4RDCA

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
364
structure length
364
Chain Sequence
b'NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with proline.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
total genus 135
structure length 364
sequence length 364
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rdcA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rdcA01
2ID9A 3LFTA 1RPJA 2ID7A 2PUGA 1PNRA 3HEBA 1WETA 5T7BA 3URMA 4JB2A 4MAAA 3T6KA 1RZRD 2PUAA 1M5TA 2IYNA 2R48A 4RY9A 5BRJA 1LK0A 3OLZA 4XASA 1K66A 4YWHA 2MYNA 2BGGA 1LBHA 1USKA 3I45A 4G0ZA 3RVJA 3BILA 1QP7A 3S99A 1VRVA 3IP6A 4MS1B 5BRAA 3H1FA 1AB5A 3SNKA 2PL9A 3KSMA 4H60A 3NNSA 1A0OA 2VUHB 4YLEA 2FMIA 3KG2A 1BDIA 1EAYA 2FKAA 4MLCA 5TQ2B 2HJ9A 2FEWB 2Q5CA 5C5EA 2MYPA 4P1ZA 3CS3A 4MS1A 4UHKA 4S05A 4LRQA 1JFVA 2NZUG 1EHCA 4LDAA 3GT7A 1DRJA 2M98A 3O21A 4Z0NA 2FVYA 2IPLA 3GRCA 4RZSA 3OQOA 2PL1A 2E4XA 3DZDA 2FQXA 2CWDA 3H6HA 4XXHA 3TO5A 5BR1A 4TLLB 2HQRA 2PLNA 3OM1A 3RH0A 3GL9A 3M9XA 2AYZA 3KLNA 1YIOA 4MS3A 1E2BA 2B4AA 1DC8A 4JP1A 4E7OA 3C3MA 2LIVA 3G1WA 5D2CA 3CFYA 3ILYA 1KRXA 5TQ0A 2RGYA 3RVQA 1TJYA 5FWYB 2QV0A 4F11A 4EYGA 5B3JA 1ZAYA 3QLUA 4Z4HA 1ABEA 2NT4A 3H1EA 5CHYA 4NICA 6CHYA 1QQBA 5DKFA 1YMVA 3O1JC 3TD9A 3O1IC 4PE5B 4MR8B 5CNJA 4RWEA 1Z17A 1ZGGA 3OO0A 3P9YA 1YMUA 4KRFA 1P6QA 4RK1A 1HEYA 1QP4A 1U2QA 1W9HA 2FQWA 3CNBA 5FWYA 3GWGA 4EGSA 3HZHA 4N03A 2IPMA 3K9CA 3HS3A 4RK5A 3QELB 2ZAYA 4OLAA 4IGAA 5IUNC 3H5TA 5JNWA 1EFAA 3HO1A 4G86A 4GPAA 2L18A 1UDRA 3D8UA 1QO0A 4WXMA 2E4WA 3F6CA 3W9SA 5DTEA 3QK7A 2QU7A 3CU5A 4WUTA 4ETNA 3N8IA 1D4ZA 2JBAB 5GQSA 2GX6A 2PAFA 4N47A 5KQLA 3MMNA 3CG4A 1PEYA 3QELA 3KKEA 1CEYA 3TX6A 5EWMB 3JS5A 2R47A 1JWLA 2RDMA 2PJUA 1J56A 4IF4A 2N9UA 1BVHA 1U8TA 4EY3A 2TMYA 4RDCA 4EYQA 3BRQA 4FE7A 4G0PA 1MVOA 4RS3A 5EWJB 2JBAA 2NZVG 4CBVA 1QQAA 3ROFA 2MSWA 1H9CA 4KNYA 2QR3A 1NY5A 3JPYA 4F06A 4UHJA 5EWMA 3CKMA 3EQZA 3C6QA 3VNBA 1FSPA 3B2NA 3UUGA 5PNTA 3DLHA 1XWWA 5HKOA 1P6UA 4ZPJA 1EWTA 3F6PA 2MYUA 2VYCA 5IBQA 4Z4FA 4FE4A 4RKRA 5FWXA 3MIZA 3O2SB 3Q41A 4EVQA 3HK2A 1PHRA 2E4YA 1QP0A 3A0UA 3DGFC 4OG2A 1W25A 5IUKC 3LTEA 2HQOA 1U0SY 2CHEA 3HJFA 3FFXA 2IPNA 4D6XA 4N0PA 1DBQA 1ZDMA 1MAVA 2J48A 3H1GA 3H5VA 3N0XA 1QO0D 4MQEB 3O2QB 4O1IA 1YS7A 1Z12A 1OXKB 2P4UA 1Y1LA 3NHMA 4F3TA 3MQ4A 5IEBA 1ZN2A 4PICA 3T95A 4KVFA 3EDCA 3Q7SA 1USIA 3F73A 4KK3A 1ZESA 3M6MD 3CLKA 4Z9BA 3OO1A 1Z18A 1C4WA 3TB6A 1SXIA 2XDYA 3EULA 3FFTA 4MQEA 3JY6A 1LJLA 3DBIA 1JX6A 3BRSA 3O75A 1P8AA 2CHFA 1T34A 3FDFA 1DJMA 2FW0A 4H3KB 3HDVA 3O2JA 3SG0A 3CTPA 3N0RA 1QMPA 3EAFA 3QLVC 4H3HB 5CNIA 3G85A 1GUBA 3LUAA 3LUFA 4RK4A 1DBWA 3RVRA 1DZ3A 4JASB 4KQCA 1NXVA 4MS3B 3RVOA 3LOPA 3CHYA 2JCGA 1L5YA 1AB6A 4D6YA 1JL3A 2E4UA 3OLVA 3QEMA 3OMWA 1D1PA 1QNLA 2CD7A 5TQ0B 2QVCA 4N41A 3RVSA 1F4VA 5HSGA 2PUDA 5DGCA 5TPWB 4OLBA 4TMYA 3MM4A 1BAPA 3GBVA 5JS2A 4F12A 5FBKA 5JNSA 1GUDA 3HUUA 3OM0A 1NXTA 4KZKA 1DG9A 4Z99A 2KYRA 4RSMA 4N76A 4MYRA 3SQNA 4NCAA 1RXIA 2H0AA 2F8SA 1URPA 2A9PA 4G0MA 3RVLA 3RVKA 9ABPA 2R25B 3H5OA 4W5OA 3OQMA 4KMRA 4LE0A 5TPWA 4L4UA 5E3JA 4Q7EA 1FFSA 2E4VA 4LZLA 3E61A 2WRZA 4ZJPA 2NUBA 3LMKA 4Y9TA 3K4HA 8ABPA 3OLXA 5KQPA 2L17A 3QLTA 4WXEA 5FBHA 3L49A 1C0EA 1YVUA 4WWHA 4NQRA 4OTZA 3IDOA 4MPTA 3LUHA 4DADA 4E7PA 4XLTA 4O1HA 2QW1A 2LPMA 3CRNA 4IMJB 1ZY2A 2RJNA 4MRMB 4RK6A 1BDJA 1Z25A 3IPCA 1ZGZA 2QZJA 3SY8A 3MA0A 1E6MA 5ED4A 2FMHA 2X7XA 2JVIA 1MIHA 4RV5A 1Z16A 4JAVC 1FFWA 4KFCA 4ML3A 3T38A 4W5TA 2OQRA 1ZH2A 2LUOA 4W5QA 1ZHHA 1LBIA 1M2EA 3E3MA 2WWVD 3L6UA 3LUCA 4MRMA 4MQFB 5IULC 4Z4EA 1P2FA 2WY2D 1FFGA 2JK1A 4D74A 3D02A 4EVRA 2HPHA 5JNTA 2FN8A 2YHAA 4O5AA 2L2QA 4DQDA 4HNRA 3GYBA 3N75A 3FFWA 3M9WA 1TM2A 5F64A 3EGCA 4LX8A 4LE1A 3QX9A 1Z15A 1DP4A 1TVMA 5IUJC 5FWXB 2PMCA 4MGEA 4EUKA 4WT7A 4MR7B 3LKBA 3H5IA 3KHTA 1DBPA 2R4QA 4MQFA 1NTRA 2F8TA 2V0NA 1QKKA 3BREA 1XHEA 3QX8A 1E6LA 4HNSA 1TLFA 1F51E 1FQWA 1NXWA 2FLWA 3I5AA 3Q15C 4QYWA 1D5WA 1JDPA 4Z9AA 3T8YA 3KTOA 2A9OA 5CNKA 2A9QA 4NV3A 2I6FA 1D2AA 4GNRA 3C3KA 1SRRA 5EWLA 2LBPA 1U2PA 1KRWA 4MR7A 3DGEC 1L5ZA 2PUEA 3KLOA 1DCKA 3RVMA 1CHNA 1JHZA 1SD5A 3A10A 2JVKA 4Z4GA 5IC5A 4M88A 4ETIA 2HQBA 3N6VA 1K68A 3HSYA 5KQMA 3EQ2A 3FGZA 2ZWMA 3JPWA 1JFTA 1E6KA 2YHBA 4NCBA 1Z13A 2M1ZA 3NHZA 5IEJA 1YK1A 2IKSA 4WZZA 2B1JA 1VKRA 2IDMA 3F7NA 4YRZA 1ISRA 3HM9A 2IPAB 3NBMA 4MS4B 4W5NA 1MB0A 3LUGA 1TMYA 3BBLA 2MSLA 4Z4IA 3Q9SA 2QSJA 3FMVA 3H6GA 2WJAA 3HDGA 4IMIB 4N0QA 4Q6BA 3IP5A 1JLKA 2IOYA 1U04A 1NXOA 5JNRA 3RVPA 3SM9A 2JRLA 3QEMB 4KK4A 2L19A 4YGXB 1SXGA 2PUFA 1KGSA 1XHFA 3EJWA 5TPZD 5IX8A 3LKVA 4EVSA 4MS4A 4QPJC 1IIBA 5TE9A 2LP4Y 3ROTA 2FMFA 1QPZA 1ISSA 3O74A 1A2OA 3KCNA 1CYEA 3JVDA 1GCAA 2VUIB 3OMXA 2W42A 4G97A 4PEVA 3I42A 3QLVA 3ILHA 4RXTA 1BA2A 4OBBA 3C3WA 5HM6A 2HSGA 7ABPA 2FSPA 4PZ0A 4S04A 3IP9A 2MYTA 1JYFA 1JH9A 5KC9A 1JBEA 3N53A 1PUXA 2H3HA 4IRXA 2WMYA 1NXXA 2QVGA 3IP7A 2PUBA 3O1HB 1GCGA 3IPAA 3MYYA 4LDZA 1NATA 4EYKA 1PNTA 1RXEA 2O20A 1EWKA 3A3KA 4YCSA 5C5CA 4QICA 5TQ2A 1DRKA 3UK0A 4MR9B 2OENG 2FXIA 4RY0A 3LUJA 1JDNA 2FQYA 5B3JC 2MSKA 1M2FA 4P98A 5KC8A 3QLUC 4RXUA 1ABFA 3OLYA 1RNLA 3VNAA 5DLEA 3TMYA 3LUDA 5ABPA 1BDHA 3Q7TA 3H75A 1YTUA 2A9RA 2FLKA 4EYOA 4TLMB 3GA5A 1EWVA 1DCFA 3OLWA 4G0QA 4OATA 4RK7A 3KS9A 4KPYA 3HV2A 3KYJB 4MR9A 4DN6A 2GKGA 5BQ3A 3RVNA 3GBPA 1MB3A 2JVJA 1YS6A 1Z2DA 5KWSA 1KMIY 4JA2A 4IILA 3RQIA 2RJOA 1JFSA 3LUKA 3EODA 2P9HA 4G0YA 4YV7A 3JVIA 2FMKA 3N0WA 4Q6WA 3C97A 1OXBB 3KJXA 3KYIB 3I09A 2DRIA 1M5UA 1NXPA 4YP9A 4QYMA 2GBPA 3H5LA 3JTEA 2PKXA 2GWRA 3R0JA 2QXYA 3NNDA 4XFKA 4PYRA 1S8NA 5TPZA 2WJWA 4RY8A 4ZMRA 5EWLB 3HXMA 1DC7A 4MR8A 4JOQA 4Z4CA 4W5RA 5JS1A 1ZH4A 5HQJA 5T3YA 2E4ZA 3QEKA 2NT3A 3CG0A 3Q7RA 4TN5A 1RZRA 4KREA 2JB9A 5JNUA 4ZMSA 1LJUA 2PUCA 3OQNA 3DLBA 5JNVA 1VPWA 2FEKA 3A0RB 4XARA 1JF8A 4XAQA 4RU1A 5TQJA 4L85A 4G0XA 1YK0A 4KQ9A 1ZITA 4B09A 1B00A 3H5WA 1DCMA 4HNQA 5CNMA 5GOTA 1USGA 1GLGA 4JB0A 5I4CA 1Z26A 4LE2A 3NNNA 3CZCA 4YR7A 5DCLA 3HVRA 1PEAA 2FTKE 1A04A 1Z2EA 1ZVVA 2WB4A 3SAJA 4HYEA 1JYEA 1SXHA 2AYXA 3HCWA 5KQGA 3GV0A 5KI6A 2FEPA 4RK0A 1VLZA 3CZ5A 1R8JA 1APBA 3MF4A 4YO7A 4ZYLA 6ABPA 4F8JA 4MLDA 5EWJA 4FB4A 2FN9A 3UKJA 2GI4A 4RKQA 1I3CA 4YS6A 2VK2A 1D1QA 4G0OA 4KV7A 4RXMA 1NXSA 2PE5A 3HUTA 4ETMA
chains in the Genus database with same CATH superfamily
1NJFA 1QVAA 2JRCA 3OOYA 1K5HA 5MDHA 5P8WA 1BFUA 1NBHA 2XWBF 1CS0B 2ID7A 2JKYA 2VJBA 3BMQA 4YDRA 1GZSA 4BB9A 3ZUGA 2AG0A 3S6JA 4HH4A 1WB4A 2N1BA 2JGMA 1WZEA 4HB4A 3F67A 2J0VA 4LXHA 5LA6B 3VO2A 3HV0A 1GFSA 3KJNA 5BV8A 121PA 4U7FA 221PA 2FP4A 2JJMA 2ZDGA 4XASA 4CUKA 2OHHA 2EDCA 3HL0A 4IDEA 1V6AA 3JAKB 2Y76A 4AYXA 3KR0A 5BSRA 3WGOA 2D59A 3C1TA 5BRNA 3NRBA 2Q7XA 5GIOE 1OBHA 1T3LA 2G5GX 3QXSA 3ZGLA 2WE7A 3D4IA 2BM8A 3WBKA 4B2LA 2Y8EA 2YV2A 2VUHB 4KQJA 3HACA 4MINA 2FMIA 5CCEA 1M34B 3GI1A 1ZUNB 1BKDR 2O7RA 2Q6TA 1E3DA 4ZO6A 1YIDA 5F52A 4LRWA 2JH9A 5DCYA 2JGLA 1E1RD 2Q5CA 1J07A 2ZR7A 1E9DA 3ZE1B 1X80A 4MV0A 1GPWB 2O8VA 4MS1A 5AK0A 3MTJA 4J2HA 4JDPA 1XTIA 3ME5A 5D3MA 4BBAA 2TMDA 3ELYA 1JG1A 5DHPA 4E5KA 5AVYA 5CIQA 3L7LA 2EF0A 3WLHA 2RBGA 3QWAA 4MUYA 3OQOA 3GUZA 3ND7A 5E1BA 3IPRA 2XTAA 2Y1FA 4BLOA 1YOVB 1XGKA 2OHXA 1TCBA 1DKNA 2PS3A 4JLVA 3WYCA 1JR3A 1N5OX 4DSUA 1O96A 4NESA 4W7IA 5JR3A 3HH8A 4AP6A 3H5RA 5K4HA 4XCQA 3QVKA 5DOVA 3S2EA 1XBTA 4EEXA 3JRXA 2XUFA 2VTVA 3I92A 2FHSA 4L8YA 1OXUA 1IJFA 4YRNA 2E3JA 4PZUA 5D2CA 4D3DA 1VSVA 4ZHQA 1S7GA 2YNMC 4Y2VA 5LKAA 3PXXA 5FWYB 5B4TA 1B6GA 3H6KA 1N33B 3DV2A 4LOHA 4Z4HA 5H83A 3SC2B 5CHYA 1AC5A 1KAOA 3WK9A 5I7UA 3CJTA 4H15A 3PVCA 2Z2YA 3AILA 4PFKA 1XTRA 2A33A 2B37A 1L7OA 4DA7A 1SY7A 2PT6A 2BLLA 3FCSB 1HK7A 3V8BA 5F4ZA 1M34E 2QJOA 1FUUA 4P9NA 5EESA 2JLQA 3CKYA 5D01A 2J85A 1BRMA 2Q1SA 1MHPA 2XOXA 4RK5A 5AXCA 2W2XA 4U0KA 4DR2B 3H5TA 4OLAA 2Q9BA 1W6UA 5JD3A 4U2BA 1Z6ZA 3T1QA 4IH9A 2O9JA 1H2YA 3AUXA 4WXHA 2HF2A 1QO0A 1U4SA 3R4CA 2J4DA 3JD1A 1EDEA 4AICA 4FC7A 3DAGA 1JT9A 4NFLA 4ZI5A 1BXKA 4JP3A 1OY1A 1I6WA 5CXXA 5C31A 3CUTA 5P21A 4A1OA 4Z7NB 5A3JA 1XCMA 4P3KA 5CFMA 4MWCA 4UZEA 2WF8A 3HNPA 3FWZA 3WO1A 3VJLA 1LQTA 3AEQA 5FHRA 5BQFA 3HL4A 1JWLA 2FJ0A 3NHKA 4IF6A 1U8TA 4LECA 2Y0DA 3N8KA 4MICA 2FPIB 2VR1A 1SQ5A 2FV8A 4GGOA 3OJ0A 2XADA 1GHTA 4RS3A 3TDNA 3LXXA 3Q6MA 1R4NA 4LBYA 1XALA 2BFEA 3V7WA 2WSMA 3BHNA 1W1IA 3DVRX 4Y1RB 2O0HA 9GPBA 2G1AA 1WMFA 1XLUA 1JHXA 2REBA 3M0EA 2V6MA 3ZE0B 3LV8A 4V1CI 1H6CA 1OZHA 2DFKB 2Q6IA 1CUXA 2WIAA 1JE0A 1PP4A 2CFRA 2FPPB 4BMNA 4BE7B 3RI3A 2EZ9A 3PNPA 4M1EA 3Q98A 3R3WA 4ALIA 4B40A 5EHGA 2CHEA 2WP0A 3FFXA 2IPNA 1I1OA 3CZAA 4ITUA 4ZT3A 4D6XA 4RSHA 5CT4A 4LQDA 2QM3A 2J48A 3H1GA 4HEQA 5KBYA 2PKQP 4KSYA 4YMHA 4CMKA 3TM4A 3VHXB 1Z12A 3ICEA 1YFKA 4GNKA 1OXKB 2EZ8A 4M9XA 1XDZA 2QTBA 4U9HS 3IXQA 4GIBA 4DYVA 2Q6KA 2FPMA 1KZ9A 5CFRA 5L7TA 4D0NA 3WP1B 1IY1A 3HADA 4G9BA 4RGQA 4R0MA 5FOWA 1OBOA 4CETA 1SXIA 1N3LA 3AR4A 3EULA 3HJRA 4JL6A 8AT1A 2DHEA 3DBIA 3NGMA 3O75A 4L5YA 4RELA 4D57A 1GXSA 2AN1A 3HN6A 4JBNA 5JVDB 3SJAA 5B1EA 8GPBA 2J3MA 4H3KB 2BEVA 1XTZA 1KO1A 1Z6TA 1NNLA 2DPMA 3CWQA 4FS3A 1P4AA 3UGTA 1R66A 3KZNA 3EAFA 5CNIA 1TA0A 3LCRA 3D4BA 2H5EA 2BR4A 2Q62A 4N65A 1KYIA 1AKEA 3M5CA 1BO6A 3EGIA 3OPMA 2ATXA 3DTVB 4R51A 5L7WA 4M0FA 4E30A 4MITA 1Z5GA 3HY4A 1T9AA 4BNIA 2HRCA 2I8LA 3FRHA 1QOQB 1K7EB 2VQDA 2OAGA 3VKFA 5IK2D 4ZT7A 3CVJA 1EQUA 1EXNA 1Y1KE 1KBZA 4KPFC 2KJQA 2VJDA 1ZEJA 1Q19A 3P20A 1C50A 1XEWY 2ZYRA 3PITA 2C3OA 4C7XA 5JADA 4G26A 1TVKB 3SYNA 3QMMA 2YMQA 2RH8A 1HKHA 3LOUA 5BWOA 4FZ5A 5JS2A 1CY2A 1DC3A 1V45E 2ET6A 2QRVA 4QO8A 2QYSA 4KP7A 1O54A 1BXGB 3C14C 2AJTA 3H86A 3OPYB 3N59A 3RVBA 1PG2A 5J2TB 1BRTA 1BTOA 1CRWG 2IITA 3D6MA 4GE0A 2I1VB 1MT3A 3PC4A 1R37A 2ZVJA 4AMBA 4LHYA 1T9DA 3B1KA 4LPSA 1KAHA 3JATA 1Q14A 4ERNA 2FJPA 4D9IA 4Y0NA 4C4XA 1ZS9A 4LI0A 1OGIA 5JECA 2WRZA 4UEQA 5FQNA 3FR7A 1Z0DA 3WR5A 1NVFA 4FFWA 1ML4A 1I01A 5KYUB 1CUBA 5KQPA 4URUR 3V1MA 5L4NA 4KR6A 1MAUA 3FTCA 3PQ2A 1H0RA 2XDQA 2ZATA 4GMDA 2ZRCA 3WJ2A 3BGIA 3H9UA 2O2IA 3OZSA 2Z2JA 4JN6B 2GYYA 5L3ZA 2I91A 2B7LA 4D9JA 5AUNB 2FMTA 2QKYA 3ECAA 1T6YA 1JFFA 3BCUA 3CF2A 4PX9A 3WJ1A 5JH7A 4MYSA 3QFTA 4OHOA 7GPBA 3ZIAD 3IOCA 3BT7A 3J80A 2FUKA 1NX9A 2ZVDA 1JHAA 4RETA 4JKYA 4MQUA 1YB1A 2XRFA 2F9MA 1OHHD 4ML3A 3IQZA 2BRUA 2DUNA 2F17A 1SU4A 2C20A 3D3JA 1EXWA 3AXSA 1EFDN 1UKYA 4W5QA 4BEBA 1KJZA 1LBIA 1MTZA 4MV3A 1N9KA 3OZXA 4O4LA 4OLJA 4X71A 4E4RA 4G4SP 1YI8A 3LUCA 4G2NA 1K8YB 4Z4QA 2Y93A 4KL8S 2C4UA 3L7OA 4B0PA 1CY6A 3NOOA 4TOIA 2ECQA 2J9ZB 4FMPA 1TZCA 1XF9A 3U5TA 4BPBA 1MA0A 3Q3IA 2HQSA 3LI2A 3WK6A 5IF9A 5FLEX 3Q0EA 3RRNA 4UEWA 1IVYA 1UPCA 3HYRA 4IXMA 4MLZA 1HDCA 1QO7A 2HQ1A 3LKBA 4RGVA 3KHTA 3F7TA 3MN1A 2Q9AA 4O4HF 5DCUA 2LCQA 3RLIA 3SEQA 3VV2A 2BEWA 2P40A 3PQ7A 2QZZA 1WDWB 3BREA 3E1SA 3AC0A 3JCZA 3LC7O 4JGBA 5B3AA 4CTOA 2V5UA 2P2CA 1HE3A 1IM8A 5KTOA 2HYDA 4DLRA 3Q15C 3GARA 3L4SO 5AK6A 3ESZA 1FVFA 1XYVA 1O95C 2IOHA 2A9QA 1C1DB 1LDMA 2FSSA 4HRYA 4QTZA 1SRRA 3WKDA 3TB4A 5BWBA 3TXAA 1JIIA 1RADA 3E9RA 3ZHBA 5H4GA 3D6AA 2HWXA 3DLCA 4J16A 4EUHA 4B3HA 1L3BA 1OFVA 1T91A 4F9FA 5DW3A 4RKEA 3VKVA 3CZPA 4C06A 1T4GA 2AJBA 5KVQA 2SKCA 3A4VA 2PSJA 1U2GA 1M83A 1U1DA 4DYHA 4BGIA 2P9ZA 3WQBA 3IH5A 2PWYA 1CLUA 3RM3A 1L9XA 1SBYA 2IYLD 1C7ZA 1GSAA 1RLTA 2HGZA 2JIQA 3WGKA 3PIDA 3ZXXA 4HSEA 2GAJA 3FA2A 4HMOA 1IOLA 2B34A 2FZGA 3ETNA 3AFNA 4I2NA 4J43A 2QQGA 2JJQA 2OEPA 4NECA 3Q9SA 2BKAA 1A9PA 4JI5B 4W5WA 1WS6A 1O6FA 4TYPA 2CHUA 1PK9A 2Q1XA 4HDMB 3R3ZA 3RCBA 2J09A 4NV0A 1U04A 4N7BA 4BFVA 1AKWA 4ZT4A 5CB0A 4R31A 4A2WA 3F4LA 4FWIB 4M83A 3HP4A 3UC9A 1XMQB 5DIZA 3RYCB 1TCCA 3A2LA 3KZ1E 1CQWA 4KDCA 2PR7A 3B9PA 4RQTA 3SPXA 3THYB 5DLQC 4QPJC 4QE3A 3NC0C 4QQFA 4BNZA 3DSRA 2HF8A 3O0DA 4FW8A 3SR0A 1JIXA 2RKBA 3SK0A 4D4GA 1LLCA 3QZUA 3OLCX 5D1HA 2PSSA 4X93A 3SVTA 2WFAA 4G97A 3F9IA 3PQFA 3QLVA 3TBFA 3C7CB 4MP6A 3OOEA 1Q95A 2IZ5A 4HDOB 3E8MA 1CDOA 5ICFA 1EZZA 2VDLB 3NR2A 4JBWA 4MCHA 3OUZA 4ZVQA 4F2PA 5LQMA 5C3UA 3CZMA 3WK7A 1JH9A 3A31A 3K1YA 1XLTC 1ZLXA 2DUUA 1F8UA 2ZI5A 4DCNA 5FBLB 1J33A 5HKBA 4O08A 4X3OA 3W78A 2MSNA 4IJQA 2J3KA 3WISA 4HWKA 3VC7A 5K6RA 2Q0HA 1BWPA 4M1MA 3R3UA 1SQFA 4L8LA 1AGPA 2B4RO 4CV3A 2IXEA 5ADHA 5KNDH 3WSWA 1ZMTA 4IGIA 5DNCA 3V7FA 4G6ZA 2I1WA 3V4LA 5C80A 4FT2A 3VPAA 1KYTA 2AQHA 3A4TA 3G5UA 2O20A 4PVCA 4Q4DA 3GZNA 3ANNA 2DECA 1UBMS 3ESBA 1K7SN 4YJHB 4C76A 3KWJA 4EH1A 3PG5A 4GR9A 4DMRA 1KWKA 2C7QA 4WN3A 2Z5FA 1D4FA 1UT8A 3L4BA 2IVFA 2ZP1A 1TD1A 3I58A 1S9HA 3UGQA 1B93A 1WBJB 3BN3A 3PNQA 4LJLA 1HT3A 4MVJI 2NU7B 2Q27A 4RA9A 3O8NA 2D0DA 3OA2A 2BL4A 4QDJA 1A9SA 3DZFA 4TLMB 3UXEA 1EWVA 1NUQA 1YDEA 5IMBA 2P8JA 3KS9A 1E63A 3HV2A 4DN6A 5CCDA 5IF3A 1ZGBA 2JVJA 4HB2A 1GT91 4C4PA 1N2BA 3EQ7A 5FDFA 1YD7A 3ROPA 4QUHA 4UBMA 4ARAA 4PGHA 5HZMA 4HADA 2FDRA 4CEIB 4MUKA 1QPGA 4YV7A 3H2HA 2ORWA 3JVIA 3RJMA 5FAKA 2PMDA 1F0KA 5NLLA 3OG9A 3DYVA 3WC4A 3BIWA 1W75A 4Q9DA 4QYMA 3T4EA 4EHKA 1NRIA 4CKWB 4ZK6A 4ZQEA 1B1AA 5L45A 1I2BA 2XNDA 3OJOA 5FPTA 2RGNC 1DQNA 1UMKA 2FEMA 5GJVC 5MFZA 4C1NA 4EZEA 5D00A 3OIWA 4NWIA 1V37A 2YINC 4HBGA 5C4MA 1BYIA 2NV6A 2P30A 1H0KA 1B7GO 2B69A 4FI3C 1EVLA 3OSUA 1B6SA 4I55F 4O33A 1ZZGA 2J08A 3V97A 4PLTA 4BFYA 1OH6A 2E4ZA 2XOKD 4TN5A 1AGNA 1JLLB 1F20A 1XK6A 1NLUA 3G2HA 4KREA 2HSJA 3DPSA 3YASA 1G8KA 3SMQA 4BVBA 3VYSB 3KAQA 2F62A 1RMQA 1XN1A 2A3NA 3IKJA 4RGYA 3DOJA 1ZIDA 2E87A 2GPAA 2HJWA 1F12A 4MWEA 3DW1X 4R05A 2C0QA 4G2TA 5GONA 1QQ7A 2DQSA 1RDFA 2PZFA 2NVBA 1KDPA 4CIWA 1SCUA 1V8PA 1SUWA 3RE1A 2BLNA 1OWNA 3VOAA 3KSAC 1XKTA 1JR4A 4DV7B 3OT4A 4URXR 4CFYA 3E8SA 3R6LA 2IDZA 2O7SA 3D6TB 1GGHA 2VBIA 3LBHA 1OIWA 3PPYA 2FTKE 3QGMA 1Z2EA 4N8DA 4QDOA 3CPHA 2AYXA 4RKWA 3WTCA 3JXEA 2EEZA 2X9QA 4RSRA 2JAQA 4YJ2F 5AW5A 4MDHA 3P5BA 2WTMA 3MHTA 1L7NA 4XH9B 5IVIA 4ZIRA 3CZ5A 4RTSA 4M0EA 1APBA 4N7RA 4J0JA 1SFRA 1USVA 4HXYA 1JFLA 1CVIA 4ZT2A 1XWFA 5E3IA 4IUBS 1TXGA 1E2HA 2R6GA 4J91A 3UKJA 2FP4B 3VO9A 1BJKA 3B85A 4YS6A 1JHQA 4AJ1A 3HXOA 4HD8A 1AY0A 1Y5NA 2JHAA 4TWRA 1SKMA 3HDYA 3PQ8A 4J3JA 5ANRB 4B31A 1PZEA 1QQ5A 1QTQA 4J90A 1PZNA 1KA9H 3HMKA 4ZAGA 3L0PA 3QYJA 3MRSA 3VHLB 1CE8A 1V5IA 2J45A 2PGLA 3J81k 4ZVKA 5IYZF 3DQQA 1R12A 5ILOA 2GXUA 5T64A 1OROA 4CKZA 5B1SA 3W3ZB 4YWHA 5SZKB 2O2XA 2SKDA 2O2CA 3ENVA 4Y9DA 3RASA 2UUPA 4PW0A 1FZQA 1RIFA 4DDVA 5KMGA 4LMAA 1X80B 3BEDA 3KQVA 1TCUA 4W6ZA 3HBJA 3ZWKA 4MS1B 3K71B 4QPCA 4Y8VA 2CCGA 5JZBA 3KDPA 4HLQB 3DE1X 4M6WA 1IBSA 5D3MB 3TH5A 5T4BA 1L7BA 3KAKA 4A6XA 1ISPA 1O3YA 3JQ7B 1GPDG 5TX7A 4ZAWA 4RV4A 4D3YA 3UMYA 1RI1A 3NDIA 3GH3A 1BU8A 1GQYA 4C78A 5M5BA 2H9AA 1O96B 5LNK6 3C87A 1FNBA 1Z4QA 2XUKA 2DJIA 1OX4A 4R2LA 3DA8A 4S05A 4K6MA 2FEOA 2P9JA 3O8DA 4Q4LA 2AN5A 4ZHQB 2FPWA 1QRSA 2YJ6A 3E4DA 3K16A 1M7GA 1K8RA 4QTXA 1EBFA 4WFQA 1F3LA 3WSTA 3PTZA 3ZVLA 2X2PA 5BR1A 2PLNA 3GL9A 2GARA 3OHPA 4G81A 4NEQA 4R7ZA 4D45A 3L0ZA 1YGPA 3IDFA 3HP7A 4AZTA 1DC8A 1SUFA 1VC2A 1XD8A 2YDXA 4TXLA 3VMMA 5FNZA 2V6GA 4NBRA 3AO0B 2VYVA 4FYIA 1Y4AE 4LGMA 1NBME 3KK0A 3AY6A 1KEWA 5IJ9A 3IUPA 3EUWA 3AOEA 2E9SA 2WE8A 5F77A 1PZMA 4UBJA 2CXTA 3RVQA 5MGBA 2WSBA 2FZKA 4H31A 2QV0A 4TXJA 2HCBA 3DXXA 4Z3DA 1WHSA 1TDJA 3GT0A 5FI0B 4DXAA 3CVWA 1IZZA 3MNFA 3VBEA 5DEIA 4E31A 5CGZA 4NCKA 1TJNA 3JR3A 3VGJA 3VU0A 3EIFA 3Q2OA 4MR8B 2G5CA 2AXQA 3PUZA 2PWAA 3LWNA 4C2TA 3H8WA 4XYBA 3FYHA 1JG6A 4RX1A 3REFA 3ZDXB 4A1FA 4I81A 2BGWA 1CYDA 1DBSA 4MHOA 5E4YA 3TMKA 3IQHX 3DXZA 1JG3A 2OCPA 4ER7A 5IKEA 2IPMA 4BATA 1R74A 2YWJA 1QR2A 5E6SA 1DTSA 1ENOA 4GP9A 3VPSA 1JR3E 3NU1A 5KHAA 1NVWQ 1JYSA 4FDMA 3AEQB 3DE2X 4NH4A 2PPVA 3C8MA 1GZ4A 2UUOA 3QYFA 4XGNA 4OHVA 2V55B 1K4KA 2VHZA 4ZCQA 2P62A 4OI4A 2VP0A 3S40A 4ALNA 4UC0A 1V39A 1UK8A 3CU5A 3D6NB 2GESA 3LQRA 3WLKX 2UXBB 1TW3A 4QRHA 3EPPA 1KR2A 1JR3D 1R4NB 3RWMB 2R5NA 4PY2A 3DNPA 2QTTA 4ZEWA 4YV0A 2WP8J 2VXOA 5LD2B 3JQ9A 4HEJA 2X4IA 3NFYA 2SNIE 3DO6A 1VG0B 2R47A 3G3EA 4AC9A 1FSSA 1KERA 1EWQA 4DY4A 2R00C 3I9V6 4FZJA 4HSGA 4LY9A 1DT3A 2P9QA 3ZBPA 3AP1A 4DNFA 2EIXA 3HI6A 5JZMA 2VF2A 3GFPA 1ACJA 4R4JA 4XWTA 4QU8A 3ZHQA 4HFRA 3RC8A 1MVOA 4KJXA 5K0EA 2E85A 3IIEA 1I4EB 3GRZA 4I4CA 1Z75A 3PQ6A 4BIIA 1FXWF 3WWYA 2XKJE 3LT0A 4JQZA 3FLAA 5KPJA 1IQ0A 2Q6LA 3M5DA 3U7GA 5JJKA 2HSDA 3OCXA 1UPXA 1ENZA 3K3PA 2WHEA 2VYCA 3I6BA 1NE7A 3Q12A 1BJTA 3GLHB 2UUBB 1E3MA 2TSYB 2JIZA 4QVKA 4TVKA 4CQMA 1QP0A 2VAWA 1U5BB 2QRPA 3D3WA 1MOZA 3VR5A 1JFRA 3X0DA 3ICCA 1H23A 1MX1A 5LZ7A 4N0PA 5LMZA 3BFXA 1A27A 4WCDA 1QO0D 2YWDA 3SU8A 5BWNA 1GXSB 2HZ7A 2R6CA 2W48A 4GLBA 3OFJA 4KQGA 1U0NA 3NHPA 4WDRA 3UAYA 1WUKS 2BEVB 5CMLA 3UN1A 3JQ8A 5H9WA 3F9CA 1MLDA 5ALJA 3PNBA 3SZRA 4P3OA 2X9NA 1QCZA 4RZQA 3UK1A 3RJZA 1ZNXA 3K6RA 4TS9A 1M1YE 1YA8A 2A57A 5CU7A 4AS2A 3OKCA 1JHMA 2OECA 3AEZA 1CBUA 4R2HA 2ZKLA 4D81A 2JLUA 3BCRA 1KDZA 1BS1A 2IZ7A 2FG5A 2JLBA 3RC3A 1TTPB 1Y89A 4F38A 1DJMA 4HAIA 4CM6A 4P2BA 2J4CA 2NSHA 2O23A 3CTPA 6Q21A 3CUKA 1ODTC 2B36A 3DC2A 3G85A 3K72B 3K8YA 3PWSA 2IU3A 4LQCA 5LXTF 3AFGA 4A8PA 1N6RA 1EGVB 1B42A 1N3YA 2J4FA 2YWFA 3GJ3A 3SX4A 4MS3B 1M2OA 2JLRA 4FMDF 3ESYA 1MZVA 2C83A 2FFRA 1Z4LA 1CUHA 2P67A 2GPTA 1KOLA 2QRVB 4E5SA 1QH0A 2VKQA 3VVBA 1QIHA 3CINA 3BGSA 1JL3A 1JHYA 1NYRA 3HP1A 3QEMA 5K0CA 2D54A 2AZXA 1J0XO 2JJYA 3C48A 2DY0A 4CKXA 1NF3A 3GLHE 3GRKA 5M29A 4WE3A 3ZBUA 4RVGA 2AL7A 3AYXB 2NTEA 3PX2A 2HFJA 3Q8LA 2FZEA 4B3TB 2NQTA 3AJEA 4UDXX 5CH8A 1FRNA 1TMGE 4ND8A 2GF2A 1GPBA 3UICA 4YT5A 2QJRA 2AHOA 1X87A 5B2FA 2X5XA 5BN3A 2BFBA 5K05A 1YFLA 1TQHA 1WA5A 2B4TO 4RW0A 3HB5X 3LCVB 2W6ZA 2XDQB 2W93A 2YVLA 4DG5A 1F4PA 1K8XB 3N8NA 2X1MA 3ACCA 3NM4A 4BO9A 4D4KA 2O8NA 3KJZA 5J47A 1JFFB 3EXFA 4V39A 2NADA 3P71T 1G8AA 3L9XA 4R7GA 4IWYA 1LBSA 2CYCA 2BDEA 5CLIA 4TMXA 3UWKA 3WK5A 3U7RA 3H19A 2RH5A 3QE4A 3C3PA 4MKRA 3ZS8A 3DNFA 1VHWA 5KNBA 3OJEA 3RK0A 1NIPA 3IAFA 4O4LB 3DNMA 3D8RA 3R3SA 4YRRA 4JUAA 1KYZA 3GFGA 3H1PA 3R0VA 3RBZA 1ADYA 5DLPA 5ALZA 2R65A 3WDMA 2NSLA 4E5PA 1ZGZA 4GZ5A 4CF7A 3FF4A 3SZ3A 4CMJA 5J58A 2FMHA 1UCFA 2JVIA 1M1UA 2PZMA 3SSNA 4RV5A 4E94A 6AT1A 1GNLA 2RAVA 2C88A 1I7PA 1BDMA 4IIVA 2GDJA 1VLVA 2OCDA 1I4DD 5CFOA 3WYBA 5HPYB 1PQPA 4GF5A 3WFIA 4QSHA 2YHIA 3M4JA 3UENA 5AHXA 3V8MA 3E3MA 3OBIA 2WWVD 1V96A 2C0PA 1YKSA 2BEWB 2JK1A 4HAWA 3LGXA 5LUBA 4D74A 5DYIA 1S2IA 3AHJA 4BO8A 3A04A 2J3HA 4WY2A 4L2IA 4BZQA 1DC5A 4QYTA 2GRAA 5F64A 5EJEA 1Z2NX 2P3OA 4YXFA 4W4TA 2Z5LA 4J2TA 3I1IA 2BGUA 5CT8A 1L8XA 1PAUA 1VP9A 4YECA 5K4GA 1DT5A 1TIPA 4YMLA 3E9QA 3H5IA 5EJ8A 1XP8A 3BE8A 2CDCA 3QMVA 4HS4A 3IULA 1GKUB 1JQKA 3K0FA 4UHBA 3O90A 1E6LA 2RAUA 1UXKA 4I1IA 5IBCA 4PXSA 3I5AA 1FVXA 3FDIA 4M0UA 3MBKA 5E8RA 1D5WA 5G0VA 1GGMA 2CNOA 4LJSA 3RTDA 2NM0A 1C7JA 1F0PA 4UVHA 1SC4A 3W6OA 3OKFA 1E96A 1B0ZA 4C04A 2O6LA 4KI0A 1Z2PX 5LQKA 4MGHA 2WZQA 2AF4C 1KIAA 5ADWA 1Z6GA 1C14A 2YZNA 1FP6A 2I3AA 4YCBA 2WVGA 5HHTA 4BOYA 1FNNA 1E7MA 2PGXA 5FUVA 5BPFA 3I83A 3WGJA 1F4LA 3IEVA 1E1CB 4I46A 1PJTA 3C1OA 1GQ2A 3I5MA 2PZEA 3DDOA 2FCRA 1QZZA 5D6NA 3NHZA 4AD8A 4V2UA 3TZHA 1ZH0A 2BE9A 1ISRA 2RHRA 4I4IA 3ETCA 1TLTA 1GDHA 2REOA 2VQSA 3H65A 3B82A 2PEZA 3FF1A 3ORHA 3KJGA 4X3PA 5EZQA 1KL7A 1TMYA 3BBLA 4FLEA 4UDOA 3U5ZB 5LCXA 3K9WA 4RZ2A 2WM2A 3OEHA 4PPFA 1H3NA 2KS6A 4YY3B 4CEJA 1RLMA 4UD2A 4KZPA 4XLLA 4BN5A 5JNRA 1Z38A 1KDOA 3CW9A 1F60A 3RRXA 3N76A 3IVRA 4P5EA 1LV8A 3OCCA 2Z83A 3DDWA 4MP8A 4QLAA 4A6PA 1GGNA 1GAJA 4KFRA 2FMFA 3T7RA 2QX4A 3UPTA 1A2OA 1CR1A 2EZTA 3MJEA 4PSVA 5JBIA 4IEFB 3TSOA 5T41A 4TZTA 4LCBA 2UVPA 1SQ0A 2GJ4A 2GILA 3UVEA 3CURA 1OKKA 3ZIUA 3GJSA 1S89A 4Z8XA 4BKRA 1JDZA 1FX1A 5IWCA 4S04A 4V2IA 4AZSA 3M6WA 3IP9A 4YEDA 4N5DA 5IFKA 2ZUWA 4IO1A 4RKYA 5DP1A 1MC4A 3OPYI 4WXYB 3VV3A 2ZSAA 1KEPA 1TM3E 2WPNA 3IVAA 4KGZA 1G3QA 5CEFA 4I5GA 3UYKA 3VSCA 1F14A 3BRWA 4Q1EA 2H4XA 3RVDA 4BP1A 3I04A 5F1KA 3BIFA 3K0AA 3V8EA 1XZEA 4DV0B 3OU6A 3BX1A 3FUTA 1FOEB 3MCVA 3NGXA 2FPXA 1FVHA 4YRFA 4HPXB 3HBFA 5LP6B 1ZLYA 4NYIQ 3D81A 2AGVA 4AF6A 1NOKA 5AP9A 1MJGM 2QI9F 3LQ2A 5LZ2A 1IN5A 1J0DA 2AZTA 4RNCA 5JJCA 2O52A 1USWA 4UAJA 5GOZA 5JPCA 3ORRA 3UJAA 3IAS1 5SY4A 3ZI4A 5B3JC 3S2UA 2QEQA 2R1TA 5IHXA 4JNCA 3VTKA 3GF4A 3KSBC 1E18A 3H75A 2FWPA 4AECA 1CETA 2BBSA 4DDWA 5ADVA 1O6ZA 1OYVA 5E7IA 4L27A 1O94A 1T5DX 3CLHA 3SS8A 2LRHA 1FQKA 1GL9B 2HJRA 4RE5A 1GLNA 1XA4A 1ZC4A 3DP7A 1E2KA 1II8A 1Y1TA 2II6A 4TTTS 2WTUA 1XTBA 3KB2A 1GYRA 2WV9A 2ERXA 5FL7A 3V00A 3GDGA 4A0GA 1EFHA 3RFFA 2GZ3A 2P9HA 1M5RA 4GVLA 4JJIA 2HHJA 4Q6WA 3K0BA 4QIHA 5A5DA 4YIKA 3BQ9A 2IQ5A 3KR1A 3F8TA 2ZIZA 3KYIB 3GVXA 2ZREA 3ZQ6A 5A2GA 4E21A 1X0VA 2LW7A 4Q37A 1VKNA 1YVDA 3K0CC 1GLVA 2BUAA 2PYDA 3MCUA 5E1MA 1XXHE 3JTEA 2AC7A 3LG2A 3M4NA 4TLAA 5K0NA 5TF4A 4ZEMA 4ZZ3A 3T3DA 5BUCA 1VPEA 2J5XA 2IDKA 2R8ZA 3NT5A 3TL6A 4A7PA 1J06A 4C5CA 1EHYA 2QY9A 3EQ6A 3NHLA 3VU9A 4P4LA 5GONB 3AR5A 3TBKA 3U3JA 3NVAA 3SHFA 1Z4MA 2G63A 2QTFA 3JQAD 3S2FA 3QRWA 2IX9A 3B3AA 5T3YA 1UXOA 4UVIA 2DB3A 3GJXC 1XNRB 4FN5A 4RZUA 4YP5A 1RZRA 1FBNA 2EW2A 4WKGA 5DE3A 1JR2A 5T8KC 1WQ3A 1LJUA 4GPZA 3HC7A 1ZCFA 1EGHA 2CJWB 5ESDA 2FZCA 5HNKA 1G8HA 4RU1A 3WK8A 9LDTA 1JDJA 1KZ1A 4K88A 4KQKA 5AJWA 3SZLA 1NP6A 1SD2A 3BOSA 3CNNA 3N7UA 3RIYA 3RODA 3I52A 3WMXA 5C46F 2OOKA 3I2GA 1Y1PA 2HCRA 2JBHA 1DJLA 1CQJA 4OXNA 4XW2A 1RJEA 5D51S 3RYFB 2Y05A 3OM8A 4KVZA 4N54A 3RK4A 2Y77A 5HE9A 2VEDA 3FVVA 3UAGA 1E1YA 2GZMA 2G9UA 5DGDA 4C6HA 3QU5A 2EW1A 2FEAA 1AXGA 1VBFA 2Z8YA 4L3OA 3SAJA 3HCWA 1CRZA 1QGOA 5TV2A 1TKAA 2BHSA 1GZHB 1PIWA 3B9BA 4IDDA 1ZL2A 3HO8A 1OX6A 2FEPA 2ZUVA 5FOQA 1N4DA 4I4TF 5JO0A 1XTTA 1MV5A 1VLZA 5ES4B 1N57A 1RBYA 2O3JA 2NTYC 2PN1A 3MCZA 2FX5A 4EWLA 1CE8B 2JKZA 4P0TA 2W4MA 4MPRA 2XNDD 3SHTA 2XQFA 3HLTA 3SBEA 4MW0A 1E1QA 4HWSA 5TVKA 4LMBA 4WK0B 3TL3A 4GMXA 4G0OA 5EYPA 3IAAA 4RFSA 4D02A 2CXHA 2I6QA 2ZJOA 3W7VA 3AW8A 1T9GR 3L7NA 4WKCA 5DIFA 3WTBA 5ICSA 4WZ6A 1V4NA 4IJKA 4BNGA 5J5AA 4X8HA 1I7LA 4GPIB 4PLFA 3U6KA 3O26A 4OJNA 4DM3A 2VNSA 1FXSA 2P6PA 4GZ6A 3ZDBA 1TGVA 3FPFA 3LHKA 2O48X 5F98A 1UBNA 3NBQA 4M9SA 1BS2A 2C3MA 3F6BX 3T35A 3W4KA 4DRXB 1JQ5A 2BGGA 1AGXA 1LBHA 1RM3A 3L7DA 3GPLA 4JV5B 4FKZA 3JQBC 2OLEA 2KBEA 3B9QA 4RH3A 1XLVA 3T3MB 2Q5QA 4JL8A 2M6KA 3GUVA 1OX4B 3EEFA 3IERA 4IVPA 3SC4A 3H1FA 3V33A 5HJ7A 3AVTA 2N47A 2YBEA 3UB3A 4Q5IA 1P5JA 2WEKA 2ZANA 1R0RE 4WADA 3H2JA 1L4LA 1LNQA 1U4OA 2R7KA 1OIXA 4UBLA 3UBMA 1FYDA 1AU9A 2HJ9A 2WUGA 1DL5A 1DKQA 3LVQE 3SYMA 3X1JA 3ZCPA 1TEVA 4FGKA 4OA5A 3UXMA 3RT7A 2C00A 2XI4A 2BFPA 2VF4X 2ZTHA 3QI2A 2DH6A 1NM5C 1SOVA 1WAMA 3PPIA 3CA8A 4UHKA 5EE9A 3V3KA 4C0HA 1D0VA 1EHCA 4IVRA 2QJFA 2YQZA 3KV1A 3IIMA 2JZOA 4Y6RA 5ELLA 4N6OA 3W5UA 5CDYA 5IJ9B 3DOIA 1QYCA 1Z3IX 3DHYA 4QUGA 2R8YA 3HZRA 5KYWB 2GF9A 1QCCA 4MWBA 3QITA 4TV9F 2ZB2A 2E5LB 2EFJA 4HRVA 5BYAA 1WHSB 3OM1A 2FN4A 3RH0A 3W5IA 1PJZA 4B8WA 4O02B 3PX7A 2XZDA 1ZQ1A 3Q8KA 4UAGA 1L8OA 3EF1A 4IWNA 3D6VA 2OQ2A 3QOYA 4H7IA 3LCCA 3WGLA 3OJFA 1RKXA 4DR1B 1IUKA 4M1WA 1RABA 4YRLA 3TSZA 3SYKA 3LP8A 3BMNA 3TI9A 4DV2B 2DHRA 2IS4A 1TJYA 3FWHA 3ZH2A 1YBFA 3GY0A 2BN4A 5KKCA 4JLUA 2JZCA 4DCSA 1XN4A 5I7OA 5E6SB 3B1VA 2IZ0A 1JVSA 1XMPA 5JQGF 4AT1A 2DKFA 2MJLA 5KVAA 1MW8X 2ZJ6A 3O1JC 4OFXA 2QUJA 3VR3A 2CCJA 4I50A 5E7MA 3UJDA 3M6UA 3KLPX 7ADHA 1U2QA 1W9HA 2B8JA 3Q5GA 1WNTA 2DUWA 3K7EA 1IN4A 4HF7A 4OHWA 1PK8A 5C7OO 5KTPA 4FCTA 3WLMA 3T9AA 3OMLA 2BBTA 4JVNA 3ZK7A 5C8DA 4IQ0A 2VUTA 3J7TA 4GPAA 3DMYA 5G1PA 2OFFA 3O4HA 9LDBA 4IJMA 3K70D 5ALSA 3QKSA 4ZQBA 1SHKA 2Y1DA 5DM70 5DMHA 1XT6A 1KJ8A 2IYXA 2QT1A 1V7QA 3DJFA 3G5LA 4JOBA 4C0LA 1P44A 4BLSA 1GPMA 4OQYA 4DV1B 4H59A 1G4HA 5EE1A 5HF5A 2VYVD 2CL6X 3A9TA 3PUWA 4ARSA 4PHFA 2OYSA 2WJJA 4IJ5A 4L3VA 1O58A 1V8ZA 4QPNA 2O2GA 1MB4A 3M3DA 3SIPA 3X1XA 3EIHA 3ENZA 5IJWA 2UYCA 3LXUX 2C2HA 2SBTA 3PC6A 4CQMB 4LS3A 1HM5A 3D3WB 5BMVF 3A32A 3STYA 1HT0A 3MPUA 4DLWA 2IXBA 4KDRA 4UULA 1X3SA 2BM9A 2G67A 3DV9A 3QVGA 3AF2A 3EF0A 2H5LA 2VT2A 3IBTA 1YJXA 2ASEA 3NT2A 4MJLA 4JFRA 4PO9A 4HDCA 2EKZA 4RCYA 3KZVA 4Y1FA 3TWOA 3WHPA 1HX7A 1QV9A 2XCSB 1BOOA 1WD5A 1Z73A 2R1UA 3W77A 4BJ3A 4D25A 2AZMA 4LV6A 3JQ8B 1VA4A 5DNEA 5B7GA 3D1LA 3A0UA 3OCWA 2Q5OA 3LTEA 1A9RA 2AG5A 1GR1A 3BJZA 2OO3A 4K8OA 5I7HA 3NW9A 3B7PA 3SXUB 1L7QA 4S0XA 2H92A 1MA3A 1S8OA 4PG7A 1ECPA 1QFSA 3E15A 1OZ0A 3QPBA 3RYIA 4OI0A 2NN3C 2P1RA 3SKXA 5JXGA 1KFKB 4G85A 4OHCA 1EB9A 1X9IA 1JA1A 1RAHA 3NIWA 5A0TA 1PWHA 3OT1A 2CLLB 4PZDA 5D86A 1EI9A 1F17A 4Q93A 2V98A 4ROSA 3RTBA 1PQUA 5I51A 3CCFA 4B47A 3WL3A 4IOKA 1RQLA 2XD9A 1NL3A 2ZVQX 3EGXA 1QOPB 2ZZMA 1C4WA 4AN1A 1FSFA 4HLUC 3TB6A 4EI8A 4RPKA 5J4LA 3RHZA 2C2BA 5A0FA 2PH3A 2HA5A 2NO5A 4COOA 2F4NA 5JAPA 4GPBA 4EM6A 4UW9A 5BW5A 3K9FC 3L6EA 2SICE 1DHRA 2JIRA 1JAIA 2VHQA 2X0JA 4JCCA 3TQRA 3WO0A 1N5KA 5K1ZA 3ZLBA 3IV6A 5CHEA 3PI6A 2CXOA 2DZDA 5AVXA 1YHNA 1PTJC 4YDQA 4KQCA 2DOKA 4ND8B 4OMCA 1JTEA 2WAOA 2YDYA 2WQ6A 5CVDA 3CHYA 5EJ6A 4PIVA 3BD8A 5BN3B 1KVSA 3VX3A 3LIIA 3HVIA 4TS1A 2JIZD 2W0MA 4CQMD 4ZAVA 3ZU6A 1OJ7A 3VR5D 3OE5A 4LJKA 5GV8A 4ND1A 1JN0A 1QJ4A 2CB9A 1HTBA 3EZ6A 3PWKA 1OREA 2QLBA 3RVSA 3GVCA 4WINA 1PJ3A 3AESA 4XM2A 4RTJA 2F90A 4NAUA 4KLZA 1YE5A 3LHDA 1VE3A 3H04A 1C41A 3GHHA 3I5YA 3P2JA 3OHMA 4IUCS 4GKKB 3MOSA 2QN2A 1UJ4A 2NLOA 4L74A 5IN5A 3WL5A 1YFJA 1H2HA 5AM4A 3UAXA 1SBNE 1RRFA 4QHTA 1DBIA 3IILA 2R25B 1VE5A 2CN1A 3ICOA 4KMRA 1Z63A 1RPZA 1E7WA 4FGUA 2W2MA 2ZCVA 3I64A 1QLHA 1BIFA 1Y37A 1T3TA 4M49A 5I48A 2JLWA 1V35A 4HP8A 3NDPA 4HFJA 2ZRDA 3M6IA 2WJPA 1R9NA 1Z4JA 5AXAA 5A4JA 4ZTUB 1XCPA 2NSDA 3L49A 2WDPA 1EZ4A 5DW0A 2XZLA 2I7DA 3ZHCA 4N5MA 1SOAA 3GMIA 3RT1A 3LUHA 1XZPA 4XLTA 2YHIB 1CUCA 1QLWA 4O1HA 3PL1A 4IEEA 4HXEB 4F2GA 4EKGA 4G0WA 3WA7A 3PGVA 2HIMA 4D80A 1DU4A 1DAOA 1J7JA 1Z25A 3HEAA 3ETGA 4KQ2A 1U7UA 1XQVA 5L40A 4DLUA 1J1IA 5TMEA 5DCWA 4CF6A 1R0YA 4CQNA 4PC2A 7MDHA 2QTNA 4L2IB 4BNVA 3LDAA 4IHJA 5JDCA 1I5EA 1N3IA 3LC2O 1LI5A 1P2SA 2IUYA 5H82A 3WQRA 3QHQA 3TNLA 1Z5PA 2VAXA 4ZAFA 4CGZA 4XCVA 4I1OA 2V58A 4C4TA 1QRAA 1E2NA 2OLJA 2DWCA 2GXAA 4EVRA 4LYYA 5JYEA 1D0IA 1VKHA 5CB4A 2C9YA 4OGGA 4DA0A 1BZYA 3IB6A 3IE2A 2YHAA 4C0SA 3KSDO 1O4WA 3JD2A 1VG1A 1J20A 4GW3A 4GXRA 5LYJF 3L46A 4NHOA 4OB7A 3S4YA 1DP4A 1J8QA 5DB4A 3VRHA 2AZ4A 2YZGA 1T0BA 4FDTA 5FR1A 2E2WA 2WHYA 3EPKA 5AVOA 5HJ5A 1EBUA 1MO2A 2GN4A 4KTTE 4U3JA 1NBEA 4WD3A 5I3ZA 1QRTA 4QXMA 2CHGA 2RMKA 3I9JA 3GLRA 4KITB 1CZOA 1LCIA 1TLFA 1FQWA 2GXSA 4CLEA 4F4HA 4QYWA 2UVDA 2ODAA 2DHQA 4XGIA 2Q0QA 3V4ZA 3T8YA 2GYVA 5FTNA 1KMMA 1WDTA 2EYUA 5ITVA 5KNBD 2J30A 1I2MA 4N5NA 4Q1DA 3UHPA 5LD2C 3INRA 4PU0A 1HZJA 3R7LA 3HXTA 1QHFA 4ENTA 3R9XB 2C2KA 4CMIB 3HKCA 1SWWA 3G0OA 5D7NA 4JYMA 5E95A 1G17A 5KTMA 4E46A 1U0JA 3PFBA 5EE5B 1M1NB 1K68A 3I73A 1CPYA 1P9NA 1A7UA 3DEAA 3PGA1 2WAXA 2X6RA 1J23A 2I99A 4IW3B 3V2GA 1V8FA 5CT9A 1QHNA 1RHUA 4NBUA 4QU9A 1N1MA 3WS7A 5KOYA 2IPAB 4ZCSA 1FSGA 4KO2S 3PWZA 1ZUD1 5ALWA 5CJJA 3LWZA 1JSXA 2E7ZA 2QSJA 1QH8B 3DZCA 2J5BA 4O29A 4PS1A 1N3BA 1CULC 1XTUA 4RM2A 3IP5A 4K6CA 3AF0A 1NXOA 1MFPA 2NVUA 3R3YA 4R01A 2OXEA 1R15A 1I4LD 4JU9A 2L19A 2YTZA 1E5TA 2EG9A 4QXAA 1SXGA 5CEJA 4U63A 2QAIA 3VVLA 5CT6A 4X41A 2AMFA 1USUA 3F74A 4RZ3A 3DR5A 3EIOA 2ONZA 2XE6A 1CYEA 5JS8A 2BISA 3T41A 3T3GA 2VT3A 1Z8FA 2GTIA 1EX1A 2OGWA 3OMXA 2F43A 3EXHB 4HN4B 5D85A 1QF7A 3ZZNA 4KI7A 4TQAA 2QNRA 2OZEA 3L9WA 3GOHA 4FFBA 5FWDA 3K0AB 2D5AA 4B3BA 2CV2A 4KN9S 2EKDA 2H0RA 1XRRA 2HUNA 4PBTA 2Y1GA 1WCIA 5CYPA 1IQRA 2HSEA 3COPA 5DVZA 1POXA 3HSKA 2V9PA 4XX0A 3DLPX 1CUVA 1DEHA 4LMPA 5UKDA 4F2HA 3E5HA 1H85A 3NDJA 1J9ZA 1ZJYA 1JAYA 4IRXA 5TS2A 4BVAA 1O5IA 1DV1A 4B7ZA 4CHTA 3I0MA 5IZCA 2HK9A 2OK8A 1KI6B 2ETVA 3CSUA 1E6CA 3RGWS 3ZE6A 1NW7A 4YAEA 1E5XA 4UOEA 2HHAA 3BULA 4AKIA 2R1TB 1AVTA 5FV7A 3HR8A 4P7KA 3IPAA 1I3KA 1O0SA 2CYBA 4LDZA 1FZTA 1G42A 3H9CA 3UV3A 3LDHA 4TLDA 4GOKA 4B71A 4JD5A 1L6IA 3O31A 4QICA 3PP8A 4TS4A 5B58T 3RKUA 3UK0A 1UJBA 3ANXA 2Q4BA 2NMVA 1IUNA 1TKBA 1II8B 2GDZA 1P81A 1NAIA 3DUFB 4WACA 3RHFA 5B7NA 2JGIA 4X65B 2X1LA 5K0FA 3HBAA 3HWSA 1WXEA 5JFTA 2X5KO 2ZXFA 2OYCA 5A5VA 621PA 5KC8A 2IHNA 1Z9BA 3I9MA 4CL8A 2D6FA 4WEOA 1WMDA 5FFNA 1Z3CA 4FTWA 3FNQA 2VUUA 4IJ6A 4AFNA 1YTUA 1CKEA 1FDRA 2VH2A 1YRAA 4EA7A 4CV1A 4XYLA 3PXUA 4L7VA 1KIFA 2PAAA 3UJ8A 2IHKA 2NXCA 3EVDA 3ND5A 3GLUA 5BW8A 1CK4A 4QT4A 5IAEA 3CH4B 1TT7A 1I80A 3SYLA 5H3HA 3QFHA 4D9KA 1VDZA 2Z2XA 1EPUA 1MP0A 1OKKD 1BGVA 3TKYA 1E8DA 4RHCA 2PRKA 3VU9B 2QXTA 4EUFA 5KSWB 3EPJA 3GEEA 2F3QA 2G09A 3EFOA 3BTOA 3EOZA 2QMEA 4M8LA 4QFDA 3BIOA 3G02A 3I09A 5K7SA 1BH6A 2GT1A 1J49A 9MHTA 3EFHA 1Y0BA 1HQKA 2HMAA 2OFWA 5AOCA 4YIHA 1AQNA 1U3FA 2CUKA 2XNJA 1I32A 3AYZB 3BRWD 3S7TA 5B12A 5FUWA 5EEGA 2H1VA 4ARVA 1NNEA 1T15A 3CM0A 1R4ZA 1TNDA 2Q3HA 4CMAA 2QK4A 3WV5A 4GPTA 4IL5A 4Q00A 1N2JA 1GKKA 1Q83A 2AR9A 2GJKA 2X76A 1K7CA 2P41A 2PKCA 1QZXA 4RYDA 3L02A 1O03A 5BYBA 5TSDA 4X90A 4AJNA 4BTVA 3E0QA 3SHQA 2GZ2A 3ANYB 2ZJ4A 3GLTA 1NUTA 3PGJA 1XMXA 3N2ZB 3PPXA 4NXMB 2FEKA 2VIIA 3GGGA 4LTMA 4NZ9A 4ZU1X 4AP5A 3OOSA 4G0XA 2G72A 1ES9A 4OX9B 2C54A 4FHDA 1JQ3A 2IEDA 2CDBA 1BEUB 4ZRNA 2WVAA 2Y3IA 1P0PA 3IEKA 3IQWA 2WIBA 3IAEA 3N3AC 2QS9A 4TL6A 2FYTA 1O94D 1NW4A 2YWCA 1X9GA 4G65A 2NUPA 5DCLA 1Z4KA 2JH8A 4FIZA 2ACWA 1PJ4A 1ODLA 2C8KA 2AB0A 5EYPB 5FL7D 4CLRB 1SZDA 2LDXA 5JEEA 1U28A 2PX3A 3D3KA 3A3OA 2FA9A 4KMSA 1TZJA 3ILXA 5E6RB 1IWBB 4QQ8A 5CP8A 2V9CA 3WQQA 1NZDA 4Y6QA 5LZ4A 1GTSA 4NLLA 1RU3A 2ZPUA 1G3IA 2ZYGA 3IC5A 4L8FA 4LYAA 3UT0A 4QGHA 1JMKC 3ZH9B 4YAKA 3SEAA 1IZYA 4A27A 3DHNA 5ER6A 4IDAA 4KV7A 1D1QA 1NBAA 1Q77A 2O7NA 4KRYA 5CR9A 1RVV1 1GKIA 2JFOA 1KYVA 4NU5A 5G0WA 4MQMA 3H5NA 5DISB 4FIDA 1AO3A 4AY2A 3RGGA 1RZRD 2PX6A 1QXSA 3HU2A 3T15A 5BRJA 1OB2A 1U4NA 5DF1A 4ZZIA 1K92A 4JK3A 5H1YA 5E3HA 2LGJA 4CHGA 4L5IA 1JKJA 3ENKA 4IIYA 1CY7A 4Z0HO 4FYVA 1UWCA 3M6VA 5JXIA 4ZRMA 1I2DA 3L1UA 1Y6GA 3I4CA 1IVNA 1NI4A 4KPUA 4IQ8A 3FGNA 3F8WA 2X86A 2Z2ZA 4WESA 4X6UA 2IVZA 2UUCB 1BW9A 3ABSB 2R2AA 3KYBA 5AOVA 1IZ8A 3ADDA 4YT8A 1YO6A 1ULHA 3DCJA 1F2DA 2ZYAA 4ZT5A 2HU5A 3HA2A 5FL3A 3FPBA 3RSZA 3VDXA 4D99A 5AVUA 4WFJA 1Y4DE 2X8WA 4U7PB 5KNCH 1R9MA 2J3EA 2YJZA 2JAPA 3GJ8A 2CVOA 3NAMA 4H1TA 4MLCA 4XVQA 3K0HA 2FEWB 3QBJA 2X9VA 3I6YA 3HY3A 4Q9JA 4OBEA 1ZK1A 2RHJA 1TYBE 1EEHA 1QX4A 1Z6QA 3V34A 1OU4A 1XZCA 4U39A 3ED1A 3B60A 1CFJA 3NGLA 2F59A 3FR8A 4R8LA 1YI1A 2ADFA 3PEEA 4U5QA 1AK2A 3MILA 4N3AA 1E1QD 1QWSA 4G1BA 3BMNB 4Y2JA 3RRFA 1CZHA 3STTA 1AIPA 4BBZA 5J4YA 2FSFA 3R0ZA 3L8YA 3V8QA 3L01A 5EMHA 3NHSA 4XXHA 4DS3A 3IQGX 4KH0A 1NQAO 4PSUA 1PYGA 2F48A 2JGKA 3FOAA 1FTWA 1K0UA 3KL2A 3RRZA 4BMSA 3KFLA 3SKYA 2VOJA 4D5GA 4I50B 4WECA 1RJWA 4RCVA 4LJ7A 4NONA 4XJVA 3ZJ4A 4I14A 1T5IA 2BKUA 1DJQA 2GS9A 2E18A 4TUYB 13PKA 4CCWA 2JGFA 5HUHA 4G0UA 3B6IA 3LA8A 1YE3A 2WFLA 4RMIA 4J0DA 3BTSA 1W29A 2WU1A 5AT1A 4B6SA 4D9MA 1X38A 1AV6A 1W6RA 4CCSA 3FWKA 5A03A 6CHYA 2IV7A 1IBMB 2RBEA 4RMNA 5LP6C 2XNSA 3BB4A 4KQWA 4LHXA 1XZAA 4ZV7A 1I3OA 3FTEA 4MGYR 5CX1A 3QKSB 4ZI3A 4LCEA 1RRKA 1XROA 3JQFC 4NBNA 5H9VA 3DWGA 3K2BA 1MJNA 1HEYA 4RK1A 1QP4A 4YRPA 3L04A 2Q29A 3VKUA 4CI0B 2JC3A 3DV0B 1FX0A 1GZDA 1FRFS 1RYFA 5G0SA 5LC1A 1T8WA 3QA3E 2OZPA 5EJ9A 2QRHA 4KQFA 1DKMA 3DPUA 1T5SA 3BFPA 4G86A 3QQPA 1JDTA 2WZCA 2L18A 4TRNA 4DKJA 5JT1A 5LYYA 5SICE 3VZDA 5C81A 1EEXB 2I3ZA 3TECE 5JZVA 1KI4A 4ZOLB 3T9BA 3MUOA 3LF2A 2PAFA 2O1SA 1CHDA 2Y1XA 4D9FA 4QECA 4XA8A 3CLRD 3KKEA 3D8NA 3LKZA 3E3AA 1A4UA 2HRDA 1KE1A 3H3JA 4N3BA 4Q39A 3UANA 4D8VA 2WHXA 3A4LA 3QVGB 2RDMA 3VR6A 3AZPA 1L5HB 2IEYA 3E9EA 1JA9A 3QVVA 1LQUA 4CGYA 1JZSA 4DGQA 4F2DA 3W8FA 4F9TA 3R7WB 1W93A 1S01A 1FLDA 4BJ6A 4OGWA 4Q9LA 2COEA 2G77B 2Q2OA 2YH2A 3FX2A 4YCNA 5JC8A 2ADMA 4PRZA 4Q9AA 4JR1A 1QYRA 3DKRA 3USES 4PNEA 4HEA6 3DBRB 4YN3A 4Y6PA 2P7HA 1P1IA 4F06A 4HRAA 4U8GA 4FNMA 3EQZA 3VR3D 2P9GA 4GLJA 4ND5A 3MXTA 4AMVA 2I2CA 3O03A 3CNOA 1LTKA 3RYIB 4FCCA 2GA8A 2I3DA 4ZCRA 4OK3A 1JTVA 2QP4A 3WYGA 5BMOA 4NXNB 3JZFA 4FD2A 1E99A 4MROA 1M2WA 5IBQA 3OT1B 4J0HA 2DWPA 1G5IA 3L8MA 1O9GA 4UHDA 1PHRA 2R62A 2PUBA 3RRBA 2XBMA 1XCGB 2XYRA 3GEGA 1MORA 3ZQUA 5CIWA 1Y4ZA 2H4FA 1EFLA 3SVZA 3A1TA 2HDNB 3I2FA 5FLXA 4DEYA 1NBIA 1UBHS 2VWGA 2UXCB 2VK8A 1NOJA 3I5XA 4QBIA 4MRRA 4EJSC 3EXIA 1YZFA 1PVDA 3EVFA 1L5MA 1V95A 4CV2A 4F71A 3CIOA 2Z6VA 1YT5A 5JAMA 4D8TA 5KWJA 1QIEA 3EGDB 3THOA 3F73A 3AL3A 1ZU4A 2WG0A 4ZTBA 1E3LA 2CMKA 2XKBA 5DHTA 4CQJA 3I8SA 4HNGA 3FMPB 4C4SA 3W5AA 2I54A 1FC0A 2AMYA 2C59A 1EFVB 1SB8A 2NXEA 1A8QA 4TYQA 5ESRA 2IEZA 4X8LA 3ZKWA 4OQEA 1B3BA 1HF3A 2QPOA 3G59A 3ONDA 3WB0A 2C2GA 2A0UA 2FUG6 4KTVE 1MR3F 4CFZA 2IRWA 1ENPA 2QX7A 1UBJS 1QMPA 2RG7A 3G9QA 3NI2A 1E9AA 2Z95A 4J0EA 4JDUA 1FFXA 1GUBA 2G1UA 4L5BA 2XF2A 4MAFA 1BS9A 4NY1A 3TS1A 1W4AA 3AESB 4TQUS 4P54A 4XX1A 3HU5A 4MARA 4L8WB 1L5OA 1NRJB 1QB7A 3JZIA 2M6RA 2QQEA 4PFQA 5KYGA 1DINA 2X19A 3PCRB 1NNSA 2IE0A 3GVHA 1AX9A 1Y4SA 4L4RA 3NV9A 2ATEA 3E9ZA 4XIJA 3T7KA 1I7SB 1KDVA 5KMGB 2Q1WA 1YTLA 4TMTA 1UP4A 1D2GA 1LA2A 2DFDA 2RHWA 3SQMA 2R7LA 1AQUA 4C43A 2EJUA 3GBVA 4M1ZA 4LHVA 2WNIA 4LJ5A 4MVJF 4PZ9A 4R1SA 4XYEA 2YQ4A 2OORC 1JQDA 4E88A 1RXIA 2C5LA 4NNPA 2ECKA 1UQUA 1AF7A 1YZYA 4FDLA 4FDUA 4A91A 1OB5A 2O8BA 1VBKA 4HAOA 3OQMA 3F2VA 3KO8A 4UHHA 3B51X 1NJ1A 5DX0A 1Y4UA 2QGFA 3B12A 3CZ4A 3KKMA 2E4VA 3MWFA 4I9UA 4PHCA 4G63A 2Q2WA 4MDYA 3ZW8A 1WV0A 1JSCA 5ES3A 1X1TA 4IRMA 3V80A 2O0LA 1FBTA 4E1BA 1O89A 1EQAA 1ECJA 4YT2A 2QPLA 4IHJB 2FR8C 1V1JA 1C0EA 4B81A 4D9BA 5EXTA 4RVUA 1HQYE 4M86A 2VBCA 1AOXA 5E2IA 4BZZA 1XZLA 1DWPA 2PGOA 4GSLA 3O82A 3IOMA 5CVTA 3IIKA 4B76A 1VCNA 1XQ1A 2RK4A 4EYSA 3PYMA 1BDJA 1CEQA 1GL6A 3ZV5A 5CB4B 3OCUA 1MQ8B 4R1UA 2C96A 2F3TA 4CR7A 2YRWA 3KZCA 4NZPA 2FWNA 3L6BA 2AJLI 4TTVA 4BYGA 2PEYA 4F72A 3RSQA 5TMDA 2W83A 4CQLA 3I6QA 1L7VC 4P58A 5FBZA 4U7DA 4CEHA 3L41A 2P5SA 3UCEA 1P2FA 2QL6A 2PX8A 1HUQA 5IBPA 3BZBA 3MLAA 4GWGA 4YVFA 5I7VA 3NX4A 5JNTA 3CRRA 4F4FA 2IIQA 3BMCA 3WNQA 4RZXA 3U61B 3RBVA 3S55A 2H5JA 3OC6A 3FFWA 3M9WA 1E1MA 4GL4A 3LLMA 2GPNA 4P31A 2ZPTX 4GDFA 1RQNA 3ANLA 5TGDA 5AKJA 1CERA 2P2SA 1CUUA 2PMCA 3QJGA 1UAAA 2RC6A 1UBUS 2MSEB 3KKOA 1NMXA 1A7JA 1Q57A 1ECGA 2F8TA 1KY3A 2A4KA 5BV2P 4OMFG 3HKCB 2B1QA 2WQ7A 3DKPA 4OQXA 3UHFA 5ED0A 1NVAA 3NM6B 2FE1A 1F51E 1Y9JA 4L9WA 2ID4A 1H2FA 4TTAA 1E2IA 4ARCA 1L4HA 5IABA 4YYZA 3GNTA 3FWPA 2P79A 4JODA 1QIGA 4GNRA 1S1MA 1GPUA 1XG5A 2O5VA 1QV7A 3FCAA 4BX3A 3EDQA 4DR4B 1N32B 1J70A 4MWZA 4MRAA 3EB9A 1EVYA 5E1OA 2VNKA 4Y0AA 4B4WA 2PMFA 1ESMA 1Z5UA 3BA6A 3QOXA 4V0NA 1UBLS 3EFEA 1PFWA 2JVKA 4GWLA 4D8WA 3O8RA 3H17A 1ETHA 2WLSA 2WTXA 3C8ZA 5KQMA 3ZGZA 3MT0A 1TA4A 2EP8A 3FGZA 4NYMQ 4QDZA 2NVUB 1FPQA 3AI2A 4B83A 1Q3KA 4UM9B 1QVVA 1ODFA 5IEJA 4AJ9A 3EC2A 3RU2A 1MRNA 1FUKA 4RDHA 3GFOA 5LU8A 2KMLA 2J33A 1GOTA 1Q1AA 2AXEA 2MSLA 1XZQA 4P36A 2GM4A 3R5KA 4D43A 2VAVA 5HYVA 3GG9A 5BXQC 1HG0A 2F43B 2JBWA 4DCVA 4DJAA 4X6LA 1GTJ1 1N1GA 4K9KA 4X3CA 1U80A 1NWCA 2LIPA 1Z62A 3A37A 1WG8A 2VWHA 1XCJA 3DD5A 4FFBB 1T9HA 4FDVA 1IEXA 4GEKA 1KGSA 4JQOA 4KH1A 5I7RA 1J2YA 3NBXX 5TEVA 1WCIB 2BCJQ 1D1TA 2DLDA 1D3AA 5LB2A 4RENA 2MHCA 5JD5A 1OI2A 3AEKA 3KCNA 1D4AA 5EUQB 4QVGA 1KQOA 1U5CA 2B7CA 2W42A 1BH2A 2YJ4A 3IMKA 3ASZA 1JHUA 3K2QA 2IP4A 5AW9A 3HDQA 4HB0A 5CDUA 4YUXA 4UOQA 2HA3A 4O63O 5BV7A 4OMUA 1TUEA 4X00A 1UUFA 2H4HA 4EZIA 2HSGA 1F8YA 2FK8A 1EJ2A 1R9GA 4RF3A 1JKXA 2LKCA 1UL1X 3M9LA 3MTEA 3OSZA 3LJKA 3MB5A 2RH9B 2EP5A 3SD7A 4QUJA 3V7NA 1OUMA 2OAP1 1Q1GA 2XXBA 3BDIA 2IUFA 1HORA 3ZK8A 5HRAA 1J0BA 4RF2A 4R8RA 2E6KA 1SBCA 1J09A 3CR3C 5J59A 1Z0UA 3A4YA 2Q3FA 4P35A 1HL3A 1Q1QA 2VYNA 3HBLA 2A58A 4P08A 4AWXA 1KAEA 1Z7EA 4P7FA 3VPHA 2IZOA 5JXJA 4PWZA 2QP3A 2WIFA 3JVEA 2BTOA 4NABA 2R7AA 3WK4A 4RMGA 1C81A 3ZDCA 2D5IA 4JR2A 3BWXA 3IUEA 4FOTA 1FP4A 1E3SA 4GMHA 3RWOA 4EFLA 3D5QA 3EXG1 4FW9A 3NJRA 4MRSA 4BLUA 2YOFA 3FBWA 1OAOC 3L0SA 5M34A 4G5QA 3BH0A 1L1QA 2VH5R 3QX7A 4B3DA 4NU8X 4CIYA 1NN1A 1P91A 1VHQA 2Q28A 4MV4A 2ZJ3A 4KX5A 4YRQA 4JYZA 3EWIA 2FQYA 4XEHA 5F4BA 4CM1A 3K0KA 1ZOLA 1UKZA 4HQFA 3VNAA 4BFUA 1YJAA 3EFOB 1FYXA 4LDPA 4L22A 4CIBA 1I5RA 2AKEA 4ZI2A 4JJGA 2HA2A 4DIMA 5CA0F 2NIPA 1GVNB 1HLGA 3AUTA 3EAQA 3RW9A 4RK7A 4WA7A 5LQJA 3KYJB 10MHA 3TOZA 4UBNA 4A73A 3LECA 4MXDA 2O4UX 3SQLA 2KM1A 1SCAA 5FI3A 4KNWA 4B6PA 4C89A 5CK4A 2XWQA 3L8ZA 2A1TS 3VPCA 4UD6A 1A8UA 4OBXA 4G0YA 4N5IX 2EQ5A 5TJHA 2QJWA 4NJMA 3A14A 2FZLA 4KO8A 1IN8A 3TPFA 5IMSA 3V8VA 5D8DA 4DEVA 1FMLA 5DHRA 1KJJA 3KEFA 4KJZA 2XAAA 4MV7A 3W0LB 3UMMA 3TOXA 2RHHA 4GBJA 4BKUA 3CRQA 4ITRC 4C6SA 1R6TA 3C5WP 4CTJA 2VBFA 5CB8A 1I13A 4UDYX 1E4YA 4FK8A 5EHZA 4BC1A 4HNTA 4UVDA 3CLTC 1IIRA 3FHCB 1RCUA 3WOVA 1WUHS 2IIPA 3UFBA 5AI6A 2HMVA 3R76A 3KQMA 3KT3A 1B2LA 4I66A 4JI2B 3GP3A 3QEKA 4WZAE 2NUPB 3Q7RA 1NT2A 4P4NA 1NW8A 5AJTA 2EZUA 4RPCA 1H69A 2PUCA 1Z37A 1YB6A 1DIGA 4MWGA 3QY9A 5BSHA 4XAQA 1JF8A 2EHDA 2I5PO 2JANA 2YN4A 4HFNA 4IKPA 5JSYA 3V9PA 3SQWA 3C7AA 3GCZA 4J9UE 1HNXB 4B09A 4TZ0A 4WT7A 4LWZA 3H5WA 4RANA 5J1TB 1JQAA 3AHGA 4XVHA 3OTOB 1SKUA 2B20A 2D5BA 2O2DA 3DHEA 3LZCA 4FSDA 4Q47A 1M6VB 2PKRA 1E9FA 3UPUA 3P9PA 5ITWA 2FPLA 2NVWA 2XGSA 2OB1A 4XD7D 2ODEA 3AERA 4I5FA 2VHEA 3W8DA 5JHGB 4ZCTA 4WK4B 3OFKA 1W96A 5AJHA 3OIFA 5I7WA 3ZHXA 4IX9A 4O2LA 4Y2XA 5HR5A 2MSCB 4YUVA 2CFCA 5BVGA 2J87A 4TV8F 1Z8NA 4KO3S 4B73A 5ALKA 1F8XA 4FLFA 2XWPA 2H52A 3KTFA 4HT3B 1N9ZA 2ZI7A 2OGUA 2C99A 2OP0A 2W8ZA 2C4TA 1US8A 3MW8A 1U9JA 4II2A 3CGWA 1HMPA 2FN9A 3ZJTA 1T4MA 1EQ2A 1AXEA 3QMWA 1JKJB 2PE5A 4BNJA 2DTEA 4K1XA 4TLLB 1JIJA 4JIGA 5CLGA 5IM4A 1GPH1 2WJIA 2XMBA 1NI4B 4KPUB 2Y1CA 3U3RA 3Q5DA 1LK7A 4DA6A 4WESB 3GLIA 3R7NA 4BFTA 1BW9B 3UH1A 5EXEA 2POCA 5A3QA 5TIIA 1P9OA 1RVDA 4V0KA 4EP1A 2PS9A 3E2IA 3T6KA 3U0VA 4EEZA 1CUFA 2J6HA 1N8NA 3WLEA 3A3NA 3OVMA 2B2CA 2MYNA 4IXTA 5DBGA 3TXXA 3X1DA 1A4XA 5K6TA 1QQTA 2X8AA 1IATA 3TPZA 3VISA 4UASA 1CF9A 3IA7A 1FB5A 1P7YA 1UZMA 2C4VA 1KMCA 2WYVA 3K5PA 2R97A 4IMRA 2D0IA 2Y6UA 4HVAA 3HN2A 4OAOA 4RD1A 3SNKA 1BWRA 2NTJA 2ZXEA 3QKRA 1VRWA 2PWZA 4OXXA 1YDMA 4YCAA 3F90A 3IXMA 1NVBA 4KV9A 4RTLA 1I4WA 2ISQA 3NBYC 3C3JA 4IINA 2QN8A 1C9JA 2VQ6A 4MUGA 2C92A 4F5DA 2IIVA 5LVAA 1IXSB 1E3JA 2I66A 4Q01A 1Q0HA 3TLGA 2X1VA 4WBXC 2FSGA 3EVBA 3U4MA 1ZOSA 3AMVA 4IHKA 3X3HA 4X6XA 1SU6A 4LDAA 1MEJA 1BVUA 1N8KA 3HB0A 1NJ5A 3VPGA 4BB6A 2CKMA 3EXHC 2PL1A 3L4JA 3RU7A 3QVMA 1H4SA 3NTQA 4AO6A 3DZ8A 1MENA 2WFLB 4ZRDA 5YASA 1GTRA 5B6JA 5GINE 1R0XA 3KLNA 4CYMA 4DMFA 4BMZA 4YT4A 2G0NA 2NUAA 4GGMX 4RF4A 1VJCA 2EU8A 4NYJQ 2Q46A 3UG7A 5CX1B 2RHBA 2DBVO 1P1RA 3LUBA 2C7VA 1NMSA 2P27A 3RANA 4BCBA 4XRGA 3QBVA 2O59A 3DZIA 2JKVA 2JI7A 1U2TA 1G7CA 4E5YA 2TMKA 4CG2A 3AJAA 3IS3A 4P93A 1FX0B 3PLAE 4EYGA 3QWIA 3DFIA 2V7TA 3DE3X 4HDRB 1PYOA 1PGOA 2O1EA 1ABEA 4K9SA 5I9LA 1C80A 1R10A 1XD2A 4A8TA 4JLNA 3GDHA 4WLOA 4Z7JA 5IDWA 4XRRA 1IQPA 2HU2A 3MSCA 4WQMA 3IBYA 4FR0A 2RI0A 1MOPA 1DRVA 2V74B 1Q0UA 3ZHOA 3G7UA 3NORA 4EI9A 1WE2A 3ORYA 1N8TA 4EHDA 2C29D 4PG4A 1RKVA 1TO6A 3SHOA 2SCUA 1WB9A 1TPYA 3UMCA 4IGAA 2QX8A 1NV9A 1QJCA 1XDUA 4LJRA 1CUEA 4A10A 1RI4A 3E4CA 1NKSA 1N6HA 2RCYA 3UOGA 1DAIA 3UJBA 1HDGO 1JEAA 4EG8A 3E1KA 3QK7A 1PUIA 2AFHA 4LI3X 5DYNA 5ICGA 1AKTA 1QDLB 2HBRA 3Q5EA 2QTRA 4GHWA 1PWEA 1IY0A 5G02A 4BQNA 1WZ2A 3DO8A 4X64B 4RJJA 1Y9ZA 2YJNA 1PEYA 3L0IB 1JXAA 2FQQA 3QELA 1ZN8A 3LHFA 5BSMA 3VM6A 1CEYA 7MHTA 3O4JA 1PU2A 5JPIA 1V5GA 3G2PA 5DDIP 3AUJB 3T06B 1GQSA 1FSZA 1VLJA 1WVGA 3A6EA 5JLJA 4NBSA 1CQPA 1WOYA 3NWOA 1E5LA 4FE7A 4G0PA 4LRTB 4XOIA 4D41A 4EMUA 1OJLA 3L1VA 1XJ5A 2F2TA 1DRWA 1HE4A 1QQAA 5FA5A 4C7KA 1HTWA 2EWWA 3AVOA 2DC1A 2HJHA 4G23A 4PX5A 1H9CA 2I03A 2WFZA 4HAYA 2W7TA 4ROTA 5EFOA 5EWMA 4BNWA 1QRUA 4I5DA 4DIKA 1XU9A 2ZRKA 2GM3A 5ESXA 1LQ2A 3EXIB 4G5GA 5KWSA 1EBBA 2UYQA 4Y7DA 1F6DA 2CC2A 1UPTA 3UFXA 5JVDF 2ZYTX 1P61B 1R0KA 2BFDA 3CEAA 4MULA 5B64A 1IEVA 2AFIE 3GJQA 3KYDA 3GPBA 2BEUA 4QJIA 4QLBA 4OM8A 4B45A 1X1QA 2I34A 1MDBA 2QY6A 2HCJB 3K6KA 5EUBA 1WSWA 2F8LA 2IH5A 3RAJA 1U6IA 3E9NA 1A8PA 3H18A 2WMDA 3ZKWB 1G21E 4TT3A 3DLIA 3HWRA 4OQMA 5IEBA 3S5UA 3T1VA 3T5TA 3IJ5A 2ZU6A 5BWCA 1V1RA 4HV4A 4YJFA 3QLJA 1H2BA 1X7GA 1EGQA 4MQLA 5CYFA 5JHHB 5LNK1 2PZKA 1FFXB 5F51A 3DLTA 3OO1A 4EB6B 3W5BA 4Y9RA 1SO8A 3N74A 4OFZA 2HKIA 1EUQA 4J0FA 4R1MA 1UBSB 2XIJA 4OSPA 4L15A 1P8AA 1VKJA 2XUPA 4GBMA 4U2EA 4LFAB 2CHFA 1RFGE 3MOIA 2JZNA 2OILA 2YRFA 3D2AA 4OYLA 4MI9A 5CM8B 1PW7A 4BO6A 1UPUA 3L5OA 1LJ8A 2EYQA 5BYKA 2HAEA 5J2TF 3FOFC 1F7UA 4JIMA 1N5LA 1NFRA 1ZK4A 1V3UA 2PLRA 3L0DA 5AJXA 4CKEA 3CUSA 2OA0A 3HBNA 1W0JA 3GUUA 3I12A 3RS8A 3V6MA 1EK5A 4XM1A 4AO8A 1ZCAA 3U9LA 4MUAA 5A71A 3B1ZA 3PEUA 4BO5A 4B3JA 3JVUA 4C0JA 1UC8A 1FFAA 3OEWA 2NGRA 5IC4A 4I99A 3UNXA 2IH4A 2FRXA 1Z0ZA 2SECE 3HKBB 4S1OA 3VYRB 3OQ6A 2CD7A 2Q99A 4O4JA 5TQ0B 2O8BB 2K2WA 2A5DA 2HV9A 2WICA 1J9EA 4K6OA 3G2MA 4LWPA 5IVPA 1JHOA 2HY7A 5F2OA 1F4VA 3BGWA 4XWOA 3AM4A 1L1FA 1EXDA 3EIUA 4ACBA 5JS7A 4OLBA 1AHHA 4TL7A 4QRDA 2N3ZA 3I2YX 4X1YA 1Z4OA 1FTQA 2QUKA 5BWLA 1U11A 2CXSA 1MPTA 3TJZA 4EW2A 2UZ4A 3HUUA 5ALUA 5AVKA 1DG9A 4ENVA 4MYRA 3SF8A 1B6TA 4O2BA 2LD4A 3DONA 1BFDA 1PVOA 2I4MA 4ERXA 3VBCA 3PFGA 3IESA 3ZCVA 4LXUA 1IY8A 1LF5A 3JQRA 3KSZO 3N8GA 4FNGA 2H1WA 1JVNA 2YHUA 2P6OA 4FJ0A 1YVPA 1XNHA 3FDXA 1VRCA 2PGJA 3DHVA 4Q7EA 1LC3A 3NKLA 2WHR