4RDCA

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with proline.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
total genus 135
structure length 364
sequence length 364
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rdcA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rdcA01
1MB0A 4HNSA 3F73A 2JB9A 5BQ3A 1TMYA 2WMYA 3H5TA 3JY6A 3OO0A 3A0UA 4MQFA 3NNNA 1Z13A 2JCGA 1BVHA 2JBAB 5ED4A 1PNTA 1QO0A 4H3HB 4IILA 4DN6A 3K9CA 4NQRA 3RVRA 3CU5A 5HKOA 4EY3A 1ZAYA 3F6PA 3FFXA 2E4XA 4UHJA 1L5ZA 2MSKA 1SD5A 4MS3B 3OQMA 1BAPA 1NXTA 4QYWA 3Q7SA 2OQRA 1D1QA 4RS3A 4HYEA 3QLVA 3DBIA 2X7XA 4HNRA 4Z4IA 2MYNA 3A3KA 4YGXB 2YHAA 4KFCA 3F6CA 3CHYA 5TQ2A 5JS2A 3LUHA 5TPWA 2PUDA 4YLEA 3KHTA 5T3YA 4NCAA 2J48A 2FQWA 4OTZA 2F8SA 2WJAA 1DBPA 1YIOA 3G1WA 4D6YA 4YWHA 4MS4B 5DTEA 4EUKA 4N76A 2E4ZA 1GUBA 4JOQA 3N0WA 5D2CA 3FMVA 4PZ0A 5ABPA 2QXYA 3IP5A 1Z17A 2R4QA 3CZCA 4MR7A 3OLYA 1KRXA 3TX6A 4RXTA 3ROFA 4PICA 3HCWA 4YV7A 3HUTA 4FB4A 2B1JA 2FLWA 3LKBA 4RY0A 3I42A 4ZYLA 3O1JC 2GKGA 2FEKA 3JPWA 3HK2A 3H75A 1LJLA 1ZITA 2ZWMA 5EWLB 3LTEA 5JNSA 2YHBA 5IBQA 4XFKA 5JNUA 1A2OA 1FQWA 4N0PA 3GL9A 2HQOA 4N41A 1JHZA 4JAVC 5KC8A 1ZDMA 1DP4A 3C3KA 4P1ZA 4WT7A 3VNBA 4F3TA 3FFTA 4XAQA 1A0OA 3QX9A 3Q7RA 1ZY2A 2O20A 2QVCA 3CTPA 4RY9A 4OBBA 4CBVA 5CNKA 2RGYA 2V0NA 5CHYA 3CNBA 3H5IA 1S8NA 3N75A 3I09A 3GRCA 5C5EA 1FFWA 4MQFB 5JS1A 4KK4A 1NTRA 3TB6A 3HM9A 2IYNA 1EWKA 2TMYA 4RXMA 2FVYA 1QP4A 1WETA 3QLUA 3TO5A 4JA2A 3QLTA 1JYFA 1U8TA 3KYIB 5HM6A 2VK2A 1LJUA 2FLKA 1U2QA 3HZHA 2E4YA 3MA0A 5KWSA 1ISSA 1KGSA 4FE4A 3MF4A 4MQEB 1QP7A 2FKAA 3QLUC 5E3JA 3T95A 1QKKA 1EWTA 1RPJA 4RKRA 3SY8A 3OO1A 1APBA 1XHFA 3OM1A 2N9UA 5EWMA 5TQ2B 2IOYA 2NZUG 4W5QA 1JH9A 3TMYA 4KK3A 5BRAA 3NNSA 4MLDA 5TPWB 2OENG 4M88A 1NXWA 3N53A 4MAAA 2JVJA 4G0OA 1C0EA 1EWVA 2FW0A 4P98A 2FEWB 1D4ZA 1JF8A 3H1FA 1VKRA 1JFTA 2A9PA 4RXUA 3EODA 1XWWA 4NCBA 5DCLA 4RV5A 2LIVA 3LUFA 1USIA 3MMNA 2L2QA 5IUKC 3HUUA 4KNYA 3BILA 1SXHA 4MR7B 2A9QA 1W9HA 3KG2A 4ZPJA 3Q15C 4Q6BA 1YTUA 3R0JA 1BA2A 1MVOA 2LPMA 3EDCA 1ABFA 3IP6A 4PYRA 3OLXA 3EJWA 4ZMRA 3OMWA 1YMUA 3Q41A 1ZGGA 4LX8A 3UUGA 4ML3A 2PUGA 1EHCA 2HQRA 5JNVA 3KLOA 4F8JA 4YO7A 4NV3A 2IPMA 2JK1A 4EGSA 3O2JA 3GYBA 3O21A 3FDFA 4D74A 3IPCA 3JVIA 5I4CA 2IPAB 1ZHHA 1YVUA 4MR9A 5IULC 3HXMA 2QV0A 1DCFA 3NHZA 3GA5A 1DCKA 2LBPA 4EYKA 3E61A 5JNWA 4UHKA 4OG2A 2FQYA 3N8IA 4G86A 4WWHA 1JX6A 1U0SY 2GI4A 1DRJA 2KYRA 2CHFA 4KVFA 4RK1A 3O74A 4EYQA 1JDPA 4N03A 3W9SA 4KPYA 1DCMA 1QO0D 4YRZA 4B09A 4F11A 3QLVC 3ILHA 3LUKA 1DG9A 1R8JA 2PAFA 3QELA 3CG0A 4EYGA 2FMKA 2WY2D 2L19A 2ID7A 3QEMA 4MS1A 4DADA 1CEYA 1QQAA 1TVMA 3GT7A 3LOPA 3IP9A 2E4WA 1PEAA 3IPAA 3SM9A 4LE1A 2WRZA 2FMHA 4JP1A 4G0MA 4MGEA 4N47A 3T38A 1YS7A 4TLLB 5B3JA 1CHNA 1TJYA 3SG0A 3DGEC 2RDMA 3O2QB 3RVNA 3D02A 3LUGA 1W25A 1Y1LA 3OM0A 5FBHA 4Z4HA 5BR1A 1Z16A 2GX6A 2MSLA 3EQ2A 2NUBA 4G0ZA 1FSPA 5IC5A 5FWXA 5EWJA 5FWYA 1YK1A 3OMXA 2P4UA 1Z25A 2PL9A 1NXXA 3Q9SA 4N0QA 1EFAA 4KRFA 3NNDA 1YK0A 2H3HA 2L17A 2MSWA 3KS9A 3O1HB 4OATA 2RJNA 4E7OA 3LKVA 2CHEA 1MIHA 5DKFA 1TM2A 2IKSA 1A04A 3CKMA 3RVPA 4Z4GA 3C97A 5KQPA 3MM4A 1MAVA 3D8UA 1NXSA 5T7BA 1U04A 1M5UA 1RZRA 1Z12A 1CYEA 3IDOA 3FGZA 4XXHA 3KJXA 5TQ0A 5KQGA 3GWGA 4MR9B 4JB0A 4O5AA 4YCSA 4Z4FA 3HVRA 3O1IC 4QICA 1USGA 3RVSA 5F64A 4Z9BA 4F06A 4EVRA 6CHYA 1ZVVA 3HJFA 5FBKA 3N6VA 3I5AA 3C3MA 5DGCA 3RQIA 4RKQA 3JPYA 2JRLA 2BGGA 2QR3A 1Z2EA 1GLGA 4S04A 2CD7A 8ABPA 5CNMA 3DGFC 4Y9TA 1IIBA 1RXEA 3OQOA 2M1ZA 3ILYA 1PUXA 4H60A 1DC8A 2FSPA 2NT3A 3QELB 7ABPA 4W5NA 4KREA 4ZMSA 1F51E 1DBQA 1JLKA 1JYEA 4D6XA 3UK0A 4WXEA 3TD9A 1FFSA 2IDMA 3MYYA 3DLBA 1XHEA 5HQJA 2GWRA 1M2FA 2ID9A 4LDZA 4ZJPA 1AB5A 5IUNC 1FFGA 2DRIA 3MIZA 3H6GA 1NY5A 1PEYA 2QW1A 5EWJB 4MYRA 3KLNA 3A0RB 2VUIB 4L85A 5PNTA 1DJMA 2H0AA 4PEVA 3SAJA 2QSJA 5KI6A 3KSMA 5IUJC 1KRWA 4EYOA 3LUAA 3OLVA 5TPZA 1YS6A 2FN8A 1P8AA 4KZKA 2R25B 4EVQA 3RVOA 3C6QA 5KC9A 2VUHB 1PHRA 3T8YA 4RK6A 2Q5CA 2WB4A 2QVGA 1KMIY 3QEKA 3LUCA 1VRVA 2FEPA 3DLHA 4MRMA 4MLCA 3MQ4A 1K66A 4RWEA 4RY8A 1QPZA 1C4WA 1VLZA 3P9YA 1UDRA 4LDAA 2PUEA 1SRRA 1EAYA 3M6MD 2HJ9A 4E7PA 1USKA 4RK7A 2NT4A 4EVSA 4Q7EA 1E6LA 2AYXA 3KTOA 4W5OA 3N0RA 2E4VA 1NXVA 2FTKE 1JFSA 1GUDA 4IF4A 4ETIA 3FFWA 4JASB 3HDVA 1DC7A 4DQDA 1QNLA 1JBEA 2E4UA 1J56A 3L49A 4FE7A 4JB2A 1QQBA 3KYJB 1DZ3A 5GOTA 5EWMB 4W5RA 2LUOA 3LUDA 1H9CA 4MQEA 2PJUA 1E6KA 1JL3A 5TE9A 3CZ5A 1M5TA 3F7NA 3JVDA 1RXIA 4Z0NA 4G0YA 3H5LA 3SNKA 1D5WA 1F4VA 4IMIB 4H3KB 2PUCA 1SXIA 1DRKA 4RSMA 5JNRA 1VPWA 3M9XA 5B3JC 4L4UA 5IEJA 1Z18A 2W42A 2IPLA 1BDHA 4XARA 2PUBA 2FN9A 4G0QA 5HSGA 5JNTA 1ABEA 4O1HA 3IP7A 4G0XA 4OLBA 5IEBA 1LK0A 2R48A 1QMPA 2QU7A 3RVKA 3QK7A 1D1PA 2HQBA 4LE2A 2MYTA 3RH0A 4RK4A 1GCGA 1Z15A 3JTEA 1Z2DA 1JWLA 3CG4A 1MB3A 4TMYA 2QZJA 2FQXA 2IPNA 1YMVA 1Z26A 2GBPA 3GBPA 1LBHA 2RJOA 3N0XA 4RK0A 1HEYA 1TLFA 1E6MA 3UKJA 3CS3A 2PUAA 3T6KA 2I6FA 3RVMA 4Z4EA 3SQNA 3C3WA 4GNRA 3ROTA 3EAFA 3VNAA 4ETMA 3H1EA 3GBVA 1ZH4A 4NICA 3EQZA 4LZLA 2B4AA 4MR8A 4MRMB 4Q6WA 1B00A 3H1GA 3EGCA 4O1IA 3E3MA 4TLMB 3QX8A 3LMKA 1URPA 2MYUA 4MPTA 2P9HA 1GCAA 1ZN2A 1JDNA 1M2EA 2PKXA 2FXIA 2JBAA 4XASA 1AB6A 2PMCA 3HDGA 2WWVD 1RZRD 3CLKA 4LRQA 4WZZA 4OLAA 1K68A 3M9WA 1U2PA 1T34A 3CRNA 3JS5A 4KQ9A 2A9OA 4YS6A 4PE5B 4TN5A 4MS3A 1I3CA 3HS3A 4QPJC 3G85A 2PL1A 5CNIA 4IMJB 1PNRA 1BDJA 3B2NA 3RVJA 3O2SB 1ZH2A 4IGAA 4RK5A 1LBIA 2LP4Y 4Z99A 1OXBB 1OXKB 1L5YA 3QEMB 3CFYA 4MS1B 1DBWA 2FMIA 2CWDA 3DZDA 3LFTA 3RVLA 4IRXA 4RU1A 3HEBA 2HPHA 3O75A 2JVIA 3H5WA 4KQCA 5KQMA 3S99A 4WXMA 4KMRA 2MYPA 3HV2A 2XDYA 2NZVG 2L18A 3A10A 2PLNA 2PE5A 1NXPA 3H5OA 4MS4A 4QYMA 4Z9AA 4ETNA 2F8TA 3K4HA 3NBMA 1JFVA 5FWXB 5FWYB 4YP9A 5GQSA 4XLTA 4W5TA 1ISRA 3HSYA 1E2BA 4GPAA 6ABPA 3KCNA 4YR7A 3BRQA 5DLEA 3Q7TA 2FMFA 2HSGA 1D2AA 3I45A 2AYZA 1BDIA 3HO1A 4G0PA 2R47A 1NATA 4KV7A 4RZSA 3URMA 1NXOA 4G97A 3EULA 5BRJA 5IX8A 1ZGZA 1RNLA 9ABPA 1QP0A 2M98A 3OLZA 3H6HA 3OLWA 1ZESA 2A9RA 4LE0A 3GV0A 5EWLA 5KQLA 2PUFA 2JVKA 3KKEA 4HNQA 3BBLA 4RDCA 2WJWA 1P2FA 3BREA 2ZAYA 3RVQA 4F12A 5TPZD 4Z4CA 3OQNA 3NHMA 3LUJA 5TQJA 3L6UA 3H5VA 1P6UA 4S05A 1SXGA 4WUTA 5C5CA 5TQ0B 4MR8B 5CNJA 2VYCA 3BRSA 1P6QA
chains in the Genus database with same CATH superfamily
2XGSA 4QOJA 3P9NA 3N0TA 2GBGA 2B6NA 1TMYA 5L3RA 2I7TA 4E22A 3STUA 1WB5A 1EEHA 2OAP1 1W88A 3JQBC 3R5FA 2CV2A 2JBAB 3BGWA 1PNTA 3PNLA 2FZGA 3C4JA 1HMPA 4I1YA 3R77A 3L1VA 4N0DA 4NQRA 3RVRA 1CK4A 4HWTA 4UE2A 1EA7A 3FFXA 4BVFA 2ZRGA 3OEWA 4PC7A 3UY4A 1OFUX 3IPXA 3R7AA 4KODA 1HQKA 4ZT7A 5FLXA 2P8SA 3U3ZA 5FADA 5B58C 2GCGA 2C5SA 3TVTA 3FGNA 2PGDA 3L4BC 4V0MA 1NVGA 4H0NA 4M76B 5AUQA 3SF0A 5JS2A 1V11B 2XX3A 3DQPA 3GT4A 1SCJA 3O9VA 4CEIA 2FVXA 2J0SA 1Q1BA 3PDHA 4UULA 5CK5A 5HFNA 4KWCA 2FPGA 2WF5A 2J48A 5AVUA 4IMRA 1WMBA 4EA8A 4OQDA 2TRSB 1ZJZA 3ADCA 3DTNA 1N78A 1W5BA 4YWHA 4GP6A 2VRCA 3BX1A 2FEAA 1AXGA 3TECE 1T2CA 2NMVA 4IHQA 5C1IA 4ZO4A 5ICFA 4AYTA 5HE8A 2V59A 1KJNA 2PPVA 1IN5A 1G5RA 3CF2A 2PZJA 2XUQA 5J1TB 4E09A 2H0QA 1YQTA 4XWAA 3DXXA 4DWOA 1CU1A 1NGSA 1YRWA 3N2KB 2R4TA 3VAAA 3WR5A 2VNAA 1HE3A 4IDAA 2YWBA 3PRKE 1SUDA 3DDUA 1SKYB 1EFUA 4HPXB 2WTUA 3U4MA 1KY2A 2FJ0A 2ETXA 2W37A 3DYVA 2X8JB 1ZD5A 2HHLA 4GX1A 5IMBA 1ORVA 4BNXA 5AOBA 3U09A 3CH6A 2NSLA 1N36B 5K8JB 1E3JA 4FT4A 2JCYA 1GIAA 4OLJA 4V03A 4HAWA 5I8ZA 2AD5A 5J4VA 1DP4A 3FPJA 4QTXA 3PIDA 1EJ0A 2D5CA 3ENWA 5B53A 2YKGA 3UJ6A 1FRFS 2Q5IA 3L02A 1OXSC 3CTPA 4I81A 4BZQA 3GGDA 5FV7A 4D8UA 5FUMA 4EJMA 5EN4A 3KBBA 1PNQA 1Z5NA 2C7OA 3JYOA 4EVIA 1SIOA 1T4MA 4FPXA 3JWEA 3BB3A 5GGYA 2HEIA 3GLHA 1KIFA 5JAQA 2ZLBA 3PQ5A 4UU8A 3R7WB 4F4FA 1MPXA 3TO5A 4ZI3A 5JY6A 4CF5A 4D9NA 1U8YA 1UK8A 4N5MA 4IGIA 2WP0A 3DZCA 2V3WA 2HOQA 3A4MA 1LPAB 2C2BA 4ER3A 4BNWA 3E4DA 4QBTA 4ZIRB 1I14A 2OUIA 3GZJA 1EBFA 3AHDA 3MXTA 3MOSA 2WYIA 1W5SA 5KTSA 2P3LA 5ALQA 2F48A 4MV1A 4N5NA 4GGPA 4YDSA 3RV4A 2XTZA 2HU2A 4XQ0A 5BRAA 1LPMA 4K6CA 4F84A 1K8ZB 4XYEA 1R3DA 1ZOOA 3CLTC 3DBHB 5HOEA 3UNXA 2HREA 3PITA 2BGNA 2ZJ8A 1FX0A 4NECA 4TQGA 2H1HA 3C5VA 1DU4A 2J3MA 2VUTA 3HY4A 1OHHA 3N07A 1DFIA 2B25A 3PQEA 2D0IA 1VKRA 3VV3A 5CW1A 2PIDA 3TNLA 4Q4CA 3NHYA 4U7HA 5I8PA 4HJRA 1G2PA 1I94B 2EFGA 3WAKA 5AW9A 5JROA 4L5JA 4MJXA 2P2NA 3WFIA 2PRKA 2VWGA 2HT1A 1XCBA 2B37A 3QU9A 4WLFA 4B9EA 5BN3B 1J2UA 1J2JA 4MR7B 4PPYA 4MVXA 4S1VA 3HL0A 3D4NA 4G1FA 2A1TS 1P3DA 2EX1A 4HNAA 4R2WA 1MO2A 1X15A 3Q7QA 4M7RA 1RTKA 3I12A 3R0JA 3L8CA 3R3XA 4JIMA 4PYRA 5CURA 4BGUA 3DFMA 3JWJA 2X0DA 1I9CA 4R54A 5E8RA 2FX3A 2YMMA 1JDVA 2O4CA 3AIMA 5ALMA 3QWHA 3D5QA 3L18A 5H80A 3UWDA 4GKAA 1VIVA 4LZNA 5LMUB 1FS4A 4RDIA 1HMYA 3CA8A 1JIKA 2HJSA 3O2JA 2ERXA 1I3KA 3TDNA 1B23P 4JU8A 4QEDA 1PQUA 5AKYA 3CW2A 4HF7A 4WOJA 4XGRA 1SVNA 1Z4OA 1XVIA 1JLSA 1N25A 2HXYA 4LYDA 1GG2A 1RYBA 2FDRA 3BH7A 4Q4AA 5P8WA 4GYKA 3ZH2A 1A1VA 2WTAA 4IZIA 4PBTA 3WK9A 5B2EA 4BS9A 1IQ0A 2FZ4A 4Z7JA 2ODPA 1N6KA 2X2EA 1PGJA 3BD8A 1ZP6A 2J32A 5BRNA 1YTLA 2EP8A 1VJCA 4XRRA 3AHCA 1EUZA 2VEDA 3TIXB 2JJMA 4WJLA 1X94A 2GTIA 3BWBA 3TJMA 3D1JA 4MOWA 2R68A 3LLVA 4INOA 1XLUA 1SQFA 2FWMX 3LXUX 1VBNA 4BNMA 3W5BA 1W1UA 1X1BA 4X84A 5DHFA 4EX7A 2RIRA 4B3HA 5GOZA 2QUJA 1J7JA 2C88A 4M7WA 1W0JA 1IQUA 4JDPA 4ND7A 3RSLA 2A4KA 3TXXA 1Q20A 4RHFA 3KLMX 2FN4A 4PSKA 1CHDA 4XGQA 2ZRFA 2CLEB 3THOA 4FK8A 1Q95A 2PUHA 1JA9A 1QH1A 1XV5A 2XYGA 4A0RA 1W581 3CNHA 4G24A 2FG6C 3L4SO 3F5SA 3I0MA 2RDMA 4FSHA 2J0VA 4X6UA 4CF7A 1CUVA 2XZTA 1Y6QA 2RMKA 3Q4GA 4I9HA 4Q93A 2QBYB 1YIDA 1K8YB 2BEUA 2CB9A 3IEXA 4DW8A 4K05A 2BP7B 4KH0A 2GFHA 4R1TA 1X2EA 3VR4A 1RXVA 5ALPA 1PIWA 4D8VA 3K9GA 3NOVA 4G4JA 4XB2A 5EL0A 1M0EA 3X3HA 1QANA 4BFUA 3K9FC 4HVTA 1EK2A 5C8ZA 2QUHA 1XF9A 1NJ2A 1RWWA 4FGKA 4NHEA 4X7MA 3ZZ0A 4GVXA 1YK0A 2ZI5A 3T7AA 2AE2A 1P2DA 2OM2A 3UPTA 5EIOA 3QBEA 4EPVA 1R6DA 1CWUA 1CPYA 1VCHA 1G7TA 1ECJA 1XF1A 3BFJA 1O96B 1KYZA 4UD6A 5HMLA 1A8SA 2ZRHA 3CKMA 2P6PA 3E5MA 3C0KA 4X44A 4Y3UA 4ZXFA 2JLWA 2QF7A 4KQ6A 2UZ1A 3MYRA 4EI2A 4M6WA 1XTVA 3KUUA 4G89A 5ALKA 5ED0A 4QTUB 3C1TA 4H1UA 4OO3A 2X58A 2GF0A 1GSOA 3VSAA 3I61A 2AC2A 4FJ1A 2JLXA 2E85A 5EGSA 3TTTA 4EZEA 1X3SA 3MJSA 2J4FA 2IBTA 2V7WA 3VU3A 1AZTA 4C2AA 2VQFB 2OT3B 1W5TA 3SN6A 4YRCA 1U98A 4K03A 3GCZA 1USGA 4PYQA 5AD1A 2C3UA 1RPZA 1BRTA 1BJRE 1TYBE 4BY9E 5EUBA 3HJFA 4ZFNA 4TXLA 4TKLA 4QYIA 1NBEA 4ZQCB 1AV6A 3H9BA 1NMSA 3NIGB 4O4LF 3P2YA 1E2LA 3C3DA 3IVAA 3R5SA 5G2OA 1VJDA 2I65A 3FKQA 5EJ6A 4R84A 4KR7A 3I9V6 4HGQA 1NVVQ 2Q21A 4I9NA 3RRJA 4M8IA 5I7FA 3UJNA 2EF0A 3WL6A 1TM3E 1AM4D 1X42A 2PXCA 3G79A 5JPCA 3CLUC 1PDVA 3DZKA 3EWAA 4CMHA 3DOFA 4ZMSA 2CHQA 2HWWA 2HF7A 2QD4A 2NUTB 3LV8A 2XGGA 4B6SA 4UTRA 2R84A 3LPDA 3FWKA 3VVBA 1DAGA 1G9XA 4PHFA 4CLHA 2ZWIA 3ESCA 3Q3JB 4YP0A 2AI2A 4CR8A 4WXEA 2EX0A 2ZZMA 4DIDA 3ANYB 1B74A 1DQPA 3DB1A 1WUHS 4YAUA 3MD9A 3PNOA 3OPYB 1XZIA 3QU5A 4R8VA 5JBNA 2GHTA 1U7ZA 3BA1A 4ZREA 3TKAA 2XB2A 2EZ4A 3P52A 1LLDA 1LLUA 2YUIA 3LOUA 2P4QA 2PGIA 3N0VA 3PC8A 2QW1A 4FTWA 4NYIR 4QFDA 4PLHA 2IF2A 4OYYA 3WSWA 4ZV9A 1EFVB 3K2EA 3N2IA 4L4YA 7YASA 1DJMA 3PGA1 4BNFA 3ZCPA 3JZMA 3FUUA 3GEPA 1NVFA 3KSMA 4F5YA 4F56A 1D07A 1VTKA 2XZDA 4UCFA 5J2UA 2JLUA 2OZKA 4ACAA 1BXZA 3NLLA 1K6XA 1QHFA 1P3JA 3JU3A 4B43A 1H5NA 2AW3A 2EFJA 1K5GA 2O7QA 3TL2A 2YFYA 1G0OA 2CJFA 4UMVA 3WRYA 1YOBA 4FZ3A 4B71A 2ZPUA 4WI1A 2XCOA 5C8YF 1OWMA 4UE6A 4AT1A 2X0RA 1EFRD 1Q15A 4PG7A 4IDNA 2Q28A 4IKEA 3D5EA 3S8MA 4COKA 3OIYA 3R44A 1DE0A 1QPZA 3CVWA 3KJZA 1HXHA 4RC9A 3BZUA 4LNUB 3NHUA 1NBIA 2CNDA 1M7HA 1Q1ZA 1L3BA 3OIUA 2PRIA 4RZHA 3PUKA 4Q7KA 1BS2A 2QN1A 2MR5A 1QWSA 2C9CA 4BMDA 2WHQA 4GC5A 3FI9A 1MNAA 4LKRA 1J5XA 3CWQA 2LWIA 3A26A 2ZSIA 3HDVA 3CUEF 4YHBA 7MDHA 5C9ZA 1NVTA 4HG2A 1MEJA 3P4XA 4CKCB 2FUG6 1ZUWA 5J47A 4O4HF 2RGGA 4BNZA 4G26A 1DZ3A 1L6IA 4GNKA 2YV4A 2V65A 4G25A 4ZV4A 2ONKA 4U7FA 1Z4QA 2WD7A 4PYIA 1CY7A 1RQXA 2ODQA 2WZDA 1VSBA 4CCYA 4DZZA 3QVUA 5EKTA 3TL6A 3TPCA 1TKBA 3IO5A 4DS3A 1E3IA 2AF3C 2RHHA 3RWBA 2Q2OA 2PM8A 1L3IA 4UCXA 4DJDC 4YCBA 3GH3A 2Z6AA 3DC7A 2FWRA 1E2HA 1N5MA 3LK6A 3R23A 4YH1A 4YV0A 3UAOA 4AY6A 3QX7A 1HQDA 5SICE 4MYDA 1E2JA 4MIKA 3RK1A 2XEXA 2EFHB 3EDOA 3ZHXA 4EB6B 3RFFA 3OWOA 5TC4A 2EKPA 3IP7A 4KQIA 3BF7A 1VL5A 3OZ7A 4HDMA 5JZVA 3I34X 2LE0A 2KB0A 2PS3A 4MYCA 1QF6A 3MJ4A 3R8XA 5BR8B 4G4SO 4DCMA 3SSOA 1P1FA 5JXJA 1ECGA 2BLLA 5DSTA 3VBCA 5BSFA 3JTEA 2J9RA 5LQCA 3A4NA 2VHUA 3FYSA 4TMYA 2I78A 3DF9A 2AJCA 1X39A 4FFOA 5CDHA 2V3VA 1T1GA 4TMWA 1P75A 3TGPA 4C0HA 16PKA 2WI8A 3UC9A 3K16A 5IKPA 3JQAD 4W6ZA 5K3EA 3ZWCA 2O3SA 1YKSA 3ROMA 1DIOB 4GZLA 3H1EA 3TAXA 2BCGY 3M49A 1YUMA 1RYDA 1GYQA 1Y1PA 3GBVA 3IKVA 3SC4A 1JIJA 4RTKA 1OIVA 1SBCA 1T1RA 2C4NA 3AUFA 1I7NA 1E9FA 2P35A 3D3NA 3GJQA 3OCXA 4NJMB 4MVJP 5EXSA 1XKLA 2FRVA 3E3MA 4TTAA 3RU7A 3TEJA 3CVJA 1P9LA 1N6OA 4MPTA 3RYIB 5D8DA 1JBKA 3W78A 1RFGE 4XIJA 1UANA 1WXHA 1JDJA 1OXTA 1NVMB 2PKXA 2Q1TA 1VQ1A 3DT9A 3DOUA 1Z8HA 4KXUA 4V1CB 1E3WA 1MB9A 1ZONA 4HY3A 4I3FA 4H9GA 4DR2B 1T2DA 2Z9CA 4OHFA 5F7OA 5IJWA 4HDKA 4DXHA 5K8TA 2BGRA 2EAUA 1K7SN 3JS5A 3QU2A 4H18A 4YS6A 1PJQA 2QN8A 4LYYA 3DEJA 3NXKA 1EDOA 3W2TA 5C2JB 4GOXA 1HT1E 1QLHA 2EW8A 2DECA 2XRFA 1P4SA 4YJFA 5AJXA 4RK5A 4OJMX 4UVEA 4JUBA 1QU2A 2FETA 2QN3A 2I4MA 2JFBA 4KSBA 3BDVA 1YBVA 9MHTA 1PGNA 5KPDA 2PSHA 1MXHA 2WWWA 4WXMA 2QLBA 1GZ6A 5K8LA 2NZYA 1AMUA 1KHTA 1QK3A 4MO2A 4AZ0A 4XCQA 2I91A 1ZW6A 4QGHA 4H7IA 4MRNA 2JATA 3GG2A 1SRQA 3JRXA 4PZAA 5DASA 1V2HE 2AB0A 4ZO6A 3GLIA 5BNFA 1E6EA 1RRGA 2QVYX 3N8GA 4I4LA 2MHCA 3TEFA 1LPSA 4JSRA 1VE3A 2W6NA 5K99A 3NOOA 2VQSA 3WLLA 3ZZ1A 3HB4X 1QYWA 1XAJA 1LS1A 1YA4A 3DTVA 4OHVA 4R0NA 1Q0QA 5C37A 3O3OB 3GMIA 3QLEA 4B48A 3HCRA 1Z7EA 4BQPA 5CB6A 3P2KA 1WQ3A 1G5TA 4LDNA 2GKSA 3I45A 4LOKA 3B2QA 1HFJA 3UV7A 3UT0A 1X7HA 2XF8A 4JFAA 1SVIA 2AFRA 3OE1A 3IAFA 4X6XA 2D1RA 2I5PO 4Q7LA 2NM0A 3LX4A 1Y89A 3R0IA 1KQPA 4QRHA 1OLSA 2Y27A 2RI1A 1QVZA 3BMCB 3FTPA 4MQMA 4CYMA 1D1TA 4E32A 1QVRA 5JXWA 1JA1A 4EYEA 4R51A 5JYBA 3I39X 3D0QA 4D92A 3BB4A 4KV9A 4X3OA 1WDTA 4HGNA 5AUNB 1EM8B 1GTRA 1GAXA 3OEEA 3H4VA 1GO2A 3EA5A 3BHJA 5TQJA 3BL8A 4S05A 2VHJA 2ZBVA 2NU9B 4U7DA 5IHPA 2IYLD 1G5FA 3F6EX 4UC0A 5HGJA 3ZDZB 1Q7TA 3BCUA 4HATA 3RRYA 1SC9A 7AT1A 2H2GA 1LUAA 5EZSA 1KKMA 2K6GA 1IBRA 2AJLI 3IBYA 3LPMA 4OYHA 5DM60 4DPLA 3MWDA 5BUQA 3H5TA 4IDEA 1RWQA 1SK9A 2GTHA 2J5QA 4P9NA 1IAVA 4C3UA 4OJTA 5BR4A 1FUUA 5SZIA 1R0KA 2VJDA 2VJQA 1NV9A 2RHOA 2R9VA 4QT0A 3T7DA 1COWD 1NQXA 4C43A 4Q82A 2JFYA 1XYVA 3R9KA 2FR8A 1L4BA 3EUEA 3P4YA 4H2DA 3V8PA 3SXUA 5KNLA 4GOJA 2C77A 2ZPTX 3DVSX 3BAZA 5LP6C 4GO1A 4CXMA 4Z4IA 3ZGNA 3ZX4A 4X1IA 3K0FA 4A4DA 1C2TA 4OAQA 1BIFA 1UH5A 5EUCA 3TYXA 4BLRA 5K6AC 1SHLA 2ZTLA 5A06A 2DTEA 3EC7A 3LUHA 3EGDA 4GMHA 4L2IB 2PX6A 4F5ZA 1Q74A 5TPWA 2WB2A 2GF2A 4ENWA 2E6KA 3UPDA 3AEUB 1ZAKA 1L1RA 2EVWX 1TA0A 3F4BA 2BOVA 4XDZA 5IG2A 3P26A 3TIIA 4LGYA 2GJKA 2WJAA 4X94A 5JR3A 2F8SA 3ZKWB 1PFGA 4BCCA 2ZROA 4DVJA 5GIOE 4TRRA 3VDXA 3G88A 1KJ8A 1WD5A 3W8EA 4HDOB 3UW3A 3ZCQA 2DX7A 4ZYWA 5BY2A 3RHTA 3W6NA 1FP6A 5GONA 4KWIA 2ZWVA 1YB6A 1RPNA 3A9TA 1GPYA 3HCBA 3OZEA 4J43A 1Y6RA 4LBYA 1G98A 4O4JF 5D00A 1QGUB 3U4QA 2P11A 3E0XA 3HZRA 3GNTA 1PNVA 2GB4A 4H7FA 4R2IA 4LJKA 4LRWA 2XXBA 4DCUA 4OKNA 2AJBA 4D3SA 1GPNA 3GGSA 4YRMA 1BH6A 4OFXA 3DL7A 2EDAA 2H1WA 3LBHA 4PS1A 4V38A 3K5WA 3SMVA 3U9LA 3UAZA 2HYIC 5AKEA 3Q7EA 4E70A 5KC8A 1GDDA 1IBSA 2HQ1A 2VO1A 4QDUA 3VJLA 2P0YA 1PU2A 2B5WA 1ZNZA 1KYWA 1UK9A 4Q9KA 2PSJA 5I9LA 2XYVA 4HRAA 3QOXA 1GPDG 1Q17A 2HADA 2QTRA 1MH9A 5D85A 5DU2A 2OMEA 1WMDA 1H65A 2FUCA 1L4GA 1XRLA 1Y7PA 4J91A 1IDN1 4M0LA 1NUHA 1TL7C 3ETCA 2DJIA 4P36A 1H1TA 3HU5A 1R0WA 3AEQB 1WTAA 3LK7A 3ND6A 1E4OA 4UOQA 2A2ZA 2GXUA 1YOVA 5HF9A 1MN6A 3A3NA 3ZTWA 1QP4A 3UFXB 1C3OB 5HYVA 2PQ2A 3H2ZA 1JYFA 3HH8A 1JIIA 1Y9ZA 1YC5A 3KOUA 3QG5A 4KUHA 4DBLC 4BO9A 4QXQA 2NOAA 3WIDA 2IU4A 1P9WA 3GN2A 4ZAZA 1QPBA 1ZJJA 1VHLA 3A6FA 4Y6SA 121PA 3QVWA 3ADPA 1EWTA 1FTYA 5LXTF 3GP3A 1S8FA 2C0PA 2CCGA 4MYTA 4NOKA 5DLPA 4Z1MD 1B4DA 1YVPA 1NPYA 3FVVA 3GNQA 1JILA 1T0BA 2ORIA 2NZUG 3BE6A 3K8YA 1T5IA 3Q3CA 3Q3VA 1U1IA 3UMGA 2ESRA 3WLHA 1N9GA 1DL5A 1IVNA 2B8JA 3RYTC 1WRBA 4TV8A 1G7SA 1GYRA 1XMJA 2D0PB 4MAAA 1PYOA 4QQRA 4KI7A 1NJ6A 3MERA 4FZRA 5ALWA 5LQSA 1B14A 3TLZA 3TG2A 4GWLA 3UUWA 5M3BA 1UR5A 1SWWA 3IC5A 1KJ9A 2H9YA 4M9XA 3CLRD 2PTGA 1M6NA 3AERB 4MZDA 1WY7A 2H4ZA 2QLFA 3JARB 3OCUA 3CPJB 1CJBA 2FWPA 4P92A 2NACA 3SZOA 4G8BA 3D2BA 3L8MA 5EJAA 2F1RA 2ZSDA 2R87A 3IFSA 4L28A 4QWWA 8OHMA 2HJWA 1CR6A 2C5AA 2A35A 2IE0A 2REQA 2BFFA 3I1YA 4FMDB 5M5BA 2HSEA 2IU3A 4XDYA 4YEDA 3Q41A 3GRVA 3BG5A 5J2TF 4CM9A 3FM9A 5K3CA 3JWHA 1Z29A 2BL4A 3JYNA 4ZCIA 1BXRB 4HAYA 3SDBA 1EHCA 1I4LD 3SYLA 1I4TD 4WK4B 4HMQA 3RTCA 1O95A 1Y7LA 1C9EA 1HFEL 2CMKA 3MTIA 2FSVA 4GRDA 1M2OA 4O08A 4P3NA 5CJJA 5KSPA 2OFWA 1O94D 3KQPA 2BSXA 1NZJA 3IL2A 1M1YE 3O73A 3UN1A 1OBOA 2IZOA 3OIGA 1IN6A 3INGA 1K88A 2PBLA 4INAA 1SIWA 1BG6A 2HMUA 2XF2A 3TTUA 3UHOA 4E12A 2W8BA 1A4UA 1DCKA 3BAFA 4N8EA 3FZYA 4FLMA 4N65A 3PGMA 4FBMA 4G86A 1ID1A 1QIGA 1VPTA 4P32A 1LVGA 3UMRA 1FQKA 1KEUA 1P5ZB 1JX6A 2A1IA 2I4NA 2ZWAA 4I5FA 4TTVA 1DIHA 4WA8A 4X64B 5K3OA 4WLNA 2EFEB 1DCMA 2NZXA 2GH1A 3ENKA 4O2AF 1YH3A 2ROQA 3AEYA 3I23A 3X1XA 2BEWA 4NZZA 2VSQA 2WWYA 2DSNA 4NE9A 4IBOA 3FY4A 3HVHA 2GCOA 3A1DA 3L7KA 1J90A 3PXEA 1CVIA 1PR9A 3N58A 3FDZA 4B6RA 2X7JA 3VHLB 3IQIX 3THWA 1YQXA 1ZVKA 2Q46A 4MP8A 5ALNA 4MDHA 4A8JA 1GGJA 3NPAA 4F21A 1PWEA 5JVDA 4OYLA 1ZA1A 4TLLB 3ZEIA 4C4SA 1VECA 3RIYA 2EBUA 5EEGA 5B1YA 4DIUA 3RVNA 4EUNA 1J2YA 3ZY4A 3HZOA 5FBQB 2RGXA 1ZCBA 3VMMA 2NU6B 3TLGB 2AFHE 1VL8A 3IDFA 1UKVY 3LY7A 4CI0B 5FWYA 2ZIGA 3IDAA 2X6QA 1Z25A 4ZQEA 1VMAA 1J0EA 1DLJA 2AEFA 3COPA 2YY6A 3KO8A 4KLNA 4L3VA 4KRFA 3LQ2A 3IUPA 2P2YA 1E2PA 4LMBA 1PJCA 2WDPA 4JOSA 4R16A 3NNDA 2YOHA 3V8BA 4EG4A 1QIEA 2L17A 2ZRBA 4ITUA 5KWVA 2NU7A 2DBQA 4HTAA 3TB6A 5HUQA 5ER9A 1E2GA 2PX2A 3CNOA 2XD9A 2GN0A 3MWYW 2VP4A 4JKIA 1P7CA 2JEOA 4CN9A 2WJIA 1GTVA 4ND5A 2AOTA 3BGIA 3P9CA 2GSWA 3QFFA 2JGMA 4UXHA 4X63A 2YN0A 4U2CA 3OPXA 3A2MA 3M2PA 1ZD1A 3K0HA 3WAJA 4WACA 4TTTS 3MVEA 1E3LA 1FU4A 3SPXA 1QRTA 3NU1A 4W8HA 4HRVA 3B1JA 2O8EB 3ZV3A 2IUEA 4YUAA 1GL6A 5FUXA 2J4CA 1W88B 2QMEA 4ZRMA 1NSYA 2IUYA 4TT3A 5JMOA 2G1KA 4KITB 3ESQA 1IK6A 4WFKA 2WJVA 1NRWA 4MR9B 1FFXA 3U9TA 4P4UA 4N6NA 1MUUA 1NU6A 4O5AA 4RDHA 4BOYA 5EJIA 2BEJA 1I9GA 4QLAA 1HE4A 2QG9A 4D9CA 1WSAA 3CX3A 3A6KA 3ONWA 4M3NA 1EGHA 4AMBA 2X8LA 5K2OA 4C4YA 1XZEA 1P1HA 4U7TB 1GN9A 4A6DA 2QYHA 2VDWA 4PLPA 1Z2EA 2IOQA 5A04A 4S04A 3F8TA 3A9CA 3AESB 3M7IA 1RYMA 1LBQA 3KZNA 4ALNA 3HADA 4CEIB 2IY7A 1G21E 2K2QB 3D0KA 3PSHA 1G6KA 4RE6A 2ZSUA 1CIVA 2FSPA 3FI0A 3ITNA 1O57A 3KHUA 1LLCA 3OTIA 3TMAA 1ZXBA 5TRTA 1OAAA 5HJEA 4CM1A 1ISMA 2NUPA 4FOOA 3VI3B 1HKUA 1SKQA 3P9ZA 4LCEA 3D2LA 1GSIA 4CODB 1EESA 5IAKA 1L5HA 2YIMA 3B1XA 5KO2A 5LM3A 4M9CA 2E9SA 1DEAA 3FROA 4JELA 3RREA 4AJKA 4GW3A 1RJFA 3BGDA 1Z33A 4FDMA 4J75A 4DG5A 1FFSA 3GPDG 2PSDA 4QREA 1GQ2A 3G9TA 5L7TA 5HQJA 5DI9A 3M8KA 4IIJA 4WK0B 3V8QA 4C4PA 1JIXA 5CBPB 1XQXA 3UJ3X 2WC1A 3JYPA 4YB8A 1WCIA 3NEAA 3CONA 3GLFE 4J1SA 4OF4A 4RVGA 4ZVUA 4F4JA 3U17A 2HHJA 5DLQC 3PUXA 5IUJC 1DFGA 1A7JA 5IF9A 2HSJA 2NQ8A 5DHUA 2CFSA 5J9FA 4FCWA 4ZVVA 3PPVA 5EKUA 1JEYB 3OU7A 3NWBA 3RUDA 5JJKA 4R3WA 4YACA 1QO9A 4LMRA 1JE1A 3LIIA 3RC3A 4P31A 1F2VA 4X7RA 2VUHB 1F7UA 5HKLA 1JIQA 1K63A 4D1YA 2WIAA 4C4RA 5DNDA 5THQA 1Y3FE 1YMQA 3O84A 3QLJA 4FYVA 2SECE 3PFHA 2MCFA 3RUIA 2J09A 2QVGA 2ZDHA 1YZHA 3VUFA 3HYLA 4TM8A 3Q3IA 2VK1A 2VJKA 3SLRA 3G7SA 1BGVA 4C3ZA 1K66A 1PZEA 2P2CA 5FBVB 5EE9A 1BQ4A 2DHRA 4EFNA 5CYGA 4ZAXA 1N5RA 1SOVA 2JDIA 1C1HA 3KYDB 3OX3A 3PHCA 1KO5A 2VP5A 1A95A 1VRCA 3ABQB 2CVQA 3V46A 4NE7A 2QMUA 2RONA 2W00A 4YDHB 4KU4A 3RVBA 4RV4A 2F90A 4PTZA 3VYTB 4DLBA 3WOHA 2JFHA 2QXTA 5K3BA 1FW6A 3FFWA 2OR3A 1LPPA 2BM0A 3TCNA 3T41A 5KYYA 1AU9A 4JB2A 4I46A 1R1DA 4F86A 4GKBA 1SCQA 4ZHSA 2ZT8A 3V1MA 4DA8A 1AHNA 2XXAB 1FUIA 3EVCA 5AJHA 3SHFA 3WIEA 1V1MB 1FP4B 3Q7IA 1J22A 2RH4A 4Z2YA 2PT6A 1INLA 3UA3A 1XROA 5DNVA 4L8WB 5FA5A 1RIFA 1D5WA 3R9IA 3TQCA 5HP4A 1T8YA 2PUCA 5KWEA 4ZAFA 2R96A 1RHJA 1X1SA 3D8RA 3BTVA 3MMSA 5I01A 4J90A 2AOWA 4L4UA 3BD6A 3ENVA 5DTMA 2JFFA 2OCXA 5KJFA 4KXMA 4RPIA 1OA0A 1SVSA 1I0IA 1NSFA 2I33A 2VSFA 4DFDA 3R7SA 3V32A 5KOJB 1GLNA 2IEAA 3QFCA 2NTJA 1CY0A 3UHAA 1NSTA 3ZJYA 5B64A 3J81A 3UKOA 1ODJA 2Q0XA 2W6CX 4IZHA 1LZKA 3USES 1G7CA 4MKXA 1ABBA 1Y6JA 4IX1A 4K9KA 3WJAA 4CN8A 1O9BA 1V8PA 3FR7A 1MG5A 3CG4A 3CVOA 5CCEA 3LCVB 4B8WA 4PZZA 1M76A 4NPCA 2ZYHA 1MOPA 3DMRA 4RK0A 2YY5A 1CVLA 1YQQA 3VHQA 5C3UA 3CS3A 3RJ9A 5FTKA 2O5EA 4JODA 1E0JA 1SM4A 2D13A 2HRBA 2IYAA 1FK8A 1C3JA 1NKSA 1ULTA 2PKQP 1JE0A 2YV2A 4P5EA 4HNVA 1NW7A 5JH7F 1OOEA 2XA1A 2WT9A 1NZDA 2WM9B 3L7DA 4J1NA 4KUEA 3HYNA 1P72A 1T8WA 1TCBA 2A94A 2PMFA 3G5TA 3OUUA 3K70D 1YFJA 1N2GA 3H13A 3IE2A 3VC3A 3N2LA 2PUJA 4CV1A 4G9EA 1ZI9A 5M2QA 2ZATA 1RXWA 1DG3A 2HMSA 4DLNA 1PL7A 1JV2B 1RKXA 1QBKC 2DWOA 2RGUA 3HJHA 4DR5B 1ZIXA 4MEBA 4LRQA 2VT6A 4NARA 3S2EA 5J1SB 3EEIA 1LPBB 4LV6A 3CRNA 1U9JA 1HEUA 1L8AA 1WMSA 1DB3A 2C78A 2WINI 3QOYA 4KFTA 1XZPA 1RAIA 1SO8A 4ZOCA 4FI3F 4C5BA 4GI5A 2RBKA 1E1NA 3M4ZA 1MOQA 2BMVA 4H7HA 3O4IA 1K4KA 3RFXA 5ADUS 4CKWB 3L7OA 5EJFA 3RBVA 2Y66A 5HCUA 3CPHA 1OI4A 1U1EA 3CZAA 1ODCA 5ALUA 2XA9A 3IE0A 4HC4A 4CM4A 3K53A 4PFSA 5T57A 5CFPA 1Q0RA 2WKSA 1YU9A 2H48A 1PT7A 1GU7A 1EMDA 1OI2A 2JKYA 2MYPA 1QMGA 2PDAA 5C80A 4WPGA 4X93A 3S2GA 2TMKA 5KMGB 2PAAA 2BEUB 3FZQA 1RIIA 3LFHA 3QUCA 5ICCA 3GJYA 3LHDA 4CMKA 3K1AA 4PG6A 4QUAA 3ZUGA 4W8OA 1NE7A 5CFOA 2WWHA 2ENUA 1OBVA 1FYDA 3GLUA 3H9CA 3ZGOA 4D9MA 1WQ4A 3EXEA 2WIJA 4O8CA 1KC1A 4QU5A 4QXOA 1W5EA 4YR7A 1W36B 5BXQC 1CBUA 2D2VA 3EPPA 1X7ZB 3ENQA 3K8ZA 2Y9PB 2YJGA 4O6VA 3F49S 4GLLA 4KV7A 4NONA 2V5UA 1WEHA 1NXOA 3ICQB 4RUKA 2GPTA 3WLTA 2ZI7A 5E9QA 1E98A 2WHEA 4HSGA 1SXJE 5DGIA 1SCAA 3ZBQA 1IHYA 1PLLA 2FW9A 2JVKA 1U8UA 1H3EA 1P5FA 4EG3A 3H9QA 5LMZA 1IY1A 1E64A 2EARA 4ITRC 4F6LA 4M6WB 3IS3A 2EATA 4KVZA 1XHLA 3TAUA 1ZJWA 2DHQA 4RD4A 2DCUA 3TRJA 2M6RA 5HA5A 1P6UA 3GDWA 2IDJA 2HT6A 1IHOA 1N2OA 2YJNA 1NW3A 4H77A 3DZHA 4WUTA 4CT0A 1OLUB 3ELYA 5C4IA 2SKEA 5DGTA 2DMRA 3N9IA 3PX3A 5CNJA 3WYFA 3GVPA 4O2BA 1GXSB 4YGXB 3V1UA 4F1WA 5B36A 4HNSA 4EG7A 4M87A 1NLUA 1ZK0A 5IJXA 1V16B 4RQUA 4TTJA 1OAOC 1I4EB 4TTIA 1ISHA 1GCOA 3T5GA 2AR7A 4B4OA 4DA6A 4DV5B 1BVHA 1ISIA 1X7WA 1CJCA 5HZGA 1T2NA 2ZUSA 2ZB3A 1GARA 3CF6R 3NYIA 4N9QA 4E30A 5JT1A 2HZ7A 3Q6NA 4FYKA 3H3FA 4MCAA 2AEJA 4G41A 3P9IA 2A1UB 1U0LA 4OK3A 3F3KA 3ZK9A 2KLBA 3OQMA 1BAPA 4LKOA 4C6SA 3OIFA 3MSXA 5E4TA 3L7MA 1XVUA 3A32A 1XAHA 3ZE6A 4CMCA 3UYKA 2YHAA 2DR2A 2OO3A 9LDBA 3NEPX 4JITA 2DEUA 2ZBUA 1YR3A 1QZXA 2VT2A 4IS3A 4NYIQ 4XE5A 3I8SA 4NNJA 4AWAA 4ZOAA 3DDZX 3AF3A 2JASA 5CCXA 4UQLA 1TU4A 1N8SA 1RMYA 3F78A 4GOKA 2P9YA 2JJYA 3CWCA 1KQNA 3FOAA 1RLUA 3KJEA 1LH0A 3RAJA 3HKEA 5DRTA 4AURA 1YE5A 1JFLA 3HN6A 4XCXA 4L74A 4AF6A 4BEBA 1RJGA 3FLAA 4QXMA 1GZ4A 4J49A 4RXTA 2GN9A 4WCDA 4JUDX 3NR2A 2NAFA 4BAUA 3NDBB 1ATIA 1T8RA 4CTNA 2B1JA 1A7UA 3FYUC 1G4AE 2AUMA 3E9EA 3R3WA 2PH5A 3MBIA 4H7JA 4IPTA 2BJVA 4QG7A 4UHFA 1J21A 2GKGA 1OFVA 5BT9A 2OA0A 4ZODA 3TFQA 4AUEA 2ZAOA 3O31A 1Z2PX 1ZYUA 3D6AA 3EZNA 4YLGA 1TD9A 5KPJA 1LFDB 2NXCA 4D0GA 4IZ6A 1EX9A 4I6JA 4LECA 2J41A 3B36A 1MRSA 2EZTA 3IMEA 5DO9A 4Y2TA 2XOXA 2WUFA 4EJSB 2VATA 4NABA 4DAEA 3JZAA 1J07A 1YJ8A 4DSAA 4PFQA 1JEOA 3EGIA 3Q7RA 3QU4A 5AUPB 2H1LA 4FB5A 3HKBB 1EQAA 3LL7A 3PQ8A 1SEPA 3CUUA 3QKSA 1MO6A 4CBVA 5FUQA 2FZCA 2YWFA 1GUFA 5AJVB 5L7YA 3M89A 3PXUA 1GQQA 3KOXA 2YNMC 4X1YA 4NXNB 1HM5A 4BLWA 1TOAA 2QPOA 2X3FA 4BATA 4CM5A 5IT0A 1F38A 4WKPA 3HM9A 1XEAA 4MICA 4EFKA 2J46A 2QTAA 5A5EA 4RVNA 2PGJA 1OGJA 4TKVB 1XNHA 2JIZA 1LJUA 3A3OA 2BHTA 4ZRNA 2H1IA 1X92A 1Q1NA 3ER8A 1M2KA 2FG7C 3OQPA 1CF4A 5JJBA 4AF8A 4CCYB 1C9YA 3GVXA 3I3OA 4PVCA 5DI3A 3TE7A 3QEAZ 1GGFA 1T5TA 4QHTA 4WRRA 3OO1A 3G2NA 2B9VA 1JQDA 2ENWA 2GUWA 2ZJ7A 2C4HA 4LS3A 5KTMA 4DLZA 5K03A 5K45A 1XL1A 4HK4A 3WOVA 2IYQA 4RSHA 5BNTA 2KM1A 4M88A 3SSAA 1NXWA 4AI6A 1I4DD 4ID9A 4XRGA 1NJFA 3SHWA 3WX0A 4Q4JA 2A88A 1DXOA 1JEAA 2BT4A 5EJMA 3AVTA 2XOKD 3D6UA 1VHTA 1PD1A 3PD0A 4HDMB 1A8UA 1XTQA 4S2UA 3CKLA 5KJCA 3DO8A 4NCBA 1AQUA 4IIHA 3WWYA 5LDDC 2Z04A 3S2UA 4JXXA 4CR7A 1NR7A 4N3NA 1JHMA 4FU0A 2A57A 3HUUA 1KF0A 2APJA 1I5RA 3KFVA 5JFGA 1YHZA 1RKVA 4XJSA 2DQZA 4PGFA 4GE0A 1OLXA 3HBJA 2O2XA 4M49A 3Q15C 2XIQA 4BFTA 1BA2A 5BSEA 5AJWA 1Z2CA 5C46F 2HIHA 1D0VA 4YT8A 2R6AA 2O2JA 2WTBA 4MWGA 1XA3A 4JI0B 1ONSA 3GOQA 2WKQA 3G5MA 4II2A 1HSOA 1YACA 2PXHA 3AO0B 3TRFA 2YFKA 5KAMA 3W8RA 4BMCA 3HI4A 2CY0A 1GQOA 1D4AA 521PA 5JMWA 3NJ4A 3GDHA 2ZI6A 4I2VA 3E8MA 1MIOB 5IYZB 4M9QA 1K86A 5HIJA 4MVCA 4D8TA 1YE8A 4S1TA 2HYDA 3VU0A 4DGSA 2PU7A 2ZT7A 4JLDA 4YROA 5ENVA 4G5YA 4TKUB 1GQYA 2XRYA 5T5QA 1FNSA 1SA0A 2IPAB 5KCMA 4XWKA 3C5CA 2CDAA 3CW8X 3HC7A 2UYYA 1LTQA 3KPWA 4V0NA 1JSXA 4WD3A 3GLGA 1D7OA 5DFAA 4EFDA 1KFJB 1HNXB 4UAVA 1T9CA 1UP6A 1VSVA 3N8IA 3RV3A 3VOAA 7MHTA 3RTDA 2OBBA 4H1VA 3H1PA 3N7TA 4LVCA 1XKTA 3AVOA 3CLHA 1TM1E 3WB0A 4CKXA 4C2BA 1QAOA 5T6BA 3AFMA 3M83A 4B8YA 5K0CA 5IRCD 1O97D 2BUBA 2W2NA 1UF9A 2Z5VA 4KL8S 4W99A 2AG5A 1Z4IA 3L7IA 1GPH1 2IP1A 4HNHA 4XDHA 2C7BA 2I3BA 2WLSA 1KAOA 3EOBI 4YPOA 1IOVA 2CLMB 1OY1A 3A2LA 3INNA 1ZS9A 4KBFA 5EKXA 4PHCA 4HQ0A 2IJGX 2UZIR 4I55F 4QOEA 2Y9MB 4K6MA 4PAGA 2R1TA 1NVEA 2XCSB 1R9NA 1HNZB 1M54A 4C5CA 2IBMA 2QZ4A 4EI8A 4GKJB 2CJWA 1ORHA 1J0CA 2CMHA 3HKCA 1JJFA 3KZXA 5EQDA 2SHKA 5CEEA 3A2NA 5REQA 3I72A 3D8TA 3RU2A 3T3GA 4TSKA 1CE8B 2X1VA 1NX9A 2JIBA 4IQ0A 3TS1A 4DLWA 1OLSB 3PJFA 2C3MA 5KU1A 3OU2A 1REQA 4AF7A 2XPCA 3VR6H 3IODA 3TX2A 4OLHA 4AUKA 1CEXA 5FPSA 3V4RA 5EUQB 2XECA 2Y2UA 3UCXA 4Z3KA 2FU5C 5I9NA 1CF2O 1MW8X 1VJTA 1TM2A 3FNHA 3OQIB 3P9SA 3K8OE 4HQNA 1CR1A 4DMUB 3DZ8A 4POAA 1TD1A 3PQ3A 4HADA 4JJ7A 2PZLA 3ER6A 5CIQA 2BI8A 2XE4A 1U99A 3NVKI 2Z6UA 1NR1A 2WV7A 1WSWA 3AP3A 3OZWA 3TTVA 3REFA 5JCPA 4Q3EA 5ARBA 3DFFA 3M34A 1RZRA 2FHPA 3RR2A 2P9CA 3ZXXA 2F00A 1E5DA 1UPCA 5F98A 2GASA 4DCJA 1JT9A 1AK1A 1G4HA 2II6A 4K86A 2P9FA 4RCYA 5BSKA 1QDEA 1TJ3A 3QPVA 4JB0A 3L6BA 4KFUA 3NEYA 3KQQA 1HY3A 1JTVA 4ZARA 2KX7A 3EHEA 1UINA 2PBRA 1UBMS 1DJLA 5DBHX 3N86A 3NH9A 5AESA 1FJHA 2JI4A 3RK4A 4RTJA 4MI3A 3D31A 3MWGA 4Q3KA 2WF8A 4RPHA 2B99A 5LDHA 3SZMA 2QR3A 3NFRA 3JQGA 4LQ4A 2JIQA 4EHHA 3RIEA 5B4UA 5K0JA 1RXEA 3CO5A 1S7CA 1DJQA 4LGCA 5F3WB 3S8YA 3G9UA 5EIAA 3EXAA 1C3LA 3O47A 2UVDA 2Q50A 5E7JA 2ABWA 2FWIA 2AVDA 4JJ6A 3RB8A 2ZJ2A 1ULBA 1Z35A 2QRVB 1WBJB 1EUDA 3HV0A 3IJ5A 4UVDA 3WWCA 5ICEA 4KVGA 1E4EA 3OIVA 4OGWA 2YN2A 4QDXA 2DC1A 1C9JA 4BAZA 1XU9A 4YCAA 5HM8A 4L51A 1SUWA 2GWRA 1LBTA 4J9UE 2IHYA 5AKKA 2VWPA 4BZZA 2BDTA 1YCHA 2GPWA 2HTFA 2M9MA 3UV3A 1OHHD 2ODAA 4JSYA 5IKXA 4ZAWA 4II3A 4C5AA 5I5GA 1QQ5A 2UXCB 1JR3A 1ZVJA 4Q05A 4YXWD 2ZOSA 5DGHA 3QHQA 3H86A 3BL5A 1TQDA 3MWJA 1T5BA 4LG1A 5KYTA 4PSCA 2YXBA 1Y1KE 3BTSA 2FN8A 1RJEA 1YB2A 1NOJA 4KZKA 4PBSA 3V6LA 621PA 1GFSA 4YJ2B 4D56A 4ENSA 2GZSA 2QOEA 1PHRA 1U0OC 1XKXA 1F3LA 3JWIA 4TX1A 3TBKA 4EITA 3R0VA 5BWLA 2CJXA 2OCDA 4RK6A 3FF4A 2EKBA 3OWXA 3AX6A 3K2QA 1CZHA 4C30A 4BFSA 1FDUA 5EJ4A 4TRJA 4N7JA 1KVSA 1XGKA 2C9DA 3MRTA 2ZYAA 1BE6A 3BC1A 3NXSA 3DE4X 2NSDA 5J4YA 4MV0A 1C4WA 1AZSC 4MRRA 3MJHA 5JZMA 1PL0A 3AR6A 4JT8A 5EP1A 4B4VA 3W3AA 4KKVA 1USWA 4EVSA 5DJ5A 1NJGA 2Y4NA 1TKCA 9LDTA 1CRPA 1YD7A 1OJLA 1RQ2A 3OTWA 3T1NA 4UU1A 4UCQA 3TXYA 1WG8A 1EK1A 1SC4A 1NT4A 1CUFA 3R5XA 4LHEA 1DV1A 3DLAA 3T7TA 4RFVA 4ZJYA 3CZRA 1LSJA 4CETA 1B6RA 3OSZA 3ZI7A 3O4HA 3SJBA 1RC1A 1O5TA 2RFLA 1PLJA 4UUNA 3ZK8A 4CU5A 2WMNB 3OP1A 1AGPA 4NFYA 4DQXA 1KY5A 4AXXA 4BRWA 1AQJA 2RK4A 4G5HA 4TV8B 2AG8A 3CZ5A 4GF5A 4F3RA 1VIAA 2GAOA 5IDYA 2IT1A 3GJSA 5D7NA 3K32A 4RVSA 5CB8A 2QQEA 5JAUA 2P40A 5CB4F 1JBQA 2SCUA 3FH0A 2X9NA 4JJKA 5FNZA 2C7VA 2B5VA 4KNVA 1H8EA 4EO9A 4PY2A 4CQJA 1VI5A 1J70A 2I2AA 4P2BA 4EY5A 2JFQA 5AI9A 3AG6A 3NHAA 4DMMA 5KCZA 1XRSB 2BM9A 2GJ4A 2IW1A 2JJQA 1F20A 2TMGA 3DULA 3UBMA 5B1EA 1QMPA 4JUFA 4LF6B 2REQB 1TVEA 2BFFB 3PRHA 4ALKA 4D3XA 2FF7A 4JQCA 2Q4OA 1U7PA 1EVEA 2JPDA 3IAEA 4IKPA 3KHSA 4YP5A 4C3OB 2C0CA 2VP9A 1R0BA 2GK7A 3NMUF 3D4LA 2IPNA 4U7PB 4OHYA 3BSWA 5EHIA 2WK1A 1HBJA 1NMEA 3LH5A 5K0EA 5KSOA 1W36D 1W44A 3Q5GA 4X1OA 2OFFA 1EWYA 4GQBA 1XZ8A 4K9RA 3KSAC 1RYFA 4GUAA 4MNTA 1MT0A 4GNRA 4LOLA 4E2WA 3L4JA 5K4GA 3QWFA 1TZMA 2RG7A 5FWAA 1DPFA 4ZOLB 3WMGA 4PXSA 1E1CA 2YRWA 4C4TA 3HB1A 3EQZA 4IJ6A 2ZBDA 1DGQA 1R18A 3FPHA 3IUQA 3R3HA 3P9XA 1ZLYA 3GRFA 4LZJA 3J7TA 3DWIA 1KZ4A 1UXIA 1XYYA 1AHIA 3DKPA 3B9BA 5L6LB 4GPEA 2WFMA 4ZCMA 1L5WA 3QWIA 1A7AA 2PMCA 3HDGA 4IH1A 4RCVA 4UBIA 4X90A 4RMJA 2Z8ZA 2WU4A 4HN4B 3R20A 4LYEA 3RYCA 1RJDA 4QPJC 3G2OA 4BQQA 4F85A 2IGBA 2IU0A 2CD9A 3JAKB 4R83A 4WE3A 4NBLA 3UAGA 3GAMA 2DVMA 4BU1A 3UM9A 3FDZB 1HLDA 3EWNA 3TVYA 1GPAA 3U16A 1Q5PA 3ZU5A 3U1VA 3RVLA 4DC1A 2R2AA 5JAZA 2F9MA 3CEAA 3PRJA 2VYFA 4H08A 3TZQA 4LRSB 3KL4A 4DUZB 4LYHA 3ON5A 4AB1A 3M6WA 4JVMA 2XDYA 1RM5A 2J9FB 4DMGA 1IOZA 4EJ0A 5C35A 3A10A 1WU7A 3C4VA 2EQBA 3IAS6 4LC0A 2I3ZA 1Y1SA 2CB0A 2M6KA 1G8FA 3FPAA 3IIMA 3TZHA 1KI3A 1POWA 1SZPA 5MF6A 1GZDA 1PZFA 1F14A 5FWYB 2AQKA 1KE2A 4W5TA 1E2BA 2UAGA 3CX6A 2FMFA 1KU6A 2HSGA 1E4VA 3MPUA 1NFRA 3WMEA 1Z0ZA 2P2ZA 2RI0A 3WMXA 1Q14A 5AXCA 2EHJA 2FSUA 2VPPA 1W93A 1D4OA 4EIWA 5DMHA 1FTNA 3OCVA 4B2YA 2P9EA 5FOTA 3A1CA 4U6SA 4XVUA 2O5VA 4MAFA 3RT9A 2WSIA 3GV0A 3ZHZA 4IJKA 4U9HS 3KNZA 1E1DA 1N2XA 3BBLA 3RIGA 3GGJA 1L5LA 1ISJA 3V1NA 2BBSA 1HOXA 1K8XB 3CB2A 3RVQA 3U37A 1JLHA 5LR6A 3QUBA 2Z98A 3E9NA 2J9YB 2DB3A 2BGLA 3FYDA 5AVQA 3ABOB 4FI3C 2H2IA 2O2IA 4K9SA 3OQ6A 5IN4A 3GLRA 1KNQA 3VH3A 4JXJA 2QT9A 4R8MA 2VYCA 5GJBA 2O0HA 2AVNA 1KQOA 5E0OA 4EZIA 1ODSA 4RF4A 3DLPX 2P7HA 4RWZA 3LPNA 3FTNA 4TXHA 1LDNA 3F96A 2R66A 3AKCA 4KQ2A 1XK6A 2XNDD 1N2CB 1T10A 3PF8A 2ADMA 4H3HB 2HAEA 4XA8A 2VDWB 1JQLB 4Q1EA 4PQFA 3NGLA 2E2WA 2JK0A 3O7WA 3WNQA 4B4KA 1U1GA 2FFQA 4JBWA 4C20A 6REQB 2V55B 3M3DA 1H6DA 4UUOA 1F12A 3R6WA 3R0XA 1YUNA 2AA3A 4K87A 1UBEA 3NBKA 2FOIA 3DBRA 1THGA 1CB7A 2CBZA 4GHWA 3TPFA 1YS4A 1L7EA 2ZBRA 1BKSB 1Y8QA 4XPIA 4I7EA 3ZE9A 4AN0A 3V1TC 1QZUA 4KFCA 1DKMA 4QOFA 3GPBA 4ESEA 1R5BA 4GGOA 5CD1A 4UE3S 5JS8A 2EP7A 1JDTA 1KXZA 3FOWA 1SQGA 8AT1A 4BJ3A 1AT1A 4IUYA 5AI8A 5TVKA 4TLCA 4EY4A 3QFTA 2RAPA 2XV1A 4P93A 1MVNA 4UNNA 1V71A 4X6YA 3HHPA 3O93A 2PBFA 3QKTA 4CIYA 2UVPB 1WCIB 1J6UA 2VXYA 2ZKIA 4X85A 3FMVA 4UQOA 1OLOA 2XZOA 4ZI5A 1UBCA 4JI3B 3DKVA 2XKAA 2QYTA 1IH8A 3HLKA 3LZDA 4RMNA 2X8AA 1EVZA 1N2JA 3E7PA 3LKBA 3FTDA 3KZMA 2GN4A 3ZD9A 1JB9A 2ZPAA 4O25A 1ZNXA 4BL5A 1AOXA 3DVAB 4XUGB 4C7MA 4ZYLA 1N57A 1LRJA 1R9GA 2QS9A 4LXUA 3OY7A 5ECWA 5FI5A 1GFIA 2MJLA 3DOIA 4PRLA 4D9HA 1NUQA 1G8MA 2HUPA 3D64A 1Q50A 1HZJA 1GGEA 2HQOA 3H2JA 1AHHA 2OGZA 4ZYTA 2CYAA 5F52A 2VDVE 1GUZA 4BECA 1N1GA 1XQVA 1TUBA 2H4YA 4E07A 4AW9A 1HFKA 4CF3A 3TK1A 1ZY2A 1FZTA 3LQ1A 1WM1A 3GT3A 1PG5A 3CIFA 1JEJA 4Q7QA 2N0SA 1LRLA 1T5DX 2VHZA 5CHYA 5D51S 1L7OA 3WHKA 1LY1A 5K05A 1XU7A 1NVWQ 3E9YA 3V48A 5KYYB 1VJ1A 3HEMA 5A4IS 3U0VA 4B47A 3CCCA 3QWBA 1ZXXA 4OHCA 3I83A 3WO1A 3K1ZA 1VLVA 4WASA 1MV8A 1KYTA 3A1WA 4YMLA 3H5NA 4WKCA 3C1OA 4BFCA 4MROA 4MQUA 4GD3Q 1CZLA 1V5WA 3V33A 1XL0A 2PD3A 3MF4A 3ZV6A 2F62A 4F9EA 5CDFE 1Y8CA 4RM2A 4EENA 1IG0A 2PZAA 3PQCA 2NTVA 1YC2A 4HZUB 5IH3A 3L79A 4R69A 1MTOA 1K4YA 4PHGA 5B37A 2NYVA 2Z5GA 2AX3A 2MR6A 2P9ZA 1WPGA 5IDQA 5ICGA 1L5GB 1AXRA 4G1BA 4EQZA 1B6SA 2JKZA 2AWOA 3N53A 5KDLA 4TYYA 4B34A 4BGIA 5LB4A 5JLAA 4L9AA 1D4ZA 1P1RA 1XFAA 1ZD3A 3HVKA 2I34A 2EKQA 3OCWA 4O3FA 4KO3S 2JCSA 3WXMA 1RBQA 1FNMA 1TLLA 3SNHA 1CSEE 5F5LA 3WGNA 1UP7A 2ZB4A 4Q4DA 2BJWA 3BJMA 1ZGJA 4OXIA 2GEKA 4TWRA 1DV2A 3JR3A 2CFIA 2XUGA 1J0DA 3ZNQA 1OSNA 4AU1A 4LJ7A 1KSJA 5IUKC 4CDGA 4F4DA 3PJGA 1QGAA 1PFWA 1V5GA 3DTVD 1SVUA 3R8CA 2OC9A 3IV6A 4ZT5A 1J1UA 3LXMA 5KVQA 4B6QA 4ARIA 3P7MA 2IL1A 3R24A 2H4XA 3F3YA 5FOVA 1GL3A 1YUBA 1ZGGA 1Z6PA 2C4MA 2YBDA 3F9RA 4J7XA 3UUGA 3ILXA 1BA3A 4DYDA 3FBTA 3M3PA 2G7MC 1X0VA 1G60A 4GOLD 4TTRA 4KQJA 4X3CA 3SYTA 2IX9A 3WRXC 4C21A 1X8XA 2R8BA 2INGX 4TL7A 4GOMD 2G67A 4EGSA 1CF9A 1FJGB 1SWVA 1TYZA 3E5RA 4Y1RB 4FDLA 2VKTA 4XGKA 3ZHCA 2JHPA 5A2QA 3HABA 2Y3IA 3V4LA 4LJRA 4CQLA 3OEED 3QMVA 3M5CA 5I4CA 1M0SA 4NDNE 3T4XA 4P33A 3ZHVA 3FPEA 4P80A 1YXMA 4BMSA 2YS6A 3W6UA 3DSRA 2V7QA 2I2BA 5AK6A 3WBJA 2DPYA 2GK3A 5H5JA 1Z6XA 1KE1A 5CXUA 4V2UA 3KKKA 2OK7A 2XBMA 1OMOA 4G67A 5JNWA 3UOAB 3U5TA 3AJDA 3BN3A 4YP1A 1QOQB 1XMQB 1EAMA 1MXFA 1QUEA 2H8GA 3E03A 2YZMA 1Z9BA 3L9XA 3H8SA 1DRJA 1A8IA 1AKRA 1Z7BA 3PFGA 4FCTA 1ZM4A 4QDKA 2AMYA 4QIHA 4TMFA 4EJFA 3RFCA 2X8WA 1KH2A 4F11A 4B6OA 4Q48A 1RMTA 2GCIA 3BXEA 3PHGA 4CJXA 1VIYA 2ZG6A 3C5HA 5BW5A 4ZYVA 4E46A 2WE8A 3WHIA 3QY0A 3QELA 1DADA 3ES9A 1Y9EA 1ZD9A 1XQ9A 3SQLA 4DADA 5HKKA 1ULUA 2AK3A 3RBAA 4DLKA 1L7MA 5KTTA 1QQAA 1N6PA 2Y1XA 1GPJA 5DT9A 3PNYA 3IP9A 4FR0A 2GAFA 4BTEA 3SM9A 4HWRA 2AQ8A 3HP1A 1G16A 3LX6A 3TSOA 4DBVO 3UMYA 2LRHA 3L92A 3X1DA 3SG0A 3VC2A 3QJYA 4GMGA 4YMHA 4FT2A 1VE9A 4JLAA 3VPGA 1PFQA 1FP1D 1KZ9A 4B7AA 3UGTA 3SE7A 4HAVA 1ZKMA 5C3MA 1KEVA 5FWXA 2UYHA 3ZDFA 2DLNA 3DNPA 2HV9A 1JU3A 4G9BA 1NBMD 2BKAA 2FI1A 1TUGA 4IDCA 4IIBA 4HWGA 5BT8A 4H31A 1P9RA 1L5KA 3DPUA 1F0PA 3WGQA 2NO5A 3AP1A 1JQAA 1XYGA 3NTUA 1LK7A 1UQRA 4ZDJA 2XI4A 3LP6A 1IN8A 2ZR0A 4ND8A 4YALA 5FRDA 4FR5A 3DPIA 5H8WA 3TLJA 3KHKA 3OQBA 4UEWA 2W0MA 2ZYSA 3L8GA 4FFRA 4TQUS 1KEPA 3BORA 4HV4A 2AQHA 4R1LA 1QVVA 1ILEA 1XPJA 4AIIA 5KYXB 4EELA 3DOOA 3FWYA 4BMZA 2FSFA 2B94A 3H5RA 2O2GA 2F43A 4O2BB 2FPOA 2FUNB 5F3DA 1KZGB 3V00A 3U4GA 4IJQA 1KI6A 4Y2SA 5T7BA 2GRAA 4CL8A 3C3AA 2V7VA 4LVOA 3WNBA 2ZANA 4LC1A 4MQBA 4AZWA 1NYLA 4KLRA 2HA6A 3BIWA 1PDOA 3SLKA 3TQSA 2CGEA 1HYBA 4D81A 4DL9A 4XQ9A 1TJPB 1SU4A 4GP9A 4Z86A 3H9JA 4RJTA 4JXZA 2DBZA 2Z5LA 4REMA 5TXGA 1USUA 421PA 1FYWA 3FKSA 2AZMA 1ZRNA 5DP1A 4Z9YA 1QAQA 5J2UF 4RH3A 4URFA 1TO1E 5L8VA 4CV2A 3S8EA 2WUGA 5GWXA 2AMJA 2BV3A 1R8SA 1VCOA 4D98A 3IT3A 1ZGBA 2E55A 3A9UA 3K94A 3HSSA 3A14A 1KK1A 2WIDA 3D6MA 4K6KA 4ZQHA 3I2HA 3K1JA 4ZYYA 4G5RA 4KE7A 4QPPA 5HK8A 5LYJA 4JJFA 1OUMA 2W6JA 3JQQA 2HWXA 3KZOA 4H60A 4EPYA 5HNKA 4QL3A 2PMKA 4IYRA 3SC6A 4B40A 3PA8A 4UU0A 3C4QA 3NM4A 4JHXA 2CVPA 2PZBA 1QSGA 2I80A 5AIAA 1CUAA 1FMFA 3R3ZA 3NORA 3GQBB 1XN1A 2ACWA 2TYSB 2D5LA 4J0DA 1JEDA 4WFIA 2QI9F 2VK4A 1E2MA 1XHEA 2R6JA 2ID9A 1ES9A 2ZTSA 1XTPA 3PSAA 4M1YA 1DHRA 5A7FA 4MHSA 2NPFA 3ZNOA 5HIIA 2BRUC 1GNQA 2A7QA 2WTEA 1JG6A 4MYRA 4GBED 2Q6OA 4GWGA 4X0EA 4QWMA 4JEHA 1RABA 1HDCA 5PNTA 1KZHA 1A9XA 3LGXA 3JQ6A 2WWGA 2BZ1A 1KRWA 1NZFA 3WKAA 5E4JA 2CLKB 3T3EA 5CVJA 5JRJA 1M2WA 4H27A 1EZZA 3OVMA 1PV4A 2Y0EA 4XM0A 1A5BB 3EW9A 1O6BA 4I99A 1Z6QA 3B78A 3H9UA 3EPJA 4ZGGA 4JR2A 4GE3A 3DMDA 3EOAI 3ISVA 1VYHA 3WDSA 3PVCA 3ORFA 3HNPA 4RHYA 4CM9D 1CDDA 1FFYA 4RE5A 4LRXA 2LW7A 4RWEA 1TQ2A 2QX7A 2A4MA 5EZYF 5AM2A 3KQKA 4WDQA 1U0FA 5IM5A 4WLOA 3AF0A 1A88A 2PUEA 5A62A 2Z4TA 3OC6A 1HG0A 3Q11A 3BXOA 4INZA 1CRLA 3MS7A 1Y7IA 1YB5A 2P75A 2ZEJA 3QVKA 4Q7EA 4WGFA 3UXHA 5AVTA 3U39A 1ZMXA 4FYPA 2JJ1A 1PWYE 2JEZA 3F2IA 5AVOA 3A9WA 4CMAA 4F3YA 2JI9A 4M0MA 4GXTA 3WB2A 2ST1A 1MFZA 2XSZA 5IT4A 1YJQA 1WO8A 5BUCA 3QV1A 4OLFA 5DI3B 2VEOA 4FD2A 3UMBA 2JGEA 3NT4A 1M1NA 5F3RA 3LNTA 3TD2A 5LP6A 3MC1A 2B92A 5TGZA 2XT0A 3RGWS 4LV8B 2IHNA 5IAGA 2I8LA 3H4IA 4BO5A 1G8JA 4EG5A 1E6KA 5K6AA 1CQJB 1TM4E 1GU0A 4KSCA 4CIDA 2Y67A 2BN4A 1MAUA 2J5XA 3W05A 4LISA 3INTA 2QX6A 4GPTA 2BF4A 1SCKA 3KAKA 3WLQA 2H7YA 3DMTC 1Z56C 1XTTA 3ZX5A 3RD5A 1DNPA 2PUBA 2Q6TA 1IBMB 3SK0A 3T61A 4DSZA 5CFQA 2KI5A 1U3UA 3T7KA 4Y2UA 2JS7A 2VFAA 1OYVA 1VL6A 4LFAB 2IIQA 1K2WA 4EMSA 2MT9A 2OXRA 3ZUPA 3ZU3A 2QU7A 2BGUA 1B8OA 2H4FA 4RIHA 3WE7A 5DNCA 5LNK1 2ZYDA 2WD8A 1Z82A 3OEHA 4C0QC 3KD3A 4TXJA 3MCWA 2C2XA 2PZ8A 4FUQA 2IELA 2YIJA 4YAFA 3W34A 2JFPA 3NBZC 4XIGS 1EZ1A 3HPQA 3CO0S 1IQRA 3TJZA 3ZLBA 3UVEA 2YVQA 1DARA 2CK3A 2I6FA 2ECQA 1IRIA 4JLOA 5FDFA 3AF4A 1RC8A 3OIWA 4Y0AA 4B2PA 3VSBA 1U8FO 4QGBA 5MGBA 1V4BA 1RQRA 2WYHA 2XMCA 3H11A 1SA0B 4GXRA 2I4LA 2WTNA 4AO6A 4D4HA 1PJ8A 1W30A 5ITVA 1WAMA 2WICA 1IMJA 1TZCA 4DJJA 1KMCA 2OP0A 1LKZA 3QPCA 2Q1XA 1IAQA 3ZGXA 2YXLA 2PS1A 4U0KA 5ITZB 3T1YB 2QU8A 1TNDA 4I4TA 1AB6A 1B42A 5AVJA 2WWVD 2GARA 2IYFA 2OCPA 2C5FA 5M34A 1C9MA 2QROA 1VJGA 3NHSA 4MITA 1I33A 3IEUA 1PR6A 2ARKA 2FZVA 3K9BA 2AKYA 4HQ6A 4KQ9A 5FX2A 3UJDA 1PAUA 1X9GA 5HF6A 2GJ9A 1DWUA 2AN1A 2G0TA 4FQ8A 4MUXA 1YZNA 3TTYA 2NNLD 1YS9A 3ZVMA 1NRXA 2C5HA 1UBRS 1OXKB 3COVA 1P2UA 4FP9A 1ENYA 2DTDA 2CHVA 2X9GA 1YDEA 3DP9A 2PT9A 3O5AA 4YCDA 3RSOA 5FEMA 2JLSA 2Q6KA 2HPHA 4FHZA 2R1TB 4OHPA 3GAZA 1AV7A 3GFTA 4URXR 2JZOA 1WKCA 2VJLA 2IHTA 3DTYA 4KPUB 1FE8A 4TLAA 2NV2B 3HKCB 5HXAA 1WW2A 5J3JA 5JYEA 2DQYA 2ZWOA 3RKSA 1P4JA 4OGGA 4DARA 1Z0SA 3FAZA 2AXQA 4GFDA 2CL6X 1AN9A 1HT0A 5ELLA 2O2DA 1JMKC 2R6R1 2P68A 1BXGA 1WMEA 4ZI7A 2G76A 3IBGA 3RAFC 1ODKA 2E5FA 4HEA1 1OZAA 1U2ZA 3HN2A 4HQOA 3C8MA 4IOKA 4RIEA 5E7MA 3KJHA 3VR6D 1MT3A 3JAMA 1BDIA 3DXYA 4RZSA 2Q1WA 2ZYWX 2DGDA 3NWJA 4RPGA 1NI5A 1GVHA 2A9VA 3RF6A 2GYVA 3EUWA 2R6FA 4A0HA 3BXHA 5COAA 1P5HA 2UYCA 1WB9A 4EPTA 1J2RA 2QRQA 1ZICA 4W9MC 2ZWPA 1ZOIA 1EVLA 1ONOA 3G3EA 3ER9A 2WDZA 1Y3BE 1MO5A 5CMLA 2HMTA 2ZSEA 3I5MA 4BUJA 1ETHA 1GR1A 1LB1B 1Y7HA 1ADCA 3S7ZA 4IIUA 4MAMA 5E9WA 1C1YA 3HGTA 1DIBA 2NW6A 3MTAA 1RHMA 1ZCZA 2GM9A 5FKJA 5JQGA 1KEKA 3TQTA 3DA8A 3OFKA 2C2GA 1T9GR 3MT9A 3N2EA 1IB6A 1GAQA 1VM6A 4LZWA 1UC8A 1E1YA 4MR8B 4ZVPA 3FOZA 3FCCA 2ZUWA 2XEDA 5HHTA 2G4LA 5GONF 5B7GA 2WIBA 3LWZA 3JY6A 1U0TA 3RS4A 1R4MB 1VA4A 1NUPA 5I9TA 3DPSA 4A5SA 1OGIA 4O4IA 1FBNA 1L8QA 1YR1A 1V8OA 2FUEA 3K96A 5KIAA 4OJQA 2VPQA 3ONVA 2AFIE 4UHJA 4BE7B 5DM70 4P5PA 4FQ7A 3RT1A 4K1LA 3SD7A 1DOHA 4MWSA 1PGPA 3RSQA 4DR6B 3EFOB 4JCOA 5B7QA 1N6LA 1OZ0A 1VJRA 4JQSA 2PLFA 1RFLA 3KR1A 4CLRA 5A7HA 3OQJA 4L4SA 5HFJA 2Y1DA 4MV7A 1PJ4A 2WFZA 3QF7A 1V1RA 3CNQS 2JANA 3TFWA 3ZJVA 3HA2A 2PUDA 3A6HA 5BQOA 1TT5A 5DXFA 1HDIA 1CZRA 1Y1QA 1PK9A 1P7ZA 2BZGA 3KJIA 1IDOA 2G5CA 3QEOA 1NNSA 2B69A 1YZLA 2DR3A 3B89A 3N2ZB 1OH5A 5HILA 1L4UA 1R8XA 2B5OA 2WTXA 4RGVA 1KDPA 3BIOA 4MKGA 1Q1EA 1MRZA 3KT0A 5JWRA 1K7FB 1X13A 3QE2A 5KB3A 2QPLA 3RAPR 5A5DA 3DF7A 5JARA 3FVQA 4HLQB 5TS2A 3HBLA 4KGZA 3AIIA 4NCIA 4UAUA 5JC1A 5HTOA 1KRXA 5GV8A 4FGWA 2PANA 4IIEA 5AVKA 2P3QA 3D6TB 5AK3A 1YFLA 2QRLA 1XRRA 4LHYA 2K4MA 2B9EA 3PPWA 3PNPA 4N7BA 1LQTA 5C8XA 1LRKA 2D8AA 1PKXA 2LDXA 3TTXA 1I0LA 1ZRSA 4Q39A 2GVNA 3PDUA 4I9FA 5EWLB 4AJ2A 4DUGA 2PVCA 4TV8F 4ERXA 3HXQA 1NUUA 1JQBA 2YV3A 1QHHB 1SBTA 3PUYA 3Q2OA 1RTTA 4P81A 3ZW8A 2J3KA 5LJLA 3FJOA 1KWGA 1AS3A 2PX4A 2ZJZA 3L7CA 1GRCA 3SR4A 3C74A 1SCBA 4QXPA 4IMPA 1UFVA 3ESZA 1PGQA 4NENB 1FEZA 1N2EA 3U3MA 4B32A 1ZW1A 2WMDA 3G5AA 3CR7A 2VBFA 3KPYA 4ENVA 3GP5A 5L3SA 1TCCA 3G49A 1JKJA 1PFYA 4X71A 3VKWA 3GY0A 3KETA 3HGQA 4Z53A 2YQZA 4H6VA 1WETA 3QLUA 4UNSA 3MN1A 4ZT6A 5HBGA 1RCTE 2WTMA 2XMPA 1Y9JA 3GCXA 5HM6A 1UOPA 3EH1A 4RJJA 2FLKA 5KVVA 1QHNA 2HFKA 3WL7A 3FOFC 2FCAA 2V8BA 2PCJA 3L8EA 3V7WA 4CIVA 3ACDA 3SS9X 1G3RA 2Q2VA 3DHWC 4OMUA 3AKDA 4X7PA 3I2IA 1ADJA 1M67A 3NB0A 1U3TA 3C3PA 4AJEA 1YAJA 2Z5FA 1P39A 1EVKA 2JGDB 2VJBA 2QRUA 2COEA 3EF0A 1V6CA 3MK31 1UPXA 3N6XA 5EWMA 4BO3A 2V1XA 4B0OA 3IHKA 5DHRA 1II8A 2VAPA 4M8KA 2AG0A 4PO9A 4EKYA 1THTA 2VN8A 2JVJA 3NQ41 1RYYA 3UK1A 3ZHYA 3JD2A 4Y9DA 2G06A 4PPGA 1IN1A 4RTPA 2WWTA 4NBUA 3TOCA 1ZIOA 4M38A 2HDOA 3MCUA 1E1QD 2NWQA 5JS7A 1WKVA 2AFVA 1FRVA 1FFCA 1J24A 1R10A 2B4TO 3FCYA 4Q01A 5DCLA 1YQWA 2C4UA 3LUFA 3DAYA 4PGHA 3ZVLA 1Z4MA 4U02A 5T3UA 1GV1A 1ZMRA 1BFKA 2C3YA 3LVFO 3MMZA 1P19A 2C2KA 1WP4A 3CM0A 1VOTA 2HGSA 1W9HA 3K0KA 3PHLA 2P6RA 2B2CA 4YQEA 5HRCA 4XGNA 5JQWA 4C2UA 2ZUUA 1L5VA 4BYMA 2QL5A 3MOIA 3OLXA 5FL7A 3AGQA 4OBEA 4E4YA 1M1YA 2BGIA 2P4SA 1SMKA 4PNEA 2E4AA 3EIOA 3MJTA 4BEWA 3W5CA 4Z9FA 2HPZA 4TYWA 3OM8A 5HZKA 5JVDF 3OE7A 5CEJA 1SBIA 2ZAMA 1DLIA 4WXRA 4MWTA 2O3UA 1GG8A 1ZM2A 3MJVA 4NBWA 3IHLA 3SJUA 1SB9A 2MINB 4O4LA 2ATVA 2R1VA 5F4ZA 5G3YA 4BB6A 3O21A 4FGZA 4LVNA 3IPCA 1RHUA 1BD4A 1L4YA 5CIYA 1MOSA 3SGLA 3V7UA 3PQ4A 1ZHHA 4P08A 5C7IO 3IOCA 4DWJA 3J81k 2NSHA 4Q7MB 1LWNA 1QHGA 2ACVA 2CDCA 1LVUA 1SUSA 2QV0A 1O2DA 1IXSB 3RYCB 1W4RA 2AKAB 3E61A 3GFFA 4QECA 4DCVA 2BMEA 1T29A 1I1QB 5D6NA 6GPBA 4DV6B 1BHSA 4YRFA 3JZDA 1PLKA 1TZBA 1IQPA 3FDXA 2J6IA 2AN3A 2VDUE 5DE3A 3DE7X 3PNMA 5H9VA 1VZ3A 5B58T 1KSFX 3CGWA 2BZSA 4KPYA 3L1HA 2GAIA 1T1IA 4RS4A 1YT5A 3AR8A 1G7RA 3K4PA 3QLVC 5KSZA 4MULA 1LTKA 5FQNA 3E0QA 4LOIA 1FQJA 2CXUA 3NRJA 2IEBA 2J3EA 1DG9A 5G1PA 2Q5EA 5EC8A 5K5EA 5AMXA 3PFCA 1VG8A 3R7FA 4MS1A 2VSXA 4U00A 2AFHA 1JKFA 2J87A 2DFNA 3A4VA 3VR1A 5KWIA 2RGRA 4X20A 3LOPA 4HFJA 3MCVA 5JECA 4DREA 2DUNA 1GJRA 3H87A 4DPMA 3LL4A 2ZI4A 4G0MA 1YS7A 4CM8A 5K8CA 4TV9A 4XI9A 3RUPA 3AXTA 4LXHA 1IWOA 3NBFA 3C98A 2GJAA 2CNLA 3P32A 3TRKA 1XMPA 4FQ5A 4L15A 4C6HA 5KNBA 3EGVA 1YL5A 2GX6A 5JASA 2JH3A 4WSOA 3UTDA 2X0NA 4HLNA 4PV7A 5EWJA 2F8LA 3BRWA 3MW8A 1WUJS 3AIKA 3CNEA