4RD3A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gdp and pi
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 103
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd3A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd3A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd3A01
2ZRNA 1YZUA 2LKCA 3PUVA 2OESA 4LV5B 1N5KA 3VR4A 3EPLA 1SXJC 4IDPA 1XCGB 4JSTA 3MGCA 4Q48A 1VQLB 5JI2E 1XD2A 5IF9A 3ADCA 1G21E 2R6HA 1G20E 4DSUA 2WWWA 1UBCA 4C2UA 2NIPA 3H86A 5AJXA 2V54A 2EYQA 2D7DA 1OF1A 5DYIA 4Q1EA 3CRVA 4UNNA 2XJ4A 1ZM2A 4LJ9A 2AXNA 4HB3A 2DFKB 1VQ6B 4Q4LA 3RHFA 3NBXX 1VG9B 3HPQA 4AIIA 2Z43A 1QG0A 4JLBA 4US1R 1T8TA 3NIBA 3RWOA 1LF0A 3VHLB 1G41A 4B73A 4JJKA 4H1VA 4A0FA 2C04A 3TUZC 1WE2A 3EWAA 3ETLA 1QHGA 5FOWA 3TVDA 1YZTA 3CNOA 3AGQA 1YR7A 1ZU5A 3CWQA 4PTLA 3F5FA 3GLGE 4A36A 2O8EB 2FN4A 3CKLA 1I7PA 5JHHB 4OQLA 3MWJA 3U3MA 3K0AB 5CYOA 4QL3A 1Z8FA 4EQ6B 3WHLA 1E2NA 1RJ9A 1EP2B 2GZAA 2FFHA 4K8OA 3SJBA 5BQ5A 3KKPA 4ZO4A 1YVDA 3FOZA 3DHWC 5FOVA 3BOSA 4OQMA 4B4DA 2IBMA 4MRRA 4MYHA 2XNCA 2JAQA 1AZSC 5JCZA 4LJ8A 3QF7A 2UVQA 2VBCA 3ADKA 1JJ7A 5GVRA 3ZLJA 3LVRE 2KBFA 1KAOA 2FGKA 1IY2A 1E0SA 2MSCB 3PUWA 1BIFA 1YRBA 2A5FA 2VHQA 2ZI5A 1UKVY 1A5TA 2F1IA 1CJKC 3AF2A 3U4QB 4BQSA 3QKSA 2CNWD 4KBFA 1L4UA 3ZS8A 1NVVQ 2I1QA 5LPNA 3IKJA 3NXSA 1G8FA 2BJWA 1AS0A 5EXPA 5DH9A 2YV5A 4Z8YA 1X8LA 1MABA 2ZSFA 2FFAA 4OHWA 4X8LA 4XD7A 1KZGB 1KI6A 3W34A 1XTSA 1S0UA 1KO5A 4FCVA 4W7SA 2GAAA 2YKGA 4XWAA 4JYBA 4Z51A 5SZIA 1W36B 3PUZA 3B13B 1PUJA 4F7WA 1TUIA 2EQBA 4JS0A 1TQ2A 2V4ZA 3GJXC 2BVNA 4J0QA 3BE4A 1CR2A 4P31A 1T3HA 2C8VA 3CZPA 4U02A 3A6PC 1G4UR 2BKUA 1FMLA 4TMKA 1ZM4A 2NTYC 4Q03A 2F43A 4AYTA 3KKQA 2BDTA 1H8ED 2ORWA 4BFVA 5HTKA 3QEJA 4IXMA 2CL7X 2YWGA 4ACBA 4RD3A 4M9SA 4V02A 1XD8A 2IYSA 5FUVA 4M8NE 5F9FA 4HATA 3VMFA 2EFHB 3NDPA 1OLOA 2F7SA 1RRCA 3ZS9A 1G5RA 2CLSA 1NVVR 4Q01A 2JLXA 5B30A 1G7CA 4PZZA 2YYZA 4TMZA 3KB1A 2ZJ5A 4EAQA 1KI2A 1IAQA 3CPJB 3CRRA 4GZMA 2P6UA 4YC7A 1SKYE 2W83A 1P9NA 1R6BX 3Q85A 5BYJA 3BJIC 4O25A 2ZVPX 1A2KC 1GL6A 3NC0C 1QX4A 1D2NA 2ZSEA 5DI3A 3PVSA 1S72B 3X1DA 4Y7CA 2MMGA 2XJ9A 2XTNA 4M1OA 4ZKDA 3RS0A 4TLEA 3W2EA 1CQXA 1G19A 1KK3A 2ORVA 4E07A 4IJMA 4C2TA 2IT1A 2WPDD 2W0SA 4KFSA 3GLHA 5C2JB 3S1AB 1SXJB 4KO8A 4AD8A 1E9BA 3M0EA 4DCUA 1VIYA 5DO9A 3T34A 2NO7A 3CX7A 4IEIA 4LJ4A 2BMFA 3CO5A 5E7IA 4B3BA 5FUYA 2NO9A 1ZUHA 4MDEA 2ZE7A 5GV7A 2ZI3A 4C9BA 1HQYE 1OXUA 2DFTA 2OUKA 4L15A 4B2LA 2Q9BA 5CB8A 4FWTA 1Q3TA 1CRQA 1GTVA 2X3UA 1RE0A 3A1UA 4NMMA 2PLRA 1Z28A 5DNYB 2ZS8A 1O3YA 4YHBA 2NGRA 1YI2B 1JPJA 3GCGA 4IDQA 2IUUA 3PCRB 3TR5A 3BB4A 2R65A 4DWJA 3JVUA 3PUXA 2ZRCA 1S9HA 2GJSA 1FNDA 4KU4A 1P75A 1SXJD 2PT7A 3W5IA 3DZ8A 5HR5A 3CPWB 4DLVA 2RC6A 2ZJ8A 1F2UB 4W5HA 1WBDA 4FW9A 4XWKA 4PC1A 1TF7A 4OQFA 3OEHA 1TF5A 3SHFA 4OI4A 1IXSB 3AF1A 2B8WA 3OEED 3T5GA 4OQXA 1VQ7B 1IN5A 2D62A 1NIJA 3VR1A 1AMOA 3PJRA 3TKLA 2WJYA 1Z63A 1AS3A 4BRUA 1E2JA 1U8YA 1OXVA 3O8CA 1SVMA 4BEJA 2GJ9A 3VNVA 3B5JA 4Q4HA 3ZD6A 4FMDF 1JJVA 1OIXA 1GR1A 2B7CA 3HDTA 3TAHA 3SOPA 2GVZC 2Z4SA 1ZM9A 4Q7MB 5FPKA 3AM1A 2CNDA 4NKRA 1IHUA 4E09A 4JIMA 5LB2A 4JBWA 4JYCA 4DDTA 4TMTA 1E9EA 4WOPA 2VTKA 3LX5A 4AY2A 2CHVA 2AKYA 4K46A 4WBSA 3DKPA 3ADDA 2NPFA 1R4AA 2ZI6A 2FOLA 1MT0A 4XWOA 2WM9B 4JLOA 3OZVA 2BGIA 2WJHA 3A1TA 4ASUD 1WCV1 2P6NA 3THOA 1DEKA 1E9AA 3AF0A 4OYHA 4QJ3A 1BX1A 3MMPA 1GILA 1Z83A 4PAQA 1P73A 3F0TA 1FUUA 3UIEA 3KKOA 3ASYA 3NHBA 2GXUA 2IUSA 4B33A 3AF3A 5CDFE 2A30A 1GL9B 2FZLA 4CRWB 1IJEA 2BKEA 2CHQA 1K5DA 1OFIA 1KSFX 4QRHA 1EK0A 1E0AA 2RGNA 3P1JA 1Z0KA 2QDXA 1GKYA 4D2IA 4AK9A 1NN0A 1XPRA 3BK7A 4TL7A 2FE4A 2BJVA 4HAWA 3UG6A 2FG5A 4ZDJA 2DB3A 2B6HA 1N0UA 1DVRA 1FNNA 3C16C 1ANKA 4KYUA 4RVCA 5JJLA 4G1VA 3KTAB 4KV9A 4DHEA 4DSTA 2FH5B 4KLZA 1EG7A 1CXZA 2GJKA 1IOZA 3WMEA 3K9GA 1E1QD 2QA4B 2VSXA 4LPSA 4QC2A 4G5GA 1HH4A 3RS4A 3ONWA 1NNEA 4TQ9A 2O8BA 1VDZA 4DIEA 2AXPA 1GKIA 1XTJA 3RANA 2CNWA 4B6FA 4N3NA 2FPLA 3B7GA 4MYTA 1EFTA 3OE7A 1ZC4A 2RHDA 3LAWA 4IEEA 3WY9A 5EP4A 1VQNB 2ZUCA 1BQEA 4DVGA 3DZDA 1DPFA 5CB6A 1DADA 1VQMB 2QN6A 3UMSA 1CU1A 3P32A 1R0WA 1FQKA 4KSBA 5B64A 3QFTA 3CC4B 5TMPA 1UKYA 1QF9A 3OW2B 1MRNA 1N0WA 1KI8A 5EXXA 3GEIA 2IS4A 1VIAA 3OZXA 3RS2A 1J2JA 4L9WA 4YQFA 1TQDA 1NBMD 4BLOA 4D25A 4CIDA 4EQ6A 2VP4A 2ZI7A 3NBYC 1W87A 2AR7A 2REOA 2WBLC 1JPNA 2F43B 2WHXA 1LV7A 4DB4A 4PPQA 1YJ5A 1U0JA 1G5PA 5THXA 3VTKA 4RKFA 1FTSA 1QFJA 1G3QA 4DDWA 5FTMA 4LZZA 2OBMA 5FTKA 4K1XA 3EIQA 4IDOA 2QGZA 2FDCA 3ZYCA 4A8JC 2QQ0A 1E79A 3UG7A 4LC1A 2GQFA 3L82B 2GJAA 3C7KA 2HF8A 1W5TA 3VNUA 5D3MB 1TVCA 1II8A 4HE6A 1FNCA 2TMKA 1FP6A 3SNHA 3LWNA 4PANA 3TSOA 3I5YA 1XE1A 4LOAA 1Q1ZA 2FFQA 2VLIA 3ZVLA 4PFSA 4U5XA 3LXXA 2VIIA 2IYZA 1EFCA 3K0EA 4PGOA 2IYXA 2J0QA 1Z6AA 1DAMA 3B2EA 1GJRA 3FB4A 4FMDB 3TQCA 3W5HA 3K09A 2DWOA 3WBKA 3K1JA 3P4YA 3TR0A 3VR2A 4YAFA 5H5JA 2QU8A 3QG1A 1R5NA 1HTWA 3LXRA 3QENA 4DLZA 1TNDA 1J8YF 4URXR 2BSAA 2JATA 3U7EB 2GK7A 1G8PA 5FOUA 2ODEA 2ATVA 4OHXA 4Q5IA 4BUJA 4TMVA 3L8YA 5TARA 1KI3A 5H8WA 2Q3FA 1JR3A 4GDFA 3E70C 1EWRA 3WNBA 4QGHA 1Z2CA 4NPHA 2R9VA 4TTQA 2ONJA 4Q7LA 621PA 1N0VC 4YONB 5G3ZA 5JLJA 4Z54A 1F2TB 4M21A 4MYCA 4ZPXA 2WWHA 2HT1A 2YOGA 2J5XA 4FXPA 4OI2A 4RCYA 2NQ2C 1EFRA 2Z83A 3C5HA 4QOSA 4MKIA 4OK3A 4MRPA 4TYPA 3LA6A 2FSIA 4IDNA 4Q4HB 1XPUA 1G64A 4WXRA 1QZXA 1XXHE 1EWQA 2IEYA 8OHMA 3RSLA 2G3YA 5G40A 3CF0A 2C5LA 2QE7D 1SHZA 1OH5A 1DAHA 1NG9A 5JRJA 1G16A 3HU1A 4PHFA 4A0RA 1J9ZA 3MHPA 1DAFA 1VCNA 1S4QA 2Y8EA 1QHYA 2H18A 4XSHA 3ASZA 3NG1A 3QPUA 4YLGA 1GIAA 1UEIA 2ZQ5A 2A5GA 3U6KA 2QM8A 1E2LA 2YOHA 5FL3A 4LYHA 1FDRA 1M1YE 4GMXA 3NWJA 4O2LA 4B3CA 3REGA 1YRAA 1S1MA 1JAHA 3VX3A 2GXSA 3QVUA 3ZVMA 3EPJA 4OHYA 2WICA 1LW7A 3QPVA 4O3MA 4CEJA 4DLRA 2BGJA 4HAZA 4CEIB 4GRAA 4V0LA 1RRFA 1YZKA 4AF7A 3HPRA 3RC3A 1QHHA 1JECA 1GNQA 1N6KA 1VHLA 5EUQB 3R9WA 5AJVB 2NMVA 3GLHE 1N6OA 3N2IA 5AJYA 3U7HB 1E2FA 2WKQA 2OHFA 3BORA 1U2RA 2WVJA 1KJYA 3QY0A 3CX8A 2P67A 2V8OA 2EFGA 4TL6A 2RCNA 2HLDD 3LBHA 1FX0B 4YAUA 3EIEA 4KVGA 4ZI3A 2ZYWX 4EFNA 1G7SA 1CNFA 3B1XA 4QHTA 5TV2A 1QBKC 1QG4A 2QAGB 1F60A 2KJQA 1FNBA 3ZIAA 5E7JA 5HCIA 4RD0A 3G82C 3NHAA 2OG2A 4FCTA 2J7PD 2ZROA 4MYUA 4GOJA 4KYIB 2QTHA 3W8RA 4PPGA 1TPZA 2A78A 1IY1A 1NKTA 1E96A 5HKKA 1RRGA 4IW3B 1E2QA 4MUBA 2NZ8A 3SR0A 1HEIA 4G0NA 3FHOA 3UMFA 3VX4A 4NYMR 3CH5A 1P72A 4HUQB 1VG1A 2DHRA 4II7A 4FCWA 1D8TA 4JLVA 1YKSA 3D7MA 2EWVA 1S9DA 1I4TD 3EZFA 1QDEA 5DI9A 1GKUB 4I99A 4IKEA 1XJCA 2UZ3A 2O8BB 3TSZA 3AVQA 3JZMA 1U0LA 4LBZA 1Z0FA 2BN4A 1QVRA 1G4AE 1RKBA 1T3LA 3A58B 3BH7A 1BYIA 3THWA 3LNCA 2R6GA 2WV9A 4B6EA 4BLTA 3I3SR 4JKIA 1W0KA 4EUNA 3AVXA 3CONA 5FUXA 3A36A 2IYLD 2NZJA 2QI9C 4MRVA 3TUIC 3QJYA 4EFMA 5HZHA 5GJBA 2IWRA 1KDTA 1T91A 1FX0A 4JLAA 5BN4A 1NF3A 1Z6TA 1XMSA 4Q9LA 5G53C 1PV4A 4WZAE 4PC7A 2ZRMA 1KOFA 3IGFA 2QMUA 2OFOA 4M22A 5J5CA 2GWHA 4POAA 4AC9A 1J8MF 1E0KA 1AN0A 4ZV4A 3IILA 2DFLA 3LV8A 1W48A 4A2WA 3MJRA 4URYR 1AJEA 1XEWX 2UZIR 1IB0A 4AKHA 1NVXQ 4A2QA 4WW0A 1MH1A 3CB4A 2OK7A 3L0IB 3U3KA 3K9NA 4JKYA 5JWHA 2W6JD 2ZRKA 3EWSA 2J46A 2ZS9A 4NYIR 3MSXA 4FMBB 4CEIA 1RJ9B 4C0AC 4K81B 5FPYA 1NI3A 1AQYA 4JT4A 2J0SA 5JJKA 4R7ZA 4JBXA 3PXGA 1TL7C 1QUEA 5CLQA 3GJ6A 3TBKA 1T0JB 2ZVQX 2IYQA 4MRNA 2X8AA 3ZZ0A 3PEUA 4LCBA 3CCEB 2WKPA 821PA 2O0HA 4Y0VA 1V5WA 2BHRA 5KOYA 5FI1B 3P4XA 1PJRA 1CTQA 3TW4A 5EXSA 4A0GA 4DQLA 1JAIA 2DBYA 4CT5A 2CJWB 3U3RA 5EJEA 2BEKA 1KJZA 2YWEA 1U0HC 3M1IA 2IWHA 1Z08A 2P2LA 2QEXB 2ZE8A 5FUWA 2DWPA 1UM8A 2VHUA 1F20A 4UNRA 1VKJA 4I4LA 1D2MA 3B1ZA 3PFIA 4U00A 4EPVA 2PMDA 4B48A 2OFWA 3DM9B 2ZJ2A 3QKUA 1KQSB 2ERXA 5SZJA 4JVMA 2WIBA 4A8JA 3U3JA 1XJQA 1J70A 2D3WA 4TMXA 4I1OA 2AWNA 3GJ5A 4RFSB 3DPUA 1P7CA 3CCJB 3KDSE 1M7HA 2QGNA 3O8DA 1FUKA 3EX7C 4LDJA 2PMKA 1TQ6A 3DEFA 4I1UA 1BH2A 2ZI9A 5BN3A 3EIHA 2F1RA 3RS7A 1EGAA 4PAMA 4B44A 5FA6A 3FWYA 5G3YA 1WF3A 1KSGA 3GQBA 4EPXA 1P3JA 4D26A 3CF6R 1UBGA 3I55B 4N0EA 4A6XA 1R8SA 2ZRAA 2IA5A 1US8A 4C0QC 5HCNA 5H70A 3MCAA 2ODNA 1XZQA 3FHTA 1SM4A 2J3EA 1G6OA 3LX8A 4ESVA 2XOKD 3ZD7A 3BBPA 3SJAA 5J4LA 1FQJA 3Q72A 2BMJA 2ZIAA 1XX6A 5KUTA 3VKHA 2OSBA 4BFYA 1S3GA 2ZUBA 3IPYA 1Q20A 1N5IA 2WPDA 3NH6A 4QBHA 4HE5A 3NDBB 3GLFA 3AVYA 3HU2A 4AKEA 2VYFA 2REBA 2KE5A 3FKSA 2H92A 4RFVA 1FOEB 3V76A 3B85A 4GBMA 1CKEA 1XTQA 5FBLB 4MDFA 3H1TA 1PVOA 1ZW6A 1M8PA 1BX0A 4LBWA 4N3GA 2G1KA 2VF7A 3RWMB 4BEBA 1H8EA 1KHTA 3CCRB 1FPMA 1ZC3A 2VH5R 4KSCA 4ZI2A 1SKQA 4BECA 4DJTA 3TIFA 1Q21A 2XGJA 4HAUA 3FPAA 5E95A 1H8HA 1VQPB 1JEEA 3SYLA 2QZ4A 3KUCA 1C1YA 4D4MA 4TWZA 2I1VB 4GPTA 2J1LA 3W3ZB 2ONKA 1UBFA 1TUEA 4WQMA 5E7MA 4Q21A 1KI9A 2R6AA 3C5CA 1UAAA 2BV3A 3W5UA 2FSHA 2F1HA 1NN5A 2PL3A 4O0MA 4CW7A 3BS4A 1K8AD 4XJXA 2VNIA 4NP6A 5H1YA 1A4RA 4AG5A 3SDZA 5TR9A 3VHXA 5EP2A 4D0GA 1GNPA 1W2BB 3QI2A 1OE0A 4IOMA 5FPSA 3CRMA 4F4CA 4NL4H 3OEEA 1OW3B 1NMZA 2JJ8A 3IUYA 4ERNA 3THWB 4G5QA 5CK4A 2ZRFA 3SYNA 4P32A 5D3MA 4EDHA 1E32A 2J0UA 1KI6B 5EE5B 2R2AA 2ZJOA 3TMKA 3PEWA 1Q12A 3KQHA 5JMTA 3S1AA 1GAWA 5CM9C 4Q7KA 2CK3A 2N1BA 2REXB 1LFDB 4WA7A 5DYGA 1CLUA 5JWRA 2CMKA 3THYA 1R2QA 3UANA 1RW4A 3SS8A 1X8JA 3QQ5A 1KNQA 4GP7A 3RS3A 4CGZA 2YJTD 3AP1A 2J87A 4G01B 2GXQA 5H68A 4PHHA 2FFBA 3PEYA 3WNDA 2G83A 4ZDKA 1YIJB 2O8EA 2GCOB 2GAOA 2JLSA 1KRHA 4I1SA 3TGPA 4MGZR 5KSOA 1B0UA 1KKMA 1R5BA 1JALA 3W6NA 2AL7A 4B3XA 1E62A 3CC2B 5FBWB 1KO4A 3GLIA 2AD1A 2N46A 3GJ3A 1I4LD 1HUQA 3FDIA 1HV8A 1SVOA 2ZRHA 721PA 1U98A 2DERA 4NHOA 2K5UA 5BWMA 3GMTA 3C8UA 4M1WA 1WQ1R 4URWR 1A1VA 3O8RA 1JEDA 4NYMQ 3DM5A 4IRUB 2RGGA 1P2VA 1Q22A 4LY6A 5TB5A 1B2RA 4B2IA 3HYTA 5FOTA 3W8NA 4W9MC 3I92A 3GJ7A 4IVPA 2IHYA 4IOKA 4TZ0A 2B8TA 3PIRA 3IEVA 1XP8A 1P2SA 3NKVA 2CCJA 4DEXA 3F8TA 1E9FA 4URUR 5LD2C 4B75A 3W6PA 2QPOA 3KQLA 1XD9A 5AJWA 3MWYW 2JCSA 4V0NA 4DUGA 5JI3E 3KQNA 4NTZA 2AKAB 3QBVA 5FR2A 2G77B 5IRCD 4CEHB 3ZBUA 4BPBA 4P4UA 4P0TA 2GF0A 3AP2A 3QIAA 3TUJC 1KGDA 3VKWA 5KYKA 1NBME 5DISB 3TVTA 4RD1A 4DDVA 2QTFA 1VCOA 2CE7A 1VCIA 4Q66C 4DLYA 1XWIA 2ZTSA 3U3OA 5J4VA 4CEJB 3LO5A 4M4SA 3HP1A 4FWIB 1TEVA 4PHTA 2WOJA 5CDFA 4HI0E 4QGGA 3AB3A 4F7DA 1WBBA 2QY9A 3W2GA 1ONBA 2PBRA 2W00A 2XNSA 3W5JA 4US0R 2ORIA 4DXAA 1U8AA 3GLGA 2FMXA 5FBVB 3CNNA 4ABYA 3U2QA 5JJIA 2ZEJA 1MOZA 1Z29A 1Z6YA 4Q1FA 1K5GA 4LWZA 1KK0A 3IBGA 4M1SA 1KK1A 4HUTA 3G71B 2Z0MA 4DLTA 1Z3IX 1OSNA 4C7OA 1OXTA 3MUFA 4KFRA 2O8DB 1NKSA 2WTUA 1ETUA 2WWFA 5EQTA 2F9LA 1COWD 4UNPA 2R8RA 2P65A 2ZE6A 3QF4B 1MO5A 1R0ZA 1DELA 1JJ2B 2IYVA 2YINC 3RLFA 5HKKD 3LO8A 3K53A 4YAWA 1GOTA 1KKLA 4XIGS 1X1RA 1BJKA 4TLDA 1KI7A 1IONA 2DCUA 2XZOA 1GVNB 3A4LA 5K8UA 3EC2A 2Z5FA 4HEJA 4N1AA 3RC8A 5EP1A 1P6XA 2IF2A 5JFGA 3QXXA 3A1SA 3I8SA 3D3QA 1DOAA 1JQJC 3DOEA 4E5UA 1UF9A 2V3CC 3IIKA 1SVWA 1ESNA 4PO1A 2IHBA 3BFXA 4MA4A 1YZGA 2UKDA 1G6HA 4NBSA 2NO1A 1N6HA 5E4FA 1Z0AA 4UXIA 1W1WA 1XD2B 2EU8A 4PAOA 3ZBTA 1Z0JA 2ZAMA 3L8ZA 2EWWA 4MKGA 2ZU0C 3SC3A 3T06B 3X1WA 2BIFA 3AKDA 3QKRA 4B76A 2AFIE 3HYRA 2C78A 1CF4A 3SQWA 5EUMA 3ZVNA 1XXHB 1AK2A 1CBUA 5IDVA 4B2PA 3AKEA 3FKSD 4KODA 3EZ6A 4NU0A 3NBZC 2KB0A 1W36C 3BAFA 1II8B 2QAGC 5P21A 5K8TA 1YHQB 1EFUA 2P5TB 4R2IA 5KSYA 3R8FA 4BLQA 1FNMA 3THXB 1G7RA 2ZJZA 1L2TA 2W2XA 3WBJA 4QBFA 2OTJB 5AUPB 2OZEA 1XCPA 2ANBA 2WOOA 4Y9UA 1J99A 5HXBA 1UFQA 2GEUA 1VECA 4Q9JA 3CR7A 2ZRLA 1H42A 2HCJB 3UWKA 3TW8B 1OFUX 2ZR7A 521PA 5IT5A 4FN5A 3SJZA 1BKDR 3C14C 2GPJA 3LFUA 4LRWA 2PT5A 4F4IA 1NSFA 2W6JA 4C30A 3TNFA 4C4PA 4UJ5A 2QA5A 3K9HA 2W0MA 1MKYA 3QXCA 3A1VA 1Y3AA 1D6JA 1UDWA 1Z47A 1I2MA 1E9DA 2VPPA 1PUIA 4V0OA 5ANRB 3WP0A 1W2GA 5FPHA 4DSNA 2V7QD 1AZTA 1YR6A 2QRZA 2PJZA 4IFEA 3ZH9B 4ZGNB 2ZRJA 1E4VA 5DN6A 5FBQB 1SZPA 4W5WA 1ZUNB 1NN3A 1Q0UA 2A7QA 2QTLA 1KO8A 4ACAA 2W2VA 2CRVA 4PZLA 1HT1E 4URZR 4YMVA 3U4QA 1VQ8B 3I62A 4YMUA 4L8GA 4D0NA 1CULC 1XEXA 4YMWA 4IFBA 4ZDIA 3CCUB 2WWGA 5DLQC 5KDLA 4BFZA 1OYWA 5AN9A 3AVWA 1LVGA 2PCLA 3K0AA 2HUPA 2PEZA 3B6EA 5FOSA 1GRRA 3CMAB 4IVRA 1TX4B 1H85A 4IOJA 1D9ZA 1FP7A 1ZMXA 4L16A 3I32A 4OJKA 5DN6D 3V9PA 4QM7A 3ICQB 3KXKA 1AA9A 2JDIA 1E2HA 2WWIA 4HUQA 1GAJA 2BBSA 3EZ9A 4NCHA 3T61A 3AVVA 2QRNA 4UJ3A 2F1JA 1U81A 1YJ9B 1YR9A 1AKYA 3E2IA 3OJXA 2ZS7A 4LYJA 2R44A 5EZ5A 2ZPTX 1W34A 4MGKR 1ZM3A 4RKEA 4B74A 1Z2AA 1XEFA 4TYNA 2XSZD 4NZYA 1LS1A 4QFMA 1VHTA 5K8IA 2AHOA 3VO1A 2JLRA 2QQEA 2DEUA 1FFHA 2H17A 2RB4A 1YZQA 2YVUA 1VQOB 1T9HA 1Z06A 2KI5A 2B21A 3OIWA 1D1NA 2PX3A 5BN5A 5KO2A 2QT1A 1LB1B 1OHHA 2MSEB 1W4RA 3HWSA 2ZAOA 4ZKEA 3RVBA 4DQKA 2GBLA 3DMNA 4DCVA 3T12A 1XTKA 1DO2A 3FFBA 1UPTA 5KPDA 2RGAA 3LBIA 4M1MA 3DDCA 4PSVA 5HE9A 2J7KA 1GRNA 3VR5A 3FE2A 5AUQA 2ZU6A 3BH0A 2IF0A 4BRWA 1FRQA 5JSZA 4Q4AA 1K6MA 1K9MD 4YALA 1ZNZA 3W6OA 1PLLA 2JLQA 2ZR0A 1HURA 4HDCA 4DIDA 5KTYA 4OQNA 5C18A 2QMHA 3TE6A 2JJ1D 4ILEA 5D3QA 2IS1A 1E4YA 4L9SA 2AK2A 2XX3A 1X1SA 4LBVA 1UADA 2D7CA 4BFTA 1T5LA 5B2ZA 2AX4A 3FMPB 4RZ3A 4UAJA 4I81A 2H8KA 4X8OA 5DHAA 4XD7D 3GLHB 4P4TA 2QPTA 1OV4A 2ZE5A 4PPFA 1CJUC 1KDOA 1IJFA 4Z1MA 2LKDA 2O8FB 1DARA 3RDPA 2IYTA 1W7AA 2ZYVX 3GD7A 1U99A 2FF7A 3H4MA 5CK5A 5KDOA 5KNDA 4RJLA 2GZHA 2X19A 2HEIA 1V43A 4ARZA 3G6EB 1U9IC 4BLSA 2PH1A 1F2TA 2PZGA 3V00A 1X86B 4PSKA 3QOFA 4A92A 3QKTA 4R2HA 1AQUA 3QFCA 1RPZA 2HYDA 1S2MA 2O0KA 3K70C 4RD2A 3IQWA 3LW8A 2FA9A 3X1XA 3I61A 1NMXA 4RSGA 2RC5A 1KMQA 2DFNA 3AEZA 3BB1A 4MKFA 3SBDA 4OI0A 1OYYA 2FSFA 2J0UB 3VQTA 1Z0IA 1ZM7A 2E9SA 5B58C 3NVAA 4GI7A 1ESMA 3AVOA 2CCGA 4Y0AA 1SXJA 4M2LA 3A4NA 3TAUA 4AF6A 2JA1A 4LJ6A 1M74A 1SULA 4TMWA 2OLJA 3T1QA 3LLUA 2JGNA 2WSSD 2CBZA 2OV2A 3IHLA 4LV6A 3MG9A 5G41A 4GT1A 4XTRA 1NL3A 1YU9A 4OHZA 3KL4A 4TSFD 4B71A 4ITRC 2NOAA 2WJJA 4NYJQ 2CDNA 2XZPA 3I72A 4TLBA 3VR6A 4BFUA 2HYIC 4LGMA 4HLDA 1Z6XA 5AWFC 3EASA 4NONA 4TLCA 4MGIR 4TYWA 1TLLA 1HE1C 2GJ8A 2JIZA 1JB1A 4D6PA 4DKXA 2IXGA 1Z6GA 3GPLA 4P6VF 2Q9AA 5JBQA 2FEOA 3I4LA 3SYKA 3Q5EA 4QG7A 2GESA 2HCBA 4ZCLA 1DAIA 3K0FB 3MFYA 3OZWA 4V0ME 4PXAA 4C0BA 1Q1QA 2FPMA 2BCGY 4EJSA 2OBLA 1Z22A 2LWIA 1E3MA 2ATXA 2PX0A 1GG2A 5L3SB 3I5XA 4Q1BA 4LHWA 2ZYUX 1ZP6A 4DRZA 2QTVB 3ND8A 3BC1A 3AVTA 4JLJA 4DLXA 1E2GA 5H59A 2GRJA 3H0KA 1JA1A 1ZNWA 2CHGA 4JJZA 2P6RA 3WRXC 2H57A 2XEXA 1E63A 4U7DA 1JBKA 2QP9X 3KXIA 4HB0A 4KAXA 3AP3A 4XSGA 3Q9LA 4D0LB 2O8DA 1EESA 3EPHA 3OFNA 3TK1A 4C43A 1DBSA 2P0EA 3ZQJA 3MD0A 4A9AA 4BLRA 5JEEA 1XMVA 1FMJA 5FTJA 4HLCA 4TTRA 4DUGD 3SFVA 1XTIA 2ZRIA 1OGJA 5CIQA 5L3QB 1E98A 4PX9A 3QKSB 2I4IA 1RFLA 1ZU4A 2IL1A 2BPOA 2ZRPA 4QJ5A 2F6RA 5C4MA 3D8BA 3LBNA 3B9PA 3CWZA 2YOFA 2DR3A 2VHTA 2W6IA 2VP2A 1WXQA 3T15A 4G1BA 5EXTA 2SHKA 2NG1A 2WAYA 4UKDA 1N8RD 3ICEA 3N5CA 1BS1A 1TU3A 1WB9A 1GZSA 4QJ4A 4M1KA 2A9KA 1VQ9B 1TU4A 1ZCAA 4PC3A 3HJNA 1I4DD 2OBNA 4CF7A 2IYYA 4PQRA 2FWRA 4JLNA 3T1VA 3DL0A 1JA0A 3CLVA 3IIJA 4LHZA 4DT1A 1W4AA 4P4SB 1HT2E 2LCFA 4ZIRA 2GDJA 1RYFA 4A4DA 121PA 4QBIA 1L7VC 1QHSA 1G3RA 4R9UC 3UMRA 2QROA 1DDGA 2ZRDA 1RIFA 5J40A 1XBTA 4Q4JB 1W36D 3B78A 4LUCA 1KIMA 2FPKA 5JS8A 4H1UA 5FR1A 1G8HA 2HDNB 2IXEA 3CIOA 4G1UC 2ZJBA 1KY3A 1NSTA 1TADA 1XDBA 3LQRA 1HA3A 3VAAA 5FFMA 4RCZA 2OEPA 1T0HB 4LJ5A 2QSYA 3UXMA 1W4BA 4F38A 4DCTA 4AURA 3WXMA 3V4FA 3R9XA 5TY0A 4F92B 2V1UA 1R8QA 1AKEA 5JSZB 2ODWA 3LD9A 1N5LA 2OE2A 2CE2X 3KKNA 4GP6A 4ESHA 2GBLC 6Q21A 4TLAA 4IVQA 4OHVA 1GL7A 4A82A 1VYTA 4E03A 5CITA 5FTLA 5KSPA 2EFDB 1NLZA 1QG2A 1H8HD 2R6CA 4KFTA 4L4UA 3L0SA 1XEXB 4DCSA 2JJ1A 2GILA 5KNBA 5CJPA 4E22A 2Z4RA 5IK2D 3CD6B 3OE7D 3RRNA 3C4JA 3SU8A 3QFSA 1XJ0A 2PCJA 3TJZA 1MO4A 5BYKA 3KQUA 3TLXA 3G4SB 1VG0B 4EPYA 2IXFA 3B1WA 4PSAA 2C9YA 2GZDA 3RABA 2XTZA 3ECCA 3IEUA 3ZJYA 5KU1A 1XFAA 5GADl 2OCBA 2QUZA 1ZINA 5AUOB 1G18A 1XNJA 3UKDA 3TRFA 1N6NA 1XF9A 2DETA 1ZIOA 2BWJA 5DI3B 2EYUA 1A7JA 1M6NA 2ZYTX 3DKVA 3HR8A 1HY3A 1KSJA 2XB2A 3CPEA 4QXAA 1T8UA 4BASA 2VNJA 1GDDA 2JLZA 2C95A 4GL2A 1FTNA 1W49A 2QEQA 5LBIA 2BCJQ 2ZSAA 1N2CE 2WSMA 4HZIA 1ZBDA 4LJ7A 4V0KA 4D81A 1RC8A 4JSYA 1E2PA 3T1OA 2QT0A 1EFRD 2BC9A 1E64A 1OXXK 1QVGB 1OKKA 3JZAA 3R20A 1QHIA 2FGJA 3Q7PA 3LVBA 4LI0A 4G5OA 3QE0A 1XTRA 1KI1A 2GCOA 1UJ2A 3K09C 4Q9KA 2GEDA 2XZLA 3I1FA 3ZGXA 4GNKA 4HDQB 2OM2A 2ASEA 2QENA 1MABB 1VMAA 2O8CB 5KSWB 1CJTC 4YDSA 1OB5A 1T3SA 2ANCA 4QNMA 2OXRA 1E94E 1N6IA 1SKYB 3CC7B 2H1LA 1QHNA 1ZAKA 2RGDA 1EFHA 3BERA 4EPTA 1NVUQ 5FL7D 1AGPA 1NMYA 3WYGA 2GXAA 1A82A 1L4YA 3EPKA 5AK0A 4U9UA 2OXCA 4D4JA 2CLDX 4M9XA 4BZQA 2D06A 2F55A 1CR1A 4URVR 4Q1AA 1JR3D 2QG6A 2EFCB 2D4HA 4OKSA 3QNUA 3JQPA 2J59A 1CIPA 1NLFA 1Y63A 3BRWD 1BMFA 2WMNB 1A2BA 1W5SA 3UWOA 3CMEB 4P33A 2ZSDA 5K8LA 2AN9A 4O2RA 2QAJA 3WHKA 4M0LA 2O52A 1Q3HA 1XPOA 4EFLA 1CNEA 1JXOA 1W0JA 4NCJA 2PLFA 3KB2A 1E1RA 1QGYA 2HV8A 4B3FX 4FIDA 1QGZA 3VU9B 3BD9A 5J4HA 3RRYA 2BMWA 4C7OB 4OL0A 1ODFA 1NY5A 1P2UA 2QL6A 3FGNA 1OB2A 3GEHA 3QEOA 1OFTA 4LK2A 3THYB 1E0JA 1N6LA 2VP6A 4Q1CA 4BFXA 3A37A 1AS2A 2JLYA 2GNOA 3GJ8A 3K70D 3WRYC 1J7KA 3QXSA 1QHXA 4Q18A 2X1VA 4ZDWA 1DAEA 4M9ZA 5DIFA 2A2ZA 5L3VA 1W44A 2ZJAA 1KK2A 1QFYA 1EP3B 3B1YA 2QP4A 1M34E 3T5DA 4UNQA 2ZRBA 4IXNA 1N6PA 5JCPA 2W6ID 5JRZA 4Q47A 2WAXA 4KJZA 4GOXA 1DTSA 4PC2A 1CR4A 3E1YE 4LYFA 3IO3A 4AYXA 2Q0HA 4MITA 4LV8B 1YZNA 1JI0A 4OI1A 4ARZB 4ASUA 4X8MA 3ZQ6A 2QBYB 2FX3A 1CJVC 2MMCA 2VQSA 2ZRGA 4YAOA 3W2IA 2V6IA 2YNMA 2YZ2A 4P4SA 4A2PA 3QG5A 1S1CA 1GAQA 4AWXA 2QP3A 1T4GA 1KC8D 1O87A 4Q9IA 1L8QA 3QE2A 3L2OB 2C9OA 2GCPA 5IHPA 2JLVA 1LF5A 2YWFA 3KJGA 1G3MA 2GK6A 3NTUA 2X77A 5F98A 4MKHA 3CUEF 4KCGA 2ZXUA 2EW1A 4LX0A 3NEJA 3FKQA 3Q7QA 4UQOA 1QH0A 3GFTA 1UEJA 2ZSBA 4NE2A 2OCPA 4QGFA 3GLGB 3FMOB 3W3AA 3AVUA 1LNZA 2BEJA 2RGBA 2WSSA 4NCIA 3TSWA 2QORA 2V7QA 3I73A 4JLPA 1II9A 4S35A 3G0HA 1R7RA 4TSFA 5L3QA 1E79D 1IN8A 1D9XA 4TN1A 4HZUB 3MWLA 2HMAA 3CNLA 2J41A 2JJ2A 3B8HA 1SHKA 4EH1A 3W5VA 4TZ6A 1E2DA 3FJOA 2XXAB 3TH5A 5FBRB 1QVFB 2KSQA 3CBQA 2JIZD 1KMHB 2VP0A 3L0OA 4GMDA 2VF8A 3X1ZA 4ZCMA 4Q19A 3PV0A 5L3RA 1YJWB 4A6PA 1F6BA 3K0CA 4MGYR 4LSGA 3U7FB 1YR8A 4D80A 2FV8A 5M04A 5EP3A 2QTZA 1XEWY 4US2R 4BE7B 5GJWC 4MUAA 4DZZA 2FU5C 1OH6A 2D2EA 3JQRA 2PIAA 3NEYA 4JL8A 1G7TA 2PJRA 4PO8A 2Q3HA 4LBYA 4TL8A 2IYUA 1JXMA 2HXSA 4MRSA 2BMEA 2HJVA 2VP9A 5JZVA 3WYFA 3LRPA 1X8KA 3N2EA 1KJWA 1OT3A 2EFEB 5LDDC 2WWYA 1GITA 4HAYA 3O8BA 4DB2A 3OAAD 3BIFA 1TQ4A 3AV0B 3CRW1 4HSEA 4LC0A 2YC4C 3OFND 1N5JA 4AYWA 1Q7YD 1JR3E 5AUNB 1AGRA 4Y9RA 1PLKA 5AR1A 1EP1B 2O5VA 4BFWA 3PUYA 2ZITA 2AWOA 2A5JA 3CCMB 2NO6A 5SZHB 4QNRA 2O8CA 1SVSA 4JBYA 1F48A 3OAAA 1NIPA 3ZC3A 4FINA 4WAUA 2VRWA 1NG1A 1GNRA 1Q57A 1P5ZB 3SI7A 3ZDQA 1HYQA 3FYHA 3GJ4A 1ZCBA 4IDHA 4JVSB 1F5NA 4DSOA 2RGCA 3KQKA 3KFVA 1OKKD 1T5IA 2NO0A 2C9CA 3THXA 1XRJA 2JASA 3BXZA 2WWXA 3ND9A 5ELXA 1GM5A 4DDUA 3K0CC 1IN4A 2OCYC 3OZUA 4Z1MD 4NCNA 1SGWA 2WJVA 1G8YA 4FK8A 1ZD8A 1ZUIA 4M1YA 2JLWA 2HF9A 3SE0A 1P9WA 1UKEA 3DO6A 2HXYA 4TQUS 1KTVA 4PC6A 3X1YA 4D82A 2FSGA 3P27A 4X8HA 2KBEA 1K8RA 2JLUA 2RGNC 2W58A 4GOKA 2QAGA 4XH9B 2WIAA 2ZREA 2G0NA 1OHHD 5JEDA 5JS7A 1U90A 3FPKA 2IK8A 2BBWA 3KFXA 3ZVRA 2ZJYA 3JQQA 4JVLA 3EA0A 4NH0A 2VHCA 1SQ5A 3IO5A 2FNAA 4M9QA 4HAXA 2IS2A 1OIWA 1JQLB 4TTPA 2V55B 1IQPA 1OFHA 3ZIAD 4QM6A 2J7PA 3EZ7A 2FEMA 4QKQA 4Z8XA 4HYYA 3CCQB 4LPKA 2C2HA 3G5UA 4RD4A 1ZRHA 5DHFA 2D74A 3I56B 1U8ZA 2C03A 2R62A 3KJIA 3QF4A 2QMOA 1NY6A 4KHZA 4F91B 3V4RA 3B1VA 2B92A 2I3BA 4AI6A 2XSZA 3NBFA 3RRZA 3R7WB 4M53A 5J4KA 4Q7JB 4Q4JA 2VSFA 3IIMA 4UNSA 4JLMA 3T1TA 1IXZA 4GSYA 2CL0X 2GVDC 2RHMA 4KVAA 1NLYA 1NVWQ 2FJUA 1SVIA 5KHOC 3U60B 2VL7A 2IYRA 1E2IA 2O8FA 3AH8A 4D4LA 3QPWA 1W0KD 2Z6VA 1U94A 1VYUA 4KLNA 2A5DA 5LD2B 1VTKA 2A5YB 2YWHA 2N42A 1US8B 3AUXA 3EC1A 4F93B 1XB2A 5DGXA 2VP5A 4C0KA 4B3DA 4YXWD 2P3SA 4W5JA 3P20A 2BBTA 2ODBA 3W90A 1OH8A 2RGXA 1EX6A 3NC1C 4UXHA 4A0HA 4C0LA 2IW3A 1CR0A 1IBRA 2F3RA 4CDGA 1EXMA 4OK5A 2DYKA 3GJ0A 4HLUC 1W2HA 4NYIQ 3RSOA 3ZZUA 2EIXA 4RZUA 2XAUA 1XZPA 3W9YA 4BZPA 1FRNA 2CLCX 2R6FA 3PG5A 2OILA 4QBGB 2MSDB 4DLSA 3LQQA 2PEYA 4FMCB 1GO2A 1ZVQA 1VQ5B 2RMKA 4OJQA 4XTCS 5HPYB 2ERYA 2GCNA 3WYAA 4YXWA 3RRMA 2XNDD 1CJMA 3CCSB 5KPJA 1G3IA 1Z07A 5HZKA 2WMOB 1RVDA 1G291 2OFXA 4XVQA 5UKDA 5FTNA 3DMDA 1QVAA 2KWIA 3EZ2A 4G5SA 2CXXA 1Q81D 5BW8A 2JEOA 3LW7A 4D4KA 5DE3A 3FMFA 1M7GA 2CK3D 3U7GA 3PQCA 5AJZA 5DSZA 1G5TA 1NN1A 2XNDA 3GLIB 4RFSA 1NDHA 3WNCA 1YE8A 3OEHD 4FI3C 3HU3A 4EKDA 4DLUA 1E2MA 2G88A 3BFVA 5CLLA 3IHWA 3LH5A 1OH7A 3A8TA 2VZLA 2R6DA 3VO2A 3K8YA 1AIPA 3L0PA 3T35A 3CW2A 1GVHA 2BM0A 1ZIPA 3U44A 3UATA 1KYIA 4G5RA 3W2HA 5FL7A 1KNXA 3LVQE 3K9LA 3K0SA 4AKGA 2ZI4A 5C1BA 1S96A 3AKCA 2VA8A 3E1SA 1P62B 2QPAA 2G6BA 2RH5A 2PZFA 4A1FA 1M90D 1KAGA 2D2FA 1E2EA 2QBYA 1Q44A 1IXRC 1GSIA 1MV5A 3AGPA 2QMEA 1YITB 5JWOA 3SQXA 4HLQB 2WJGA 1ZNXA 3REFA 3B9QA 3QFRA 4HDOB 1EWYA 2C77A 1OPXA 1K73D 1FZQA 1Z5ZA 3EXAA 4PPNA 1YHNA 3EA5A 4MH0R 5A4JA 1QUFA 2ZUDA 3F3YA 3EW9A 3FVQA 5CM8B 4B43A 1BYUA 1IY0A 1R0XA 3EAQA 2NPIA 4DT1B 1KY2A 3BWDD 4R71A 1LTQA 1W0JD 3EARA 3SHWA 4B34A 3VFDA 3W2FA 4BWYA 3K70B 1B23P 4HB4A 1YJNB 4BZXA 1G17A 1DAGA 2AFHE 3KZ1E 4XOIA 1C4OA 5F2EA 2H7VA 1DO0A 5KDDA 2X2FA 3C41J 2EVWX 2XOKA 3QVVA 2IYWA 2VO1A 3R9IA 3SFZA 4DC9A 3U5ZB 4LJYA 1ZJ6A 3RS5A 1F3OA 1DAKA 2B7BA 4B47A 1J90A 1QRAA 3OF5A 4AKIA 1DE0A 2BBOA 5GV8A 3AUYA 5TDHA 4CYMA 1MO6A 4BPRA 1FW6A 2W2TA 4OBEA 1N6RA 1UBEA 1X6VA 1R0YA 4RZ2A 1AM4D 4XVRA 1SVKA 5EE9A 1JR6A 1E9RA 3KUDA 4Q02A 1NBMA 3H2YA 4KBGA 1E9SA 3DOFA 5IK2A 3OESA 1CS4C 1OGIA 2Q21A 1A8PA 4JZKA 1PLJA 1XMJA 3BFKA 1RZ3A 4M1TA 4EPRA 1XCMA 2GF9A 2H5EA 5L3SA 5TVKA 2ZR9A 1XXHA 1ZD1A 1E1QA 3L43A 4TYYA 3GP8A 5HE8A 1UDXA 2BF4A 2XXAA 1WA5A 1SXJE 4HB2A 1TTTA 3CRQA 4ZCIA 2OO7A 1KSHA 1C9KA 2WKRA 4I1VA 4PQYA 3IBYA 1KMHA 3MRSA 5JHGB 2IS6A 5F9HA 4RZXA 4HAVA 1RRPA 4LJAA 4CT4B 4IHQA 4L5BA 4QGAA 2ZANA 2VSOA 4JMPA 4R98A 1GRQA 1DG3A 3ZZTA 4DLWA 3RAPR 3VR3A 1P60A 3PENA 1OIVA 2C96A 1QFZA 2QNRA 3CR8A 5CJ2A 5CYPA 2CVFA 2XITA 1II0A 3GLFB 3LY5A 4KFUA 1D2EA 4FD2A 1YZLA 3DVLA 3KTAA 2OTLB 2AK3A 2V6JA 2GEVA 3CCLB 2HT6A 2QSZA 2VEDA 3C15C 4ZIRB 3OJWA 3D6TB 3CH4B 4MQBA 2CEAA 4DEYA 5B57C 3KJHA 4V0MA 3P26A 1E2KA 1W46A 1ZD9A 1WRBA 1CEEA 1GFIA 1NP6A 4PZYA 4A15A 5EZ6B 4TQAA 3A1WA 1U9IA 4LHVA 3MAAC 1VPLA 3N70A 4TT3A 1IN6A 4PR0A 4WXPA 5J4YA 2VNHA 1I2DA 2ZM5A 4ZGQB 2E87A 3KJEA 1KI4A 1OXSC 4A8JB 2RKOA 1XU4A 1N3BA 4EIWA 2XB4A 2O0JA 4KXFB 1QGAA 1HE8B 1DG1G 2X2EA 3PITA 1FL9A 3R7WA 4KI0A 2IC5A 1KO7A 1IN7A 1CRPA 1Q82D 2ZETA 5EMNA 1OJLA 3QKRB 3BH6A 4BGDA 2ECKA 4JLKA 4TT3D 4HZUA 3RYTC 2OLKA 2YHSA 4G3XA 4JL5A 3IDQA 1LY1A 2V9PA 3KXLA 3RNLA 3SEAA 4CEHA 4H9GA 2GTPA 1T6NA 5EE3A 3KKMA 1Q86D 3FHCB 3GEEA 2QE7A 2JDID 4QHSA 3OIYA 4TL9A 2DPXA 4P3YA 3J81k 4FMCF 4YMTA 4Q1DA 1F2UA 1M1KD 2OAP1 1BOFA 3IPXA 1HQCA 2Q3MA 1ELOA 1M7BA 2V1XA 1IM2A 3I8XA 1G9XA 1CP2A 1TF2A 3MLEA 3NH9A 4NDZA 3VKGA 1VG8A 3MJHA 2J45A 2FZ4A 4JLDA 4CZ2A 4NYJR 1Q1BA 4PO9A 1UKZA 2A3RA 4NCKA 4C0HA 3X2SA 1ZNYA 2GHIA 1VQKB 2DWQA 2P5SA 1P9RA 1GP2A 2CJWA 3OIUA 1NJID 4S2EA 2H16A 3GFOA 1W47A 3B60A 5EE1A 1MO3A 4RY2A 4C0JA 2L0XA 4WIAA 1KZ7B 3U61B 1DS6A 2G0TA 2F3TA 4JVNA 4Q4AB 1TEXA 221PA 1W35A 3CRZA 3FFAA 3VU9A 2AD5A 4BLPA 1KO1A 4PHGA 3GLFE 1W4CA 1VQ4B 3AQ4A 2BOVA 4LHYA 3CCVB 2HJGA 2RAPA 2G1JA 3CPHA 3FMIA 1KD1D 5FI0B 3Q8XB 3D31A 1G8GA 1UMKA 421PA 3R8CA 1H65A 1NJFA 4GZLA 4CVNA 2GETA 5GJCA 4RD6A 1BMFD 3JVVA 5GVSA 4C0SA 2BMDA 4Q9HA 4EJSB 5JECA 1PZNA 3AF4A 1D5CA 3Q3JB 4UXJA 3QXHA 2CCKA 3GFPA 1Q1EA 1S8FA 4GFDA 2CVHA 5E3HA 1RYHA 3GLIE 1E69A 3SZRA 1DDIA 1VCMA 4B32A 5EE0A 1EX7A 2F9MA 3SBEA 1G3UA 1BO6A 1VYVA 4IOLA 3UPUA 5KSZA 1R5OA 1S3SA 1KDRA 3M6AA 1G1MA 3QXJA 2OAQ1 1KDPA 5GJVC 1JNYA 2G9NA 1M2OB 4BFSA 5A5GA 2VNKA 1P61B 2HLDA 5LB4A 1E6CA 3CZQA 3CX6A 1QHHB 1WMSA 1YQTA 3E20A 3OIVA 4Q00A 2C98A 3WMFA 3A4MA 2OK8A 3O47A 4ON9A 1NJGA 4B3GA 4WZ6A 1Z0DA 4TYQA 3AKYA 4EPWA 2E1RA 4QHYA 3U6BA 1P2TA 2C99A 2QM7A 3LLMA 3QUSA 4DBLC 4DCNA 4JL6A 5L8VA 3BB3A 4JT2A 3BGWA 3PR1A 4V03A 2J0VA 3LDAA 3KX2A 4YMSA 1NRJB 2XTMA 5FOXA 5FPTA 5BXQC 3AVPA 1LS6A 1MR3F 3EG5A 3U44B 1E1RD 2B5OA 3SJCA 4AG6A 2Q9CA 4B35A 4KITB 2XNJA 5C4GB 3ADBA 2IX3A 2VHJA 5KNCA 2RGEA 1N25A 2GKSA 3SN6A 1WP9A 4PQFA 3WMGA 2GA8A 3CXCB 2DY1A 4EJSC 2CL6X 4C3ZA 1E99A 2BM1A 2J9RA 4LYAA 1P4SA 3CM0A 3K0FA 4F4JA 4WZBE 3PEVA 3CF2A 2VYQA 1JB9A 5F3WB 1COWA 1ZYUA 1MRSA 1R10A 3FTQA 4HLUA 4WVFA 3Q5DA 5C46F 2IUTA 3HR7A 2OT3B 4OK6A 1TAGA 3H84A 4N0DA 5J47A 5CIWA 4YDHB 3QSYA 3E5HA 5SZKB 5TXGA 3ES9A 1GWNA 3MWKA 4XVUA 2WZQA 3OHMA 1TMKA 2PZEA 4LHXA 3QBTA 1WDTA 1GUAA 5A0FA 2Q6TA 3UK6A 2OCAA 5FH9A 3WP1B 1X3SA 2JJ2D 3M4YA 1XMIA 3TQFA 2IEZA 2YC2C 1E9CA 3B82A 2WJIA 3IQXA 1SVLA
chains in the Genus database with same CATH superfamily
2B3DA 2BELA 1JKJB 2R6ZA 2ZRNA 3MTGA 2LKCA 3PUVA 4JUBA 3RFFA 2C8KA 4XLCA 2YXPX 3UMMA 1DHRA 4JB2A 2WLSA 1JEQB 3Q9NA 2C4TA 1SXJC 3UWSA 5BR1A 5KOHB 3RSHA 3T5BA 4FNAA 4DQUA 3O8LA 3HABA 2VDJA 2FRDA 1Z12A 1G20E 1DEHA 1E1YA 1FQOA 2WWWA 3HLYA 3KLBA 4HR7A 3NAQA 2H1RA 2HU8A 4II3A 1OLSB 2WHYA 2XXBA 4L22A 5IULC 2OHOA 1WDKA 3DOHA 1FSGA 1U1FA 3CRVA 3Q88A 3LGAA 2PJDA 4CCSA 2UZAA 1ODLA 1GKKA 3ZE7A 4E7PA 2ZWIA 3NHWA 1DBQA 2DFKB 1VQ6B 3DT6A 4Q4LA 3RHFA 2HMWA 3G6WA 1F8GA 2KYRA 1E4EA 4L0DA 2VJNA 2QNIA 1T8TA 3RWOA 3SVZA 4YP7A 1A97A 2R2GA 5KYUA 3JYQA 4OJYA 1Z2DA 1ETHA 1NM5C 4A0FA 4B73A 2C04A 4L4XA 3RJMA 1Y9JA 3TUZC 3EWAA 2JBAA 5BYBA 1JMKC 1A9OA 1Y3HA 2GJRA 2I71A 2JFUA 1ISJA 3EH2A 4O2BA 1ZU5A 1Z5WA 1BMDA 3GLGE 5H3LA 2O8EB 2FN4A 1QOQB 2DKNA 1YK0A 1SCUA 4F5ZA 1I7PA 1LTHR 2DULA 2BGUA 2D0IA 1N8NA 1TZ2A 3PT5A 4M86A 3ZG6A 2VJYA 4AN1A 2RK4A 2ZB3A 3JAWA 3LIPA 2RCYA 4YP0A 4G07A 4XGQA 4LJSA 4U00A 2PNJA 3SLNA 4NEHB 3LXUX 3N2KB 4P7BA 5BQ5A 3SJBA 3TLMA 3KKPA 3RYCB 4KR2A 5B3AA 2LUOA 3BM5A 2PUBA 2E82A 3G13A 4B4DA 3V7YA 1U0FA 5FAXA 1F17A 1GNTA 3DV2A 1I9GA 3F4LA 2HMUA 4D9CA 4BNYA 4NMWA 1AZSC 1O95D 3WIBA 3WKCA 4DCCA 4JYAB 3QF7A 4CV1A 3V97A 3ADKA 1N06A 4Y2VA 1K6XA 1JBEA 1F0NA 4Q93A 4XLHA 3CTPA 4ZYTA 2KQUA 3GFSA 4PXSA 1BIFA 5F3RA 4HGRA 5HGXA 1ES9A 3A9CA 2I87A 1A5TA 2FQYA 2F1IA 1CJKC 1SUBA 1DEXA 1R9MA 2R6R1 2ST1A 3QKSA 4AUEA 3GZNA 3MQ4A 4KLAA 5C7OO 2XUGA 1XDWA 3S2YA 4U0KA 2OYSA 2CYCA 5L53A 1I2AA 5KREA 2GM4A 4UM8B 2C9MA 1T9DA 5EXPA 5DH9A 2YV5A 2CSXA 3O82A 4UAGA 3Q0EA 3VH3A 2FR8A 4IR7A 1W85B 4X8LA 1KZGB 1KI6A 1VSUA 1MXHA 3KAQA 2EJTA 3BFPA 3E0QA 1VHOA 5SV2A 3WSVA 4Z51A 3B6MA 4WCFB 4UU0A 1W36B 1QR6A 4I5IA 2O2YA 3GZNB 1K0UA 2EQBA 3COPA 4PCLA 1TQ2A 1W9HA 3GJXC 4J0QA 3BN3A 3KLPX 4GRDA 5I7EA 4U02A 2C8VA 3A6PC 5DEOA 3FCYA 5KNBD 5KTTA 2BKUA 3BRSA 1FMLA 1MJGA 3H3JA 4K0RA 5CT9A 3O5AA 4TKVB 1X7XA 1ZM4A 2NTYC 3MMNA 2M1ZA 5JQWA 3V1MA 1BRMA 4ARVA 3TLGB 2NZUG 1O8CA 3FDZB 5HTKA 1XCOA 2DHDA 5B53A 1U5CA 4M8NE 3GLQA 1C4XA 1WUHS 3H9BA 3NAMA 1ZL0A 1PGOA 1Q0LA 1PEYA 2FPGA 2F7SA 3EOAI 2EP8A 1BROA 2NVBA 1KA9H 2RGYA 5DM70 3MTAA 2VJOA 2YVQA 3HBAA 4BV3A 4XGRA 2VLBA 4EAQA 2ZJ5A 1YDMA 1KI2A 2ZT7A 2PO7A 3O0DA 1A5BB 4XQCA 4XWYA 1P9NA 2C20A 5IAKA 5BYJA 1QFSA 4NBVA 1T2DA 1XVAA 1NV8A 2ZVPX 4ZI5A 1GL6A 4JK3A 1QX4A 3S70A 1TO1E 4ZGGA 1H5UA 3O1JC 3X1DA 4Y7CA 3KPVA 3VC2A 3RROA 1ONSA 3NS7A 1MB9A 4YRKA 2WLTA 1QMGA 4C2TA 2IT1A 1WP6A 2W0SA 3GJSA 4WKNA 2WK1A 3GLHA 1ZVVA 1D5WA 2NTJA 1AO0A 4ZU3A 3KG2A 1VMKA 2QTWB 1IE3A 2H9IA 4L1KA 3T34A 5TPZD 2O2ZA 1XGKA 2HDOA 3LSYA 4IEIA 5KQSA 3CO5A 2P2DA 1IB6A 3OZIA 3DB1A 5FUYA 1Y4UA 5I01A 5GV7A 4TV9F 3U1TA 2WP0A 4LGYA 4KEAA 3G7SA 4Y2GA 4X95A 1FUYB 1CUGA 2DFTA 4L15A 2Y0BA 3EN0A 4XIFA 4B2LA 2WNHA 3F3SA 5EVCA 1CUAA 4FWTA 1GNLA 1NDUA 5HUHA 3W5AA 2W2LA 2X3UA 4FQ7A 2FUNB 1G6Q1 3CZRA 1Z28A 2AOVA 2ZS8A 5DNYB 1WPCA 1LPSA 4G4SP 4BNJA 1YI2B 4RM2A 3GCGA 4WK0B 5BRJA 4KBYA 3PCRB 3UB4A 2R65A 2CJPA 4KK3A 1S9HA 2GHRA 2CDCA 1P75A 3GDHA 1GG5A 1Z37A 2PT7A 3V8PA 3W5IA 2Z30A 5A9SA 4I1PA 5HR5A 3CPWB 5BN5B 4DLVA 3G2MA 3LGSA 3NVKI 5A5DA 4W5HA 5DLEA 4ZAWA 3GRAA 4MVJD 1XDUA 3EMDA 1WBDA 4GR9A 4BO4A 1JG7A 4XWKA 2ZYRA 3CJRA 1TF7A 3OEHA 3NALA 1TF5A 1FMFA 2FMUA 2R6JA 3HNOA 5G0UA 3QHAA 1DC3A 4OI4A 4HF7A 1IXSB 2AN3A 3AF1A 3OEED 3UAVA 4OQXA 3DEKA 1BQ3A 2D62A 1IN5A 1HOXA 3MQFA 3WADA 4DABA 2DOGA 3SK0A 4GXTA 1NIJA 2FI1A 5BRAA 1EAMA 1NXQA 1QORA 3Q9UA 3VR1A 1LSUA 1ODJA 1C3VA 4Z4VA 5B12A 5I7UA 2PGAA 1HKUA 4H4EA 3ITEA 4CU2A 1DKOA 5C7YA 2HBYA 1SVMA 1WUIS 3ETNA 4YROA 3U13A 4B4OA 4E2WA 1S8OA 4FMDF 1OIXA 3M6IA 3HDTA 1XK7A 2PGXA 3VSDA 2V98A 2QXYA 1UD3A 1EVKA 3NEAA 1BN6A 3HVHA 4JIMA 3S4YA 1NHWA 4B6QA 4JBWA 4L57A 4DDTA 4L9AA 5JYBA 4F9FA 2A9OA 1XV5A 2J67A 3ZHVA 2ADMA 1DIOB 3RJ5A 3ROXA 4Z86A 3QKWA 4WOPA 4FNMA 4EX6A 4QTYA 1VA4A 2R96A 3L46A 3M1YA 4HZGA 4EY6A 5CDYA 2FOLA 2XCTB 1MT0A 4NLLA 4IGEA 1DP4A 1LJLA 3OZVA 1Q9SA 3AT1A 3N8DA 1PK7A 1GFSA 3SJUA 5JSFA 1QP4A 3R23A 3WAGA 2HF2A 4OREX 1DEKA 1KXJA 3AF0A 3EIFA 1IHYA 1BX1A 2CFTA 4QJ3A 1V7PC 2BJHA 2OBXA 2PSHA 3F0TA 4FP9A 5CB4B 3KV3O 1Z35A 5D85A 2HWUA 3V4PB 2EBFX 1L7QA 3KKOA 4BKOA 1N32B 2FPIA 1M2HA 3ISJA 2Q0XA 1YONA 1M2OA 3KEMA 1GL9B 2FZLA 5GAJA 3T4UA 4MTLA 3D0KA 3ZHZA 1Z13A 4FILA 1RI1A 2CHQA 2NZ2A 3I5UA 1ILWA 4H1TA 3U3ZA 3WFZA 1FFYA 3GG9A 3DDHA 2RGNA 3HJFA 4PN3A 4ZCQA 1W59A 5CFQA 1ACMA 1Z0KA 1NI4A 4KXNA 4Q6WA 4D2IA 3GGGA 2VZEA 1NN0A 2PMWB 4E5YA 3BK7A 4L78A 3ANTA 2FG5A 4ZOBA 1B1CA 3ZK9A 3FBWA 2B6HA 4ZOLF 1FNNA 4YR9A 3PZRA 5FBZA 3RBXA 1L1EA 2VYNA 5B3JC 4KV9A 2F8LA 3KTAB 3VJRA 4UFPA 4Y67A 2ZUSA 1IOZA 3WMEA 1ZXBA 1E1QD 4LPSA 2VSXA 4QC2A 4A1OA 4G5GA 4XYLA 4PR3A 4KMOA 3P9ZA 1U7ZA 2I22A 4WFIA 4Y2TA 1RPNA 1KIAA 3GLVA 3QXGA 3TCKA 1TW3A 3W1VA 4CQMD 4DA8A 2GBGA 5MN5A 3RKUA 4MR9A 1BS2A 2X8JA 3RKRA 3WKDA 1GKIA 2WJWA 4XX0B 1JG3A 2OHJA 4LG1A 4AMYA 3O2SB 4Z9AA 2WVHA 3I42A 4FSXA 5KTKA 1QYDA 2EFJA 2HK8A 1EFTA 4C4XA 3PL5A 4CF3A 1ZC4A 2GN4A 2YL2A 3LAWA 3WY9A 2XWPA 4O63O 5JO0A 2ZUCA 1BQEA 5CB6A 1BKSB 2P3LA 2PZ8A 1VQMB 4BRSA 4K26A 1VPWA 1CU1A 3P32A 4CJXA 4KSBA 1SKAA 3JQ8B 3QFTA 4ETMA 1RS0A 5B64A 1WABA 5TMPA 1UKYA 3W1EA 1QF9A 4PGAA 4PU0A 1KI8A 4ID3A 1EH5A 3LP8A 4QJBA 4CQLA 2FZWA 1Y98A 2C07A 1DX6A 3DULA 3RS2A 2HI0A 4YQFA 2AGVA 3GCZA 1TLTA 1O9BA 2WD8A 3UXYA 4HV4A 4FE3A 3PTLA 2X9QA 3N7AA 2HWXA 2HJWA 1DFHA 1PJSA 2VP4A 2ZI7A 4FN4A 4H77A 5ESDA 3EMKA 4I50A 4U7TB 3IT0A 4DXHA 3I39X 4HO1X 4QUAA 3WGHA 2F43B 4G9EA 4M8SA 1LV7A 5ES4B 2V6BA 4BATA 4UZUA 1JJBA 1USKA 3EGXA 5THXA 2PQ0A 1F7VA 1FTSA 3EIOA 3K73O 5FTMA 4M7WA 4BWFB 2OR3A 2JCVA 4JU9A 4WY8A 2DF8A 1JQAA 4K9SA 4K1XA 2NN3C 3EIQA 2NM0A 1DV1A 1V6CA 1ZUWA 3HADA 4U2KA 3RK4A 2QQ0A 4AUKA 1E79A 3VVMA 2JI4A 2J07A 1YHYA 2GJAA 2R1TA 3H75A 3QMMA 1ZVMA 4C4SA 2F4VB 1EWVA 4HE6A 4MI1A 3TLYA 5KOIA 4OATA 1EJ2A 1WO8A 5EOVA 3SNHA 3DGFC 1YWGO 3LWNA 2RAFA 4K9NA 4NFHA 3WGMA 5FFFA 5FFNA 3B3FA 1AQIA 3D8NA 1EFVB 2VIIA 4S04A 2VXBA 4FDLA 3K0EA 5DBHX 6PFKA 3JU3A 2IYXA 3L8FA 3H5LA 2Q9UA 5LMUB 5ADVA 3DD1A 4UDXX 3KVRA 3RVQA 5JJ5A 1EUDB 1FJHA 4RY0A 2H3EA 3P4YA 4RPHA 5AKZA 5A4KA 3ZN2A 5F5XA 4FLMA 3TR0A 2OQRA 4Z4CA 4YRRA 1YF3A 3QG1A 3VPXA 1C81A 4I46A 5B4TA 2H1WA 4CN9A 3U4IA 4ALNA 3O8OB 2WQ6A 1TC1A 2BSAA 1RC0A 3U7EB 5FOUA 2PKYX 5DCLA 2VTBA 4DUZB 4OHXA 1V1RB 4BUJA 4Q4CA 2RAUA 4M9CA 3GQBB 3R24A 1ODIA 3R7BA 1OAAA 2Q3FA 3FWZA 1UCFA 5H8WA 3W5CA 2DXIA 3UW3A 3E70C 4D8XA 3QWIA 2XA1A 2XYRA 4RL6A 4NPHA 1GYRA 5DGTA 1LI5A 1KU0A 5G3ZA 5JARA 5CLFA 1F2TB 4M21A 4N7RA 4MYCA 3RSSA 2WG2A 1O89A 2B1JA 5IKXA 2YOGA 4CM8B 3TQRA 2EKPA 1E6EA 4RCYA 2W2OA 4JUCA 5A3JA 4YUZA 2X4DA 1EFRA 2F8MA 5FWYA 5EIXA 5AOAA 1KBOA 3LA6A 5J3JA 1WHTB 1RM5A 4WXRA 1QZXA 5HZMA 3EA4A 1RYYA 1XXHE 2D9RA 2X9VA 3BL8A 1R4MA 3PFWO 4Q0MA 5HZGA 3RSLA 2BUBA 3TB4A 3KLMX 3PXUA 2D3TA 5EKDA 3H05A 5BT8A 4PM4A 1YI8A 1B6TA 4RJJA 4I66A 2BFDA 2JGAA 1DAHA 2YZKA 2ZBEA 3C2QA 4ZK2A 4UUNA 4O4HF 4PHFA 1MVNA 3MHPA 1VCNA 1S4QA 1PL7A 4J0KA 1OFVA 4YLGA 1PL0A 2WIJA 3NI2A 1RI5A 2YOHA 1XDSA 3EYAA 3HDYA 5IT4A 4QAJA 4O2LA 2YFKA 2B4YA 1YRAA 1ULHA 4QDTA 5KJ1A 3D3EA 3IJRA 5C8YF 3OJOA 3B6IA 2VSNA 2WICA 1LW7A 5FTWA 1SCAA 3ZBQA 5TGTA 1RRFA 5AVRA 4D4HA 5T6MA 2WP8J 3HPRA 3Q0TA 2HO5A 4ZI7A 3RC3A 1Y42X 2FVYA 3WGKA 1GNQA 1N6KA 5EUQB 2O23A 2HWKA 5ARDA 1P4MA 1N6OA 3EK2A 4I4NA 4Q3OA 3PRKE 1DQNA 1E2FA 4J4BA 2VWQA 3BORA 1U2RA 1NKVA 2PL9A 4GZ3A 3CX8A 4EA9A 3P7MA 3VISA 1PYGA 3NW9A 1MFPA 1PR6A 3TLEA 5KCMA 4UREA 4HHEA 1UT6A 5A5EA 1ADGA 3DBHB 3F7OA 3OLQA 3PPXA 2XUZA 1FX0B 5L4LA 4NCAA 1PD0A 3CXRA 3N5KA 2P35A 2ZYWX 4ZI3A 1G7SA 3D0RA 1N2GA 1PNTA 3NNDA 4J0CA 4QHTA 1QG4A 4DG8A 3LUGA 3BMNB 1NXPA 4RDXA 3F97A 4K6OA 4EW1A 4QDOA 5E7JA 5HCIA 4IDEA 3G82C 4Q9DA 1N92A 4UMFA 4YBZA 2OG2A 2J7PD 4AJOA 2X14A 1A2OA 4W5QA 4JEUA 4ILKA 2ISSD 4V3CA 2A78A 5HKKA 1TPZA 5CG2A 3RTEA 4NBNA 2OCKA 1CNMA 1M1YB 2HLNA 4ZO8A 3QLEA 1ZHOA 3C1AA 1OCEA 4XFDA 1VBMA 4KKUA 1JEJA 1P72A 2OYCA 2YIVX 3HCAA 4JLVA 3TLGA 4Z9XA 2FEAA 3ILSA 3EZFA 3IVGA 5LBTA 2OCGA 3B1JA 5F2OA 1GLGA 4ZGBA 2PX5A 3EISA 2UZ3A 1TVKB 1HETA 4JBLA 3OQHA 4UUQA 4NV1A 1FTWA 3C3PA 4P84A 1A4IA 3N28A 4CKEB 3THWA 1AKWA 4DPKA 2QJRA 4FGKA 4B6EA 4EUNA 3HFRA 4RPIA 1SCQA 2ECOA 1QS0B 4LDNA 3VUFA 2MYNA 4ES6A 1XU9A 3N75A 1M1ZA 1YVRA 2FZCA 1YZ3A 3W6ZA 4K9PA 1GPAA 2QI9C 3E9DA 4BWVA 2R87A 3S2SA 3QJYA 2IOFA 2IWRA 2YW9A 5BN4A 1PV4A 1FX0A 1RD4A 1XMSA 1ONPA 4QU9A 4BNVA 5LR6A 4PC7A 3C8HA 4JXXA 2IY8A 1KOFA 2PBFA 1IOVA 3LY9A 2OFOA 3E7FA 3T41A 4GBED 4M55A 3O4IA 1E0KA 1M6EX 2Q45A 3ER6A 2VDKB 1DCTA 4IDCA 1TB4A 1TMGE 1C9MA 4EJ2A 3IILA 4ED9A 3IV6A 2X58A 4GXNA 1FFCA 2PXAA 4A2WA 3U56A 2JJQA 3N6RA 4URYR 4C0LA 3OP4A 1A5ZA 4EL5A 1IB0A 1JFLA 3KQHA 2ZZEA 1LPNA 3AW9A 4A2QA 2GK3A 3PNQA 2C2GA 1FDWA 4KI7A 4YS6A 4UTOA 5EJ6A 5LA6A 3HB4X 3ZV4A 5HSGA 3NFRA 5HBRA 3H5OA 4IG9A 4JKYA 4RESA 1D0VA 2W6JD 1H23A 3OECA 2AZDA 2J46A 4L5YA 2RHRA 3HCBA 3KT6A 4WLEA 4W6ZA 4CM6A 2B20A 5KJ6A 4MW0A 2VTDA 3HGQA 2VK4A 4JWKA 4PTZA 4OP3A 2I4LA 5JJKA 4JB0A 1AQYA 4JT4A 2J0SA 4MPJA 1I5EA 2V4DA 4JBXA 4GI3A 1LJUA 1K89A 1E7RA 1TL7C 3OBIA 3Q3AA 3PYMA 2IYQA 5ALPA 5IEBA 2HJ9A 3BXEA 5KJCA 3KQMA 1J9EA 4OTZA 2E4YA 3VTZA 3FHLA 2GB4A 3KJZA 4R8LA 5FI1B 3W1WA 2A1TS 5EXSA 4DQLA 1V5FA 2NP7A 1NDQA 4JYZA 4ZT2A 1AGXA 1Y82A 3OQIA 4B5LA 5I9NA 3UUWA 2QEXB 5EUCA 4PHCA 5FUWA 5K0SA 1MBZA 3EIWA 2ORED 3G7NA 4I4LA 2UZ1B 2EGUA 1D2MA 2PHZA 2QN3A 4HJRA 2WFLA 4B48A 1P7VA 1V8PA 2ZIUB 3O3NB 3DE5X 3DM9B 4OV6B 4OXNA 5ALYA 1KDZA 2DUUA 3FCSB 1I7LA 4K6FA 4WKGA 5EKUA 4CKWB 4EECA 1AKVA 2HB6A 5CVEA 4DK0A 4JVMA 2D4AA 3ED1A 5J1TB 3UQYS 4XWTA 4C7VA 4I1OA 3OE4A 3ONEA 2AG1A 2ACKA 3GJ5A 2FDXA 3NLLA 4RA9A 3L8EA 4QZVA 1Q95A 3CX3A 1AK9A 2WIGA 3HYLA 2QGNA 3RS8A 1FLDA 1HDOA 1FUKA 3K6SA 4G4JA 4F3TA 2PMKA 1TQ6A 2HRDA 1G60A 3RTDA 1L7RA 3DEFA 4I1UA 1V35A 3NHYA 2Q5OA 1BH2A 3SMVA 2F1RA 3G5LA 2EZTA 3QOYA 5EJEA 1A9PA 5LBUA 3TZ6A 3GQBA 4YRTA 3FFTA 4G41A 4YAJA 1F9EA 1T1JA 4LXTA 3CUKA 2LIPA 4DJAA 4R0MA 2BAGA 4FFLA 2ALJA 1RZRA 3KTFA 3QA3E 4N0EA 1DIBA 1KVSA 2X9GA 4L4ZA 2ZRAA 3M82A 3BMOB 3L6BA 4C0QC 3L1VA 1XLTA 3A6FA 2I80A 4E5PA 5CT5A 3FHTA 1VLJA 3BBPA 4DFDA 1JILA 4LN1A 5J4LA 1FQJA 2O3UA 1ZXLA 3Q72A 1ADFA 1JTEA 1Y3FE 1XX6A 2JF0A 1UUFA 4BN4A 1ESCA 3THYB 1ZG3A 2XE7A 3NPMA 1QWOA 1CUZA 1MN6A 1S3GA 1Q20A 1V11B 3IPYA 3BY1A 4KG7A 3ROQA 5L40A 3FFWA 5M29A 3GLFA 3TB6A 2VYFA 5IXSA 3F5MA 1WB5A 1ZMOA 1FDOA 1VB5A 4K2AA 2REBA 4RFVA 4A8HA 2H92A 4CKBB 3BIOA 3V76A 3QOWA 3B85A 4ZHQB 3TG2A 1CKEA 4NJMB 1DTEA 2ZCUA 4OA8A 3O8QB 5AHXA 4EY5A 2ZCJA 5FBLB 3VU3A 3H1TA 3T7IA 3KJNA 1ZW6A 1M8PA 4DR5B 2I7TA 1TZBA 4WI1A 3E8MA 1BX0A 3ZX5A 2QSJA 1DIRA 2JVJA 1MHTA 2GNAA 1H8EA 1KHTA 2QT9A 1FPMA 4IZHA 2HA2A 1S2OA 4ZI2A 4DJTA 4BECA 1H9AA 4HAUA 1H8HA 2XQFA 3FCXA 4HP8A 4MPRA 4P12A 2QZ4A 1O95C 1C1YA 3KUCA 4X7FA 3L7DA 4ME6A 4TWZA 2J9YB 3R6TA 4WFQA 3C7TA 4XQGA 3KVVA 3ZV5A 5E7MA 2RHJA 1TOAA 4L3WA 4XDYA 4D9NA 1V2HE 2CZQA 4LQLA 7MHTA 3JPWA 3G2OA 3B1KA 2FSHA 3JY6A 3MB8A 4MW4A 4LNUB 1KQNA 3TF5A 5H1YA 1T36B 5AW8A 3KOUA 1G21B 4GDMA 3WRXA 5C51B 5BPFA 4D0GA 4QASA 1E3TA 1DJNA 1GNPA 3QI2A 2NV4A 5FPSA 1C2TA 3JQFA 5K20A 2JGKA 4AF8A 3ITDA 1JHXA 3PA6A 1NMZA 2JJ8A 3QLVC 1VSBA 2XMQA 5DBOA 3IE2A 3K4HA 1UKBA 1WX1A 4ARBA 4ERNA 1ULTA 2ZRFA 3UGJA 1D2CA 2XMZA 4MINA 4MQ6A 4OFXA 4BJ3A 3QWHA 2X41A 3EGXB 1BW9B 3E2MA 3QX7A 4JUAA 4YRIA 3PEWA 4J6EA 5A4IS 3AXSA 1KJIA 4NVRA 2CK3A 5CM9C 3AJEA 5JWRA 2XF8A 3HMQA 4MYRA 1RW4A 2YN4A 1OLUB 1KNQA 2GS9A 1FP1D 4GP7A 4X06A 1HRDA 2IP1A 3AP1A 3KWFA 4MVJP 4BDTA 2Z2JA 2BDUA 3O4JA 3TG8A 4RHUA 3GPBA 1YCFA 4YACA 1GGMA 3VKVA 1X2BA 1MPTA 2O8EA 2IKSA 2JLSA 1KRHA 4HEHA 1JBQA 1H1DA 2QM0A 2ZYAA 3A1EA 3ZLUA 4PPYA 1NNUA 5AXAA 5IKOA 1QS0A 4QUZA 1C30B 2GN6A 4L0MA 3RIMA 3FPPA 1KKMA 1ABFA 1X80A 1RAGA 1R5BA 1NMSA 5J2UB 1G6KA 2AL7A 4BZZA 4B3XA 1E62A 4HIZA 1XLWA 1NLMA 5FBWB 1DFIA 2N46A 3KQWA 3GJ3A 3VOBA 4JI4B 1DHTA 1SVOA 2BP7A 1KOLA 4XYGA 3H04A 1SBHA 4IDDA 5LP6F 3QV2A 2K5UA 2WDZA 1T4CA 4IIHA 2P2GA 3MTDA 4NHOA 3FOFC 1QE3A 1N08A 1WQ1R 1ECFA 2RIPA 3OCYA 1A1VA 1GZ3A 4NYMQ 1XHLA 3PI6A 1GZ4A 1U1GA 1V39A 4LI3X 4K6KA 4FZ5A 1Q22A 2XDQA 4K6HA 3ZQKA 4B2IA 1ADBA 1PGPA 5FOTA 2QX9A 3I53A 3ZDBA 3OPXA 1JA9A 1NTOA 1P18A 3I92A 2H06A 4Z2AA 3K6KA 4TZ0A 3QVLA 5JRDS 1LBIA 2B8TA 3UUFA 4O4JB 3ZWOA 1PS0A 3NKVA 2CCJA 3EZNA 3PFFA 3SLRA 2XQGA 1SBCA 1DPGA 2BI4A 3NZEA 4RKYA 5LD2C 1YB6A 3KQLA 4F2DA 4QICA 1PD1A 3D3KA 3ZCSA 1A9ZA 3MWYW 1EZZA 2JCSA 2R7NA 4JC4A 1TO2E 2YJGA 4PCUA 4C7BA 5JI3E 3KQNA 2JAPA 2AKAB 3QBVA 2AW5A 3CLSC 5C35A 4K3VA 3RH0A 2QD1A 2FMIA 1M9NA 5SYMA 1A8HA 1VJSA 4DK1A 1Y8RB 1IJBA 2GF0A 3EXHC 3NDJA 3KR0A 2WU8A 3QIAA 4P4UA 1NBME 4PE5B 4UATA 5IJAA 4BX2A 5JS6A 2QTFA 4B3RB 1YJXA 3NX4A 3OSUA 2Z6QA 2EP5A 4DLYA 3ORHA 1XZIA 4CEJB 3RRFA 3TLKA 1ZD2P 5CCXA 3HP1A 1TEVA 4BWGA 4UNIA 1UDBA 2FZ5A 3VZQA 3USZA 4ZI7B 2WV7A 3F8SA 1Q6YA 3TL2A 5JNUA 4HI0E 3O73A 3AB3A 3T0GA 4D42A 2BFFA 5BRNA 3KE8A 1QB8A 4KP7A 5CB0A 1ONBA 1I30A 2D5AA 2PBRA 2W00A 1PBNA 4US0R 2ORIA 1U8AA 5AOVA 3ZJ4A 4WPGA 4E4YA 5DT2A 1M34B 1WW3A 4ZCTA 1UP6A 3K72B 4RZIA 3CNNA 5JJIA 4WOJA 3ZV6A 4IV8A 1JSCA 1K5GA 2YHBA 4FT4A 4LWZA 2B9VA 3W7VA 1P74A 1KK1A 4OMCA 2A0XA 1OZHA 1P3DA 1HTTA 1ST3A 2HU7A 2Z0MA 2WT9A 5DSTA 4DLTA 1VP3A 2WTXA 3VBEA 3ICOA 2QTTA 5K03A 3MUFA 4KFRA 2O8DB 1U0TA 1MGPA 3A04A 1ETUA 3L41A 3MBKA 4Q9AA 2ACVA 2WU0A 1EGVB 4UNPA 1CQZA 1P1KA 2R8RA 5LL6P 1MO5A 1Q14A 1VE7A 1R0ZA 1V9CA 3KUKA 4I36A 2ZJ1A 2AN1A 3GGCA 1FP4A 2FOIA 4GNRA 4W63A 2ZBFA 4XYMA 3VKUA 5HKKD 2CBGA 1KKLA 4PEVA 4XIGS 1X1RA 1OA0A 2SKEA 4UU8A 1KI7A 1PR5A 4V1CI 3M3DA 1GPDG 2DCUA 3HSSA 3IIEA 1B8NA 1GVNB 2H2HA 3NTOA 3OZDA 3PPYA 4GKBA 3IKTA 5CUQA 1WUJS 1AVTA 1SVNA 1LLUA 2G04A 1LQUA 1UOOA 3EXFA 1P6XA 2VHWA 1I7SB 2JLBA 2ZVJA 4X62B 4BO6A 4X0EA 3RE1A 1AUPA 1DX4A 2YHIB 2DKOA 1OUMA 1EK1A 5E0KB 3L1KA 3RWBA 1M0WA 3LIIA 5ECGC 5LKAA 4KQMA 4YP1A 1YZGA 2YDYA 4D3FA 1RYNA 4NBSA 2CB0A 5BURA 2ZZMA 1G2OA 5BUCA 5DGDA 4CXMA 4RABA 1NZDA 2EU8A 1AH2A 4DQDA 2A88A 1Y0RA 2WU1A 3D2CA 4MDYA 5EIOA 2FLVA 2FQ1A 3T06B 3X1WA 1K97A 1R3DA 2XUOA 4IIYA 3QKRA 4OB7A 1H3EA 4B76A 2JI7A 2ZZGA 1H5NA 1CUEA 5EHIA 1SY7A 3OTIA 4HWOA 4OOFA 1XXHB 5BN4B 2PMEA 4L72A 3LCCA 5HNKA 4B2PA 4KODA 2WM8A 3NBZC 1XJWA 3R09A 4K28A 5JVDF 3Q3HA 2RE8A 5LZ5A 1K7FB 1XCBA 2Y0DA 2O19A 2WMYA 1YHQB 5K6TA 1O8BA 1SVUA 1A69A 4BBAA 4RTJA 5KSYA 2CDRA 2V6MA 3PPVA 4AL4A 3E1GA 3QLUC 1P5FA 1G7RA 2CVPA 1TVKA 1FMCA 5LQUA 5AUPB 1ODCA 4QBFA 4UCWA 3R0ZA 4NG4A 1EWTA 5AI9A 4QU0A 4AW9A 2WOOA 4FB5A 4Y9UA 1J99A 4PLTA 4ZODA 2OORA 3VR0A 1M83A 1PR2A 1EKXA 1ZOIA 2D0OB 2HCJB 1M8GA 3IAFA 3ER8A 4INJA 1A7KA 3G2LA 4N5LA 1LPBB 4EELA 1SQSA 2ZKIA 3GT0A 1JG1A 3UTCA 5DTQA 2H1CA 3LFUA 3RODA 3WLHA 2BGNA 2Q0QA 2PT5A 1U3DA 2QVCA 4NV3A 4F4IA 3BWVA 1I8DA 4V24A 3NNSA 2W6JA 4R2KA 3TNFA 3KUXA 3ZWBA 4OAPA 4C4PA 5JH7F 3WK8A 5AMXA 1MKYA 3D6JA 3JVEA 1Y3BE 4B7ZA 1PTJA 4A03A 2F1LA 4K3UA 5AW6A 4IQ4A 3H11B 4V0OA 5CCBA 1W2GA 1FU4A 1AZTA 1YR6A 4FR5A 4JC5A 1HL3A 2FRVA 2PJZA 4WESA 1GQFA 3ZH9B 4DAEA 3OLCX 5DN6A 4I9GA 1SZPA 4W5WA 1ZUNB 2TMYA 5C1IA 2V5UA 1QX3A 2OPHA 3CVXA 2BI7A 2Q46A 3KS9A 4PZLA 1H2HA 5J2TF 4YP9A 3IVAA 3G8DA 1AKMA 4YMUA 3M6UA 1Z4MA 3A9VA 3B52X 4YMWA 5E6RA 1EWKA 2EGGA 4ZAVA 5KDLA 4BX9A 1OA1A 2JIDA 5AN9A 3AVWA 1I01A 1LVGA 2AMYA 2CXSA 2HUPA 2PSJA 3R0XA 2RGWA 5LMCA 3B6EA 1GTSA 4KQ9A 5ISMA 2BTQA 4C88A 4B3HA 4IVRA 4LDAA 3N2KA 2OHVA 2ZIEA 2MR5A 1TX4B 1H85A 3FIJA 4JA0A 4KGXA 4AULA 4OPVA 3KZOA 3TQSA 2JDIA 1O96A 2WWIA 1YB4A 2DX7A 3L6DA 2XMGA 4EJ6A 4XASA 4WCFA 1YFLA 2QRNA 3SEZA 3HE3A 3W04A 4AFNA 3E2IA 2ZL5A 1AKYA 1U9ZA 3OJXA 3S6JA 3Q6MA 2DWCA 4MGKR 1MG0A 1QIHA 2H1HA 3ZWNA 5BORA 3V1LA 1LS1A 1SD5A 1X39A 2CNBA 3AB7A 3AM5A 3KPWA 4R83A 4EYOA 4BO3A 2NU6B 4LVNA 2QQEA 2DEUA 4V0QA 2CJFA 1PDOA 1YZQA 2GBCA 3L7AA 1T9HA 4KW7A 4PBRA 3U17A 4YB8A 4PIPA 1E5DA 1KYXA 3OMLA 2IDJA 2JFZA 3M6LA 5I6DA 3HKBA 2IBTA 1WW2A 1DJMA 3CGGA 1H94A 1RP1A 5LC1A 3BF7A 1QVVA 2OXIA 3T12A 5KYUB 5LMNB 1DO2A 5LUAA 3LBIA 1SB9A 3DDCA 2C2MA 1V5VA 2J7KA 1GRNA 1SZJG 3PEEA 2CXQA 4E51A 2E2WA 5AUQA 2HIAA 2HZ7A 1PEAA 4JOQA 4K05A 2P3MA 5U1PA 3TZKA 1KF0A 4Q7QA 2RHTA 4ZU6X 3IKLA 1XMQB 4NE7A 1K9MD 1EDDA 2PDAA 2CMGA 2VRNA 3BVPA 3JD1A 3PGKA 4GW3A 3V7FA 3W6OA 5HKBA 1WMBA 1QAMA 2XTJA 3KVNA 3DWIA 1VPVA 3JQAB 2X7XA 4N5NA 1ECCA 1KEVA 1X1SA 3GCXA 3F46A 4X7MA 1FW8A 1V8OA 4RVDA 5JT1A 4RZ3A 3ROPA 5HS4A 2G07A 4AY5A 2H8KA 5JCJD 2EOAA 2GNPA 6NULA 3EXHA 5G1OA 4KK4A 1OTHA 2YDXA 3IOCA