RQRA 1ZWLA 2QD5A 3EDYA 1ACMA 3OM1A 3R3ZA 5JWHA 1IBRA 2VH2A 3BZBA 3GB9A 3OLZA 2X0NA 5EPUA 1LDMA 1B3RA 4NJOA 2PO7A 1BDMA 2OLKA 2P1RA 3DFFA 1PUXA 1XYVA 2ACEA 4G4SO 4P2BA 3RG2A 5KEIA 4UEOA 3M6WA 3A9WA 3WGQA 2G4VA 4G5XA 1SIWA 4Y2GA 1VDMA 3WK6A 4E4YA 3LLCA 1GN8A 4C0AC 1C3LA 3LFUA 4CU5A 1UDXA 3DE3X 3K73O 3AESA 4NEQA 1ESEA 1ZRHA 1FUEA 1XRMA 4C2BA 4C0WA 4OLBA 1HE2A 1QF9A 1TKBA 2GCGA 2Q3LA 2ZYTX 3IQWA 3ZV4A 2WPDD 2OTJB 4R0VA 1V4NA 3EWNA 2Q9AA 2MSCB 2W2VA 1BTOA 1ZAKA 1S3IA 4WADA 2XDQB 3DZCA 4HIZA 2QTVA 1NUQA 3N2IA 3QLTA 4CT4B 4R9SA 5JJ5A 2O5CA 4AKIA 3BXGA 4F60A 4LVCA 2B8WA 3ZHYA 4ID9A 2EW8A 3PNLA 4HT3B 2YJ4A 3QE4A 1SUSA 2CDAA 3GDFA 2V7UA 2OUKA 4WT7A 3ZVLA 3AHJA 1RWMA 1J33A 2PKWA 3W2EA 2OD9A 1Q1AA 3WYNA 2R1TB 2GWHA 2WHXA 3QTBA 5DYIA 1Y3DE 4KXMA 3C6XA 3GJZA 3SZLA 4L57A 2PH3A 2YJTD 4KN6A 3IAM1 2RI1A 2KBFA 4HDRB 4YLEA 4YO7A 4Y6RA 2WD7B 4ND6A 4DLVA 1C9KA 1PJLA 3KL2A 1SKQA 1OBCA 2ZREA 3C5CA 1UWVA 1P9LA 4ND1A 1FNDA 2FEMA 2RJNA 3FGPA 1PK7A 3U6KA 4NK5A 1IBSA 3CR8A 1KZGB 4HDNA 5LSAA 1J42A 4QUAA 3CPWB 1FW8A 1E18A 3IE0A 2OFXA 3QX8A 3WLLA 1U5AA 2FPXA 4EJ2A 2ZT8A 3LPCA 3EF1A 4PZZA 2VI5A 2C0QA 3P0EA 3VI4B 1FJHA 5DN6D 3TLYA 1PFVA 4HJXA 1TIPA 5CH3A 3PQCA 4W8HA 4DG8A 1EYZA 2BN4A 2FSVC 1KH3A 2IYPA 2V1XA 3RY8A 4INPA 3WQRA 4MVJD 4JQZA 2ESRA 2B36A 3X1YA 1SQ5A 4TWZA 3D6MA 2QN2A 3P9RA 1UM9B 3QMMA 1W36B 1IJBA 4J1TA 2N46A 4UE3S 4D9JA 4FYXA 4J94A 5K2MA 3ASZA 4HQOA 1DC5A 1O95D 1TT5B 2V6BA 3M2TA 1O5OA 3ZKAA 4J3JA 3GLQA 2EFCB 1EVEA 3ESXA 1I10A 4NX2A 2LW7A 3FKSD 2CK3A 1HC7A 1KYWA 2YYAA 2Z8XA 1ML4A 2WU3A 4XR9A 5C3UA 2BI8A 4DC1A 3OQVA 1CVRA 2OHXA 2PWYA 3BICA 3C1UA 1P7YA 4RCYA 2B4AA 1EJ6A 3I6BA 3OPMA 4TPKA 2EKDA 4U0KA 3PK0A 4UXHA 1N3LA 2FMHA 2D4HA 2WG2A 3GVCA 3RTCA 4QPJC 4D4KA 1EDDA 4MUIA 2V9CA 2NO4A 4MVJM 5B7PA 1QU2A 2I1LA 5EQFA 1RWBA 4YUAA 3WWOA 4FSHA 1KQNA 4MP8A 1YZTA 2IKQA 1NJ8A 1PZXA 3G8CA 4GG1A 3SNKA 1TM5E 3AUTA 1EUCA 1WEHA 4X06A 1JSXA 5E7MA 1KH1A 3ROXA 1YE5A 4PS0A 1X1AA 1JSCA 1SY7A 2ZGVA 4JBYA 4M9QA 1QQBA 3FWPA 2WM2A 2XQJA 2C4NA 3GLFB 1V3QE 5L7YA 2FSFA 4OOSA 1SIOA 3JQ9C 3EUEA 2XZTA 2OP1A 2P6MA 3AIOA 3IH5A 4FGUA 4IFBA 4L15A 4CQMD 2XAAA 3VDNB 3FOFC 3F73A 3QBTA 3AF0A 1FDOA 4FQ8A 5DB4A 3TW4A 3N8IA 3IR7A 2AVNA 4YAJA 1WXFA 1G291 1GWNA 5HKLA 3IRUA 1R4MB 1XQXA 1U7TA 1T5EA 1EVZA 3AX6A 2INGX 2IYNA 3Q87B 1R8SA 2VDQB 3GEMA 4YR7A 5LQNA 3MWKA 3UMGA 1VCMA 1I2AA 4CLXA 1N6HA 1P2SA 3K6KA 4JFAA 4M0PA 3NAMA 4MKXA 4C30A 1E3DA 2XKKA 3ZS8A 1M7HA 3R4CA 4MKZA 4ITRC 4QNNA 5DWQA 1N8NA 1KZ4A 1L8OA 1VL6A 3T3GA 1XCLA 3TQRA 4Z53A 1VHDA 2G82A 4XE5A 4QDUA 3KVRA 1GQSA 1M33A 2H4HA 2VHWA 3ETNA 1E9DA 3OZXA 3ROEA 3T94A 2NV6A 2J7PD 4PLWA 4KRXA 1B6RA 1SVKA 3QVJA 1JSRA 2PX5A 1Y5MA 1GNVA 1Z08A 4XR6A 4FBMA 1QGAA 2QSUA 4X0CA 3RFXA 1F3OA 1E8NA 3CEMA 2QXYA 5TF4A 1PP4A 1SNYA 2FZ5A 3IVCA 3OFNA 1AKWA 4LYJA 2BJHA 4OBXA 4W8OA 3VZSA 1S4MA 3LI2A 1SHUX 5FPTA 3DCNA 4JMQA 3GX1A 3OPQA 3RSOA 4QQRA 3NHFA 2DT5A 2A92A 4GQAA 1EESA 3NHPA 4REQB 3UPUA 4UM7A 3GEDA 3Q9SA 5GY7A 1FB5A 2DBZA 2AUMA 2FI1A 3BHJA 2ST1A 4CQLB 2RCNA 1G6Q1 3GLUA 3ZHXA 2DUMA 3IP5A 1OH5A 5KO2A 1KK3A 2Z9DA 3VKFA 4UQLA 2P2NA 3QUBA 5KB3A 5AXAA 1JFLA 2J5KA 3H9JA 4BUJA 1M6YA 2D1RA 5FAKA 3PE3A 3R9IA 3OJLA 3V4SA 3OZVA 2WUGA 2VTEA 3NIFB 3TIGA 3Q15C 1GTZA 1UWKA 1EP9A 3D2CA 4WINA 2JVIA 3BY1A 3IMCA 2PMEA 2V55B 1FS6A 3ONNA 4IXDA 1W36C 1H3EA 4G8JA 3AM1A 1DEXA 4B4UA 1BEEA 1OA0A 3W2IA 1DC3A 4R1LA 1BMDA 2OAP1 1Z18A 2H2DA 3TZBA 3JATB 2JD2A 5K8VA 3ZH9B 1E3WB 4I50A 2FQ1A 2XYQA 1ZGBA 3CYFA 1XZFA 5GTDA 3R0VA 3AZOA 1Q81D 1EFLA 4WL0A 3JD1A 4WOPA 2LR0A 3LA8A 1RM0A 2JK0A 3BJIC 5JDCC 1IMOA 2R751 3C3DA 2XWSA 3BKXA 4ARVA 4KSBA 4AP6A 2QRPA 4UJ3A 3SJUA 4YAUA 4LQ4A 1KTIA 4MI3A 3ZW8A 1T6ZA 3N59A 3DDHA 2IYXA 2NU7B 3DE4X 3MTBA 4EJSA 5DI3B 5F4JA 3F7TA 4JL6A 3BK2A 2ENUA 4OMFG 4C2TA 4BGEA 1T9CA 2QN8A 4C2UA 3G23A 1RHJA 4KFUA 2WFZA 4CM3A 2XUAA 1K6MA 3GIDA 4LE1A 4M99A 3TSZA 2FEAA 3P4UA 2JA1A 4OY3A 1X1DA 3WISA 4NHEA 3IDOA 1RM4A 2QM8A 3KHTA 4BJ1A 1H4QA 4P8RA 1G4HA 5BR8B 1ADFA 1T6NA 1CQXA 3TTSA 4A4DA 4EPYA 1G5HA 3VAYA 2AOUA 4TM7A 2CMHA 1VSQA 2C95A 4WZAA 1IXSB 2CLSA 1KP9A 2ZCUA 3K0EA 4P5EA 4OXXA 5C1BA 2WU4A 1VQLB 3VSCA 1WMBA 1AV7A 4HR7A 3GN1A 2WT8A 1OXBB 1EXDA 2ZL5A 1JAXA 3O6VA 2YXPX 5HUJA 4D0RA 3WJ2A 3FCEA 4Q9LA 4CTNA 4ZREA 2V54A 3OCJA 1LBSA 4BBZA 5F4ZA 2J3LA 3OTQA 2DB3A 3EAGA 1Q0RA 2E4ZA 3P1JA 3OE7A 3QFCA 3ZU4A 2ZZQA 5L3ZA 5AJYA 1PJ7A 2A1UB 4FMCF 4C7XA 1FFAA 1WBJB 3U9SA 4Q3KA 2QG4A 5LB2A 4W9MC 1A4RA 1C3OA 3AL2A 2XQFA 4TTIA 2QDKA 4BQSA 4IHJF 4PR0A 3IMKA 1KE1A 4ARIA 1PN3A 1U80A 2JIPA 3HMKA 4MV8A 3G8AA 2EHJA 4BAGA 1QV7A 2OAGA 5CT5A 1QQ6A 1ZPDA 5BN3A 3VPSA 4XJXA 3KDPA 1RCTE 2AD1A 3ZWWA 4DLZA 3DTVA 3I2FA 5CB6A 2FFJA 1JLLA 2N9UA 4MRMB 4LXQA 2VHJA 3L2OB 3LVQE 4DWJA 1B8NA 2A88A 3FRHA 5JI2E 1KDRA 3SHTA 5M2QA 1U8XX 4Q9NA 3MRSA 4GZ3A 5BOSB 2C9OA 2DH5A 2OEPA 3K2QA 3P8ZA 1RKBA 4QHTA 4AJLA 2QL9A 4R81A 1T5BA 3F1KA 4PCLA 1UP7A 4RF3A 5FF9A 2BMWA 2PUEA 1I5RA 2FFAA 5KVQA 3PYMA 3S44A 3T0GA 1Z75A 3ZIAD 3K1YA 3GWZA 2BGKA 4IFTA 3IPAA 3R6DA 4TMFA 5EOVA 4MRAA 1VPLA 4D81A 1N5JA 3JYNA 3M9WA 3K1AA 4KKTA 2IC5A 1MORA 4CQMB 4BC0A 4GOJA 3CVOA 1A50B 2M6SA 3H7AA 1M7GA 4CBVA 1ND6A 3H2IA 2Z6UA 5DS0A 4AN1A 3CWZA 4LV5B 3EVBA 5HCUA 3LH5A 3OT4A 1OD6A 4HXGA 1DRKA 1ZNZA 1GTL1 4GXNA 1L3IA 3LW8A 4PZLA 5BSEA 2D3TA 2L17A 4GI3A 4AZ0A 1MB0A 4DWVA 3HB0A 2JJ1A 1VJCA 2QD4A 4ZQIA 1R74A 5CDFA 2GREA 2VK4A 3HYNA 1HYBA 2CV2A 2P3QA 1N6KA 2R48A 3DVLA 5ALQA 4N12A 4J2HA 5EN4A 4KN5A 1V6CA 5LMCA 3U0VA 4UZSA 4AMVA 4RY9A 3H99A 1LLCA 2PS1A 4RM2A 3WWPA 4POOA 5JXHA 5MN5A 1E8DA 5H80A 2WJWA 3U3OA 1NJ1A 2B78A 5K1ZA 2ZTLA 1YZQA 2I65A 4OQPA 4DYHA 1VLOA 1WD5A 3P2JA 3RYIA 4DNPA 5E6RA 4LF9B 1ONBA 4NAUA 3TGPA 1BXKA 4D4IA 1JFRA 2OQ2A 4ER3A 2V74B 4PANA 3Q3IA 2OSBA 3E1SA 3FWZA 3EH1A 3RTEA 1UKYA 2Q41A 3TLXA 4FIDA 3BJZA 3CLTD 4CMEC 1H66A 3I01M 3CXRA 3L8MA 2DT8A 4GR4A 3ET5A 5IT9A 2A8YA 2E21A 4Z8XA 1HEUA 2BONA 4BO1A 2ODPA 4AMUA 2G1UA 2OD7A 4U8HA 4PFKA 3BE5A 3VOAA 3RBZA 3QYAA 1CY4A 3RUPA 1GPLA 1NMEA 3C3KA 2GEVA 3PNVA 3N39C 4HBGA 3E53A 3TNJA 1F4VA 2H1CA 3I9KA 4YP1A 1IZZA 5LJLA 5AVSA 4J0IA 3CCSB 2VBCA 3CEAA 2ATVA 2JFVA 2X9NA 2G5CA 1YJWB 3ISJA 5E7QA 1V9CA 3BDIA 4O0MA 2R5WA 3OZUA 4JP2A 4X5OA 3U4HA 2EBFX 1QHIA 2GS9A 4CIXA 3B3FA 5AOCA 3K6SB 4I55A 3UVEA 3MS7A 2OO5C 2J08A 1TKRA 5G1OA 2R87A 3DV2A 4B7XA 3B6JA 3K8OE 4C1BA 3VR6D 4DRYA 4GVXA 3RASA 1QRDA 3L6EA 1I32A 4WNCA 2BFEA 1XRQA 4OQEA 2R6R1 3KUXA 1TA0A 3FNBA 4NP6A 2AFIE 1Q20A 3A1EA 4PXSA 3UAWA 4BNGA 3L7DA 3LY7A 1N2OA 1UFKA 4TMYA 1U28C 3RAJA 3VV2A 1U5BA 1A69A 4Z9AA 1GPWB 5FAXA 2WF5A 4F92B 4H17A 1HA3A 4FT4A 1T4MA 3UXYA 5IYNA 4FGLA 1T10A 1P0FA 2A5GA 3E9EA 3PDWA 4IZHA 4MR7A 3MWEB 1GAWA 3T61A 1ZM4A 1YQEA 4RQTA 3HKDB 4BNVA 1NBOA 4CM8A 1IUOA 2VP3A 4B6QA 4G0UA 1Z29A 1S01A 4OXKA 4M1MA 1ZVMA 2EJBA 4R8KA 3KQUA 4LFBB 4M1ZA 4OKIA 3DNMA 1T4BA 1IQPA 3GT7A 1GR1A 2EW2A 4YUVA 2X4LA 5FWNA 2HXSA 1IXZA 2H07A 4N5MA 2XLBA 1T1RA 1WXXA 4R5HA 2VL7A 2ZRIA 1X7YB 4Q4JB 1ZCZA 3USES 3SVLA 4Q3OA 1SXJE 2CNWA 3U44A 2HUNA 3WBBA 3ZV5A 1RW4A 4HVCA 2ATCA 3LKZA 5LP6C 2O8BA 4IGFA 4OXQA 1KI2A 3TK1A 3WNVA 3ELYA 5HNKA 1RHQA 2JEZA 2V6GA 1U2DA 4R40A 5HIKA 1T5HX 3HV0A 2VJAA 1D4AA 1Z6TA 3EBOA 1JS1X 3L4BC 3RODA 4C7MA 4PYKA 1KMMA 1WHTB 3E03A 4X44A 4EG5A 1FUKA 4HS4A 4UOEA 4DJFC 3IOEA 1QVRA 3KB8A 4N0PA 1R9GA 3V3TA 1H6AA 1NSYA 1PF7E 2DPYA 2ZE6A 4UPEA 3CPJB 5I4KA 5EYPB 1G8KA 4QEDA 1J2EA 4V0RA 1EM8A 3B9PA 1O5IA 4NBNA 2FN3A 2CXNA 3DEIA 3GEHA 1OQAA 2BMJA 3ULKA 3N8KA 1NV8A 5J4HA 1BDBA 4ZT6A 3K53A 1NVKA 2HK6A 4DMCA 4YRSA 1YJ9B 1KSHA 2BELA 2WTXA 3ANNA 4NOKA 5DP2A 4W7SA 3CXCB 1EX1A 3GELA 1U1CA 4US0R 2LP4Y 1TMGE 3IS3A 3K32A 1JUDA 2CCJA 4RD6A 3IUBA 2AVDA 4PSVA 1P62B 5CDTA 1AQNA 3RYCB 5J1SB 1B73A 5BYJA 3QE3A 2IEAA 1N5DA 4F2GA 1ZUNB 4HGYA 2YHUA 1GZ6A 1J09A 5EXXA 1Z0AA 2JFFA 3JARB 2Y93A 1KBZA 2K2WA 5TPWA 4X8MA 2JFBA 3R7LA 3D6NB 1TA9A 4ZYTA 4ENQA 3GUZA 3CUVA 1IVSA 1L4EA 1RHUA 4IHAA 5BNIA 2D0DA 1Z5GA 3KSAC 3R7DA 1KY3A 1NASA 2FKNA 1NJID 2X2OA 4CQJA 4KBYA 5BUCA 3D0OA 2C7OA 1NXOA 2C2KA 2WT4A 4RBNA 2HGSA 3OUTA 4M60A 2IPAB 3CN7A 3JU4A 1JAHA 1UXGA 4NJEA 4P54A 1ZZGA 4I9HA 4EKNB 5JMPA 5IZCA 1X2BA 2O2HA 4GMHA 4E5MA 1PL8A 2LIPA 1X3SA 2BGWA 4B48A 3MAAC 1U4OA 4I8DA 2H7VA 2R79A 5DP1A 3RF7A 1F2VA 4LDZA 4B9EA 1DQZA 5DJ5A 1SB9A 4RVSA 2I7XA 1D0SA 3EZNA 3LM8A 2ZRCA 4Q24A 2QY9A 3D8RA 3EZGA 4PC3A 5AJWA 2ZSDA 3BTUA 5JZVA 4LSZA 2C9YA 2LNDA 1M3SA 4I66A 3LGSA 3AB8A 4LMBA 2X4IA 3LO8A 2RHGB 3E7DA 4GO1A 4P92A 1L4KA 4FS3A 4PLFA 4ZVVA 3THWB 4ZJZA 1VHTA 2HKIA 1JR3D 2XB8A 4G65A 2AOTA 3P52A 1K0FA 1XU7A 4LMRA 1U3DA 2VT6A 4IJVA 4RVHA 2GF9A 3QPCA 1P9RA 4AZWA 1ZUD1 2FY8A 1H2XA 2VNAA 1FX0A 3FTCA 3PNYA 3G59A 1AXGA 1II9A 4KX3A 1F14A 2QJRA 2YW2A 2M5SA 1D1TA 2H31A 4DCOA 3HKBA 2FN9A 3V9PA 5DNWA 2R4QA 2B4KA 3DZJA 4R3WA 4XVQA 3NBAA 1U7WA 2QTAA 1BE1A 3T12A 1NKVA 1GARA 1QIKA 5E8RA 4XQCA 5HFAA 4DRXB 3UKJA 3ZE2B 2FEPA 1RC0A 3EVDA 3L0ZA 4HVTA 1ZINA 4X92A 3GY0A 3UAXA 3UG6A 4IQ4A 1RXVA 4KRGA 4DLBA 4M76B 2VBUA 5F64A 1GRVA 4OQLA 3S1AA 4YWJA 1NT2A 2Q5QA 3GRPA 3L0OA 1W4BA 1SULA 1E7WA 3ZWQA 1FMLA 3E8SA 1Z15A 2QE6A 1KC8D 3L0BA 4QLOA 5HJ5A 4IEEA 2X8JB 2F2TA 5CNJA 1Q0HA 1ZEMA 4AKHA 2VKQA 1EEXB 3BGDA 1RI3A 4DAOA 1OIXA 1BFKA 2PZMA 2MINA 3TQOA 2XT0A 5I45A 1H9CA 1KU0A 3E15A 2PCLA 1X9IA 1CUUA 3OOHA 5ANRB 1ECLA 4XYBA 4D2IA 3HCFA 1GN9A 3LVFO 4D4GA 5E4TA 2JGDA 3DWFA 3O8LA 2ZJ6A 1YTLA 1L5WA 1JA1A 1QZUA 2P77A 2P8JA 3A1WA 3NM4A 3OY7A 5D3MB 4EKEA 1CYEA 3QLVA 3U7QB 2WF6A 5LMNB 2ZSAA 4ER6A 2OXFA 1HFKA 3E82A 4OHVA 3C7CB 4DA9A 1FVXA 4CUZA 3Q3EA 3JZDA 3T1NA 5JLJA 4YRQA 1C80A 2JARA 1PZGA 1G19A 4QWMA 3U4QB 1W9HA 2PE5A 1G20A 4CMIB 2OO3A 3VISA 4IQGA 3NXKA 5KKCA 1YBAA 4CKBA 3BJMA 2FDXA 2WR8A 1G7TA 4NOJA 3TXYA 3A9RA 1P4MA 4QARA 3UJAA 2VLIA 5A3QA 1FMCA 2DOGA 2J3EA 3WLHA 4H7PA 4ETIA 1PV1A 3PUYA 2O4UX 2LRHA 2WTAA 4IIHA 3M3HA 4G6IA 3QV2A 4MKFA 1H4SA 4YJDA 1IJKA 1CDDA 4EZBA 2ZJ3A 5F3RA 1G5QA 1UXOA 4JYMA 1FS5A 3IHLA 4WECA 3G85A 4DG5A 2EYQA 2JH8A 3P9CA 3OQIA 4W5HA 1J9EA 2HOQA 1U7XA 3AGPA 4E5UA 2NU8B 2DJ5A 3DONA 1CTQA 3I3SR 1UDAA 4E08A 1LF0A 2GJ9A 4EY3A 2BRUC 2HSGA 1P0IA 2CDCA 2F9FA 2GPAA 2OC4A 3FYCA 1ZD2P 1KVSA 4V0LA 5HKOA 1UD4A 3LV8A 3MTEA 4E88A 3J81k 3R7WB 4B33A 1EA7A 2YINC 4P98A 5CB0A 4I50F 1FQKA 2O2IA 1VZ2A 5DNEA 1D3AA 1KDPA 4KJXA 4QQ8A 1MGPA 1A9ZA 2YY6A 1JG1A 2ZU0C 1XJCA 2GN4A 5F76A 1L5HA 2OBTA 1RLOA 2DH6A 3BULA 2H4XA 4KQXA 4TTQA 4Y2SA 3MZ0A 4ITUA 5AR1A 1Z7WA 1KY2A 3U56A 4J1QA 4UM5A 3AEUA 1HLGA 1XZHA 1PJAA 4B74A 1POWA 3C5VA 2FG7C 4HB4A 3WIVA 1HTWA 3HVUA 4XFKA 4B7AA 3UAOA 4M8KA 1T13A 1EUYA 4QHYA 3NVAA 4UBJA 4EP1A 3AF1A 3LKVA 4PLTA 2H1SA 4DQLA 2DZDA 5D87A 4YJ2A 3RROA 4G25A 2YHIB 1ODTC 4W1PA 3PWZA 1U4SA 4URUR 4ZHQB 1GYPA 1DAMA 4TROA 1QE5A 1WW2A 2VF8A 1P7PA 2XRMA 5C5DA 2UYHA 3BCUA 3CZCA 1GQFA 1Q2XA 4RKWA 2DQ4A 3MD9A 5BSTA 3P9KA 4A0GA 4B3FX 1J39A 1ULSA 2ZANA 1YHQB 2W58A 3TNYA 3NWBA 2Q0HA 3E84A 3PGMA 4FFBA 4N82A 3CMCO 3DZKA 4A26A 1KQOA 3A0RB 1PJ4A 2I4NA 4MYRA 4ARAA 1UKVY 1VJGA 1Z45A 2FOXA 4ZEXA 1QLHA 2BEUA 3G6EB 4JFRA 4YUYA 5KTYA 1YMQA 3LO5A 3WS7A 5L53A 1G8PA 1EWRA 2VSXA 4PGGA 1PJCA 4IIJB 5BXYA 4I81A 3S2UA 3OIVA 2JH3A 2NQTA 3K0FB 3R8CA 1V5VA 3K0CC 621PA 1U3TA 4S12A 4A0FA 5ESRA 1ZS9A 1P91A 3U81A 1KRWA