4RD7A

The crystal structure of a cupin 2 conserved barrel domain protein from salinispora arenicola cns-205
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
NAMEIRPLDRANLRLDNNLRAQRLMPWPTVNAPFEGSWCVVAPGVSSGEHGHHEYEIWIAMTGRAELVSDGARRPFHAGDVVYLPPGSRHQVVNPTDEQFQMYAVWWDAAMVDRFATRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cupin 2 conserved barrel domain protein
publication title The crystal structure of a Cupin 2 conserved barrel domain protein from Salinispora arenicola CNS-205
rcsb
source organism Salinispora arenicola
molecule tags Unknown function
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rd7A00
3S7EA 3I59A 3I7DA 4IEWA 3BCWA 4EWDA 4BIFA 4IEQA 2HJIA 3H3UA 1NXMA 5E1RA 4FT8A 4XEZA 4O9GA 4YSFA 4K8FA 1J58A 1EP0A 1WLTA 2WC2A 4AQ2A 3SMHA 3EBRA 1SQ4A 4HBNA 2OZJA 1ZZ7A 4HSLA 3BPZA 4PIXA 2GAUA 5KHJA 4I0AA 4XF4A 4XFAA 2Q30A 2D5HA 4IEUA 4NVPA 4IEPA 3EJKA 1JUHA 2XKOA 1EYBA 1CAUA 3OF1A 5FPZA 1O7FA 3SCHA 3CF6E 3NSTA 5FLJA 1GQGA 3FE5A 3QACA 5JCTA 2IXLA 3SCFA 4CYDA 5D1IA 2IXKA 1YFYA 1ZREA 1ZRRA 4MGIE 3CEWA 5JSOA 4IESA 2OYZA 1CAVA 2IXCA 3UKVA 4META 3N4MA 2HKXA 3FHIB 4GULA 2QJVA 2XLGA 4ONUA 3WW4A 2GC1A 5I8SA 3RDIA 3RYPA 2H6CA 3H1WA 3CJXA 3PNAA 5F1RA 1YWKA 1CAWA 1ZRFA 4I0BA 3PVBB 1X7NA 2E9QA 3E6CC 2Q0AA 1CAXB 3KCCA 2IXIA 1RGSA 1ZZ8A 4MV2A 3E6BA 4DINB 1UIJA 4AQ6A 1Q43A 4LLOA 2OPKA 2PHLA 2BNOA 2QCSB 5I0UA 4MGYE 4PIZA 1ZZ6A 4Q29A 2PHDA 4Q0SA 3TNPB 1NZCA 2XKPA 1TQ5A 2GZWA 5J3UA 4PIYA 4JV4A 3H1YA 1LB2A 3D82A 1NYWA 4N9HA 5JR7B 2H6BA 4HSJA 5LRRA 4WVZA 3DV8A 4TLFA 2K0GA 2XL7A 1Q3EA 1QXRA 4IETA 4KWKA 4HVRA 2OA2A 1IPJA 2PA7A 5CVRA 3RZZA 3E6DA 1LR5A 2WFPA 1J1LA 2CAVA 3MYXA 3CL1A 2B8MA 4IEOA 4BYYA 1O5UA 4JTNA 2I45A 5T3NA 2CV6A 2MHFA 3NJZA 5EFUA 1O3SA 4QGLA 5FDBA 1DGWA 5LEKA 5FPXA 3SCGA 1DZRA 3LA7A 3E5XA 5JAXA 3MDPA 2PAMA 3MPBA 4KWLA 2K9ZA 1FT9A 2Z2SB 3C3VA 4BH9A 3SXWA 2Z69A 2N7GA 1X8EA 3ZDSA 5E16A 4XF1A 1UCXA 4HMZA 4R8HA 5I8TA 4KU8A 4OLLA 3RYRA 2PAKA 3HT2A 3MZHA 3DL3A 1DGRA 3E5UA 4Q0QA 4I09A 1O4TA 3LWCA 1SFNA 2MNGA 1PM7A 5I0TA 5KHKA 2PFWA 1UD1A 3B02A 4I02A 1LKNA 3H8UA 3OTFA 1VP6A 4LEJA 4XF0A 1EPZA 2B5HA 1RL3A 1J59A 4O9EA 3I59B 5BPXA 4IEVA 2D40A 3UKNA 1XE8A 4L2NA 4X6QB 1U12A 3FX3A 3M3IA 1QY4A 3EHKA 3LZZA 3G7DA 3IDCB 2Q1ZB 3ES1A 2XHKA 3U10A 1RUNA 3H7YA 5FCCA 4IERA 5C6CA 2CGPA 1OFNA 4JVAA 4XF9A 4AVBA 4F7ZA 3FJSA 1NE4A 3DKWA 4MX3A 1CAUB 2XGXA 4XETA 3GYDA 2ZKLA 5FLIA 3WW1A 3BU7A 4AVCA 1H1IA 2VECA 4RD7A 4L11A 2GH2A 1XRUA 3IWZA 4HZFA 4QM8A 5JSRA 1CAVB 4D7TA 4YNIA 4XFFA 2EAAA 3IBMA 1YLLA 1ZX5A 2QVSB 3PLQA 5HI0A 3H3ZA 2F4PA 2OZ6A 4D7SA 3VHRA 4HVOA 3KGZA 3IDBB 5KHGA 5FQ0A 5LRSA 1CAWB 1WA4A 2GU9A 3WW2A 2UY8A 3SHRA 1HW5A 1ZVFA 5KBFA 3H50A 4B29A 3EQEA 4J1XA 1L3JA 1O3QA 4ZU4A 2ET7A 3GBFA 2QDRA 3ES4A 5J7MA 1XE7A 2XLAA 4Q0PA 5I93A 4QXKA 2MPFA 4LA3A 5I8YA 2ET1A 3LA3A 4HN0A 4EV0A 4H7LA 4LUMA 4IEZA 5BV6A 4Z07A 3R6SA 4FBFA 1OMIA 1YFXA 5LEJA 4EWEA 1G6NA 4R52A 2D93A 2QNKA 4A2UA 2BGCA 4EWAA 1YFUA 5C8WA 4AVAA 4LUKA 2PYTA 4UBHA 5AVPA 3LOIA 1ZZCA 4MH0E 3HT1A 3ACLA 2PTMA 3U11A 4F8AA 2D5FA 4ORFA 5CADA 1CGPA 4XFIA 1OI6A 2GC0A 2IXHA 3S0MA 2VPVA 4E2QA 1OD5A 2ETEA 4XFCA 4LTAA 3ROUA 1I5ZA 1VR3A 3BB6A 3HQXA 5I91A 2EVXA 2H0VA 2KXLA 1FI2A 2V09A 1V70A 1Q5OA 4Q0VA 1H1MA 2Y0OA 4XF3A 1Y3TA 3NVCA 3KMHA 1YUDA 3FWEA 5KHHA 1UW8A 3H7JA 1QWRA 2O1QA 2PAEA 5FLHA 1J3PA 4QM9A 4HN1A 1ZRCA 4MUVA 2GC2A 4MZUA 1ZZBA 3LA2A 2FMYA 1DZTA 1UIKA 4I01A 3H1MA 4ZU7A 2VQAA 3EO6A 4LA2A 3TNQA 3IIAA 3KSCA 1QXJA 4P9GA 1EY2A 1CAXA 1RC6A 4IEYA 4YRDA 4ZU5A 3OD0A 2P17A 4KWJA 2BNNA 5BY5A 3JZVA 4FAHA 2CAUA 2BEOA 4QGNA 4I2OA 3O14A 3U0ZA 2B9UA 5K8SA 4UXAA 1RTVA 5J48A 4I3PA 4JTOA 3H9AA 5JSPA 1CX4A 2BNMA 3NW4A 4YYOA 4MGKE 3FFQA 1FXZA 3I54A 1X82A 1ZZ9A 4OFGA 2XL9A 2FQPA 2UYBA 3HIFA 4HVQA 4Z82A 3ST7A 5I0SA 4Q0UA 4QX5A 3RYKA 3S7IA 5CU1A 3DN7A 3LAGA 1J3RA 3OCPA 3M70A 2XLFA 1O3TA 3NL1A 4YARA 5BXXA 4MGZE 4WZCA 3ELNA 1O3RA 4EROA 3BALA 2ATFA 3E5QA 2C0ZA 3CO2A 2BYVE 3FZ3A 3WW3A 4E2GA 1J3QA 3D0SA 2IC1A 1RUOA 3D0JA 1LRHA 4N9IA 4UBGA 2IXJA 1IPKA 4J1WA 4E2SA 5I0RA 1YFWA 3OGJA 4WBBA 1GQHA 1PMIA 3KGLA 3QOPA 1VJ2A 4IEXA 1O5LA 4XFBA 2EA7A 4KU7A 1ZNPA 5KHIA 3L2HA 2UY9A 4XFGA 4LULA 2O8QA 4QMAA 1WGPA 5BUVA 3E97A 2Q4SA 4PJYA 5FQ0B 2UYAA 2PQQA 3RNSA 3ETQA 1Y9QA 2ZCWA 1I6XA 4KL1A 4QGMA 3CLPA 5EZWA 3RPQA 1ZRDA 1X8MA 4XFHA 4AXOA 3NKTA 3USSA 4FAGA 1UPIA 2DCTA 4HLTA 4X6RB 2GC3A 1NE6A 1YHFA 3UKTA 4BHPA 1SEFA
chains in the Genus database with same CATH superfamily
2ZAAA 3S7EA 4XAEA 4ZXKA 3HBZA 1W3VA 3ZR6A 1NT0A 5ACA1 2A6VA 3CZJA 3MW4A 2QDNA 4DXSA 5FZ3A 1XB9A 2JG9A 2VMCA 3TB0A 1OD3A 1KFUL 4DFSA 2QQNA 3N9OA 4IV1A 2HJIA 4ISRA 1NXMA 1V6IA 4WM7B 3IM0A 4UI9L 4K7JA 3RZHA 4AEDA 2XJSA 4OUSA 2W39A 4K8FA 1J58A 1WLTA 4AQSA 3S5AA 1JOJA 3VLBB 3LCPA 4IE0A 3D5OA 1HN1A 5LA2A 2ZBJA 1TE1B 4FPOB 1PO21 1WMDA 1QJY1 4UT5A 2A1XA 4I0AA 4Q1PA 2ZGPA 3ACFA 3K4AA 2R073 3ZO0B 1OFSA 4IEUA 1GQPA 4CU8A 3WY6A 3NRUA 4JX0A 4IEPA 4QB1A 1MS1A 1W6QA 1PX4A 3JB4C 4QDRA 1OLME 2G19A 1GNZA 1WD4A 2VE1A 1AX0A 4YW4A 1JU4A 2A73B 2XDVA 1H8TB 2DCYA 5LATA 3RWNA 4OULA 1BYHA 2WS91 3VD7A 1OKQA 5FLJA 1BQPA 2UWCA 4OI2A 3J4UH 3AKQA 5IUQA 3AZXA 3T2PA 4BDVB 4TYSA 3SCFA 4D3WA 3ABZA 3ZSEA 5E8AA 3AXDA 2DVFA 2P34A 4CDXC 4IL7A 1LGNA 2CSGA 1VMHA 4M0NA 2EXHA 5JSOA 4IESA 2VUJA 3UKVA 3LEKA 3IZOA 1AYN2 1D0HA 2A6YA 1UY1A 1W6NB 2YXSA 3GJAA 4NOTA 1IS5A 4UF0B 4ONUA 4IGPA 5H9QA 5I8SA 5DZGA 4HG6B 3WHUA 1SZBA 4LHKA 3ZOIA 5LZ6A 3H1WA 3WQ7A 4GB33 3JD72 4FPYA 5C5TA 2WO1A 2G9GA 4OQ8A 1OOPC 4S2FA 3JQWA 2WSVA 2J1VA 2YYOA 1H30A 1RHI1 4B1MA 3ZYIB 1HQLA 3GJBA 1OVPA 5JI9A 5EWSA 5FWJA 3NO8A 1K12A 1ZRFA 1S0JA 3N35A 4CEWA 2DVGA 4JHTA 1VBA1 1V6OA 2DU1A 4FQ4A 2WQZC 5A6XA 1AF9A 3ITQA 3KS7A 2E7QA 1PO11 4PF5A 1V6NA 1RUH3 1W06A 2RR13 3POGA 4FP2A 4RS5C 1CAXB 2KR2A 1U5IA 3LKJA 2XXZA 1JMUB 5FPBA 2JDNA 2HWF2 3GDBA 4EN9B 1Q43A 3C7HA 2A3WA 4N53C 4LLOA 4XUNA 3LDKA 4DXRA 3A7QA 2PHLA 2UURA 3WG4A 4V2VA 5DG1A 2BNOA 2QCSB 2WSUA 4P9WA 1C5IA 5C71A 4BQ5A 2QQKA 1R091 3QCWA 5M0TA 4Q0SA 5T5OA 3TNPB 2VOXA 1AL22 2E53A 1AR62 1GP4A 2B45X 2X5IA 4YPJA 2XKPA 4CU6A 1TQ5A 1XNCA 2AEYA 2GZWA 1HLCA 1NA1B 1COV3 4LBQD 3IPVA 4JV4A 4CPBA 5BNPA 4W6XA 4DRVA 1LB2A 4A3ZA 1D4M2 4N9HA 5AFBA 5L9VA 5JR7B 5C3PA 1HN0A 2WFF2 2E31A 1XBFA 3K3NA 5AC91 1DGLA 1HRI2 3ZYHA 3R05A 2JWPA 4JC1A 1H2KA 2PXJA 1OLRA 2R042 3PL0A 4XUTA 5FFOC 4GJYA 4M3CA 3PVOA 1JH5A 1PVC1 4NRPA 4FTEA 4QQPA 3VBOA 1QXRA 4IETA 2JIJA 2VUCA 4HVRA 2VULA 2BVVA 1IPJA 2PA7A 3RZZA 3CBNA 1R1A1 4QD2A 1XE0A 1XQNA 2D7FA 4ES8A 1ZBA1 1C1LA 1DLLA 2V4VA 4JGZB 1C8NA 3FLRA 3VZOA 2VBBA 4BYYA 5H9RA 2I45A 3K48A 1FNZA 2WZR2 1LOBA 2ZX0A 3LGRA 3V0AA 2ADDA 4QX3A 4NO4A 1VIWB 3C7OA 4COWA 5F7UA 1DGWA 4DB5A 1F35A 2O14A 2WWJA 2SBAA 5A7QA 3R4SA 3SCGA 2W0XA 3MIFA 4XBQA 4HANA 4NIGA 5JAXA 3OPWA 3MICA 4NN0A 2MEV1 3MDPA 3ZYFA 4CCOA 4GH4C 1AHSA 1FT9A 3IAPA 1NOVA 3QBQA 4Y33A 4RR3C 4Q5OA 3N9NA 4D94A 5C9AB 1X8EA 2UWAA 1HXS1 4AAXA 3EYPA 4JRAA 1NCRC 3B5LB 3SKVA 1G9FA 2LRPA 4PDWC 2DYCA 1YO8A 3RZGA 2E51A 1MQTA 1TZOA 1AJOA 1CVNA 5ACA3 1RUE1 2YPJA 5FMCA 3V0BB 1NZIA 5DAXA 3E5UA 1RUD3 2PHTA 4Q0QA 3LEMA 4Y1YA 3ME2A 1O4TA 1O8SA 3AP9A 2ID4A 5FK8A 1SFNA 5KHKA 2ZXQA 2EICA 4CDQA 1D4VB 4AEKA 1SLLA 4AK3A 5FZOB 2RVAA 1VMFA 2W92A 5JXIA 5L73A 3MV11 4PCRA 4YG6A 1XNDA 3N9MA 3DGTA 2R6QA 1LKNA 1QJY3 3OTFA 4XQWA 4D6SA 5K0UC 3LOBA 1IKPA 1XSQA 1EPZA 3HD8B 3WOGA 4ZY9A 5JXJA 1SBFA 1IQDC 4AOCA 5A7OA 4K40A 4JQTA 5IT6A 1LOCA 3Q8AA 5FP7A 2EAKA 2OXBA 3J7NA 4KMQA 3DPRB 1U12A 4Q4X1 4CA9A 5C8CB 3JCIA 2BGOA 3EHKA 2VOVA 4QU1A 5IATA 2HWC1 2WS93 2DVBA 3GGLA 4ISQA 1QNYA 3U10A 4FTSA 1CN1A 1K5MB 3ZYBA 3H7YA 5FCCA 1TMF2 3MBWA 3LF7A 1UY2A 1VBD2 3CHXA 2XJTA 1WMXA 1FATA 2JE9A 1ST8A 1LGBA 1QOTA 2ZZQA 1C8M2 2W46A 4XDOA 4RN5A 2B7YA 3DKWA 4K21A 3BPSA 4LE3A 2VC9A 3MLKA 1WUVA 2ZABA 2DFCA 3SH5A 3X29B 3POSA 2JICA 1PZ8A 4NJ4A 1HB1A 3Q8EA 3N9LA 3BVCA 2ZKLA 3M3OA 1REEA 3I2GA 4NHMA 1LOFA 1A3KA 1ENXA 3Q9OA 3VBHC 2YC0A 3ZN6B 1RHI3 3USUA 4XDPA 4LO4B 3PVEA 5JOXA 3OGGA 3BYWA 4YVWA 2E33A 4CU7A 1LJ7A 2CWMA 3ZSJA 4L99A 1XNAA 3B94A 1BEV1 1VALA 1RMU1 1PO13 1DHKB 2NQYA 2O8OA 3O12A 4UAPA 5FMOL 5JSRA 4YNIA 4DQAA 3VUOA 1LHOA 3T2QA 3HJRA 1ZX5A 3PLQA 5HI0A 3H3ZA 1RJ7A 1MS3A 2QQJA 2HBTA 4DY5A 4WM8A 1CONA 3DYMA 3RFRA 3VHRA 4QQ2A 4D7SA 1ND3C 4HVOA 5LWBA 1R093 5FQ0A 3NAPA 3I97A 2GU9A 4IV3B 4OHXA 2BPA2 1VLNA 4Q27A 3ZKYA 4CCDA 1SBDA 5KBFA 1N3PA 1RUI2 1QJEA 2E32A 4B29A 2Y6HA 3SC7X 1L3JA 3HN3A 2JDZA 2PHFA 1SLAA 4Y26A 2Y6FA 2BP6A 3ES4A 5FZEA 3AKPA 1LCLA 3KQRA 2TEPA 2XLAA 2VNVA 3GALA 4WV8A 4AI0A 3NV1A 5AC93 3LB9A 2ET1A 3Q8CA 4RQPB 4EV0A 5ABJB 1CWPA 4QKNA 4DPNA 4F3JA 3JBG2 4Z07A 3ZFFB 4QQOA 3BOPA 2EALA 2LTNA 3RMYA 3RS6A 1YYNA 2QQMA 1XU1A 1PVC3 1GZCA 2QNKA 1WBLA 1G86A 4JKMA 3MIDA 3UESA 4UFJA 4WM7A 3BIWE 1WW6A 1YFUA 3LEIA 3W59A 5GLZA 3ZFGB 5DZFA 1VBE2 2PHXA 1R1A3 2W9XA 3LOIA 4YW3A 1ZBA3 3PUAA 4IE5A 4MH0E 5E6HA 2RS11 5FZ0A 5IVJA 4LO8A 2JJ6A 1H8VA 1KFXL 4F8AA 3OOXA 5LBCA 3NV4A 3POYA 4ORFA 2HWE2 4Q8LA 2ARBA 3WV6A 2BERA 2ZX2A 3AYAA 3L9JT 5IVYA 1YJKA 2XONA 3NNGA 5A3TA 1ZBE1 1OC1A 1Y7BA 1Z7S1 4TN7A 2VTXJ 2RS52 4E2QA 5E89A 1GNHA 2WNVB 3FBYA 5C7GA 3HOBA 4JHZA 4A41A 1SCSA 1YQ6A 4NROA 4KG0A 1BVVA 4KGGA 4W65A 1H8TA 1Q8PA 4Q4V2 4U36A 2JDHA 3AVSA 1UYYA 4UFKA 4F83A 3R0RA 2KXLA 4OCTA 5DDJ1 3OEAA 2FHRA 2X05A 2AENA 4CVUA 2Y38A 4FSJA 1BBT2 1RUF3 1HXS3 4UFMA 4E9KA 3VDBA 4PLMA 2GMEA 1Y3TA 2VZTA 3TYJA 3KT4A 5A3LA 3Q8FA 1YQCA 2BGPA 2Q5TA 4JCKA 5LW9A 3L2YA 4FPCA 4IW3A 5HCBA 3KT7A 4MG2A 4P5YA 3J7HA 2I2SA 1RUE3 3HR9A 1OT5A 1W6NA 4LO7A 1NKGA 2XQRA 3FWEA 1DQ6A 4UF0A 1TNRA 1PK6B 2VL4A 3C2UA 2W52A 4ASLA 4ATEA 5B2GB 5T5PA 4Y5TA 1J3PA 5FYUA 4E8DA 2Y6GA 1ZRCA 3LEGA 2R0HA 1FMD1 2Y0IA 1G9AA 5F3EA 1H4GA 2RM22 1ZZBA 2DTYA 4Q4Y1 4B7KA 3U78A 4XUOA 4XJ9A 2FMYA 1CZSA 5F3IA 2NZ9A 3HAGA 4LBJA 3ZYGA 4AFCA 4ZU7A 1W6PB 3KSCA 2WABA 2WL1A 5CA6A 1EY2A 1JN2P 1CAXA 1D0GA 1RC6A 2IVIB 1JUIA 4LOSA 2QE3A 2JG8C 5FUIA 4KWJA 3FBMA 1NLRA 1IOAA 4ASMB 3JZVA 3C8XA 2BEOA 1UOBA 2HWC3 1JYVA 5IWFA 4EQVA 2AACA 5FY4A 1A78A 4BMEA 4E4HA 1BMV2 3NV3A 4B4PA 2VMFA 2BNMA 4KNCA 3T1MA 2WNUB 4BE3A 2WIIB 1L7RA 2YROA 4GMP0 1NA1A 1Y9MA 5K9YA 3QD6A 1MEC2 3VKFC 1DQ2A 1TVGA 1HKDA 3I54A 3WDTA 2WLQA 4TZDA 5FZDA 1UY3A 4COYA 4G4FA 1R082 1NXD1 2LROA 4LR4A 4QX5A 1HQWA 2XH6A 3PUHA 4LT5A 3B9CA 5DABA 2C6SA 4JDMA 3AP6A 3RYKA 2V5DA 1JYXA 2P6CA 3ZXFA 1BJQA 5CU1A 4CP9B 4EJRA 5JZGC 5FPUA 5CKNA 2RMU2 3ZXEA 2VBDA 4YARA 5BXXA 4MGZE 3WNMA 2G1MA 2JB4A 3WP5A 1BEV3 1RMU3 3JUUA 2ZGQA 3E5QA 2PHRA 4H3WA 1UY0A 2E7AA 4JGZA 1W8WA 5HXVA 4QQLA 1XNBA 5FPLA 1DQ5A 2J1UA 3WCSA 1ZA4A 1QDCA 1PNFA 3BGAA 3ZPOA 2BU9A 3ZPYA 1EUTA 1LRHA 1LENA 4CUBA 4UBGA 1QQP2 1QJZA 3DYPA 3OBTA 3VBSC 2NMOA 5FUPA 4E2SA 5I0RA 1NG0A 2WNOA 5FP3A 5FYMA 4CXXA 2D97A 5C3QA 3GBGA 3KGLA 4P14A 1UKRA 4UFLA 5EHDA 1WZXA 5FP4A 3WNKA 2F17A 1QHDA 5C9AA 3L2HA 1BXHA 1RXFA 2ARAA 2RS31 4QKBA 5FK7A 2ZGLA 2JX9A 2Q4SA 3O1VA 3W5NA 1OHFA 4LKEA 2JXAA 3V0BA 2JD9A 2J1SA 4OHZA 1VRH2 3RNSA 4MYEA 1PMHX 1GUIA 1UU5A 3WNLA 3HPNA 2GP5A 2YMZA 1OF4A 2P5BA 3KT1A 3CLPA 4YGEA 2ORXA 5FXVA 3TEZA 3ILRA 1DGWX 1DIWA 2HYXA 2VAUA 3CIHA 3I2IA 3VDCA 5D8AC 3KCYA 1HRV2 2CNAA 2IVJA 1UO9A 5FZOA 2W1UA 1LAJA 2XQXA 1FPN3 5HPOA 4FAGA 4FOWA 1UPIA 2DCTA 2E7TA 4ATFA 4X6RB 5GLTA 3AJZA 2ZX3A 4NPLA 4ZONA 4GH4B 1ZBE3 2A3YA 2VMHA 3V64A 1Z7S3 3GHMA 4RR3B 1WA6X 1H2LA 4FP3A 5D2AA 4GJZA 4Q26A 3VHPA 5KXCA 1AYM2 2W5FA 1NCRB 3DPRA 5FBZA 4EWDA 4ET7A 3LPGA 5C8CA 2ZMNA 1JW6A 4EN7B 5E1RA 1ZM1A 1W2OA 4XEZA 4O9GA 4BA6A 4YSFA 4ZS3A 4AQ2A 1EP0A 1Q8VA 3MIBA 3SMHA 4HBNA 2OZJA 5DDJ3 5CBLA 3BN6A 4PIXA 4XCBA 3TEXA 4XZUG 3J9SA 3DYOA 4UYBA 4AL9A 3N36A 3IMMA 2BFUL 1JZ7A 5D21A 2BQPA 2HEVF 1AL21 1AR61 2AH2A 4NAMA 3T08A 3ZN5A 1ALYA 4LBQB 2VOTA 3EJKA 3ZXAC 2XKOA 1EYBA 2V4AA 4L8QA 1NX9A 1SDDB 4NHXA 5FPZA 2YBPA 3A0NA 3PJQA 4BM8A 2JDUA 1JOPA 4GA9A 3AX4A 3MO4A 1MPXA 1FMD3 4PBPA 3N7JA 3ZN6A 4RYDA 4AHXA 4Q4Y3 1GQGA 1LU1A 5JCTA 1OH4A 3R4UA 3WDXA 4DMIA 5BNNC 5IVEA 2IXLA 3IIIA 1POQA 2PLV1 1HRI1 3VD5A 1ZREA 1UZ0A 1L7QA 2R041 3SEEA 3CQOA 4H7MA 4MGIE 3N9PA 2XWJB 1W8OA 2WT1A 3B69A 2R062 1GP5A 4QX1A 1WMFA 1AR71 2A75A 2OYZA 3V65A 3ZDVA 2VZVA 1DGRN 2Q1MA 4OUEA 2XLGA 1OPOA 5GKAC 2GC1A 3RDIA 3WF1A 5LY2A 3RYPA 3J8F2 4YVSC 1H9WA 1F9KA 4GMP1 3WHTA 4A45A 4BCUA 1H1AA 2Y60A 1S0IA 3PNAA 3VZMA 1YWKA 4M3CE 1CQ9A 1VE0A 3MLLA 1MS0A 4YW7A 4LKFA 4IV3A 4LBMA 3UETA 1PHMA 2WZR1 3BOWA 4CSWA 4FOQA 3WDVA 3JU9A 3CDZB 4QU2A 4XC9A 1SPPB 1W8TA 2E9QA 4TWTA 5C4WB 4WVMB 1M4WA 1W3XA 3KCCA 2IXIA 4AHZA 4BQWA 1RJ8A 1YQ2A 1FOD3 5BNOB 2A7AA 4MV2A 2AGSA 1DU3D 3WG1A 4QPIC 1I9RA 3ZLIA 4FPEA 4RQPA 5ABJA 5FKBA 5FZ7A 2UU8A 5DPNA 3ZFFA 5J37A 5I0UA 4MGYE 1ZZ6A 4DEVA 1UXXX 3A4UA 2FD8A 3O1TA 4BLIA 3BTXA 1GU3A 4FO9A 3M4FA 1IPSA 3P1IA 3ZFGA 5JVVA 1UQXA 2HWB2 1Y9GA 3D82A 1NYWA 2CY6A 5EYYA 3VBUC 3WR0A 2AREA 1W8ZA 4XJUA 2H6BA 3K75B 4NPMA 1GZTA 1B35B 4Y1UA 5DUUA 1FYUA 1GP6A 5JPMB 1OKOA 5LRRA 1W04A 1YIPA 4DXZA 4OI0A 2ADEA 1EUUA 5KR7A 2WJSA 4L9BA 4MO3M 3DV8A 2WNVA 4TLFA 1RVF2 2D3PA 4P9YA 3AB0A 5EQUA 1HQNA 1Q3EA 3AL5A 1MR5A 1VBB3 2WWUA 1YI7A 4G3YC 5A7SA 1UAIA 2D6PA 1BK1A 1WCDJ 2OA2A 5A6QA 3WDYA 3N7LA 5CVRA 4NIAA 3VDDB 4YZ2A 1LR5A 1QJX2 4D8MA 4QDQA 4COVA 1DYOA 1Y43B 2WINB 4IEOA 2OQ7A 4LK6A 1O5UA 2RS33 4N7UA 5L7OC 2AC1A 4XJZA 5IAXA 3E1F1 3MFAA 1O4ZA 3R4DB 5EFUA 2DU0A 3QH7A 4CEYB 5IFTA 2ZA9A 1VBD1 4Z1VA 5FDBA 2R32A 3LIGA 3ZIWA 4C0BA 5G04L 1PK6A 1RUC2 3GNEA 4XXPA 2D6MA 5FPXA 5FYSA 4LBOA 4MHRA 3VBRB 3WNOA 1TG7A 2WA4A 2K9ZA 5F5AA 5FY9A 5CFCC 2Z2SB 3C3VA 3IDAA 4BH9A 4ZZ8A 2Z42A 3THPA 1NCQC 3OBAA 2DCJA 1QJU3 3BIEA 1VAMA 1PGL1 5IAVA 1W6PA 2IZWA 4RA0A 3MPPG 3NNFA 2QFEA 4KU8A 5FYVA 2JDYA 1X33A 4JAAA 1TME2 2OIIA 4AE2A 2WA3A 1SMVA 4CZSA 5KXBA 3HT2A 5LBBA 1EV11 3DL3A 1DGRA 2WO3A 4N43B 4Q2FA 4CCEA 3W58A 2NLRA 4LJHA 1UYZA 5CG8A 1HIXA 2AR6A 2MNGA 3C7FA 2PFWA 3OY8B 4HK9A 3VGIA 4DO0A 3CJIC 4HOOA 4OI4A 4RGGA 4KGQA 1W28A 1RUG2 4UW4A 2FBEA 2VZ1A 4JGYC 4OI1A 2VQTA 2ZPXA 3WZ1A 2WNUA 1HB3A 1L7LA 4YM2A 4R9CA 2DTWA 5B4XA 3OD4A 4CDWC 3WCRA 1AL23 4OZOA 4RGAA 4X6QB 2DDUA 1W2AX 1RB8G 1EPWA 3T3YA 1TEIA 1IGOA 1RUI1 3GZAA 4BIOA 3BTZA 3M3IA 1QY4A 4XQ4A 2JG9C 3QLQA 3T0AA 4FPKA 3BTYA 2ZGOA 2J1AA 5GALA 4IV1C 4FPHA 1PIV2 4CP9A 5LBEA 2JG8B 4AEDC 1RUNA 2QZ2A 4IERA 5C6CA 2PLV3 2VW1A 4QPGB 1EAH2 4BWOA 4Y1XA 3DXUA 2R043 1VBC2 1ZYBA 2XR4A 4YFZA 2EIBA 4AVTA 1AR73 3M3CA 2W1QA 4Q4W2 5E88A 1REFA 4LKDA 4BK4A 1HJGA 2VZ3A 3UJQA 4DY3A 2D3SA 3O1PA 1CAUB 3PIJA 1VBE1 2XJVA 3MLJA 3GYDA 5GLVA 4D0QA 4C90A 1DQ0A 2A6XA 5FLIA 2VCBA 1A8DA 2EIEA 1GOHA 3BU7A 3KF3A 3WP3A 1GR3A 4XMAA 3S57A 4AVCA 2WZR3 4P9XA 3KHCA 1H1IA 1A34A 1W99A 3J7MA 4AGVA 1K42A 3LDRA 2GH2A 1ASJ1 2BOIA 3AYDA 3BTAA 3IWZA 1IS3A 2RS51 2G4IA 3HEIA 1NY71 4OQ9A 3RGBA 3T2OA 1CAVB 1ULGA 5JZGB 3FHQA 3LD8A 2Q8DA 2PHUA 2D6NA 2DWRA 4XFFA 2J1RA 2EIGA 2VTXA 2XVKA 2E26A 2Z79A 2R072 3ZMOA 4XIKA 2C26A 4JRLA 2GDFA 5ERLA 2NYYA 4IQPA 5FO7B 2B39A 4EYUA 2XPJA 1BBT1 3KGZA 4NMIA 3MIEA 1N1YA 3IDBB 1RYYA 5CFCA 4HFSA 1CAWB 1WA4A 2C9AA 2VW2A 3SHRA 1D2QA 1HW5A 1ZVFA 2E6VA 3K2OA 5CFDC 4FOVA 3NJXA 3H50A 2GALA 4BQ1A 3EQEA 4J1XA 4CEWC 4R9DA 2XVLA 3FHAA 1O3QA 2ET7A 5FZ1A 2QDRA 1NLQA 4LBLA 3C7GA 4Q0PA 5LA9A 4P9LA 1GMMA 2HLEA 2MPFA 2R1BA 4LA3A 4GH4A 1DFQA 4HN0A 4AW7A 1PM4A 1JZ6A 4RR3A 2OPWA 1OMIA 2W94A 5LEJA 4BU2A 1NCRA 4GB32 2DVAA 2W91A 4CXWA 4BHPA 1OUXA 1W8HA 1ND2B 1QJFA 4H55A 2BV4A 2Q8CA 4ES9A 4EWAA 2OS2A 4AYUA 1MZEA 2PYTA 2VMGA 2YU1A 4LUKA 4Y22B 3PMEA 3ZXDA 1ZZCA 2WN3A 3KB5A 3UNPA 5K4LA 1PGW1 3MIGA 2D5FA 4KWUA 4YWAA 5BNPC 5IK7A 2RR12 4IE4A 1JS9A 1UMZA 4OZXA 5CADA 2C24A 4NRQA 5D8AB 2ZZJA 4FOYA 4JKKA 3O0WA 5FYIA 4DUWA 5FP8A 3PHMA 1CGPA 3UGFA 2VPVA 2JENA 1OD5A 2QUOA 2DV9A 3OYWB 2G9ZA 3B01A 4LBQA 4QAWA 4CCKA 3ROUA 2JDMA 1OPMA 3RRDA 1X50A 5KC6A 3BB6A 1MEC1 3HQXA 3O5SA 4NPRA 5I91A 2EVXA 5F6LB 3VBOC 3OUHA 3PUSA 5FZGA 4CE8A 3T09A 1R081 1Q5OA 2A3XA 4ARXA 5CB7A 3M1HA 5FYTA 2P3JA 2BBVA 3O0XA 1COV2 1SG3A 4K20A 3ZX7A 1WCQA 4AI2A 1W9SA 4B7EA 2QQUA 5F5IA 1JI6A 2BRTA 4W6YA 4MVTA 4XTMA 1PO23 4CDUC 1EV13 4C8DA 5KHHA 3SQOA 1UW8A 3H7JA 1HX6A 1P8JA 1XU2A 4I30A 2PAEA 5A33B 4QM9A 4UW5A 2GC2A 1LNSA 1ULEA 2R7EB 3POEA 3MF9A 4N8MA 3M3QA 3VBFB 4GWIA 3RVHA 1UIKA 2R16A 2WAOA 3DECA 3ENRA 4LA2A 3TNQA 5FZAA 4MSVA 1K45A 1SPPA 4P9GA 5C4WA 4WVMA 1MZ5A 5BNNB 1U5YA 1YNAA 1MQTC 2PQSA 2ZHNA 4AFDA 4ZU5A 1OQ1A 5DXDA 1MZFA 5BNOA 5FZ9A 4G9SB 2YPDA 5FYCA 2H0BA 2JDKA 2L9LA 5IVVA 1WW4A 4IXLA 5A70A 5F9TA 2CAUA 4UW6A 4MADA 4BMBA 3U0ZA 1W9YA 5CISA 3W5MA 3ZFEB 2ZEWA 5FYYA 5FZ4A 5JSPA 3TRSB 3I2DA 4LHLA 1RUJ1 2WNEA 3NW4A 3PMSA 4YYOA 2WT0A 3B3QE 4H2AA 2WZEA 4GZ9A 2ILMA 4PI2A 2XUEA 3ZXLA 1VBA3 3KV6A 1XOYA 4OFGA 2ZEXA 3RI8A 1J83A 3KWVA 4RHV1 4HVQA 4Z82A 1C1FA 5I0SA 5ACA2 4QPWA 2VCCA 1B35A 2ZOEB 1HRV1 3O0VA 5HCFA 1JHNA 1N3QA 3HBKA 4DUVA 1LHNA 1RUD2 2OUJA 4OHWA 5EV7A 5F8PA 4RGKA 1G9CA 4QPIB 4CP1A 2VMEA 3M70A 1W0OA 2XLFA 5F2SA 2WZPP 4DOUA 1O3TA 3HNMA 4UW3A 4B1LA 4J25A 1AL0G 1ASJ3 1G7YA 2D43A 2XHNA 3MUZ1 4QXCA 3BALA 3VDDA 2ATFA 1AYM1 2K46A 4Y5SA 4UWDA 5FY0A 1QJY2 2O0OA 1DZQA 1SFYA 2BYVE 2YGMA 4Y24A 3HNYM 4EN0A 1F5JA 4FTBA 2VQ0A 1WCUA 4XUQA 1RUOA 2QQOA 3D0JA 5IK4A 2OX0A 3VBUB 4N9IA 3BU0A 1NQDA 3JQXA 4CEYA 2IXJA 3WP6A 2VG9A 2YFUA 4AFBA 4J6GA 1T2XA 1W9FA 2GNTA 5FPVA 1AR81 1LOFC 4JQRA 3MV01 4TXWA 5FRAA 1GQHA 1PMIA 2R30A 1CIYA 4XTPA 5CYYA 3WG2A 1JYNA 3VBRA 3U75A 3U4XA 3POFA 1HDKA 2QKDA 5IFPA 1HB4A 1KJLA 4KU7A 1ZNPA 1CD3G 4LOTA 4AR2A 3N7MA 2UY9A 1LEDA 2O8QA 2YFZA 1V9U1 2CHHA 4QKDA 3TOJA 3ZXGA 2FDIA 2J1EA 2J7MA 4W50A 3ZIXA 2Q8EA 2UYAA 2PQQA 4N43A 4WM8C 4A7KA 1Y9QA 2GP3A 1KRIA 1HJFA 1CZTA 5L7OB 2BWAA 4KL1A 1Q56A 1YJLA 2QZ3A 3DKQA 3P3NA 3T2TA 1RHI2 3NAPC 2A5ZA 3BKZA 1QU0A 1X8MA 3POJA 5IVCA 3GZEA 3OY8A 1O6UA 3S30A 4LLFA 4YGDA 5SV8A 3J8F1 3OG2A 2MEV3 2Y64A 4LK7A 2YBKA 4XJAA 2GN3A 5FOBB 5IHRA 5J1XA 5F37A 3ZKUA 1QNWA 3AYEA 3PUIA 3WDUA 1QOOA 4Y3OA 3I7DA 3FFZA 3BCWA 4IEWA 4WVVA 5CKQA 3KZ4C 5APAA 4Y5Z0 5JIUA 3RQ0A 4AI1A 1S0GA 2YUEA 4BIFA 1S2BA 1KITA 4AHYA 5FZLA 3ZSMA 1R092 1JYCA 4YW6A 5EP9A 4C1WA 3AP5A 1SQ4A 2A71A 3EBRA 4P9JA 4D6RA 4WM7C 1ZZ7A 4AEMA 4B4QA 5KXEA 2VVFA 2JG8A 5FZBA 1WW5A 5J09A 3AMNA 4HT1T 4CRQA 4PHZA 3WF2A 1GZ9A 4QPGA 1YQ5A 3W20A 3OB8A 4XF4A 3ZM8A 4ITCA 4XFAA 2CTVA 2Q30A 2ZTNA 2NP0A 3ASIA 5GLUA 1GSLA 1CJPA 3AKRA 4NVPA 5FXXA 5CAZA 1GFF2 2ENRA 4RL7A 2DURA 5AC92 1DF0A 4JGYB 4LQRA 5EIYB 1CAUA 1GWMA 2P2KA 3AVRA 2FDGA 3SCHA 2XBO1 2VZSA 2NM1A 3NSTA 1MS4A 1PVC2 4Q4X3 2OQ6A 2J22A 3J7LA 4FQZA 1H8TC 2WQ8A 4CDXB 3POWA 3OUIA 4CXYA 3MI8A 1JYIA 3KV5A 5AFEA 3FL7A 3PUQA 5D1IA 2ZAHA 4ZXEA 1R1A2 1KD7A 2IXKA 4OMDA 5A32B 1ZBA2 2X10A 4ZPIA 3CMGA 2YBSA 5DQ0A 5JZGA 2ERFA 5A3PA 1CAVA 1RVF1 1FV3A 1MS5A 2VNGA 1AX2A 3N3HA 1DQ4A 1LHWA 3FHIB 3F95A 1B09A 3MHZA 2QJVA 3WW4A 1A6CA 1OOPB 1VRBA 4C91A 3G6JB 5FBJA 1GZWB 2CDOA 2ZACA 1BLZA 1UMHA 2VUAA 1LULA 1JYTA 5KWRA 3NQHA 3CJXA 2P4EA 1CAWA 3NJVA 4P9IA 3PVNA 5IW0A 2HWD1 1RUJ3 4I0BA 4RS5B 2HBUA 2P1BA 2ZGMA 2KA3A 2JECA 5HBAA 2W95A 1RUF2 1HXS2 3TAYA 4N53B 3PU8A 3E6CC 1QKQA 1AR91 2BW8A 2VD7A 3THCA 3VZNA 5J98B 1POV0 3WQ1A 4RHV3 2YC2A 4AQ6A 4Z2WA 3RZKA 1UZWA 2YB7A 1PGSA 1RUE2 2OT7A 5GZDA 2BJSA 2TNFA 3WSOA 1VMJA 3MIHA 2XJQA 2CGOA 1GNYA 3D3AA 4PIZA 2PHDA 3UV9A 1CJDA 2WLPA 1KXGA 4ARYA 1GLHA 5FR3A 1ND2A 5F3CA 1TME1 3NKGA 1BCXA 2VQUA 3GF6A 5J3UA 4IE6A 1AYM3 4Y22A 3SEPA 5FXZA 4DEQA 1NA1C 5CFDB 3UKTA 1S0BA 5FY7A 5KXDA 2WDBA 3S5QA 5DAVA 3TBDA 5D8AA 3AMMA 2F4LA 1UYPA 4GALA 2EXJA 2JEMA 3AKTA 3VZLA 1US2A 2YDEA 3OYWA 4QWNA 2PHWA 2XL7A 1AR83 4E4DX 4HL0A 2HWC2 2XMLA 4E4SA 3TN92 4LE4A 4KWKA 4KBBA 3VV1A 2DUPA 1K3IA 3ACIA 1PVXA 3EXUA 3O7OA 3RI9A 1UN1A 4HETA 4QDSA 2WFPA 5DUXA 3IN9A 2CAVA 3MYXA 1ODNA 2B8MA 1AYN1 1N47A 3K4ZA 4JTNA 2XWBB 4NHLA 5IVFA 2MHFA 1PIV1 4QXHA 5FZIA 3P3PA 1N3OA 1V9U3 1C5HA 2RS13 4JGZC 4O65A 3WNXA 3WNNA 5HV4A 1O3SA 4XAAA 1W8NA 2FDHA 2VO5A 3JD71 1UOGA 4XMIA 4LORA 5FY1A 1EAH1 2OKXA 4O61A 4GKXA 5LCWL 1DZRA 2X29A 3E5XA 5A33A 1OLQA 4QPYA 1ULPA 1W2TA 4KWLA 4Z8BA 1JZ3A 1GKBA 3O1UA 3HWJA 2DVDA 4PDWB 1NLSA 3GHNA 3VBFA 2Z69A 1Q8OA 1BEV2 1QF3A 1RMU2 2VOWA 3UGGA 3ZDSA 4NIDA 3POBA 1UCXA 4ZS2A 4CCJA 3WX5A 2HWF1 5C9AC 5I8TA 4OLLA 1AX1A 1K5MA 1UU6A 2ZHMA 4AVSA 3I2FA 4LHSA 4YW5A 2PAKA 2SLIA 3IAQA 4EE2A 5BNNA 3MZHA 4KH9A 4C1XA 5DAWA 3RMXA 1R64A 2ARXA 3RJRA 1I1EA 4I09A 3TEYA 4AF9A 4NIIA 1DDLA 4NUBA 1PM7A 5I0TA 3HNBM 3UT0A 3B02A 3M2MA 1HV1A 5DUVA 2DUQA 4P5HA 4CDUB 5K0UB 4URAA 3WNPA 3OPTA 3ZFEA 4A4AA 1BK0A 3U1XA 4BQ2A 4XW3A 3LQCA 5AVAA 3KV9A 3NV2A 1D4M1 2ZGNA 4XF0A 2B5HA 4NE9A 5CKMA 5A1LA 4LITA 4QKFA 5JUVA 3AZVA 2G9FA 2Y33A 3I59B 5BPXA 2WFF1 3UKNA 2C4XA 2VZPA 4BISA 1XE8A 3AFGA 3PJYA 1N1TA 1ODMA 5L9RA 1H2NA 5FZ6A 1JOBA 4MGTA 2GNBA 3U4SA 3LZZA 2XBO3 1Q8SA 3DPRC 4Y20B 1QDOA 2IFWA 2CDPA 5F5CA 3VD3A 2Q1ZB 5C8CC 3ES1A 3UGHA 2XHKA 1LU2A 1VAVA 4LXLA 4K8RB 4AVVA 2LS6A 1ONAA 4QPIA 4L0PA 2CGPA 1OFNA 4JVAA 5F3GA 5FPAA 3I3DA 4L92A 1FPN2 4YZ1A 1RVF3 4PQ9A 4LIUA 4QQHA 1SLCA 4BQ3A 3AP7A 1LODA 1ZBE2 1JZ8A 1SCRA 3VBHB 1Z7S2 5CNAA 2XGXA 2BZDA 2JKBA 4XETA 3KVBA 4GD4A 1SDWA 4NIHA 2GN7A 4PBOA 4FFGA 2GMPA 3U37A 3VBUA 2RJLA 2RHPA 3Q8BA 1OA4A 4GIQA 1POV1 3T1LA 4CCCA 5EJ1B 4PF1A 2HWD3 3ACHA 1IS4A 5JI7A 3H3LA 4HZFA 4LMFA 1H9PA 1S55A 1W03A 4QX2A 1XXNA 4E4ZA 1CIWA 4D7TA 1AR93 2PELA 3SH3A 4BK5A 5G05L 4NAOA 2EAAA 3IBMA 1E5SA 1YLLA 2QVSB 3KQ4B 2FCTA 2ZMLA 1ND3B 3VN4A 4NWVA 1W2NA 1W6OB 4WZFA 2QQWA 4FPFA 2OZ6A 1S2KA 4DZGA 5A3MA 3K3OA 5C33A 5CZKA 1Z0HA 5LRSA 1BKZA 3WW2A 1U5ZA 2YGLA 1GOGA 2UY8A 5FMOS 5L7OA 1FMD2 1GICA 3AL6A 4AHWA 2ARCA 2GNDA 1UY4A 4IV3C 1PX3A 4LBNA 1KDKA 5F2WA 1F8VA 3GBFA 2NPIA 2QQVA 1XE7A 1D2SA 4JDOA 4JKLA 4QXKA 5I93A 5FYHA 4Q8KA 2UWBA 1KQRA 5I8YA 2C1FA 2E63A 2NMNA 1ULFA 1ENRA 1H6YA 1STMA 4IEZA 4LUMA 5BV6A 4FPLA 3THTA 4R52A 5T5JA 4RQPC 5ABJC 1V6LA 2DBNA 2D93A 3A23A 3IDEA 4A2UA 1H4HA 4PLNA 4R9AA 1TMF1 5DZEA 4AVAA 2D98A 3I8TA 4EN8B 5EJZB 4UBHA 5HCAA 5AVPA 5JXGA 1J1TA 4QB6A 4XILA 3T0BA 2DCZA 4A3XA 2YZ4A 3OBRA 1C8M1 3H8OA 3ACLA 2PTMA 3CNAA 5IJRA 4AQTA 1AYN3 3T4HB 1WCKA 4XXAA 5T54A 2B42B 4P02B 4BPZA 1K5JA 1FOD2 4XFIA 2GC0A 2EIDA 3JD73 3I3BA 4BQXA 5T55A 4JGYA 4XFCA 1KS5A 3S6PA 2VZUA 4LTAA 1UZZA 1W0NA 1I5ZA 1UOFA 1V6MA 3MUY1 1WMEA 4PI0A 3URFA 5GZEA 3KHBA 2A6ZA 1MVEA 5A1AA 1V70A 4CDXA 3I2HA 4Q0VA 2BOJA 5FV3A 4GXLA 4XF3A 1XPWA 3NVCA 5JLVA 5A32A 5JOZA 1I5PA 1CR7A 1RUD1 2HWF3 3ACGA 3GCXA 1VB4A 2VUDA 3U07A 3KMHA 5FOJB 4K1ZA 4SLIA 4HPKB 4AFAA 1H6XA 3WUCA 2WO7A 5LK5A 2VU9A 1OOPA 3I49A 1GZWA 2O1QA 3M8LA 5FLHA 3OPZA 1AR63 4M00A 1PK6C 3OGRA 4MUVA 4XBLA 3K51A 4GKYA 1NAEA 3ILFA 4S2GA 1VBB2 5GZFA 1DZTA 5BYNA 3UL2A 3D6EA 1D4M3 2VQAA 2BUKA 3EO6A 1GV9A 4RS5A 4DRRA 5BNQA 4LIVA 4BLJA 4A42A 2WFF3 5LY1A 3WXPA 1BHGA 4N53A 1S4CA 4HONA 2RS32 1FX5A 1XYOA 1HRI3 4MXVA 4OMCA 4Q1RA 4YRDA 2B9VA 4CP0A 3JBG1 3OSDA 5FWEA 3WD5A 1JYWA 2LM3A 4CPBD 2VJXA 4DIQA 5BY5A 4BZ4A 3AZWA 4FAHA 1CZVA 2JD4A 4K3UA 3T0DA 5TSWA 3IMNA 3O14A 2TUNA 2B9UA 4AWDA 5K8SA 2I74A 3LPFA 4D6QA 5J48A 1URXA 4I3PA 4JTOA 3H9AA 1FV2A 3B00A 4GMP3 5FTTC 4COZA 5FJKA 1DG6A 2WYSA 1SLIA 1S0CA 3O1MA 4MGKE 3FLPA 1SBEA 3VDAA 2HWE1 3FFQA 4EZ4A 4X8PA 3AFKA 3RWKX 1QJU2 2WNUC 1ZZ9A 5ISLA 3LDBA 1IG3A 1IZ3A 4YW1A 2XL9A 2FQPA 4QX8A 2VY0A 1W2UA 2HYKA 5ANQA 1ENQA 1JTZX 4Q0UA 5CFDA 1JZ2A 2P6HA 1UWWA 2ZX1A 1YXWA 1SLTA 4K1YA 4D7YA 4R9BA 3S7IA 3LAGA 2CYFA 1POV3 2P3YA 3OCPA 4Q4V1 1W9WA 2XG3A 3HQRA 1C28A 3NL1A 3THDA 1V0AA 4YZ3A 3RG0A 2VMDA 1O3RA 3ELNA 3HVDA 4EROA 4R4ZA 4Y1VA 2FZ2A 3ILNA 2ZGRA 1ULOA 1WLCA 5IYYA 3CO2A 5A3UA 1AXYA 2Y6LA 3MW3A 4HXCA 3ECQA 4AFMA 4E2GA 3O1SA 3D0SA 2IC1A 5DMYA 5JIAA 3VBSB 2W2IA 1OBNA 4FFFA 2W47A 4KG8A 1LOEA 1IPKA 4LHNA 2QQPA 3KLSA 5FYBA 4I3GA 3GXUA 5DG2A 3SNMA 4EN6B 5C3RA 3OGJA 2RM21 3M7AA 3N9QA 3A0KA 3JB8A 1WW7A 2X53S 2EF6A 3FN9A 1VPHA 4QX7A 5LASA 1H2MA 1VJ2A 2ZJCA 3CKHA 2LW8A 1O5LA 2PLV2 4PDWA 3UYJA 1AJKA 2X8KA 4DNYA 5EYXA 4ZZ5A 5H9SA 4CP2A 4TLGA 4AG4A 1UU4A 4MXWB 3GZUC 1QGLA 2ORZA 4AI3A 1WCSA 2LALA 4LULA 4XFGA 1AR72 1WGPA 2X5IC 2XOMA 5BUVA 3E97A 2HEYF 1QIQA 1YI9A 1VB2A 1XJAA 2QQIA 4LO5B 1RUH2 2RDNA 3ETQA 2J42A 1KEXA 4TTGA 4QGMA 5F5QA 2VZRA 5EZWA 1TMF3 4IE7A 1BMV1 1W6MB 1RXGA 1VBD3 4XFHA 4CCNA 4W4ZA 4CDUA 4MOAA 1OQEA 5K0UA 4S2DA 1XYPA 1C8M3 1W39A 2RDSA 4GWJA 4KBZA 4RSUA 5LB6A 3USSA 3NNLA 1U5XA 2Z4FA 3AK0A 4HLTA 5IK5A 2GC3A 1YHFA 3ZYRA 4L97A 3I59A 2XJPA 3A22A 4AGRA 5LA1A 1V6KA 1WKYA 2KM2A 1CESA 2C9KA 1GWKA 3NWKA 4IEQA 2YG0A 3H3UA 5GZGA 2PMWB 1RUF1 2RMU1 3KD4A 4FT8A 4NRMA 4Y20A 2V73A 4KI5M 1IHMA 2WC2A 1RINA 3FUOA 2GSYA 5SV5A 1WLWA 4HSLA 4DUXA 4KQ7A 3BPZA 4W6WA 5C5UA 1DP0A 3H8XA 4AAPA 1C3HA 4FFIA 2VNOA 1KDMA 2VXJA 2GAUA 5KHJA 1UX7A 1AXKA 3M3EA 3T30A 2XJRA 3LFMA 4K9SA 2FDFA 2D5HA 1JZ4A 1QH6A 3OJBA 1G8WA 5HXMA 1LHVA 5DN2A 4BJ0A 1JUHA 2YV8A 3VBHA 1LGCA 1QQP1 3OF1A 4N90A 5FZHA 1O7FA 4FXGB 4URTA 1ZA7A 5F6KA 4PT6A 2P3KA 1KS4A 3CF6E 4INDA 3VL9A 3W9AA 5LA0A 4FI9A 5F39A 4UOJA 1RUI3 3I4IA 3TEWA 3FE5A 3QACA 1XNTA 3VZKA 5GLWA 1UNBA 3HQUA 1O8PA 2BFUS 3B7MA 5EXOA 2RJKA 4CYDA 4LKSA 1YFYA 2WRAA 4YGCA 4HK8A 1ZRRA 3CEWA 1M06G 2XUMA 3VZJA 2YY1A 2IXCA 2CU5A 3KVAA 5FREA 1Z78A 4META 4MHUA 2HKXA 4YVSB 2ZKNA 4GULA 4CDQC 4LNVA 3N4MA 1AR92 3TN91 2ZGKA 3JBG3 1ND3A 5FMDA 1BZWA 3VHOA 5C70A 1W6OA 2H6CA 3WLUA 1VRH1 1DQ1A 4HKOA 2A6WA 1WWYA 4QT6A 3OGSA 4AZZA 4C0HA 4XVHA 3POIA 1HV0A 5F1RA 4UFHA 3ORJA 1IQAA 2P3IA 1VBE3 4YZ5A 5LBFA 1UKGA 5FYZA 3KV4A 1WLDA 3P6BA 4FPJA 3ZYPA 3AZZA 3PVBB 2VR4A 3APBA 3VD9A 1PMJX 2I07B 4CUCA 1PZ9A 2HWE3 3FC0A 1X7NA 5HCHA 4BB3A 2Q0AA 1RGSA 1PGL2 1ZZ8A 5T50A 1JHJA 3E6BA 4DINB 1UIJA 5A6ZA 2JDAA 1OLMA 2KD7A 5C4WC 2RS53 2OPKA 3QH6A 5BNOC 1PO22 2DUOA 2WBKA 4Y1ZA 1EV12 1IS6A 5JWPA 3BUCA 4Q29A 4Q4V3 3SKJE 4OUMA 1NZCA 1QEXA 1BBT3 2R1DA 4M01A 3OBZA 3AZYA 4W8JA 2CGNA 4PIYA 4XACA 3WEZA 1J59A 1W8UA 3H1YA 4H14A 3AP4A 1ULCA 5H9PA 2WS92 5A7WB 1V00A 1N1SA 3LE0A 4WVWA 5FZFA 5JPNB 5A7PA 4YVWC 4XPVA 1CPNA 2GH8A 3IT8A 4HSJA 1DYPA 4AI9A 4XHXA 4WVZA 4S2HA 1B35C 2BTVC 3WINE 2K0GA 2VTFA 2Q1FA 2RM23 2GMMA 1UYXA 3GBWA 2QTWB 2IUWA 2VH9A 3RJ2X 2WKKA 4XJWA 3LSDA 4MLOA 1G9DA 3DF0A 4IUGA 1ACCA 3E6DA 3ZSLA 4OHYA 2Y6JA 4YG3A 1S2EA 2OUHA 1J1LA 3CL1A 2JE7A 1UZVA 4XBNA 2R061 3VDDC 4Y4RA 5LK7B 1LESA 2AEZA 5EPAA 5T3NA 2WWSA 4AI8A 2CV6A 3NJZA 1ENSA 1VBA2 4CCMA 4YW2A 4HPKA 4QGLA 2FMDA 2V5YA 1AUYA 5FY5A 4Y4YA 5T52A 1OA3A 1LECA 1PO12 5GZCA 5LEKA 1JU3A 3FUQA 4P08A 1GWLA 5CFCB 3LA7A 1FPN1 2TBVA 4CEYC 1MVQA 3F2ZA 3ZYJB 3OGVA 2PAMA 3LIHA 3MPBA 1NCQB 5FY8A 3I2OA 2VZOA 3OEBA 4QHBA 4RFT0 1QH7A 3A21A 1X9TA 3PDQA 1WBFA 2OW4A 3SXWA 3VBRC 3ZN4A 2N7GA 1ASJ2 1MEC3 5A1FA 2Y8KA 2AZ5A 1NY72 5E16A 4XF1A 5DAPA 4XJ8A 4HMZA 4R8HA 1XYNA 3P5BA 1R083 4XYXA 5DAQA 1V6JA 3RYRA 1QOSA 5FO8B 4YZ4A 1E5RA 5A3OA 3EB7A 2WAAA 4COUA 1IG0A 3DUIA 2RMU3 3CJIB 4MGQA 4AEJA 3LWCA 4N43C 3WDWA 1UD1A 5FIXA 3GCWA 4JZRA 1KGYA 4QHOA 2LUWA 4I02A 3H8UA 1S0DA 4CDWB 3DXTA 1KJRA 1VP6A 2HWB1 4LEJA 3RSJA 3WT3A 1RL3A 2W08A 4O9EA 2D6KA 1Q8QA 2D6LX 1Y4WA 4ASKA 4IEVA 2D40A 3AMHA 3ZXJA 3NMBA 4HKLA 2JG9B 3FMGA 2WYFA 3NNJA 4L2NA 4BXSV 2WQ4A 3B93A 2VVEA 5JMCA 2VCAA 2ZGTA 2ZHKA 1QQP3 3FX3A 1E5HA 4GQ7A 4IV1B 4XCAA 4Z92B 3I3MA 3I2JA 1YEWA 1S0EA 2R0FA 4AEDB 1I3HA 3FLTA 1X36A 3G7DA 4V1PA 3IDCB 4FPGA 1FNYA 4YM3A 2VW0A 3UK9A 3OUJA 4A7YA 1C4RA 2J1TA 2HH9A 1QJX1 1S0FA 4XF9A 4AVBA 1MS8A 4F7ZA 2FDJA 4ZHNA 1PGW2 2W87A 3FJSA 1NE4A 2QBXA 2VNRA 4QPGC 2MEV2 4MX3A 4K6BA 5FZCA 2B4KA 1W6QB 4N7IA 3TN93 2YC4A 1A8MA 2BBAA 1T6GC 1F2NA 1VRH3 3BI3A 5GJ6A 1RUC1 3VBSA 3ZXKA 1QXPA 4GAZA 1OVSA 2VMIA 3MW2A 3B9IA 1UXZA 1E5IA 3WW1A 4P00B 2JB8A 3WP4A 4D69A 1TNFA 1X9PA 4RFRB 3SISA 1HRV3 5FUNA 1BVP1 2VECA 5FZKA 1DCSA 4RD7A 1OUSA 1FOD1 2ZEYA 3ON7A 4L11A 1YCIA 2RG4A 1XRUA 4E8CA 2B46X 2VXRA 1RIRA 4QM8A 5C3SA 2GNMA 4EZHA 3NNMA 2Q8OA 4I0WB 1MACA 1US3A 4FCAA 4MXWA 4XE9A 2ZS6B 2F4PA 5CG9A 2WT2A 2RE9A 3WVJA 4OHVA 3UJOA 5KC5A 4GWNA 2IWGB 3WF4A 1YQ8A 3AXEA 2NN8A 4NWWA 5KHGA 1CX1A 3EMRA 3VL8A 4CEWB 1UX6A 2D3RA 1APNA 4Q4X2 1RUG1 1W6MA 4B3NA 2Z5WA 1VAKA 3IB3A 1DLCA 2CWSA 1PNGA 4ZU4A 3TWIA 1YC61 5J7MA 3KM5A 5JOWA 2XVGA 2XB6C 4MGSA 3ATGA 3KCXA 2JDPA 2RV9A 2VGDA 3U14A 3WUDA 3ZMNA 4XQDA 2JE8A 5A3NA 1O4YA 3LA3A 4H7LA 1VBB1 4CUAA 4PLOA 1R1ZA 3VB9A 3K46A 3R6SA 3H42B 4FBFA 1YFXA 4LO6B 1G6NA 2ZX4A 4DS0A 3IKWA 4EWEA 3O1OA 3RZMA 2BWCA 5HV0A 5IK8A 2BGCA 2X5IB 2V72A 3CZUA 3ZR5A 5C8WA 3HN1A 4BQ4A 3SLIA 3I2KA 2EXIA 4YLZA 4E27A 3IPVB 3VD4A 2IFRA 3VKNA 1ND2C 3H0OA 4JDNA 5BNPB 1VBC1 3HT1A 2ES3A 1RUJ2 2WO2A 4OVEA 4X8NA 3U11A 2R063 4ZKTB 3ALQA 4FXKB 3H8RA 2VVDA 1C57A 1OQDA 4Q4W1 3PURA 3VKMA 1JZ5A 5JR2A 3MFCA 2Y6KA 3AC0A 1UF2C 1OI6A 2CL2A 3J8F3 4XZPA 2IXHA 2DCKA 3BODA 4RHV2 5FMBA 3S0MA 4M3CB 1F15A 1YIFA 2VBPA 2ETEA 5FZMA 3DEMA 3AM2A 3I3EA 3VBOB 4BXFA 1VR3A 2DBIA 2ZMKA 3RZLA 3AMPA 4O7XA 5A80A 3ZVXA 2R49A 1QJU1 5L9BA 3ZSKA 2VM9A 2H0VA 5J36A 1FI2A 2V09A 4BQYA 1CPMA 2K2SA 1H1MA 5JDBA 2AUYA 2Y0OA 3W21A 5K7PA 4QB2A 4CUGA 1UZYA 3NJYA 3SH4A 1G9BA 1DYKA 1LOGA 1U0AA 4GWMA 2RDRA 3V0AB 5A7NA 2R071 5IVBA 4LPLA 3PTYA 4IGQA 1SLBA 4YVSA 1YUDA 4U2AA 2P37A 4CTEA 1E57A 1JODA 1XSRA 2WR9A 1MZ6A 3GM8A 2RDQA 1SFPA 1F5FA 1QWRA 1UOJA 2JIGA 3CU7A 1SACA 2ZGUA 2QQLA 2RJ2A 4M4RA 4A44A 4HN1A 1JXNA 1MS9A 2A70A 2ZEZA 1AR82 3DCQA 4MZUA 4V2WA 5FAXA 2PN5A 4SBVA 2FCVA 5EJ3A 5FO9B 1O91A 3LA2A 1S1AA 5JXHA 4I01A 2HWB3 3H1MA 3HMYA 1AVBA 3VBFC 3WQBA 3IIAA 1SHWB 1MQTB 4M4PA 2VOKA 2W68A 1QXJA 4B8EA 1ZRIA 1GOFA 3O1RA 4IEYA 1LHUA 4XHBA 1K5MC 1LOAA 4AGGA 1V9U2 3OD0A 2RS12 5FJHA 2P17A 4DXTA 2BDRA 2BNNA 2JKXA 4NR1A 1W05A 5FXWA 4FVVA 1T6BX 1NUKA 4GB31 1OURA 1DBNA 2W3JA 3RZJA 4QGNA 3LFIA 4I2OA 3AYCA 5FZ8A 1LTEA 2OVUA 3N7KA 4PQQA 4CDQB 1OF3A 5B4NA 4UXAA 1RTVA 4UFIA 5GM0A 5JMOA 4XUPA 5T5LA 4B4RA 1QJX3 3D4KA 2W1WA 1CX4A 4IGOA 1H0BA 2ZGSA 3ZFEC 2ZHLA 2AYHA 1RUH1 1WD3A 2RR11 5J96B 1FXZA 5A6YA 1X82A 5A7WA 3SITA 1GYKA 4YG0A 2UYBA 3HIFA 1FAYA 3K77A 4NHYA 1W0PA 5DDJ2 3ST7A 5CEHA 3J26N 4XOGA 3T4VA 3LSEA 4XURA 1RUC3 1GBGA 1XC6A 5FP9A 3GZTB 3INAA 4A7ZA 4QXBA 3DN7A 1J3RA 2D44A 4YM0A 2FZ1A 1AZDA 4FFHA 5DUWA 5L19A 2HEWF 4BOWA 4WZCA 2VZQA 2YHJA 1AXZA 5ANNA 4YFWA 1COV1 2F6BA 4IDZA 2C0ZA 2D6OX 1XNKA 4NHKA 1REDA 3PU3A 3WF0A 1TME3 4CU9A 2DFBA 5L36A 3FZ3A 4Q4Y2 3MF6A 3WW3A 1J3QA 1OH3A 2WUHA 3K4DA 2DF7A 3AJYA 3MEPA 4XDQA 1UPSA 4TSVA 3USUB 4J1WA 1QMJA 1F4AA 5FKCA 3VKOA 3WF3A 1YFWA 2XBO2 3AKSA 4R4XA 1ULDA 4WBBA 4YGBA 4HKWA 4YVWB 4A6SA 1W9TA 1W90A 1LEMA 4YM1A 2BVBA 5A3WA 1RUG3 3WG3A 1D7PM 1GANA 3QOPA 2FDKA 1NCQA 4IEXA 4A6OA 2FCUA 1N1VA 4XFBA 2EA7A 3ZFFC 3MGUA 2WN2A 3I3QA 2XJUA 5KHIA 3JXSA 1JBCA 4M3CF 4XIOA 4QHZA 4QMAA 1OXCA 1UL9A 1F4HA 4WM8B 3VHNA 4QX0A 2EXKA 1IKQA 1HB2A 1UMIA 4PJYA 1F31A 3ZFGC 4Z2AA 3AMQA 5FQ0B 1O59A 3NAPB 5F32A 1OSGA 1PIV3 4XABA 3V56A 3VKLA 2ZCWA 3PTRB 1I6XA 3WQ0A 5C3OA 5I0DA 1W8FA 2WZ8A 3CJIA 2W1SA 2Y26A 5CIRA 3RPQA 5JOYA 1ZRDA 4M0HA 2YU2A 1EAH3 1RITA 3ETPA 1NQJA 2Y34A 4AXOA 2VCMA 1PZ7A 1VBC3 3NKTA 1J84A 2HWD2 3KF5A 1OA2A 3D8CA 4CCLA 1YRZA 3C7EA 4OYUA 2WNVC 4Q4W3 4CDWA 1NE6A 3PIGA 4LBKA 2X09A 2C5DA 1SEFA
chains in the Genus database with same CATH topology
2ZAAA 3S7EA 4ZXKA 3HBZA 5ACA1 2A6VA 3MW4A 2QDNA 2JG9A 3TB0A 1KFUL 4DFSA 4IV1A 2HJIA 4ISRA 1NXMA 1V6IA 4WM7B 3IM0A 4K7JA 4AEDA 2XJSA 4OUSA 2W39A 4K8FA 1J58A 1WLTA 4AQSA 1JOJA 3VLBB 3LCPA 3D5OA 2ZBJA 1TE1B 4FPOB 1PO21 1WMDA 1QJY1 4I0AA 4Q1PA 2ZGPA 2R073 3ZO0B 1OFSA 4IEUA 3WY6A 4IEPA 1MS1A 1W6QA 3JB4C 1GNZA 1WD4A 1AX0A 4YW4A 2A73B 1H8TB 2DCYA 3RWNA 4OULA 1BYHA 2WS91 1OKQA 5FLJA 1BQPA 2UWCA 4OI2A 3J4UH 3AKQA 5IUQA 3AZXA 4TYSA 3SCFA 4D3WA 3ZSEA 5E8AA 3AXDA 2DVFA 2P34A 4CDXC 4IL7A 1LGNA 4M0NA 2EXHA 5JSOA 4IESA 2VUJA 3UKVA 1AYN2 1D0HA 2A6YA 1W6NB 2YXSA 4NOTA 1IS5A 4ONUA 5H9QA 3WHUA 5I8SA 5DZGA 4LHKA 3H1WA 3WQ7A 4GB33 3JD72 4FPYA 2G9GA 1OOPC 4S2FA 3JQWA 2WSVA 2YYOA 1H30A 1RHI1 3ZYIB 1HQLA 5JI9A 5EWSA 3NO8A 1ZRFA 1S0JA 3N35A 4CEWA 2DVGA 1VBA1 1V6OA 2DU1A 4FQ4A 2WQZC 1AF9A 3KS7A 2E7QA 1PO11 4PF5A 1V6NA 1RUH3 2RR13 4FP2A 4RS5C 1CAXB 1U5IA 3LKJA 2HWF2 4EN9B 1Q43A 2A3WA 4N53C 4LLOA 2PHLA 2UURA 3WG4A 5DG1A 2BNOA 2QCSB 2WSUA 4P9WA 1C5IA 1R091 3QCWA 4Q0SA 5T5OA 3TNPB 2VOXA 1AL22 2E53A 1AR62 2B45X 2X5IA 2XKPA 1TQ5A 1XNCA 2GZWA 4LBQD 1HLCA 1NA1B 1COV3 3IPVA 4JV4A 5BNPA 4W6XA 4DRVA 1LB2A 1D4M2 4N9HA 5AFBA 5JR7B 2WFF2 5AC91 1DGLA 1HRI2 3R05A 4JC1A 1H2KA 1OLRA 2R042 5FFOC 4M3CA 3PVOA 1JH5A 1PVC1 4FTEA 4QQPA 3VBOA 1QXRA 4IETA 4HVRA 2VULA 2BVVA 1IPJA 2PA7A 3RZZA 4ES8A 1R1A1 4QD2A 1XQNA 2D7FA 1ZBA1 1C1LA 1DLLA 4JGZB 1C8NA 3FLRA 3VZOA 4BYYA 5H9RA 2I45A 3K48A 1FNZA 2WZR2 1LOBA 2ZX0A 3LGRA 3V0AA 4NO4A 1VIWB 4COWA 1DGWA 4DB5A 2SBAA 3R4SA 3SCGA 2W0XA 3MIFA 4XBQA 4HANA 5JAXA 3MICA 4NN0A 2MEV1 3MDPA 4GH4C 1AHSA 1FT9A 1NOVA 3QBQA 4RR3C 5C9AB 4D94A 2UWAA 1X8EA 1HXS1 4JRAA 1NCRC 3B5LB 1G9FA 4PDWC 2DYCA 1YO8A 2E51A 1MQTA 1AJOA 1CVNA 5ACA3 1RUE1 2YPJA 3V0BB 3E5UA 1RUD3 2PHTA 4Q0QA 4Y1YA 3ME2A 1O4TA 3AP9A 1SFNA 5KHKA 4CDQA 1D4VB 4AEKA 1SLLA 4AK3A 5L73A 4PCRA 4YG6A 1XNDA 3DGTA 2R6QA 1LKNA 1QJY3 3OTFA 4XQWA 5K0UC 3LOBA 1IKPA 1EPZA 3HD8B 3WOGA 1SBFA 4K40A 5IT6A 1LOCA 2EAKA 3DPRB 1U12A 4Q4X1 5C8CB 3JCIA 3EHKA 2VOVA 2HWC1 2WS93 2DVBA 4ISQA 1QNYA 3U10A 4FTSA 1CN1A 1K5MB 3H7YA 5FCCA 1TMF2 1VBD2 2XJTA 1FATA 2JE9A 1LGBA 1QOTA 2ZZQA 1C8M2 2B7YA 3DKWA 4K21A 4LE3A 3MLKA 1WUVA 2ZABA 2DFCA 3SH5A 3X29B 3POSA 2JICA 1PZ8A 2ZKLA 3M3OA 1REEA 4NHMA 1LOFA 1A3KA 1ENXA 3Q9OA 3VBHC 2YC0A 3ZN6B 1RHI3 3USUA 4LO4B 3PVEA 5JOXA 3OGGA 4YVWA 1LJ7A 2CWMA 3ZSJA 4L99A 3B94A 2NQYA 1BEV1 1VALA 1PO13 1DHKB 1RMU1 2O8OA 3O12A 5FMOL 5JSRA 4YNIA 4DQAA 3VUOA 1LHOA 1ZX5A 3PLQA 5HI0A 3H3ZA 1RJ7A 1MS3A 4DY5A 4WM8A 1CONA 4D7SA 3VHRA 4QQ2A 1ND3C 4HVOA 1R093 5FQ0A 3NAPA 2GU9A 4IV3B 4OHXA 2BPA2 1VLNA 4Q27A 1SBDA 5KBFA 1N3PA 1RUI2 4B29A 1L3JA 2JDZA 2PHFA 1SLAA 4Y26A 3ES4A 3AKPA 1LCLA 3KQRA 2TEPA 2XLAA 3GALA 4WV8A 4AI0A 3NV1A 5AC93 3LB9A 2ET1A 4RQPB 4EV0A 5ABJB 4DPNA 4F3JA 3JBG2 4Z07A 3ZFFB 4QQOA 3BOPA 2EALA 2LTNA 3RMYA 3RS6A 1YYNA 1XU1A 1PVC3 1GZCA 2QNKA 1WBLA 1G86A 3MIDA 4WM7A 3BIWE 1WW6A 1YFUA 3W59A 5GLZA 3ZFGB 5DZFA 1VBE2 2PHXA 1R1A3 3LOIA 4YW3A 1ZBA3 4MH0E 2RS11 4LO8A 2JJ6A 1H8VA 1KFXL 4F8AA 3NV4A 3POYA 4ORFA 2HWE2 4Q8LA 2ARBA 3WV6A 3L9JT 2ZX2A 3AYAA 1YJKA 1ZBE1 1Y7BA 1Z7S1 2RS52 4E2QA 5E89A 1GNHA 2WNVB 3FBYA 1SCSA 4KG0A 1BVVA 4KGGA 4W65A 1H8TA 1Q8PA 4Q4V2 4U36A 4F83A 3R0RA 2KXLA 5DDJ1 2FHRA 2AENA 4FSJA 2Y38A 1BBT2 1RUF3 1HXS3 4E9KA 4PLMA 2GMEA 1Y3TA 3TYJA 3KT4A 5A3LA 4JCKA 2Q5TA 3L2YA 4FPCA 5HCBA 3KT7A 2I2SA 1RUE3 3HR9A 1W6NA 4LO7A 3FWEA 1DQ6A 1TNRA 1PK6B 3C2UA 2W52A 4ASLA 4ATEA 5B2GB 5T5PA 1J3PA 1ZRCA 2R0HA 1FMD1 2Y0IA 1G9AA 1H4GA 2RM22 1ZZBA 2DTYA 4Q4Y1 4B7KA 4XJ9A 2FMYA 2NZ9A 3HAGA 4LBJA 3ZYGA 4AFCA 4ZU7A 1W6PB 3KSCA 2WL1A 5CA6A 1EY2A 1JN2P 1CAXA 1D0GA 1RC6A 1JUIA 2QE3A 2JG8C 4KWJA 3FBMA 1NLRA 1IOAA 4ASMB 3JZVA 2BEOA 2HWC3 4BMEA 1A78A 1BMV2 3NV3A 4B4PA 2BNMA 4KNCA 3T1MA 2WNUB 4BE3A 2WIIB 2YROA 4GMP0 1NA1A 5K9YA 3QD6A 1MEC2 3VKFC 1DQ2A 3WDTA 1HKDA 3I54A 2WLQA 4TZDA 4COYA 4G4FA 1R082 1NXD1 4LR4A 4QX5A 1HQWA 2XH6A 4LT5A 3B9CA 4JDMA 3AP6A 3RYKA 3ZXFA 1BJQA 5CU1A 5JZGC 4EJRA 2RMU2 3ZXEA 4YARA 5BXXA 4MGZE 3WP5A 1BEV3 1RMU3 3JUUA 2ZGQA 3E5QA 2PHRA 4H3WA 2E7AA 4JGZA 5HXVA 4QQLA 1XNBA 1DQ5A 3WCSA 1ZA4A 1QDCA 1PNFA 3ZPYA 1LRHA 1LENA 4UBGA 1QQP2 1QJZA 3OBTA 3VBSC 2NMOA 4E2SA 5I0RA 1NG0A 2D97A 3GBGA 3KGLA 4P14A 1UKRA 1QHDA 5C9AA 3L2HA 1BXHA 2RS31 2ZGLA 2JX9A 2Q4SA 1OHFA 2JXAA 3V0BA 4OHZA 1VRH2 3RNSA 4MYEA 1UU5A 2YMZA 3KT1A 3CLPA 4YGEA 3ILRA 1DGWX 1DIWA 5D8AC 3KCYA 1HRV2 2CNAA 1FPN3 4FAGA 4FOWA 1UPIA 2DCTA 2E7TA 4ATFA 4X6RB 5GLTA 3AJZA 2ZX3A 3V64A 4GH4B 1ZBE3 2A3YA 2VMHA 1Z7S3 3GHMA 4RR3B 1H2LA 4FP3A 3VHPA 4Q26A 5KXCA 1AYM2 5FBZA 1NCRB 3DPRA 4EWDA 5C8CA 2ZMNA 1JW6A 4EN7B 5E1RA 1ZM1A 4XEZA 4O9GA 4BA6A 4YSFA 4AQ2A 1EP0A 1Q8VA 3MIBA 3SMHA 4HBNA 2OZJA 5DDJ3 5CBLA 4PIXA 3J9SA 3N36A 2BFUL 2BQPA 2HEVF 1AL21 1AR61 2AH2A 3ZN5A 1ALYA 4LBQB 3EJKA 3ZXAC 2XKOA 1EYBA 4L8QA 5FPZA 3PJQA 3A0NA 4BM8A 4GA9A 3AX4A 1FMD3 4PBPA 3N7JA 3ZN6A 4AHXA 4Q4Y3 1GQGA 1LU1A 5JCTA 3WDXA 3R4UA 4DMIA 5BNNC 2IXLA 2PLV1 1HRI1 1ZREA 2R041 4MGIE 4H7MA 4AW7A 2XWJB 2WT1A 3B69A 2R062 2OYZA 3V65A 1WMFA 1AR71 2A75A 1DGRN 2Q1MA 2XLGA 1OPOA 5GKAC 2GC1A 3RDIA 3RYPA 3J8F2 4YVSC 1H9WA 1F9KA 4GMP1 3WHTA 4BCUA 1H1AA 1S0IA 3PNAA 3VZMA 1YWKA 4M3CE 1CQ9A 3MLLA 1MS0A 4IV3A 4LBMA 1PHMA 2WZR1 3BOWA 4FOQA 3WDVA 3JU9A 4QU2A 2E9QA 4TWTA 5C4WB 4WVMB 1M4WA 4AHZA 3KCCA 2IXIA 1RJ8A 1FOD3 5BNOB 2A7AA 4MV2A 2AGSA 1DU3D 3WG1A 4QPIC 1I9RA 4FPEA 4RQPA 5ABJA 2UU8A 3ZFFA 5J37A 5I0UA 4MGYE 1ZZ6A 3A4UA 4BLIA 4FO9A 3M4FA 3ZFGA 5JVVA 2HWB2 5EYYA 3D82A 1NYWA 2CY6A 3VBUC 3WR0A 2AREA 4XJUA 2H6BA 5DUUA 4Y1UA 1B35B 1FYUA 5JPMB 5LRRA 4DXZA 1YIPA 4OI0A 2WJSA 4L9BA 3DV8A 2WNVA 4TLFA 1RVF2 2D3PA 4P9YA 3AB0A 1HQNA 1Q3EA 1MR5A 1VBB3 4G3YC 1YI7A 1UAIA 2D6PA 1BK1A 1WCDJ 2OA2A 3WDYA 3N7LA 5CVRA 3VDDB 4YZ2A 1LR5A 1QJX2 4COVA 1Y43B 2WINB 4IEOA 1O5UA 2RS33 4N7UA 5L7OC 4XJZA 3MFAA 1O4ZA 3R4DB 5EFUA 2DU0A 3QH7A 4CEYB 2ZA9A 1VBD1 4Z1VA 5FDBA 2R32A 3ZIWA 4C0BA 1PK6A 1RUC2 3GNEA 4XXPA 2D6MA 5FPXA 4LBOA 3VBRB 2WA4A 2K9ZA 5CFCC 2Z2SB 3C3VA 4BH9A 2Z42A 3THPA 1NCQC 2DCJA 1QJU3 1VAMA 1PGL1 1W6PA 2IZWA 4RA0A 3MPPG 2QFEA 4KU8A 1X33A 4JAAA 1TME2 2OIIA 4AE2A 2WA3A 1SMVA 4CZSA 5KXBA 3HT2A 1EV11 3DL3A 1DGRA 4N43B 4Q2FA 3W58A 2NLRA 5CG8A 1HIXA 2AR6A 2MNGA 2PFWA 3OY8B 4HK9A 3VGIA 3CJIC 4OI4A 4RGGA 4KGQA 1RUG2 4UW4A 2FBEA 4JGYC 4OI1A 2ZPXA 3WZ1A 2WNUA 4YM2A 4R9CA 2DTWA 3OD4A 4CDWC 3WCRA 1AL23 4RGAA 4X6QB 1RB8G 1EPWA 4BIOA 1TEIA 1IGOA 1RUI1 3GZAA 3M3IA 1QY4A 4XQ4A 2JG9C 3QLQA 4FPKA 2ZGOA 5GALA 4IV1C 4FPHA 1PIV2 2JG8B 4AEDC 1RUNA 2QZ2A 4IERA 5C6CA 2PLV3 2VW1A 4QPGB 1EAH2 4BWOA 4Y1XA 2R043 1VBC2 1ZYBA 4YFZA 4AVTA 1AR73 3M3CA 4Q4W2 5E88A 1REFA 3UJQA 4DY3A 2D3SA 1CAUB 1VBE1 2XJVA 3MLJA 3GYDA 5GLVA 1DQ0A 2A6XA 5FLIA 1A8DA 3BU7A 3WP3A 1GR3A 4XMAA 4AVCA 2WZR3 4P9XA 1H1IA 4AGVA 2GH2A 1ASJ1 3AYDA 3BTAA 3IWZA 1IS3A 2RS51 2G4IA 5JZGB 1NY71 1CAVB 1ULGA 2PHUA 2D6NA 2DWRA 4XFFA 2EIGA 2XVKA 2Z79A 2R072 3ZMOA 4XIKA 4JRLA 2GDFA 2NYYA 4IQPA 5FO7B 2B39A 2XPJA 1BBT1 3KGZA 3MIEA 1N1YA 3IDBB 4HFSA 1CAWB 1WA4A 2C9AA 2VW2A 3SHRA 1D2QA 1HW5A 1ZVFA 2E6VA 5CFDC 4FOVA 3H50A 2GALA 4BQ1A 3EQEA 4J1XA 4CEWC 4R9DA 2XVLA 1O3QA 2ET7A 2QDRA 4LBLA 4Q0PA 4P9LA 2MPFA 2R1BA 4LA3A 4GH4A 1DFQA 4HN0A 4RR3A 1OMIA 5LEJA 1NCRA 4GB32 2DVAA 4BHPA 1ND2B 4H55A 4ES9A 4EWAA 4AYUA 1MZEA 2PYTA 2VMGA 4LUKA 4Y22B 3PMEA 3ZXDA 1ZZCA 3KB5A 1PGW1 3MIGA 2D5FA 5BNPC 5IK7A 2RR12 4OZXA 1UMZA 5CADA 5D8AB 2ZZJA 4FOYA 1CGPA 3O0WA 3PHMA 2VPVA 2JENA 1OD5A 2QUOA 2DV9A 3OYWB 4LBQA 3B01A 3ROUA 1OPMA 3RRDA 1X50A 5KC6A 3BB6A 1MEC1 3HQXA 3O5SA 4NPRA 5I91A 2EVXA 5F6LB 3VBOC 1R081 1Q5OA 2A3XA 5CB7A 3M1HA 2P3JA 2BBVA 3O0XA 1COV2 4K20A 3ZX7A 4AI2A 4B7EA 4W6YA 4MVTA 4XTMA 1PO23 4CDUC 1EV13 5KHHA 1UW8A 3H7JA 1HX6A 1XU2A 4I30A 2PAEA 5A33B 4QM9A 2GC2A 1ULEA 3MF9A 3M3QA 3VBFB 1UIKA 2R16A 3ENRA 4LA2A 3TNQA 4MSVA 4P9GA 5C4WA 4WVMA 1MZ5A 5BNNB 1U5YA 1YNAA 1MQTC 2ZHNA 4AFDA 5BNOA 4ZU5A 1OQ1A 5DXDA 1MZFA 4G9SB 2H0BA 1WW4A 4IXLA 5F9TA 2CAUA 4UW6A 4BMBA 3U0ZA 3ZFEB 5JSPA 3TRSB 3I2DA 4LHLA 1RUJ1 2WNEA 3NW4A 3PMSA 4YYOA 2WT0A 3B3QE 2ILMA 3ZXLA 1VBA3 4OFGA 3RI8A 4HVQA 4RHV1 4Z82A 1C1FA 5I0SA 5ACA2 1B35A 2ZOEB 1HRV1 3O0VA 5HCFA 1JHNA 1N3QA 1LHNA 1RUD2 2OUJA 4OHWA 5EV7A 1G9CA 4QPIB 4CP1A 3M70A 1W0OA 2XLFA 2WZPP 4DOUA 1O3TA 4UW3A 1AL0G 1ASJ3 1G7YA 2D43A 3BALA 3VDDA 2ATFA 1AYM1 1QJY2 2O0OA 1DZQA 1SFYA 2BYVE 2YGMA 4Y24A 4EN0A 1F5JA 4FTBA 2VQ0A 1RUOA 3D0JA 5IK4A 3VBUB 4N9IA 1NQDA 3JQXA 4CEYA 2IXJA 3WP6A 2VG9A 4AFBA 4J6GA 2GNTA 1AR81 1LOFC 4JQRA 5FRAA 1GQHA 1PMIA 2R30A 4XTPA 3WG2A 3VBRA 3U4XA 1HDKA 2QKDA 1KJLA 4KU7A 1ZNPA 1CD3G 3N7MA 2UY9A 1LEDA 2O8QA 1V9U1 3TOJA 3ZXGA 3ZIXA 2UYAA 2PQQA 4N43A 4WM8C 4A7KA 1Y9QA 1KRIA 5L7OB 2BWAA 4KL1A 1Q56A 1YJLA 2QZ3A 3T2TA 3P3NA 1RHI2 3NAPC 2A5ZA 1QU0A 1X8MA 3OY8A 3S30A 4YGDA 5SV8A 3J8F1 2MEV3 5FOBB 4XJAA 2GN3A 1QNWA 3AYEA 3WDUA 1QOOA 3I7DA 3FFZA 3BCWA 4IEWA 4WVVA 5JIUA 3KZ4C 4Y5Z0 3RQ0A 4AI1A 1S0GA 2YUEA 4BIFA 1S2BA 1KITA 4AHYA 3ZSMA 1R092 1JYCA 4C1WA 3AP5A 1SQ4A 2A71A 3EBRA 4P9JA 4WM7C 1ZZ7A 4AEMA 4B4QA 5KXEA 2VVFA 2JG8A 1WW5A 5J09A 3AMNA 4HT1T 4CRQA 1GZ9A 4QPGA 4XF4A 2NP0A 4ITCA 4XFAA 2CTVA 2Q30A 2ZTNA 3ASIA 5GLUA 1GSLA 1CJPA 3AKRA 4NVPA 5CAZA 1GFF2 2ENRA 4RL7A 2DURA 5AC92 1DF0A 4JGYB 1CAUA 2P2KA 3SCHA 2XBO1 2NM1A 3NSTA 1MS4A 1PVC2 4Q4X3 4FQZA 1H8TC 4CDXB 3POWA 3MI8A 1JYIA 5AFEA 5D1IA 2ZAHA 5A32B 1R1A2 1KD7A 2IXKA 1ZBA2 5JZGA 2ERFA 1CAVA 1RVF1 1FV3A 1MS5A 2VNGA 1AX2A 3N3HA 1DQ4A 1LHWA 3FHIB 1B09A 2QJVA 3WW4A 1A6CA 1OOPB 4C91A 3G6JB 1GZWB 2ZACA 2VUAA 1LULA 5KWRA 3CJXA 1CAWA 4P9IA 3PVNA 2HWD1 1RUJ3 4I0BA 4RS5B 2ZGMA 5HBAA 2KA3A 2JECA 1RUF2 1HXS2 3TAYA 4N53B 3E6CC 1QKQA 1AR91 2BW8A 3VZNA 5J98B 1POV0 3WQ1A 4RHV3 4AQ6A 4Z2WA 1PGSA 1RUE2 5GZDA 2TNFA 3MIHA 2XJQA 2CGOA 4PIZA 3UV9A 2PHDA 1CJDA 2WLPA 1KXGA 1GLHA 1ND2A 1TME1 3NKGA 1BCXA 3GF6A 5J3UA 1AYM3 4Y22A 1NA1C 5CFDB 1S0BA 5KXDA 3TBDA 5D8AA 3AMMA 4GALA 2EXJA 2JEMA 3AKTA 3VZLA 2YDEA 3OYWA 2PHWA 2XL7A 1AR83 4E4DX 4HL0A 2HWC2 4E4SA 3TN92 4LE4A 4KWKA 4KBBA 3VV1A 2DUPA 1PVXA 3EXUA 3O7OA 3RI9A 1UN1A 4HETA 2WFPA 5DUXA 3IN9A 2CAVA 3MYXA 2B8MA 1AYN1 1N47A 4JTNA 4NHLA 2XWBB 2MHFA 1PIV1 3P3PA 1N3OA 1V9U3 1C5HA 2RS13 4JGZC 3WNXA 1O3SA 3JD71 4XMIA 1EAH1 4GKXA 1DZRA