4RD3A

Structure of aif2-gamma h97a variant from sulfolobus solfataricus bound to gdp and pi
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 103
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd3A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd3A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd3A01
4PZLA 3F3YA 4TSFD 1NSTA 4OQFA 4V0OA 3RRYA 3GLFE 2FZ4A 3CM0A 4W5JA 2RGAA 3GJ6A 4AF7A 3W5UA 3VTKA 1SXJC 4CEJB 2YWHA 1EFRD 1QHHA 4IDPA 4UKDA 4TMKA 1DE0A 4P32A 1MRSA 2J9RA 1F2TA 1D8TA 1R0YA 5GJWC 1MRNA 2F7SA 2DFNA 3TSZA 1KJZA 4NYIQ 2J59A 1E99A 4GFDA 1AS3A 2W6JA 2V9PA 2IBMA 1DAMA 4ZV4A 1WA5A 3AQ4A 1KY3A 2XEXA 1GDDA 4U9UA 2AXPA 4BEBA 3OJWA 3RHFA 4NCKA 4M1SA 1ZRHA 5E95A 5L3QA 3KB2A 1LS1A 1NVVR 4AIIA 3QKRA 4CDGA 4DWJA 1E9CA 2R8RA 1RJ9B 1VQ8B 1Z2CA 2IT1A 2EVWX 1JPJA 2BCJQ 3RDPA 3OF5A 3A1VA 4KLNA 2WJIA 4NL4H 1VQPB 3LVBA 3EA5A 1HH4A 4B76A 1CJMA 3O8RA 4DHEA 2GWHA 3FWYA 2H18A 2JJ2A 4KJZA 2RH5A 5L3VA 2ZRCA 3WNCA 1U0JA 1XEXB 1CXZA 2HXSA 4JKYA 4IHQA 1XPOA 3OZXA 1Z63A 1KMHB 5EMNA 4ZDKA 5A0FA 1UKEA 1II9A 2KBFA 1I2DA 3F8TA 3R9IA 1T4GA 2V6JA 4V0MA 2VL7A 1OH6A 4R2IA 2Q3HA 1XF9A 2GVDC 4NYMR 1ZAKA 1GJRA 2QN6A 2IEZA 3QG5A 4BFVA 2W6ID 1Z0FA 3FTQA 4URZR 2WV9A 1K9MD 4GOJA 3RC8A 4LSGA 1FP6A 1NLZA 2ZANA 1XXHB 3QKTA 5GADl 1S4QA 2JLQA 1F20A 3ZIAD 5DO9A 4JKIA 5FOUA 2R44A 3NH9A 4PC3A 2VYQA 5ELXA 3U4QA 1P61B 4Q01A 4LHXA 3THWB 3ND8A 4NYJQ 1R5OA 3QFSA 4G1BA 1KNXA 4G5QA 5AWFC 2KBEA 2CE7A 1W46A 1H65A 4A0RA 2VP5A 3ECCA 1NLFA 5DNYB 2GESA 4E03A 3LH5A 4FIDA 1FNBA 1KDOA 4IJMA 1OFHA 5FTMA 2GK6A 1DVRA 1T9HA 2FPLA 3K9LA 1PLKA 5E3HA 5B2ZA 2DWQA 3NEJA 1G7CA 1P7CA 4D4JA 1E2MA 2I1QA 5FL7D 1VIAA 2CVHA 4IVQA 2QMHA 1JA1A 4B71A 2G1KA 3G82C 1OXTA 2MSEB 2VHUA 3KKNA 4KBFA 1G8FA 3ASYA 3Q7PA 1CJVC 2GQFA 4N0EA 2V6IA 3EASA 2ZS8A 1N6HA 1D9ZA 4LX0A 4UNQA 2PZGA 1P9WA 2ZRMA 2ONJA 1T6NA 1CNEA 1NN3A 3SYKA 4HE6A 4EQ6B 4Q4LA 4AG5A 2FGJA 3KUCA 1JAHA 4Q19A 4OJKA 1TF2A 5AN9A 1RPZA 3ZLJA 1CJUC 1OHHD 1RFLA 2JDIA 3IBGA 4TT3D 4PPFA 2WZQA 3FMFA 4P3YA 3ZBTA 3K8YA 5HTKA 1Z47A 2XJ9A 2AR7A 1GAQA 4D81A 2IYVA 3NH6A 3NBZC 2CLCX 3FHTA 2GEUA 4JLNA 1E2PA 1Q21A 1YZKA 1BQEA 1ZNXA 5C46F 3T1VA 3KQNA 2O8DB 3OFND 4DSTA 1H8HA 1KMHA 4TL7A 5G40A 1HT2E 2RGDA 2WJYA 1GFIA 2W2TA 1AZTA 1KSGA 3N5CA 4KVAA 1YJNB 4Q48A 1FTSA 5EE1A 5C18A 2KI5A 3RS5A 4DCVA 3V9PA 2QBYB 5UKDA 4TTRA 3DOFA 2J41A 3IDQA 3ZZUA 4E22A 4JLAA 4L9SA 3QQ5A 2C9OA 4HB4A 3ZVLA 1B0UA 1VHLA 1XEFA 3KJIA 2ZM5A 3EC1A 4FK8A 1Q7YD 1S96A 1XXHA 3EW9A 2QTLA 4Q9HA 2CRVA 4LV5B 3W5HA 1G18A 4LOAA 4UQOA 1Z0JA 2ZYVX 3EARA 4RZ2A 4OK3A 2QRNA 4LWZA 2Q9AA 1DG3A 3MRSA 2IWRA 3VQTA 3TH5A 2P6UA 4BZXA 4C3ZA 2JCSA 2BMDA 8OHMA 1JR6A 3CCJB 4EFMA 1N2CE 1CIPA 5KPJA 4MUAA 3U7FB 3AVWA 4DC9A 4IKEA 2ODWA 3CF6R 1KO8A 1AZSC 4KO8A 2JIZD 1CJTC 3FJOA 2O5VA 5FTNA 4BE7B 4QXAA 3UIEA 3AGPA 4JLVA 4XTRA 5LBIA 4HYYA 3PXGA 5KNDA 4UJ3A 4DLRA 3I5XA 3VR6A 2A7QA 1KDPA 4LJ8A 4W9MC 1NMYA 3M1IA 5JS8A 2ZSBA 3CWZA 2OSBA 3P26A 3B13B 3UWOA 4E07A 2WOJA 4ZIRB 5EXXA 3KTAA 5H68A 5AUPB 1NIJA 4BFUA 1VQ6B 1P3JA 2DEUA 4A0HA 1NN0A 1W44A 3JZMA 3GJ5A 4Q1EA 1H8EA 5AR1A 1M1YE 1L4YA 3P4YA 2FA9A 3LV8A 4EQ6A 2GTPA 2QM8A 1HV8A 5EE3A 1E2IA 1UBGA 1AJEA 4JVMA 4U00A 2V1XA 1DS6A 1IN4A 3A4LA 4LJ7A 4ASUA 1DO2A 3ZD6A 2ZAOA 1EG7A 1Z07A 2GCNA 2UZIR 5KPDA 3TE6A 1OXUA 2P5TB 3CRMA 3K09A 1AIPA 3BBPA 5DN6D 5KSZA 5FTJA 1OGIA 3THYB 2WAYA 4PO9A 2WTUA 3A4MA 2BGJA 3GEIA 2D4HA 5HPYB 3IBYA 2ZU6A 1Q57A 1SQ5A 3T5DA 1OXVA 1UJ2A 4BRWA 4F4JA 4AWXA 1LFDB 2NO6A 2BM0A 3NEYA 2F55A 2PT7A 3VNVA 5SZJA 1VDZA 3IKJA 4R9UC 3RYTC 3UMFA 1WQ1R 1G21E 1T3SA 4EAQA 4XH9B 3E70C 3VHLB 3CZPA 1P2VA 1PUJA 2F9LA 4DKXA 3LFUA 4LYFA 2CXXA 3K09C 5FPTA 4LI0A 1NN1A 2D7DA 2CL7X 4XWAA 1YIJB 1XJ0A 2XSZD 5KOYA 3QENA 4P33A 3VR4A 2ODBA 1GVNB 2HV8A 4O25A 1A2KC 3TLXA 4A4DA 5TY0A 121PA 2RGBA 3X1WA 4PZYA 5BQ5A 5HKKA 4M9ZA 4TYQA 4TN1A 3WP0A 3PUXA 2ODEA 3M4YA 1QX4A 3QVVA 4BRUA 3GPLA 3BIFA 1GL9B 2BJVA 3RAPR 5FPHA 4OHWA 1K8AD 3BK7A 3CIOA 4YMTA 3Q72A 3MMPA 4TYYA 3IQXA 1KK1A 3FMOB 3ASZA 3H86A 4MRPA 4AI6A 3TSWA 5A4JA 1VG8A 2VP2A 3WP1B 4BUJA 1WE2A 1SULA 1ZM9A 4ZIRA 4HB2A 1NG1A 3ZGXA 2BF4A 3DEFA 1LVGA 3PFIA 3AF4A 3PUWA 2VF7A 5EZ6B 3VR5A 1T91A 1XZPA 3T1QA 2ZE6A 4A6PA 5DI9A 3EX7C 1F5NA 3B6EA 1ZNYA 3GD7A 5BN4A 5DYIA 3K0AB 1Y3AA 4BPBA 2BEKA 2YOFA 3HU2A 4RKEA 4P4SB 2KJQA 4DT1B 3OEEA 2RMKA 621PA 4D2IA 3GLGA 4EFLA 4ARZA 1FRNA 2ZRAA 1AA9A 2O0JA 2WVJA 1D2EA 4NYMQ 2JLSA 4OI4A 4G01B 5A5GA 1IHUA 4C43A 3W8RA 2ONKA 2IF0A 2W6JD 2XZPA 2D2FA 4LGMA 2IS1A 3WNBA 3SE0A 1Z0DA 3ADKA 4LBVA 4DLVA 4NYIR 4EFNA 5DI3A 4QOSA 1S3GA 3NTUA 4I99A 4BQSA 3K0SA 2O8FA 3QPVA 2HYIC 1XP8A 2CCGA 4QNRA 4D25A 3QUSA 1DDGA 3P4XA 2QEXB 4JS0A 5AJYA 2BWJA 4YMVA 3OZWA 2W2XA 5K8TA 2OFOA 3SJCA 4WA7A 3EZ9A 4C30A 1ZC3A 2NO7A 3TVDA 3OEHD 2XXAA 4JVLA 5CM8B 2OBNA 3HU1A 5SZHB 2P3SA 1RZ3A 2R6DA 3A1UA 5LD2C 2WWGA 1OXXK 1RRGA 1W34A 2Z6VA 4GP7A 4Q1CA 1CKEA 1AS2A 2OLKA 1TUIA 1W2GA 1N25A 2ZRFA 2YJTD 2QNRA 1W1WA 1Z0AA 1LW7A 3C16C 4GSYA 4PHTA 4RD0A 1IOZA 3VKWA 3E2IA 2QU8A 4Q1AA 1SKYE 1QBKC 1S9DA 2Z4SA 3K0CA 2JLUA 4TTPA 2QE7D 1SHZA 5IT5A 4HAUA 3CC7B 3SYNA 5J5CA 4NPHA 4QJ4A 2AHOA 1NMXA 4EH1A 1CS4C 4RJLA 1AKYA 4EIWA 2DFTA 4MGYR 1IONA 3KQLA 3L43A 5JS7A 2FG5A 4MYUA 4PQRA 2FN4A 4JYCA 5HCIA 3WMGA 2JLZA 1R0XA 3VHXA 1ONBA 1C9KA 3RS4A 3L0OA 2REBA 3SFVA 1OF1A 2F1HA 3MWJA 5IK2A 2KE5A 4OQMA 3KQUA 1KNQA 4YHBA 2NPFA 4OJQA 2VP0A 3VMFA 1TVCA 3W9YA 1W4CA 3IEUA 3K0CC 4U02A 1BIFA 3HP1A 2QP9X 4NYJR 3ADCA 2O0KA 3BJIC 1ZC4A 2G3YA 1IY1A 4BLTA 2OHFA 5E7JA 1LV7A 3BWDD 3QF4B 1COWA 1G8YA 2XB4A 3AKEA 3BAFA 5KDLA 4JSYA 4YMWA 4TYNA 5EXPA 3RABA 4EPRA 3U2QA 3R7WB 1G41A 4QBHA 4F91B 3NXSA 2XTMA 1U81A 1MH1A 2JLRA 4DLYA 1Z8FA 4DT1A 3VU9A 1LTQA 3JQPA 2ZUCA 4A2QA 3TVTA 4HZUB 2QL6A 2ZS7A 5JBQA 1E0JA 2CK3D 2JJ8A 1XX6A 2DFKB 4XSHA 1E2JA 1LS6A 3E20A 4MRRA 4PZZA 1CULC 1YE8A 1PVOA 4MUBA 1XEWX 4HLUA 3SBEA 1W36C 1W49A 2D7CA 2GEDA 4CYMA 1Q81D 2H92A 3CCSB 3B9QA 3L0SA 3MHPA 1IN8A 3JVUA 3U3JA 2QTFA 1R0WA 4QFMA 4RZUA 3ZH9B 1TUEA 4EDHA 3T12A 1A82A 2WAXA 1BOFA 3EZFA 1R8SA 2A78A 4D4LA 3I3SR 4M1WA 4HAZA 1G8PA 4Z1MD 3R9XA 1NVUQ 4QL3A 1VG0B 1XTIA 3W3ZB 4DQLA 1NBMA 1NJGA 4LHZA 3OZUA 1JR3A 1XJCA 2QZ4A 3W6OA 3EPLA 1JJ2B 4QG7A 2GXUA 1QFYA 3TQCA 3TQFA 2BV3A 2X3UA 2N42A 4HLUC 1M7GA 2QTHA 3LWNA 4C2UA 2O8CA 3CKLA 1PJRA 1PV4A 2P6RA 2FPKA 4FMDF 1L7VC 2HCJB 1XD9A 4D26A 1Q1BA 3K1JA 3FHOA 1BMFA 2ZI5A 5GJVC 2C77A 2NZJA 3W3AA 2VEDA 2ZITA 1WP9A 3S1AA 3QIAA 3IIKA 1QFZA 4MKFA 3GLGE 1T3LA 2VTKA 2BBSA 5B64A 2DCUA 2QQEA 3A8TA 4QNMA 3BH7A 1XMSA 4Q00A 1FPMA 2AX4A 1EK0A 1OFTA 1GITA 3H84A 1YJ9B 2HXYA 4LJ9A 4MRNA 5DISB 4OHYA 2BMJA 1U0LA 4YXWD 3B85A 1SVIA 1UM8A 1UF9A 3GLIE 3WYAA 4FI3C 3CD6B 2QSZA 5HCNA 2FMXA 4M1KA 3CXCB 3BGWA 1YZGA 1O3YA 1TAGA 3KFVA 5LB2A 4DVGA 2WWFA 4D80A 1VCMA 2AKAB 2J5XA 1GZSA 1QVFB 3FB4A 2IYXA 4DDVA 3TK1A 5J4YA 2GZDA 3QKUA 5H70A 3QFTA 4B3BA 1FQKA 3TAUA 1OYWA 1T0JB 1YR9A 2ATXA 1FMJA 3CX6A 3P20A 3LRPA 4XVQA 2KB0A 1QHXA 3G5UA 3QKSB 3B8HA 4EPWA 2OESA 1GNPA 2RGEA 4HZUA 2GETA 1MO4A 1E9EA 2A30A 3HYRA 2QPTA 1YZNA 1U90A 3OIWA 4F7WA 4F38A 4F92B 2J0VA 4TLBA 3T34A 4XWKA 3GEHA 3NC1C 1SVKA 5KDDA 1H8ED 1CQXA 1TF5A 4JZKA 4YMSA 4NKRA 2FOLA 3RC3A 5KNCA 3KXLA 2C98A 4FWTA 2DWPA 5KU1A 1HQCA 2FGKA 1UEIA 1RVDA 3NKVA 2Q3MA 1G7SA 1E2EA 1E62A 1Q1QA 4JIMA 2CE2X 4Q4JB 1ZP6A 3U6BA 1FNNA 3QFCA 1X8LA 2ZR0A 2WSSA 3WYGA 1YITB 3I1FA 3QXXA 5P21A 4EJSA 1M1KD 4DUGD 4BGDA 2C99A 2DB3A 4PAQA 4AG6A 3G6EB 4Y9RA 2C78A 3TJZA 4BECA 1OV4A 3C7KA 3PUVA 1DEKA 4DCUA 3I55B 2UZ3A 2CLDX 3CBQA 4B32A 1MO3A 5GJBA 2V55B 5KYKA 3GMTA 4ZO4A 4BZQA 4G5GA 1TPZA 2J0UB 3AV0B 3LXRA 3QEJA 4RVCA 4NCIA 3AF3A 2DPXA 3VR2A 4G5SA 4IXNA 3U3OA 2IHYA 2YWEA 4CT4B 5G3YA 1E1RD 2ZEJA 2PMDA 4PPQA 2ZSDA 3W5JA 1WDTA 1CLUA 4B3GA 1QHSA 4EJSC 4URWR 1W5TA 3PV0A 3RSLA 3LD9A 3ZYCA 1KY2A 4POAA 1X86B 4Q9IA 1ZU4A 1GUAA 2J0QA 2NTYC 1Q0UA 2YOGA 4II7A 4MKIA 1G3QA 3IO5A 4I1VA 3SN6A 1QFJA 1XPUA 1XTKA 2IUTA 2L0XA 4EKDA 1F2UB 2EU8A 1ZCAA 5H59A 2IYWA 1VQMB 3C4JA 4C0HA 3WRXC 4GI7A 3K70C 1G5PA 3UANA 3BB1A 2FEOA 3RS7A 3QOFA 2Z4RA 3KFXA 5EP4A 3FMIA 4JT2A 2ZREA 3T35A 1IQPA 1P72A 3L0IB 1FTNA 1R5NA 3SDZA 4Q5IA 3ZS9A 6Q21A 3WXMA 4HSEA 4NBSA 4KITB 4B34A 2BMFA 1XTRA 3MUFA 4NDZA 3W2EA 2J45A 2PLRA 2BMWA 1E9DA 1YRAA 3EXAA 4IDNA 4R2HA 5DYGA 3KDSE 3QKSA 3MD0A 3OW2B 2PCJA 4YC7A 5FBLB 2V1UA 4L15A 1G9XA 2VP4A 1SZPA 4M9SA 1IB0A 2HJVA 1D2MA 3GJXC 1Q3TA 2QAGB 3LQRA 4HDCA 1N0VC 4UNPA 5JRZA 4IOKA 1N3BA 2GKSA 3D31A 4KSCA 3I4LA 5DE3A 3NBFA 2WKQA 2OILA 1JXOA 2KWIA 3OEED 1QDEA 3BORA 2H8KA 3GFTA 3V4FA 5IF9A 1J70A 3GLHA 3JZAA 2IXGA 3O8BA 4PQFA 1CEEA 1KSHA 4D4KA 2N46A 3DDCA 1GIAA 3N70A 1KKMA 4AKGA 5J4HA 4YAFA 4EPVA 4Y0VA 2GILA 2IK8A 1CNFA 2YHSA 3DOEA 1M7HA 1JAIA 4CRWB 3LX8A 3TIFA 4B3FX 2BBOA 2P65A 3OZVA 1LB1B 3CC4B 3CB4A 1XDBA 2PH1A 4TLDA 5DGXA 1N5LA 2JASA 4N3NA 2WPDA 3OE7A 1JJVA 1KAOA 1MABA 2J0UA 4D0LB 5J4KA 2GJ9A 4MGZR 1PLLA 1OT3A 2GJ8A 4Q66C 3MWYW 2RHDA 4M53A 4BASA 3QI2A 3ZBUA 2IXEA 1XCMA 1EFUA 2HJGA 4AY2A 1Z0KA 1W87A 3DMDA 3PITA 4IOJA 2QI9C 2RGCA 2AFIE 2V7QD 3ETLA 3IHLA 4RSGA 3A4NA 3FKSA 4K8OA 5L8VA 5JLJA 2CJWB 4TZ6A 1XD2B 5FOVA 1N6NA 3MAAC 4ACAA 3CX8A 4GZMA 4YAUA 1DAEA 2J87A 2FDCA 4ZCLA 1NRJB 4LC1A 2GJSA 3CRVA 4P4UA 3RVBA 1FW6A 1F2UA 1EP2B 1KAGA 2A5JA 1E1QA 3Q3JB 4L9WA 4MYCA 3ZVRA 4DEXA 1FRQA 4TMWA 2ZVQX 4ZI2A 4LYJA 3VFDA 1OYYA 4LHYA 3KX2A 1S8FA 4CEJA 1IM2A 1W0JA 2QGNA 3HPRA 2D3WA 3GFPA 3NDPA 1EGAA 5DHFA 1G291 5KHOC 2YYZA 1W47A 3CRW1 1Z3IX 4ILEA 1GILA 1II0A 1YHNA 1G6HA 1GRNA 3EG5A 1XPRA 4L5BA 2AD1A 2Z5FA 3QSYA 3CR7A 1XTQA 4DLUA 4ZDWA 5FH9A 5IHPA 2OFWA 2C04A 3MFYA 2IX3A 2NMVA 4F93B 2FSGA 5FR2A 3N2IA 3KQHA 1OB5A 4RD2A 2J7PA 5GJCA 1A8PA 1MO5A 4GOKA 4CF7A 4RFSB 1U8YA 2ZYWX 1RJ9A 3CO5A 1SXJE 3U3MA 4PO1A 3O8CA 4TL6A 2G9NA 4C0BA 2QAGA 821PA 2VNHA 1CJKC 1G3RA 3LQQA 1IN7A 1KI9A 3VX3A 3A1WA 5JZVA 2EYQA 5EZ5A 5HE8A 1DAFA 3LXXA 1XEXA 5DLQC 2BIFA 4TLCA 2GXQA 2B7CA 1JB9A 4YLGA 4MYTA 3EC2A 3HYTA 2ZS9A 4R7ZA 1S72B 5FTLA 3LBHA 4JLBA 4NZYA 1VYTA 4KFTA 4LYAA 2ZRHA 5F9FA 1OH8A 2XGJA 4WQMA 1G3UA 2WMOB 5CLQA 5KSPA 1OH7A 4WVFA 2DYKA 4ERNA 5FBVB 4AKIA 4C0SA 1DADA 3CCRB 4DRZA 1NVXQ 4ESHA 5KSOA 2QAGC 1OXSC 4Y9UA 2WBLC 2G6BA 3GEEA 5LPNA 2C9YA 4HI0E 3T1TA 1J8YF 1Z83A 4IOLA 4CEIB 4PO8A 1HA3A 2VP9A 4DJTA 2P2LA 4IEIA 1DO0A 2BHRA 2JA1A 5J40A 1SM4A 3THWA 4TT3A 2CNWD 1AQUA 1JEEA 4XJXA 3LDAA 3P27A 4FXPA 3AUYA 1E9SA 1TF7A 1YR8A 4L16A 5JJKA 1YR7A 2CJWA 2OZEA 3W8NA 2FV8A 2VA8A 3IPYA 3UXMA 1N8RD 3BOSA 3EWAA 2VZLA 1G6OA 2AKYA 2BBTA 3GLHE 2WWYA 3CC2B 1Q44A 1VIYA 2FSIA 3IEVA 1XMIA 2A9KA 2HUPA 4LV8B 1S3SA 2FZLA 2FSHA 4V0ME 1UFQA 3GP8A 1HEIA 4OYHA 1X3SA 2F3TA 2IXFA 2W83A 2W58A 2WWHA 5C4MA 2ZI3A 5L3SB 1AK2A 4BFYA 4FMCF 2VHQA 4Q47A 5CK5A 3W34A 4I1OA 3OAAD 4GRAA 1Q86D 1FZQA 3CW2A 1C1YA 3A36A 2MMCA 3K53A 4KVGA 1Z6YA 1Z6TA 5F3WB 4JJZA 1ZVQA 3VR3A 1XEWY 2VP6A 3UG7A 2EFCB 2F43B 5CLLA 5EXSA 1E96A 3RS2A 5KDOA 2ZJ5A 2ZRBA 1G1MA 2FFHA 1QHIA 4KHZA 1UEJA 2ZE7A 1KJYA 1NMZA 4Q03A 1IXZA 4RFSA 3CR8A 3X2SA 4AKEA 3LX5A 1R4AA 3C5HA 4LY6A 4PXAA 3W2HA 5IRCD 3WNDA 3FMPB 3HU3A 4ON9A 4PFSA 4WOPA 3SS8A 1N6KA 1RYFA 3PEVA 1E79D 2XTZA 2OM2A 3RRNA 1QVAA 2B8TA 1QGZA 1AMOA 4LPSA 4TMXA 5JSZB 1KTVA 4RZ3A 2GVZC 5FUXA 2QA4B 1N6OA 3HJNA 1E9BA 1KDRA 2QMOA 2O8DA 3X1XA 1QGYA 4A0FA 2GPJA 3LAWA 3CMAB 2EWVA 1Z6XA 1GO2A 4A36A 4S35A 2YOHA 5F98A 1KZ7B 1GG2A 2J3EA 3IO3A 2QBYA 1N6PA 4NP6A 2E87A 2PJZA 5TVKA 1ZUIA 2V54A 2GJKA 2J0SA 1JB1A 3SQXA 4IDQA 2CNDA 1K73D 3GFOA 1E64A 4CGZA 2FH5B 2LKDA 1EP3B 3SFZA 4WW0A 1JBKA 4KODA 1W0KA 4BLRA 1VKJA 4NCJA 4QGAA 4Q4HB 4HLCA 2XNDD 2ZROA 4QRHA 4WBSA 3TGPA 2W2VA 5GV8A 3NBXX 2IS4A 1MKYA 3A1TA 4O3MA 1Z08A 4GP6A 4PTLA 3WRYC 2WKRA 4TZ0A 2ZSFA 1P2TA 1GR1A 4Q7LA 4P6VF 1N6RA 1G7RA 2RB4A 4Q7KA 2GHIA 4B73A 1GP2A 1KIMA 4YAWA 5FI1B 1NI3A 4F7DA 3EPHA 5H1YA 1FNMA 1NJFA 5H5JA 4RCZA 1SHKA 2WWXA 5K8UA 4GOXA 1TEVA 1GRRA 2R6AA 2WSMA 4FCVA 4IXMA 3TR0A 4IDHA 3UG6A 3K70D 3PJRA 4LC0A 1SXJD 4OHXA 1IJEA 3CRRA 3CNNA 4LHVA 1G19A 4BZPA 1E2NA 3CCMB 3FDIA 4JYBA 1G3MA 4Z8XA 3SQWA 1W4AA 4O0MA 5EQTA 2GA8A 2YC2C 4AYTA 3AVTA 2J46A 5JCPA 1US8B 5L3SA 4UAJA 3B2EA 1WRBA 4GPTA 2NQ2C 4PAMA 4ZDIA 1I2MA 4TLEA 1F60A 1RIFA 2BCGY 4DCTA 2QMUA 1VECA 3U60B 4C0KA 5CM9C 1XXHE 4TL8A 2F43A 4LK2A 1U8ZA 2BBWA 3KL4A 4QKQA 1LNZA 3N2EA 3WY9A 2W0SA 4Q9JA 2G1JA 1TQ4A 1WXQA 1WMSA 3OJXA 4PPGA 3TR5A 4DEYA 2K5UA 1S1MA 4H9GA 3M0EA 4HEJA 4WZ6A 1ETUA 4PR0A 2QEQA 2ZTSA 5TARA 3CZQA 3G0HA 4U7DA 3OHMA 2W00A 5BWMA 1UKVY 4B2PA 3BXZA 1E2HA 1A7JA 2PX0A 2QY9A 5SZIA 4DIDA 4DLWA 2EIXA 4PAOA 3THYA 4HATA 1NVWQ 1ZM7A 2VYFA 3RRZA 5CB8A 1ZM4A 3RANA 4N1AA 1QVGB 3M6AA 1QHGA 2H7VA 5JFGA 1G5RA 1E69A 2IC5A 5BXQC 3RS0A 4WXPA 2BOVA 1ELOA 2JJ1A 2BKEA 2IL1A 3C5CA 2JJ2D 2ZU0C 3I32A 3W6PA 5AUOB 3PG5A 1FNCA 2H5EA 3BB4A 1KD1D 5F9HA 4Z8YA 2ZRIA 2RGXA 4LJAA 2W6IA 3IUYA 4LZZA 5FOSA 3P32A 3GLFB 1BO6A 2F6RA 4XVUA 4Q4HA 2ZJ2A 5JHHB 4ZGNB 2VHTA 2R6GA 3DL0A 2ECKA 2QAJA 4QC2A 3B5JA 4V0LA 1W2HA 3PQCA 4HDOB 4MRVA 4RD3A 4TYWA 3BRWD 3Q5DA 2GAAA 3NIBA 1VQ9B 4IDOA 2VF8A 4ZI3A 4I1SA 3HPQA 4TYPA 1VQKB 2I3BA 3AEZA 3OE7D 1ZW6A 1G8GA 4DLSA 1VQNB 2WIBA 1QH0A 4URYR 2FNAA 4B44A 1N6LA 3AKCA 4G1UC 1TEXA 4PHFA 1D2NA 3I5YA 2R6HA 2D06A 3CONA 2CL6X 3GQBA 5FL7A 3PEWA 3FKSD 3RWMB 2CMKA 1SVWA 4OL0A 2WOOA 1M34E 2WKPA 2D74A 2ZSAA 2O8EB 2VSOA 4C9BA 1OKKA 4XSGA 3L2OB 3B7GA 4JLKA 3RNLA 2NO0A 4MA4A 2DERA 2R6FA 3TNFA 1DPFA 1KO5A 1TQ6A 2GEVA 2VIIA 2OCAA 2XNSA 4JLJA 3I8SA 2A5FA 4UXIA 1KI3A 1ZCBA 1J8MF 3BFVA 4OI2A 4WAUA 3IIJA 2ZI9A 2PZFA 4DXAA 3K0AA 4KYUA 4LJ6A 1GL6A 1Z22A 3J81k 2ZI4A 4LPKA 4JLDA 4P4SA 1Q3HA 5FUVA 2QMEA 3ADDA 4PSVA 4EPYA 5AJXA 1J7KA 4UJ5A 5CK4A 4HAYA 4B35A 4NMMA 3EPJA 2NO1A 2ZAMA 2Q0HA 3R20A 1OHHA 1U9IA 1E94E 1JEDA 1KK0A 3I73A 1R10A 1U8AA 3NBYC 3ES9A 3FFBA 3SR0A 1QGAA 1QG4A 3B60A 1N0WA 2OT3B 1Z5ZA 3U3RA 3CH4B 4GDFA 2H1LA 3I92A 3SJBA 3AKYA 2GF9A 1JA0A 4HAWA 5KSYA 4KI0A 2J7PD 5JJLA 1AS0A 1R7RA 1Z0IA 2JDID 1PLJA 4I4LA 5TR9A 4PHHA 4Q1BA 2EYUA 2QPOA 4JT4A 1OJLA 4MITA 1A4RA 3BFKA 2OV2A 2QTZA 4BFXA 5JJIA 3O47A 4PANA 3C15C 3U3KA 4NTZA 3BFXA 1WBBA 5M04A 4K46A 1U9IC 3Q7QA 3SHWA 1ZNWA 1KO4A 1H8HD 3WBKA 3W6NA 4KLZA 2P6NA 4G3XA 5B30A 2IF2A 4A0GA 2OK7A 4DZZA 4UNNA 1P73A 3GLFA 4ZPXA 1T5LA 1Z28A 2GXSA 4G0NA 3QY0A 1X1RA 1FDRA 2D62A 3E1SA 5JWOA 4IFBA 1TMKA 4JLMA 4WZAE 1VQOB 3VKHA 5FL3A 3QFRA 3CCQB 3TMKA 3ZQ6A 4KYIB 2BN4A 4DLTA 4RZXA 4PSKA 3ZS8A 2GAOA 2XX3A 3KQKA 3Q9LA 4IVRA 1YVDA 4E09A 2VSXA 1CTQA 1EFTA 4M9QA 5SZKB 1XZQA 4WZBE 1KZGB 1ZUNB 2YWFA 1RW4A 2G77B 1VMAA 3KKPA 2RC6A 4C0LA 2QTVB 4Z51A 1OFUX 5EP3A 1AN0A 1I4TD 3FPKA 5FFMA 2ZYTX 4FD2A 4YQFA 1HYQA 1MV5A 2HDNB 4LDJA 2EFDB 2X1VA 4TMVA 2X8AA 5FR1A 2C5LA 4AD8A 3QF4A 1FL9A 4NONA 2VHCA 4W5WA 3BS4A 1OE0A 2ZE5A 3GCGA 2OCYC 3WHLA 3R7WA 2CHQA 1JNYA 2YWGA 5EE5B 4JBYA 3CNLA 4Q7MB 1NG9A 1GL7A 3RS3A 5AJZA 4V03A 2OXCA 4MRSA 4BFZA 1BX0A 1IY0A 3BH6A 3D8BA 4A2PA 2IW3A 2IYTA 3VO2A 1F2TB 2X2EA 1M90D 3QF7A 2GDJA 3TRFA 1OSNA 5JECA 1GRQA 5DN6A 1CBUA 2QP4A 3QKRB 1N5KA 4ASUD 2ERYA 3U7HB 1KO7A 4XIGS 1J99A 1MOZA 2MSCB 2R65A 1JECA 3K0FB 4OK6A 2WM9B 2O0HA 3EZ2A 1Z29A 2RKOA 2VPPA 1BJKA 1M2OB 2Z43A 4YMUA 3BE4A 2PJRA 2C2HA 2QT1A 4MH0R 4FMCB 4QBIA 1DBSA 5JEEA 1DAKA 4AYWA 3QEOA 1F6BA 1EFHA 2QG6A 4JL5A 1BS1A 1BYIA 1U99A 2A5DA 3BH0A 1KK3A 3BD9A 1BX1A 2XSZA 3K0EA 5BW8A 1QRAA 3NDBB 5IDVA 2HT6A 4M1MA 2RGGA 3B1WA 1W2BB 2GRJA 2J1LA 1FFHA 2XAUA 1W48A 3LO8A 1PUIA 2F3RA 3CNOA 4ZCIA 3IHWA 3KKOA 3MGCA 4H1VA 1JJ7A 4OQXA 4XOIA 3T1OA 5G53C 4DSOA 2WWWA 2HF8A 1GAWA 3FYHA 421PA 3OIVA 3DHWC 3ZD7A 4B3CA 2OAQ1 4Q02A 4B33A 4DCSA 2V4ZA 4GNKA 3EPKA 2PT5A 3B1ZA 4URVR 3P1JA 1KO1A 2WWIA 1D6JA 4F4CA 3U4QB 3EAQA 3B1VA 4JJKA 4B2LA 2AL7A 4GL2A 4HE5A 3CCEB 5HKKD 2C9CA 1UDWA 3A1SA 2FEMA 3CPJB 4A2WA 2ZRLA 1UBEA 2ZE8A 1NBME 1JR3E 3ICQB 1VCOA 3CF2A 1KI7A 1YZLA 1U98A 2AXNA 4DDWA 2XZOA 3AVYA 1HTWA 3QNUA 1WB9A 3AF2A 3MLEA 2PIAA 4DIEA 1NNEA 1VHTA 2CBZA 5E4FA 3Q85A 1OW3B 2VNJA 2Z83A 5FOTA 4B47A 2CVFA 5JRJA 1YKSA 1X6VA 2CDNA 2GCOB 2IYRA 5D3MB 3RSOA 1AM4D 1UPTA 3AVXA 4BLPA 3ZVMA 3KJGA 2H16A 4HLDA 4QBFA 2NGRA 4V0KA 1VQLB 1XTSA 1G17A 3KKQA 1E2DA 2ZUBA 2Q3FA 1XRJA 3R8FA 1NN5A 2G83A 4CEHB 4A6XA 1FUKA 1ESMA 3SJAA 2ORVA 3UMSA 1YJWB 4C2TA 3EZ6A 1XWIA 4R98A 4C0AC 4ZKEA 1NY5A 1HY3A 2ZJAA 2AK2A 1E2QA 3UPUA 4OQLA 1V5WA 1LF0A 4Q4JA 4QHYA 1A5TA 1IBRA 1YU9A 1ODFA 4LBZA 1I4DD 1XNJA 2B92A 2Z0MA 4B74A 3WYFA 3ZQJA 2X19A 2VLIA 5HZHA 3K0FA 4GMDA 4UXJA 4KV9A 3A37A 1BH2A 3LBIA 4HZIA 2IA5A 1PZNA 1G4AE 2GJAA 1GAJA 3VKGA 5HXBA 3OEHA 4X8MA 1KK2A 4ZKDA 3EWSA 4URXR 4DBLC 1JXMA 3W5VA 4FN5A 4L4UA 3QE2A 4D4MA 4JMPA 1TQ2A 4AYXA 1FP7A 5TMPA 4Q1DA 5CB6A 1XD8A 5DSZA 4DSUA 5EJEA 721PA 1OIWA 2HYDA 2ZYUX 2IUUA 2JJ1D 3KB1A 4JLOA 2IYQA 5FPSA 1CR4A 2QSYA 4U5XA 2IEYA 3LLUA 3UKDA 2ZR9A 4A9AA 4QM6A 4Q9LA 4MKGA 2QE7A 3U7EB 3QBVA 1HT1E 4PSAA 1WF3A 4XTCS 2JGNA 1DAIA 3CPWB 1KI4A 4RD4A 3ADBA 3TW8B 1G8HA 1TTTA 1IAQA 2QGZA 3ONWA 1GNQA 1NIPA 2V8OA 5E7IA 2VRWA 3PCRB 4MYHA 2EFEB 2F1IA 1NKSA 1IJFA 4TQAA 5GVSA 2IS2A 5AK0A 2ASEA 3LBNA 3QJYA 4PGOA 2Y8EA 1N5IA 2FJUA 3JVVA 5LDDC 4MDFA 4RCYA 1E2KA 3AP3A 4QJ5A 1RRPA 3AVQA 1AQYA 1VG9B 3L82B 3TKLA 4IFEA 3GJ3A 3SU8A 5BYJA 3SZRA 1OLOA 4YAOA 1XFAA 4Q7JB 2AWOA 1T3HA 3AH8A 3H2YA 4YONB 3R9WA 1ZBDA 3T5GA 4D82A 1SVLA 2XITA 5J4LA 4A92A 2CCKA 3JQQA 2A5GA 4PX9A 1JQLB 4HUQB 5IK2D 4XD7A 2FFBA 1P6XA 4XWOA 3AVOA 3QBTA 2QUZA 3AUXA 3CCLB 2HCBA 2MMGA 2BGIA 4G5RA 4A82A 3AM1A 1LY1A 3DMNA 2GCOA 2JEOA 5D3MA 5FUWA 3KXIA 3HR8A 3I62A 4AC9A 4QHTA 1W36D 2GZAA 2VH5R 2ERXA 4TMZA 3KTAB 1OKKD 2AD5A 2DHRA 3DM5A 1YHQB 2EQBA 4EPTA 2CK3A 1G3IA 1COWD 3IPXA 1ZU5A 4OI0A 4X8LA 5J4VA 3OIYA 1ZINA 5DH9A 4CEHA 4XVRA 1JQJC 4M1YA 1S9HA 2ZJBA 4MDEA 1E9RA 4I81A 3X1YA 3SI7A 1VCNA 5JWRA 1W4RA 2TMKA 3UK6A 1GKIA 3U44B 1SKYB 1AGRA 1TNDA 4PC7A 3UWKA 4PC1A 2RHMA 4Z1MA 1N5JA 5B58C 3MWLA 1KSJA 4US1R 5TDHA 4TMTA 3CWQA 2EWWA 5BYKA 3CPHA 4P4TA 2GZHA 5EP2A 3AF1A 4Q21A 1MO6A 1IN5A 2NG1A 4X8HA 3ZVNA 4GT1A 2AFHE 1XBTA 1EXMA 3FFAA 4B6EA 1KHTA 4CW7A 4US0R 5L3RA 4M1TA 3W90A 1QUFA 1B23P 4LYHA 4OI1A 2PEZA 1Q22A 2H57A 1NBMD 3D3QA 1JR3D 2G0TA 1YR6A 1E98A 1YZQA 2FWRA 4LJYA 2ZJYA 4EPXA 5JI3E 1W7AA 4AKHA 1KOFA 2HF9A 1OH5A 5KNBA 5HE9A 2QP3A 3SHFA 4B2IA 3FVQA 2GBLA 4TTQA 2WHXA 3REFA 5B57C 1U0HC 3IILA 4JLPA 2ANCA 1XD2A 1BMFD 4F4IA 4NE2A 2AK3A 4O2RA 1G16A 4M21A 3B78A 2OO7A 3U5ZB 1NF3A 3VAAA 2VQSA 5H8WA 1ESNA 3JQRA 3F0TA 4MQBA 3K9GA 4YXWA 1E63A 3PVSA 4GBMA 2O8BB 1EP1B 1AKEA 4G5OA 1QG2A 1KI6B 4A1FA 5JCZA 3UMRA 3V00A 1G64A 2NOAA 1CR0A 1EX6A 3DPUA 1P2SA 3AP2A 3EIHA 2PL3A 1J90A 3TAHA 3ZDQA 2QPAA 4FINA 2GBLC 1E4VA 1QG0A 1KDTA 2DFLA 4HUQA 3H1TA 3OESA 4HUTA 4KAXA 2OEPA 3DM9B 3TW4A 4LCBA 4FMDB 5GV7A 4DDTA 1XMJA 3HWSA 2PBRA 2A2ZA 1R2QA 3REGA 1W35A 1TU4A 4TWZA 2F1JA 5KTYA 4Q18A 4M9XA 2LWIA 3ZC3A 5AUNB 2VNIA 1UADA 3CX7A 1S1CA 3QPUA 4BLOA 1KQSB 3LVRE 2VO1A 2OG2A 2XOKA 5G41A 5K8IA 4ITRC 1GTVA 3ZZ0A 2FFAA 1I4LD 1NSFA 2IYUA 3BC1A 3LVQE 2WIAA 4GZLA 4J0QA 1SGWA 1UBFA 2FPMA 5FOXA 3WMEA 3MCAA 4ZCMA 1DDIA 3WBJA 2Q21A 3U44A 3T15A 1YRBA 1C4OA 1DOAA 2EFGA 1Z6GA 3GLGB 4ARZB 3QXHA 5EE0A 5FPYA 1X8JA 3PR1A 1TX4B 3B9PA 1XU4A 1R6BX 3V76A 2OBLA 2XJ4A 5LD2B 3AGQA 4Q1FA 4DUGA 4UXHA 2ZJOA 2DETA 2CL0X 2IYZA 4PPNA 3BB3A 3I56B 5DI3B 3LY5A 4A8JB 2B7BA 2R9VA 2O8FB 2ZXUA 3GLIB 1TU3A 2HLDA 5KUTA 3KZ1E 2IYYA 2X77A 4B3XA 2WSSD 4CEIA 3ICEA 1Z2AA 5BN5A 2FSFA 3NWJA 1SVSA 4P0TA 4PQYA 2R6CA 4L8GA 2R62A 3MG9A 1CRQA 2B21A 2P5SA 1M8PA 1QF9A 2XXAB 1E3MA 1TADA 1HE8B 1E1RA 1IN6A 1DAGA 1XMVA 2QENA 1X8KA 1FQJA 3CH5A 4RFVA 2D2EA 2QA5A 2YINC 4ABYA 4BFWA 2CEAA 2OXRA 2YVUA 2GXAA 4TLAA 2E1RA 4A15A 1HE1C 3THXB 5EUMA 4K81B 4DLZA 2ODNA 2ZUDA 2R2AA 1GNRA 3KJHA 3H0KA 4AF6A 1OFIA 3NHAA 1KI8A 2QM7A 3KXKA 5HZKA 2O8BA 2C96A 3CCVB 4TSFA 4US2R 2BC9A 4JBWA 4C4PA 1KI6A 4X8OA 5FBRB 3T61A 2OCPA 3K9HA 2IUSA 4LRWA 1FNDA 1RE0A 1P4SA 5CIQA 1Q20A 3SBDA 1T5IA 1ZIPA 4W5HA 4YDSA 3T06B 3NC0C 2ATVA 2RGNA 1EFRA 3RLFA 1K6MA 1OB2A 1CR1A 2RC5A 1W4BA 1M6NA 3A6PC 4S2EA 2J7KA 3EIQA 3G71B 2OFXA 4WXRA 4WIAA 1CR2A 4CZ2A 2ORIA 3I61A 4M0LA 4YALA 1NVVQ 2QQ0A 2F9MA 3TBKA 3W5IA 4NH0A 5DIFA 1T8UA 1JI0A 2ZI7A 3DZDA 2AN9A 2BVNA 5FA6A 2B8WA 1E2LA 3DO6A 3LW8A 4KFUA 1W36B 4B48A 1ZYUA 2C03A 4KU4A 2PEYA 3DVLA 1N0UA 1TL7C 3IGFA 1XCPA 3O8DA 4GMXA 4I1UA 4JBXA 5EE9A 3V4RA 3ZZTA 2ZRDA 4AURA 1R8QA 3KKMA 2RGNC 4MKHA 2FE4A 5JSZA 4FW9A 4YDHB 4M22A 3DKVA 1D1NA 5JI2E 2JATA 3CF0A 2P0EA 1S2MA 4HAVA 1WBDA 4W7SA 5DHAA 5TV2A 1ZUHA 2OTLB 3VU9B 2YNMA 4PHGA 2BSAA 1UKYA 1K8RA 4EUNA 1ZNZA 2VNKA 1MR3F 3PENA 4RKFA 1H85A 3QXCA 4UNRA 1EWQA 1XCGB 5FBQB 1FMLA 3R8CA 1ZD9A 3FGNA 1D9XA 1R5BA 1YZUA 3RWOA 3EIEA 4ZDJA 5THXA 2DY1A 2OK8A 3CPEA 4P31A 5AJWA 1WCV1 1EFCA 2OTJB 1KJWA 1VTKA 2OBMA 4A8JA 1IXSB 1G7TA 5KO2A 5FPKA 1UKZA 3SNHA 5HR5A 4DQKA 1Q1EA 2CCJA 3W2GA 3PIRA 5GVRA 2FU5C 1H42A 3SEAA 3GLIA 1E0AA 1DARA 4C0QC 2QRZA 5FOWA 3X1ZA 2ZI6A 4D0NA 4JL8A 4B4DA 4M2LA 3ZIAA 1FX0B 2QT0A 2G0NA 4NCHA 1IY2A 5FI0B 1EX7A 1OPXA 1F3OA 2PCLA 3AF0A 3RRMA 1YQTA 2Q9BA 1T0HB 2IYSA 2C8VA 3X1DA 4LBYA 4AK9A 1NDHA 2V7QA 2QORA 2ZVPX 5F2EA 2O8CB 2WPDD 3HR7A 1QVRA 4DLXA 1MT0A 3THXA 4A8JC 5EUQB 2N1BA 2FX3A 2HEIA 4BEJA 2BMEA 3PUYA 3ZJYA 3S1AB 1SVMA 3TUJC 2DWOA 1NKTA 2Q9CA 2ANBA 1ANKA 3B1YA 4DDUA 3CCUB 3CLVA 1US8A 2NIPA 3D6TB 3W2FA 5KSWB 1L8QA 1Q1ZA 1ZD1A 3FKQA 5LB4A 1EWRA 1RC8A 2YV5A 5C1BA 1VQ7B 4FCWA 3NG1A 1CU1A 2H17A 1A1VA 1DG1G 1E1QD 2ZRKA 1J9ZA 4M1OA 3SJZA 1E9AA 1M7BA 1VQ5B 2YC4C 4HAXA 2V3CC 3D7MA 2A3RA 2GNOA 2JLWA 4KBGA 2QDXA 4JSTA 2BPOA 1OIVA 1W0JD 1YJ5A 4DCNA 1P75A 5C2JB 3NHBA 2YKGA 1NL3A 1XJQA 3GJ7A 4RY2A 3VX4A 3KJEA 2HMAA 2VHJA 3KUDA 2BJWA 1I7PA 4TQ9A 2ZIAA 4XD7D 4FMBB 4CIDA 2OAP1 3DZ8A 3QPWA 4RD6A 4ESVA 4HDQB 1ZD8A 2GCPA 3LA6A 5J47A 3HDTA 4NCNA 1P9NA 2E9SA 1K5GA 1E2GA 2CLSA 1W5SA 3EA0A 1EWYA 1ZJ6A 4Y0AA 3OFNA 2IWHA 4Q4AB 2GF0A 4KXFB 3NVAA 4LUCA 4OK5A 2ORWA 2ZPTX 4HB3A 3U6KA 3CUEF 4MGIR 3QVUA 5CDFA 3IQWA 2BEJA 5CYOA 2XB2A 4QGFA 3C41J 2REOA 4B6FA 1KYIA 2JLXA 2I1VB 3LW7A 2IHBA 3ND9A 2GK7A 5EP1A 221PA 3W2IA 1RYHA 2EFHB 1UDXA 3BERA 3CRQA 4HB0A 1KKLA 2RCNA 4JVNA 1DELA 4URUR 1XE1A 1VCIA 2P67A 1N6IA 3E5HA 4HLQB 3F5FA 5CJPA 1FUUA 4DB2A 4R71A 1II8B 1NY6A 5E7MA 1B2RA 2PLFA 3B82A 3VO1A 1L2TA 4QHSA 5K8LA 1FX0A 2F1RA 1ZMXA 4QGHA 1KMQA 1VPLA 2XZLA 4TQUS 1QHYA 4EJSB 1RRCA 4N3GA 1E32A 2KSQA 5JHGB 1GOTA 3QG1A 3AVUA 1ZM3A 2CNWA 3MSXA 1UAAA 1E6CA 1P9RA 2FFQA 2VBCA 2ZJZA 4OHVA 3VR1A 4G1VA 2Q6TA 5AUQA 1Z06A 2WJJA 4LJ5A 4NHOA 4QGGA 2WICA 1KI1A 2JIZA 3SC3A 3SYLA 3FE2A 1VYVA 3E1YE 4C7OB 1OIXA 1GVHA 1K5DA 1Q12A 1KSFX 4BFSA 3K70B 5FTKA 4B43A 3DKPA 2IYLD 2ZRNA 1SKQA 2O52A 1T8TA 4H1UA 2RAPA 1SXJB 2ZJ8A 4UNSA 5JMTA 4FCTA 4D0GA 4QJ3A 4N0DA 4LHWA 2BM1A 3FHCB 1QHNA 1LF5A 2JLVA 2G88A 1Q82D 1DTSA 4LV6A 1RKBA 1QUEA 3TSOA 1GWNA 1U94A 1BYUA 3L8YA 1IXRC 2O8EA 2W0MA 4O2LA 1P60A 1KRHA 1CP2A 3MWKA 3H4MA 4IVPA 1TLLA 2CHGA 4M8NE 3OAAA 4OQNA 5CIWA 4KCGA 3G4SB 1VYUA 2CHVA 2OLJA 1E0KA 3U7GA 1Z6AA 1UMKA 4BWYA 1CF4A 2PZEA 5D3QA 1M74A 1XTJA 2FF7A 4B75A 1E2FA 4BFTA 1KI2A 3FOZA 1S0UA 4Y7CA 521PA 1TQDA 3IIMA 3Q5EA 1QHHB 2WMNB 2ZRJA 3PEYA 2X2FA 1P2UA 3C8UA 2YZ2A 1JPNA 1O87A 1E4YA 2ZETA 2EW1A 1G20E 1NLYA 3AVVA 1EESA 4ACBA 4NU0A 1DAHA 2ZRPA 4LJ4A 1GSIA 1E79A 3AP1A 3K9NA 2I4IA 4IEEA 2PX3A 2SHKA 3FPAA 3Q8XB 4PC6A 4Q9KA 1E9FA 2BKUA 3LLMA 2OUKA 5CYPA 5L3QB 4Q4AA 1KGDA 4DSNA 2B5OA 4D6PA 4QM7A 1RRFA 4BLSA 2UVQA 3GJ4A 4OHZA 1L4UA 1HUQA 4ZGQB 2WJHA 3WHKA 4JL6A 4B3DA 1G4UR 2C95A 2XOKD 3L0PA 1ZM2A 3OIUA 4JVSB 5FBWB 4MGKR 1AGPA 4IW3B 4PC2A 2AWNA 1OGJA 1BKDR 1X1SA 5CITA 4V02A 2JAQA 2OCBA 2DR3A 5C4GB 3CRZA 1HQYE 2OE2A 4RD1A 3PUZA 4KSBA 1HURA 3L8ZA 3UATA 3GLHB 2NZ8A 1ZIOA 2ZRGA 1CRPA 5AJVB 1GKYA 1II8A 2HT1A 3C14C 1J2JA 3GJ8A 3I8XA 1F48A 5EXTA 3TUZC 3WMFA 5TXGA 1P5ZB 2XNDA 4QBGB 4C0JA 3VNUA 4V0NA 3TUIC 1SVOA 2DBYA 2VSFA 2MSDB 4IOMA 4CVNA 1UBCA 3EZ7A 4LBWA 2WJVA 1E0SA 1QZXA 1YZTA 2A5YB 2IS6A 4FWIB 1XB2A 4IRUB 3MJHA 5BN3A 3A58B 3U61B 1JALA 3QXJA 2HLDD 1FOEB 1W0KD 1GKUB 2ZSEA 3LO5A 1A2BA 4E5UA 2JLYA 4DB4A 4BLQA 1MABB 2LKCA 2UKDA 1R0ZA 2XNJA 1D5CA 3GJ0A 1VQ4B 5JWHA 1U2RA 3CMEB 4CT5A 4C7OA 3B1XA 1KC8D 1Y63A 3QXSA 4KFRA 4KFSA 4OBEA 3AVPA 3THOA 1SXJA 4K1XA 2ZR7A 2PMKA 4Z54A 4M4SA 1VG1A 2ZQ5A 5JEDA 2REXB 1V43A 2XNCA 4BPRA 2NPIA 2NO9A 3AKDA 5CDFE 2QROA 2B6HA 5FUYA 1P62B 3AB3A 1NJID 2XTNA 3QE0A 4OKSA 5G3ZA 2WJGA 3MJRA 3PEUA 1NP6A 3LNCA 5ANRB 2BDTA 3SOPA 1GM5A 3I72A 5TB5A 1G5TA 4TL9A 2LCFA 1YI2B 5CJ2A
chains in the Genus database with same CATH superfamily
4PZLA 2DQKA 3F3YA 3VM6A 4OQFA 3RRYA 3GLFE 5FNZA 5JYDA 1NNUA 4MNTA 1Z0ZA 2XKAA 1B7GO 3KJQA 3SE7A 4RIHA 5JJBA 3LTNC 4HZGA 1PQ4A 2IEBA 4J3FA 1Z16A 4DM7A 1T6ZA 3BWVA 5EJ6A 2J3DA 2OO5A 3LPDA 1XQ6A 2IV2X 5FIUA 2J9RA 3CA8A 1R0YA 1P4GA 2DFNA 2Y76A 3S2GA 1KJZA 3QLVA 4GR9A 2J59A 1L1QA 4GFDA 2VAWA 1LEHA 2W6JA 1PZFA 1OLUB 1KY3A 2AXPA 2JF0A 4YJ3B 2JFUA 2OP1A 4RVNA 5KYNA 5TGTA 4K05A 5L3QA 1UH5A 3KB2A 2A0XA 4M7PA 5K0SA 4AIIA 2YHIA 3GMSA 4DWJA 4EKGA 5A5EA 2IT1A 1V8FA 3MQFA 3OUTA 4FOLA 1N2CA 3OF5A 5CCEA 1GFZA 3RIGA 4AP6A 4L9AA 2WF6A 3UMBA 1VQPB 1WF6A 3FFTA 2P9FA 1CJMA 3O8RA 1CYEA 4DHEA 1K4KA 3KCNA 2IPAB 3AHEA 3CZCA 2K2QB 5L3VA 5SY6A 3NGLA 1LPNA 4RHCA 1D4OA 4E7PA 4JJ6A 5BQPA 2VPZA 1CK4A 1JIQA 1T36A 1Y1LA 2C5SA 2HXSA 1UCFA 2VH2A 3PCTA 5EIBC 1OVGA 3HWWA 4ZDKA 2SBTA 3Q88A 3G49A 4BNDB 1HRKA 2JBAA 3R9IA 4D43A 1T4GA 4I8DA 1QYVA 1U7OA 5AVQA 3O4JA 4KOEC 2DYIA 2QRJA 4DV2B 2IY9A 2WILA 3C3AA 4FX2A 4DMKA 1E5QA 1U0EA 4HIZA 1C2TA 3CZ5A 4PTYA 4NYMR 1GJRA 3QG5A 4Y0NA 3GOQA 3E3MA 5BOSA 1UFOA 1Z5WA 2W6ID 1TM7E 3RSSA 2B99A 3S2FA 1K9MD 4GOJA 4DY6A 3TSCA 1EE9A 4YCBA 3TIGA 2BHTA 2VK2A 4MQFA 4PYJA 2PS3A 5J3OA 1F20A 3DAPA 1JDTA 4FGWA 1UPBA 3MT0A 4KYVA 5EGNA 5C81A 2BGRA 2X1HA 3HUUA 4W5OA 4F5DA 4PLTA 1VKZA 5TLSA 2IP4A 1P61B 2YV1A 5CIYA 5ELXA 3IXLA 1XLUA 4LHXA 2Q5HA 1G98A 3GVCA 4NYJQ 1R5OA 1SFRA 1T2AA 4G1BA 1VM6A 2BTOA 1KNXA 2O4CA 2PH5A 1OX4A 2Z3ZA 2CE7A 3EOBI 4LXGA 3TG8A 1R37A 3EXHA 5DK4A 1NLFA 5T64A 1A8QA 3SSOA 1GAEO 2GESA 3LOUA 3LH5A 2IOFK 2Q49A 2JCXA 3NTRA 2OV4A 1R4MA 4FIDA 5FTMA 5LA6B 3ZU3A 1YJAA 3D1VA 3Q3VA 4LE1A 4H4EA 4G8JA 4MV1A 4AICA 2BUCA 4D4JA 4OCZA 1LNQA 4WXEA 3M5PA 3I9LA 2I2DA 3HNOA 1VIAA 5FL7D 1ECCA 5A6VA 2CVHA 2QYOA 2OOKA 3KBOA 1QMPA 2VUHB 4IJVA 2ZAGA 4OGGA 1RBZA 2W8BA 4G8CA 3STWA 1VSQA 4PU0A 2VHUA 3F46A 3VVLA 1YI0A 2O0MA 1TD1A 3KKNA 3PDUA 2PUGA 2WHEA 1XWWA 3HGMA 4LX8A 2O2XA 2GQFA 2YVLA 4POOA 2V6IA 1A9QA 1U9JA 4RSMA 3TRHA 4MV6A 3JYQA 4AAYA 1ENOA 1U3CA 4P98A 4UNQA 1P9WA 5GZ1A 1W6UA 1NN3A 2ZTGA 4HE6A 1ZA1A 2NT4A 5M3BA 1EFKA 1YJBA 3ZCUA 3F6BX 3ER9A 1U1FA 2C8KA 3I9JA 2HSGA 1QJ4A 2R60A 1H5UA 3MK31 5B6JA 2YXDA 5IVHA 4LRUA 3L3BA 3GP5A 1GPAA 3A11A 4OIMA 4EG5A 1RPZA 3OTHA 2QYSA 3WDLA 1W581 1OHHD 2JDIA 3P45A 3HA5A 4FEGA 1L4MA 4E5DA 1PEKE 2BHLA 4XD2A 1SC6A 2WZQA 4GECA 5HTKA 4PS0A 3JY6A 4D81A 3FDXA 2IVZA 4ZAVA 3NBZC 1X80A 2IITA 1M8GA 1MG0A 1Q0HA 2ZUVA 3C3DA 4WD3A 2IXDA 3KT6A 1LV8A 2GEUA 1ZNXA 1BQEA 2ID9A 1G63A 3OFND 3OD1A 3Q0EA 3WLOA 5G40A 2RGDA 4BTEA 2R86A 1NHGA 3HFJA 1PJ6A 4KVAA 3Q3GE 1Y4UA 3SQMA 1YO6A 1YCGA 1W88A 3O73A 1D3AA 4UNIA 3V33A 2AG1A 4HNAB 3OPVA 4KE6A 1MC4A 3ZDZB 4OF4A 4O4LA 3DQQA 3ED5A 2QMZA 4P12A 3IDQA 3NFRA 4ROSA 4R40A 4GI3A 4EW1A 2VDUE 5COBA 3EVBA 2C9OA 3VO8A 3DKKA 2I7DA 2QUJA 3C24A 4HQ0A 1VHLA 2XVXA 3AJEA 2ZBDA 2QOEA 4FK8A 1QH1B 3BTVA 4JY7A 3EW9A 4RK6A 5BR4A 1IAVA 3JQAD 2QTLA 4IFTA 3PDJA 4ZANA 4Q9HA 5DCLA 4BZWA 1FS4A 1E2BA 4RL6A 1BKYA 2WF9A 4IIYA 2ZYVX 2I4OA 1S3FA 2VS1A 1QLHA 2OV3A 3G88A 4YUAA 4OHRA 3L07A 2IWRA 3VQTA 1BZYA 1FYWA 3CCJB 2YXBA 2CFSA 3RHTA 5CVTA 4GVXA 4MUAA 3U7FB 3EXIB 4JWTA 3ZE7A 4BX2A 2PUWA 4EMBA 1J9GA 4XGQA 5ALQA 3BCSA 3PNLA 1PWZA 4LXUA 5F12A 4UHHA 5FTNA 3C43A 4NBTA 5GM2A 1NQVA 3CG4A 3D4OA 1EX1A 3C2QA 3F3MA 1XDWA 4NMLA 1BGWA 3BGIA 3AGPA 3GFGA 5JNSA 1DKOA 2X9NA 1CE8B 4GMHA 3FPBA 4DLRA 3FNEA 5C80A 4ETNA 4KO3S 5KNDA 1DEXA 1KXJA 1U5CA 5KYWB 1KDPA 4KPYA 4YO8A 3HZRA 3BCDA 1RLIA 2ZSBA 4WOCA 2OSBA 4Y6RA 2REQA 3B13B 2ZOSA 5EXXA 5H68A 4YRQA 2D4AA 1SXPA 2G17A 1VQ6B 4BKUA 3CFYA 4H77A 1V7QA 4A0HA 4JC4A 4EB3A 3WGGA 1CUEA 4CG0A 5L46A 1DHRA 4MKRA 5SYNA 2IPOA 5AW2A 2Q5LA 4O5AA 4BVJA 5BVHB 5AR1A 1IG0A 1Z4OA 2AZXA 2HSWA 1XLTA 1EUZA 2YWRA 2ZB2A 1RM0A 3MTQA 4FT4A 3BL8A 1NNI1 1ZVMA 4OBBA 3WO1A 2FPUA 4L07A 4XX1A 3EXFA 4BNJA 4U00A 4YS6A 1DS6A 4N5MA 4U2CA 4QYXA 3QVKA 1IN4A 2PO7A 4LJ7A 1NTRA 1K28D 1Z75A 2ZAOA 3TR6A 7ADHA 1GPNA 5KPDA 1CQJB 1N08A 1H2HA 2XW6A 4R31A 1Q16A 3U9SA 4AWBA 3K05A 4QUZA 3NZEA 4AULA 2XA9A 4ZGWA 2B36A 3K09A 5ICGA 1NW5A 2JHFA 3H6KA 1Y9AA 2DY0A 5AVOA 4DA7A 5KSZA 3GVXA 2V3VA 1YS6A 5FTJA 3ZOZA 3ZJVA 3OZFA 1OV6A 1JDNA 3TW6A 3GEIA 4MEJA 3DNMA 1BD4A 2D4HA 3HRKA 3CMCO 2VK8A 4WZBB 3TPCA 3TRDA 1HTBA 1OXVA 3GY0A 4Z0PA 1Y1QA 3IB6A 2PNFA 1GGFA 2H4YA 3C3YA 1K68A 1HZJA 5SZJA 3TEMA 2PY6A 3IXMA 2DHDA 2DTDA 1H93A 1RPNA 1T3SA 1LW6E 2OORA 2P5YA 2PX6A 3SKVA 4XH9B 1NXWA 5EWLA 5IZCC 3CZPA 1ITZA 1JZSA 1P2VA 5EI5A 4F6CA 4GBJA 3CLRD 3F7TA 2O2DA 4YAJA 3QSGA 4Q93A 2XSZD 3U7QB 4KXLA 4CV1A 3TTSA 3VR4A 4YLYA 1EP9A 5I9IA 5IAAA 1GVNB 2QTGA 1GXSA 4G0XA 3TLXA 2AQHA 121PA 2RGBA 3NRJA 4Q3OA 3D8TA 4GQBA 3KHUA 1SA0A 1U4SA 1E1CB 3F7OA 3NASA 3R3JA 1VPTA 4MR7B 4AL4A 2GAIA 3RF6A 4TYQA 3E3AA 2ODEA 3PUXA 1QX4A 3QVVA 4BRUA 1HC7A 2J3HA 1GL9B 1PTJA 4BB5A 2M2IA 5FPHA 3ZDCA 1OBVA 4HMQA 3CIOA 2G9QA 3V46A 4YMTA 4Y9DA 4UEOA 3EAGA 4TZTA 3IQXA 5BSXA 2Y67A 1WOOA 2AQ8A 2HIGA 3LQKA 4MI1A 1SU7A 1XTBA 3GT3A 4WKGA 1RWKA 2QDKA 3A1FA 1ZCZA 3OTIA 3WLPA 3DMTA 1D0IA 3WLHA 3FF4A 1DTEA 4M60A 3PXEA 1PJ3A 4MVJF 1ZM9A 3C6KA 3D8HA 1IHMA 1J97A 1V48A 3BK2A 3LQ4A 3NHJA 4PNZA 4NBNA 4XZ3A 5ESXA 4YRGA 1LVGA 2B82A 1C7RA 4H1HA 5GGXA 4JI1B 3MWGA 5D5QA 4D9MA 1TJYA 4DYVA 4I50A 1BVRA 2P2YA 1FMFA 5ABPA 2ZE6A 2HEGA 5DI9A 3W6UA 5D87A 1F5NA 2ID8A 2YRXA 5BN4A 1BHQ1 2HXGA 2OZLA 1YU6A 2QJFA 1AF7A 4RKEA 1O77A 4DT1B 5C34B 621PA 2O4UX 2FW0A 1KU6A 1FRNA 3A2NA 1ZXBA 1MJ5A 2WVJA 2BGNA 2ZRAA 1D2EA 4Y2UA 1SIBE 3JTEA 4JOBA 1T9ZA 3CBGA 2ZAIA 4OI4A 5I9MA 1PJZA 3ABIA 1Z9BA 3DOIA 4JVOA 2IF0A 2W4MA 2KPOA 2IS1A 1KS2A 1Q5PA 1X77A 2P3QA 1R6AA 3K8QA 5AXAA 3PE4A 3VTAA 1MF7A 4IJ5A 4X92A 3RS8A 3WWPA 5AHXA 4WI1A 4NYIR 3TB4A 2ZGVA 4QOSA 4QELA 1TPYA 4I99A 1DC7A 1QIHA 2FPRA 1O94D 4QDUA 4C4TA 1XP8A 1EXVA 4DW8A 3SAJA 2COKA 3AIMA 4CLHA 1U11A 4HXYA 1YRLA 4I4TA 2YV3A 5AJYA 2ZXIA 5LL6P 5EWMA 2XDWA 3BHMA 2OOSA 3PDIB 1IVYA 2H2GA 4BCDA 1H05A 1EU1A 1ZJZA 1ZC3A 4NS1A 2XXAA 5CPBA 3FNQA 1XR3A 3B3AA 4UULA 1P81A 2F2TA 5F9MA 3VR0A 1T5BA 4TTAA 4LI3X 2H2IA 3K9FC 1HR0B 3B6IA 1RZ3A 4H3HB 5LD2C 1RRGA 4I9HA 2AR0A 3N8IA 3G59A 2QLTA 3KLOA 1VE3A 4Y7DA 1N25A 4ME6A 1UJMA 3PSAA 2QNRA 3IEPA 2K6GA 4OH1A 2Q5CA 1PG2A 1UP4A 4XARA 1WAMA 3JASA 4DMRA 2NM0A 4BQPA 1ZEJA 4FYJA 4HFRA 2IZ1A 1QBKC 5AK4A 1J33A 1UBHS 4OJYA 4UPEA 3UJNA 4TTPA 4B6GA 5IT5A 2JLUA 1ZMBA 3BIWA 3OQJA 3CC7B 3GQVA 3PPYA 1NJ5A 1L3CA 1N1GA 1USVA 1Y5MA 2Q4OA 4QJ4A 4C6TB 4EH1A 2PJDA 3DBLB 4ZVRA 3AM3A 4B7ZA 4DXDA 5B7NA 1UPUA 1IONA 5DNWA 5FPQA 1YASA 5FWYB 5JS7A 3KQLA 3A3KA 2WVGA 3GRAA 3HB1A 4MWTA 1R0XA 3ON5A 4XX0A 3VPDA 4FHFA 1SUFA 1ONBA 3G7SA 1ZEMA 3O3MB 2IQ5A 1T15A 4K3UA 1C9KA 1V0JA 3A9WA 5A0TA 5AW5A 3TO5A 5IK2A 1OF1A 2ET6A 3MWJA 4RY0A 4BCBA 4EA6A 4IUYA 4QFDA 3E4CA 4UOZA 5B3KA 5BNIA 3KQUA 1KNQA 4PLGA 5DNDA 1C7FA 2VP0A 3VMFA 1YH3A 3HVIA 4ZGBA 4ALLA 5CR9A 3ZCRA 4DYHA 3MNFA 3IEUA 1YFJA 3CXUA 2QL7A 1BGVA 3FPJA 4FYMA 3COZA 5BQ3A 1RHKA 3L8HA 4RDKA 4MS1A 1IY1A 1NBHA 3UTCA 5LP1A 1GPDG 3NM5A 4TTJA 5DM1A 4S12A 2PQ0A 3INNA 2XB4A 4HYTA 4UCFA 5E1BA 4GX5A 4EPRA 1YZVA 5BQFA 4IIHA 1D2GA 1SOUA 2V98A 3EQ9A 4NF2A 4G4IA 1TLTA 1E1LA 4XKVA 3OW7A 1Z8FA 3IVXA 4NV0A 2NU6A 5A2GA 4A2QA 4BV3A 3OECA 5I9LA 4Z4WA 2Z2XA 3REQB 2CMFA 1E0JA 2JJ8A 2CK3D 2R4UA 3JYNA 3V32A 5TJ9A 2OGTA 4EHLA 1QZ3A 3UUFA 4E13A 1MB0A 3PE6A 1W36C 1XEWX 3H1BA 3UJAA 5JC8A 1GLGA 2D7CA 4TUYB 3IP5A 4E5PA 1Q81D 2Y71A 3CCSB 3B9QA 1R0LA 1UBMS 3I8OA 1IN8A 3L0SA 4PFJA 1P74A 1V0EA 2I6UA 1TW3A 1JH9A 3VA7A 1X38A 1A82A 4JHLA 1EVJA 2Z6UA 3V1MA 4D4LA 3UXEA 1TOAA 1WB4A 1N05A 3R9XA 2I7CA 1NVUQ 4QL3A 5A3RA 2MYTA 3VMMA 1RLJA 4JBGA 4KXWA 1ATIA 2V7BA 4MVJD 1U0BB 2QZ4A 1BJTA 1Y48E 1HDOA 3W6OA 4ZREA 2H65A 3EPLA 4QG7A 4GZ6A 3GWZA 3GLVA 1BLIA 1QFYA 3OX3A 2HQBA 4BO9A 2DUWA 3GCXA 4FN4A 2XUHA 4KWEA 3CKLA 2P6RA 4BVGA 3FUVA 1ZG3A 4OP3A 4XIIA 1CIJA 1F4VA 3H2JA 1XD9A 3FUCA 3IAM6 5HBGA 3K1JA 5E6RB 3U4DA 2XMRA 2ZI5A 4HVTA 1RHUA 3W3AA 2CNKA 4BNKA 1WPQA 4V24A 1XZJA 1Z8HA 2BI7A 1A9PA 2FAXA 2VEDA 3L93A 3TMAA 1IEVA 2NU9A 2I6FA 3H2GA 3SHQA 3GLGE 1MA0A 2DCUA 3M6MD 3GA7A 3K9CA 3QX3A 1QIIA 3N0VA 5BUSA 3B7WA 1C3XA 3OIGA 4H15A 4BVAA 3U9LA 3ZZMA 4QLBA 1K8QA 4RTPA 1CF2O 2XH8A 2C3MA 1YJ9B 1VI6A 2ZT8A 3QV2A 4JR0A 4RQBA 2GKGA 3N8NA 4MRNA 4PLVA 5ES3A 4BLUA 1EM6A 4OHYA 4L2IB 2BMJA 1NYLA 2V4DA 2O2JA 3HKDB 3LNTA 4MS4B 1CT9A 3NOQA 3RCBA 1CUDA 2FEWB 4X7PA 2PVCA 1PT5A 2E37A 5BURA 1NVTA 4FI3C 2ZBRA 2VJPA 3CD6B 4Z4SA 5HCNA 3OTOB 4RPHA 3Q6IA 4FXOA 4M1KA 1Y1SA 5ICMA 2WINI 1YZGA 5MFPA 1Z68A 1TAGA 2BP7B 3M3PA 3P94A 4IQ8A 4LZPA 5DFAA 2P4QA 1UD4A 5TPWB 4DVGA 2XBMA 3Q3HA 2WWFA 3ISVA 3PCXA 4HD8A 3UN1A 5KWSA 2AKAB 1GZSA 1QVFB 3FIUA 4BVLA 2IYXA 4DDVA 1A9XB 3JCZA 4RTQA 3NAZA 4N82A 2NU8A 1TCUA 4RV5A 3DSRA 3GZNA 2IYEA 1WZEA 4N5LA 3QFTA 5AVVA 1OWLA 2HU8A 2LTAA 3TAUA 2UYCA 2JKYA 3IULA 3CX6A 4MICA 4XVQA 1SRQA 2KLBA 2ATEA 2KB0A 1QHXA 1XRPA 1YQGA 1YQQA 2DR0A 2ZCUA 3IUNA 3B8HA 2V7XA 3WZ2A 1ULTA 4R9VA 2DBQA 2GHTA 4HZUA 5TQJA 3GARA 2GETA 3B3GA 5E4YA 2AFIA 4NG5A 1U90A 3F7NA 4LMRA 2G5PA 4M0DA 1Y80A 2J0VA 4RJKA 5KDDA 2CBGA 1AB5A 1XPJA 1SVKA 2D5CA 3IQZA 3NC1C 1V9LA 4HNHA 4YMSA 4JU9A 4P0PB 1I10A 3RC3A 1KRWA 2VUTA 3COVA 2C98A 5B4TA 1QNFA 4J0KA 2XOXA 1QS0B 1CUWA 1JYFA 1YJCA 2Q3MA 1RKUA 3EIUA 3TM5A 2WHPA 4R6WA 4RHTA 4DSZA 1R66A 4HTAA 3NQ41 5K7SA 2VDNB 1V39A 2YJ4A 1VA4A 2ZR0A 4TSKA 4D8WA 2VJCA 3DCNA 3NJ4A 2L2QA 1U3FA 3GXBA 4EJSA 2ACKA 2B0CA 3OPYA 3C97A 3ZKAA 3HVHA 4AG6A 4II2A 4Y9RA 3WIUA 4BECA 1AB6A 2JAXA 2AXQA 3C7KA 3L4EA 3PUVA 2F8TA 1DEKA 3DBRA 3NKLA 3TLEA 2RB5A 3O94A 3PHBE 5A4MS 1SZDA 3T9CA 2X8WA 1EYZA 4HRVA 4ZI7B 5M2QA 3MYRA 5KYKA 2VYND 3DDUA 2O9JA 4MP6A 4DABA 4RPDA 4P3IA 4W63A 3LXRA 4RVCA 1DBWA 4NCIA 5LLTA 4YR7A 2DPXA 1WDKA 1XUOA 3ESZA 1JZQA 4DVJA 3U3OA 5JJ5A 2IHYA 3AESB 3I37X 3I3OA 4IGEA 1W1IA 1E1RD 4F45A 2ZEJA 5M7EA 2CYCA 2W48A 1XMQB 3QWIA 4D96A 1DRVA 4D97A 4B3GA 1CLUA 3PV0A 3STVA 4I1PA 1Z5OA 1T3ZA 4OM7A 1HE5A 2P4UA 1YC2A 3BTUA 3T99A 1V8DA 4JAVC 1UFKA 3DMGA 4UTRA 1L4FA 4N18A 1QP7A 1THMA 1GUAA 1Z4PX 2NTYC 2J0QA 4II7A 3SN6A 1G3QA 3IO5A 2Q6VA 3Q4GA 2IUTA 3JU4A 2L0XA 4JX8A 1Z4JA 4R2KA 1ZCAA 2ZG6A 5IBPA 3OZEA 3EFOA 4N6OA 1QORA 5C0OE 4C0HA 1L8OA 2QW1A 2WHYA 3WRXC 5A0VA 2HO5A 2H8GA 4PZ9A 4X1OA 3RS7A 2CXQA 3EVCA 1XG5A 3QOFA 1V47A 1K6IA 5AW7A 5EPOA 1SNYA 4TV8A 3TBHA 2W6PA 3SDZA 3L7MA 4Q5IA 2EJBA 2AFHA 2AW5A 4I6JA 5F23A 2BGGA 4KITB 5FORA 4HH1A 2J45A 3ZK8A 1O03A 2QS9A 4MA0A 3KDSE 1L9KA 1GL3A 3QKSA 1B73A 2PCJA 4YC7A 4Z4TA 1YIOA 3TNYA 2I65A 1WW8A 3L0CA 4L15A 3QPCA 4FQ8A 4X7EA 4M9SA 1RHRA 1E8NA 1KJ8A 5FA8A 1L0BA 3QFFA 4UNPA 1FTQA 5JRZA 1B00A 1UJ5A 4ZQIA 4EOGA 2G04A 4YTEA 2YIMA 4BO2A 4YP9A 1AUQA 3COJA 3NBFA 2WKQA 3LUBA 4MP8A 4X7BA 2OILA 2RG1A 4YV0A 1G5QA 1JXOA 2QPLA 3NWOA 3IYLW 1KOLA 3KZVA 1C80A 3BWEA 4Q4DA 3ROTA 5TF0A 1ZITA 1J70A 3GLHA 1V26A 3JZAA 1WHSB 1EA7A 5B1SA 1C50A 1PNRA 4XIYA 4R8RA 4CTOA 3RUPA 4BJHB 4D5EA 1BH6A 3R44A 5L4LA 1QMGA 3P0HA 3DDCA 4WKOA 3PDCA 4FB4A 1PNOA 2HBRA 1E1KA 4EHNA 4AKGA 5CX1A 1QWOA 4PG7A 3RC2A 1C3OA 2IK8A 2H5JA 3DOEA 1RBMA 4YWHA 1JAIA 1X7HA 5IP5A 3LX8A 4CRWB 2QJOA 1PFVA 1GG5A 1NYQA 1TVKA 3LYHA 2DKFA 4DARA 3WWYA 2Z6BD 1N5LA 3UVEA 5KZMB 3WZLA 1TYAE 4N3NA 4R2WA 4PLFA 1GHTA 1KAOA 2J0UA 4EQZA 1C5KA 3ASRA 1UZNA 1TJPB 2BGMA 3E9ZA 3KJFA 3KSDO 3PHLA 4MGZR 5BNTA 1WXFA 5HKBA 1FDWA 3PIIA 5E6TA 4M53A 2JGJA 4MXDA 3ME5A 4JP1A 2IXEA 1XCMA 1OZGA 1EFUA 5DS0A 2Y4NA 1Z0KA 3F96A 3ITNA 4QTZA 3LDUA 4D99A 4QVIA 1LJUA 3MOGA 3QX7A 1XZBA 3A4NA 1VMDA 1PKVA 2AG6A 1LH0A 3HCEA 4FFNA 4Q05A 4QDOA 5AHOA 4L8WB 3RJTA 4CR8A 1P2FA 4M0MA 1P0PA 1ZJ4A 3QHQA 1YQDA 3MAAC 1W85B 1ST3A 3UC5A 5BUCA 4R0NA 4ZCLA 5U9CA 3DTNA 5HMLA 3EIOA 1F51E 2R1TB 3CRVA 1E3SA 4P4UA 2H59A 3K73O 3ZVRA 3GFRA 4MUXA 4ML3A 5C1OA 1HK7A 3BSYA 2YJ6A 5IKOA 2ZVQX 2WZPP 1OI4A 1V1JA 2FQ1A 4U9IS 2G5TA 3HFSA 2UZAA 3A2MA 3VFDA 1ZIYA 4LHYA 4CIBA 3WIVA 3KX2A 1O95D 2ZWMA 1S8FA 1FYDA 3OPMA 4RH3A 1JBQA 2V8BA 5DHFA 1UL1X 1YL7A 2O1SA 4MP3A 4IIFA 1WUIS 4CPDA 4E2ZA 3CRW1 1Z3IX 5I7RA 1YHNA 4RQTA 1CRZA 1IEWA 1JHUA 1YSCA 2Z5FA 3W77A 2B6NA 4DHWA 2RE8A 1XPRA 1OXBB 1IBCA 2PR2A 2H48A 3JU3A 1XTQA 2G70A 3IHTA 4HQ6A 1PI3A 3GRVA 4H2DA 2OFWA 4ZDWA 5E8RA 1B8PA 3EBPA 3OO1A 4ZARA 1RYYA 3JALB 2FSGA 3PQ3A 1R27A 2J7PA 1JILA 1A8PA 2P6PA 1L5ZA 1T8PA 3IBCA 1VHEA 2ZYWX 1UXIA 1YZYA 1R9JA 3UY4A 3ZHUA 1IBMB 3WSTA 2BEWB 4PO1A 2QR2A 4TL6A 4YJGA 2G9NA 2G8LA 821PA 1CJKC 3LQQA 1G3RA 4OG2A 1UT5A 2WNSA 4YUVA 4ZHQB 3T9FA 1RRKA 2PGLA 3G2LA 2GD2A 2EYQA 3PPIA 3ZWAA 3L7DA 1NAHA 4V3CA 2NTVA 5HE8A 3CPSA 1Y8QB 4HWGA 5I6DA 3QUBA 1XEXA 5AMXA 2BIFA 4XYLA 4ZMRA 1D07A 1KIAA 4YLGA 4WNAA 5B37A 3EC2A 3FW1A 3LJKA 2RGRA 1GGEA 4PXYA 3ULKA 4Q39A 1J22A 3LBHA 4YJKA 4DREA 1B42A 3GX1A 4EUFA 3ROZA 1OH8A 4YCSA 2IHZA 4WQMA 1R4NB 5C53B 4Y1RB 3CR3C 1NF9A 1XZHA 1SC1A 4ERNA 2NADA 2YW9A 3ELWA 1WPGA 2Q9UA 1HZZC 4AKIA 2PFKA 2X0IA 1YV9A 1DIAA 2ZBEA 1J6UA 3I9OA 1XQXA 1OA1A 1UIRA 2G6BA 2E4VA 4P81A 3HWRA 5HVNA 2C7QA 2DQZA 3RYFA 4I6GA 4KO1S 3S40A 1Z83A 1MQ8B 4IOLA 1DAPA 3KYCA 2AF4C 4L57A 4R54A 2NAPA 1NUPA 2JH8A 3B7PA 1HA3A 2YIDA 4HWKA 4PO8A 1MOQA 3VGJA 4J0IA 4CL0A 5KYTA 1NVBA 5CB4A 3D43A 4J3JA 4MV9A 3LHSA 2QN8A 3A2LA 1DEAA 1Q77A 3LQYA 3LIPA 1GPBA 4GX1A 4ND1A 4TT3A 4V39A 5JQGB 2HCFA 4FE4A 2RHHA 3ZYZA 4WKNA 2SKDA 1G55A 5HQ3A 2YV2A 3O1HB 4G0WA 1QE0A 2D2XA 3WGNA 2KX7A 1AA6A 5BT8A 4J0FA 5JJKA 3INGA 4C07A 5GAJA 3SWWA 3W8NA 3QMPA 1J5PA 3C74A 4A0SA 1JU4A 3E53A 4OPSA 1W52X 5CBPB 2F17A 2E1PA 1GA4A 2RG7A 3IQFA 3R3VA 5JAOA 1XEAA 1D6SA 1ESDA 3OJLA 1A4IA 3JQBC 5F4MA 4QDTA 1Q44A 3EDRA 4RPGA 4E1AA 3WL8A 5AJUA 4LV8B 1DKNA 2FZLA 2AUMA 2SECE 4HDKA 4B81A 1FFEA 5DP1A 1KZ4A 1X3SA 2F3TA 2IXFA 2W83A 3OC0A 2WWHA 3ZX4A 5L3SB 4LWQA 4C7MA 3HY6A 4DXHA 3IVGA 4XR4A 3L01A 4OPOA 1H2FA 4I1OA 2B78A 1Q86D 1ZD4A 3CW2A 2P8JA 3EEIA 4YCLA 5KSOA 4WOBA 2FOIA 4JUDX 3NTLA 2YH2A 4L3WA 2NZXA 4Q6WA 3TDMA 4X41A 2VP6A 5LQRA 3UG7A 1P80A 5CLLA 2R8PA 2WP8J 3UT5B 1N32B 1ND5A 3D3WB 5F1YA 1L4BA 4NBRA 4WOKA 1QHIA 3PE3A 4KHZA 2C7PA 3IP7A 4Q03A 3K2EA 3JWGA 3BQMB 3X2SA 2XD9A 2FI1A 2FKAA 1R6XA 1R4AA 1GUDA 3ASUA 4LY6A 4E14A 5A03A 5AIBA 4KGXA 1VSVA 3KAPA 4ON9A 3KEQA 4MINA 1B41A 3VO9A 1IEQA 4MVJH 4OAPA 2OM2A 1QVAA 1AMOA 3DR3A 1NW8A 4TMXA 1KTVA 4AM8A 3VPAA 3DGFC 3LPMA 3I2FA 1F8GA 5FUXA 2QA4B 2O8DA 2QMOA 1RLMA 2WABA 3W4JA 1A7UA 2X8LA 3X1XA 2WLTA 4YEDA 1NT4A 5BR7A 3ABSB 3VGPA 3CMAB 4N5NA 2PWBA 1Z6XA 4S1VA 4X90A 1GO2A 2XHZA 1PUXA 3AUAA 1KZ7B 1NZDA 1XN4A 1QIMA 3OQVA 3KQOA 4LY9A 4W7HA 2V6FA 4MCAA 3RG8A 5CXQA 1N6PA 1M34A 2E87A 2PJZA 3N87A 3TLYA 2PGOA 2WSLA 4OB8A 3ELBA 5KQMA 1U02A 5ITZA 4IDQA 3UOGA 4NJEA 4U2KA 3TI9A 5JCJA 4ND4A 4MJXA 1IVSA 4UZUA 1VJTA 2FMKA 3HNRA 4FSDA 3T7KA 1EP3B 2RH9B 3DVAB 3SFZA 1C1HA 2JFNA 4BLRA 2H0AA 2G4CA 2EGHA 2E48A 4FDUA 3R6JA 2QVCA 4ARSA 5GV8A 2WA1A 3ZE6A 2IS4A 3SMQA 4YLEA 3A1TA 5KKCA 4GP6A 3U19A 2GAFA 4O3MA 3WRYC 2WKRA 1RP7A 1V1RB 2I99A 5FHRA 2HNKA 1G20B 2XDAA 1N6RA 4KDRA 2RB4A 4LXTA 3DTVA 3KOMA 3M5CA 4UHFA 4YAWA 2YBEA 3EPHA 4X1YB 1GZUA 3FYDA 1GCUA 1TEVA 2WSMA 1JZTA 2IX9A 3I5AA 3OKFA 1IXKA 4GOND 3L1HA 3FAKA 3UZUA 3CNNA 1T5DX 5K05A 1W4ZA 1G19A 3ABZA 1E2NA 4UHEA 4BZPA 1E7SA 4FEYA 4FHCA 4DJ5X 3CCMB 3FDIA 4Z8XA 2AC2A 1FYVA 2GN8A 2NVWA 3LGXA 3OJEA 3Q7EA 3ZN2A 5ETJA 1I36A 5FT9A 1O89A 3ROXA 1OR8A 2P3OA 1PJLA 3EG9A 3RUCA 1JSCA 2ZLBA 1N33B 3L40A 2I22A 3P19A 1WOSA 1A77A 4CV2A 3ZWQA 5F3DA 1KA9H 5DX1A 5L4NA 3B2EA 3KZNA 3RSCA 3UHAA 1SD2A 1E77A 2A92A 1I2MA 4P7FA 1A96A 2YQ4A 2ETVA 3K96A 3U60B 4R6XA 4G0VA 4C0KA 1NB9A 1WD5A 1XXHE 4TVOA 1C1XB 2GPNA 4LK2A 5CM9C 4CIVA 2DTEA 3MEQA 3MJCA 3R6KA 3KL4A 2MSNA 1LNZA 2VDQB 4K6GA 4DIOA 4ZP1A 1USWA 4JJ7A 1O57A 2ODQA 5IKEA 3AIOA 1O5TA 3N2EA 4O4LF 2W0SA 4DDHA 5BXYA 1A5AB 1WXQA 3D6UA 1P4JA 3OJXA 1KFKB 4N48A 2K5UA 3T7IA 3P9NA 5TARA 3KEFA 4BVHA 4XYGA 1GARA 4U7DA 4ANFA 2W00A 3ILHA 1UKVY 4JP5A 3BXZA 1J4AA 1I8TA 4M37A 4B2PA 4IXTA 3CUSA 4UBIA 1H5QA 4HMOA 5BSUA 3MGKA 3W8EA 1HGXA 1LCIA 2VJMB 1MFPA 3K0BA 4HATA 3I04A 4MCJA 3D3EA 2LZ0A 3TFWA 4GX0A 1RM4A 1ZM4A 3DDSA 1ENYA 4CM9D 4ZT2A 4P4LA 2C4MA 4N1AA 3W5AA 5JFGA 4GMFA 2H7VA 4ESEA 4DR4B 1D4ZA 1G5RA 2IC5A 3MBKA 4J9VA 3WLFA 5BXQC 4WNIA 2BOVA 1Z0UA 2JJ1A 2BKEA 4OGKA 2QL9A 2M5SA 5CX4A 3I32A 2I2CA 3BREA 3W6PA 4MULA 2UU9B 3RROA 1QV6A 3PG5A 4DJAA 3LL4A 1IE3A 1T2VA 4ZOLF 5J1TB 1KD1D 5F9HA 2G6TA 4EYGA 3WFJA 1F8XA 3B9RA 3FZQA 4Z8YA 4WJLA 3RW9A 1XDGA 2HPAA 2ZRIA 4WKPA 4TXLA 2J9ZB 4NNJA 4AX4A 4D4HA 4GD3Q 4S1PA 4KR7A