4RDJA

Crystal structure of norovirus boxer p domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
297
structure length
293
Chain Sequence
b'KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGPQTLPINGVFVFISWVSRYYQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid
molecule tags Viral protein
source organism Human calicivirus nlv/boxer/2001/us
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
total genus 68
structure length 293
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdjA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdjA01
4RPDA 5J35A 5IYRA 3ONUA 3BQJA 4RM0A 4P3IA 5BSXA 3D26A 5F4OA 5F4MA 4OP7A 4P2NA 3V7AA 4Z4YA 5IYNA 3LQEA 4X0CA 3ASQA 3PUNA 5IYWA 3Q6QA 2ZL7A 3R6KA 4X07A 4X7CA 3SLNA 4RDKA 5IYPA 4Z4UA 4WZKA 4RLZA 3BY1A 4P12A 5KW9A 4Z4RA 3PVDA 2OBTA 5F4JA 2ZL6A 4RPBA 3ASTA 1IHMA 4WZLA 4Z4WA 2OBRA 3LQ6A 3PUMA 3Q39A 4Z4TA 4QUZA 3SJPA 5BSYA 3SKBA 4QV2A 4X7FA 3ASSA 4OPSA 5IYQA 4ROXA 4WZTA 4P1VA 3ASPA 3PA2A 3ONYA 3BY2A 4Z4SA 2ZL5A 3ASRA 3Q6RA 5J3OA 4QVAA 4RDJA 3RY8A 4X05A 4X7DA 4P25A 4RDLA 5E6TA 5HZAA 4OOSA 3SLDA 4Z4ZA 3Q38A 3Q3AA 4X7EA 4P26A 4OOXA 4WZEA 4Z4VA 4OPOA 4OPVA 4OOVA 3SEJA 4QVJA 4X06A 5HZBA 2OBSA 3PA1A 3R6JA
chains in the Genus database with same CATH superfamily
5H5JA 2JIZA 4IW3B 4YAOA 4DQLA 2V7WA 1D1NA 2JN9A 1ZM2A 4XLCA 1ZM9A 2PMDA 1UD2A 2E1RA 1NJID 3GVLA 3KL9A 3CCVB 4NCNA 4XLFA 2WJYA 5IYWA 1DG1G 3GVKA 4G1BA 3Q6QA 4TMTA 1OB5A 1CNFA 2CF4A 2BN4A 2X6WA 3R6KA 2P3MA 4II2A 4TMZA 3SJZA 3WNCA 4XN0A 5FIUA 2NPFA 3SLNA 4RDKA 4TT3A 1QFJA 5IYPA 2DERA 1K73D 1H42A 1KK0A 2OK8A 3CMMA 1COWA 2X6XA 4RD0A 3FJOA 4XORA 3U2QA 1E3XA 1VJSA 2VZLA 4HE5A 2BMWA 1E79A 2WJVA 4UZFA 1QG0A 4LBWA 5HXBA 1WOPA 5HKKA 2QA4B 2DEUA 2YWHA 3VNVA 5FL7A 4ZV4A 1A8PA 4WZLA 3W2HA 3T51B 2OTJB 4YAUA 5B6IA 1T6YA 3MHPA 2OBRA 3AGPA 1D2EA 4ACBA 3T56B 4FN5A 2F43A 2C77A 1IB0A 4X8IA 4P9SA 4UZEA 4DK0A 4RD6A 4ZGNB 5L46A 3OZVA 2XOKA 1SKQA 1YLOA 4RJLA 1KJZA 3KEWA 5BSYA 1YX2A 4QV2A 4X7FA 4B3FX 4C0SA 2V7XA 4XQFA 4E0FA 2DY1A 1QVGB 1VQ5B 1WTHD 3JQQA 3BCDA 1QX4A 4NNJA 4TMVA 4DNTB 4YHBA 5TV2A 1VF7A 3ES9A 4YAFA 3OKXA 1FNCA 1KD1D 2VBSA 3CW2A 3ONYA 4PAAA 3BY2A 3WNDA 3ZZTA 4UAJA 1AIPA 1EP2B 1T5EA 1N08A 3QFSA 4R71A 4Y7CA 1VQ7B 1SKYB 4RD4A 3AVWA 1T6XA 4TN1A 4TSFA 1YJWB 2V7UA 1FNBA 5IK2A 4RD2A 1Y0RA 1XQBA 2VNHA 1UD5A 4L8JA 1WOSA 1PJ5A 1GAQA 2XZLA 1N06A 5FO0A 3J81k 3AVXA 4Y9RA 4RDLA 4XNFA 1GJRA 2RC6A 2NV4A 1ZM4A 1TLLA 2BM0A 3SLDA 1E43A 3P27A 1TUIA 2QTLA 1FDRA 3E20A 4ACAA 4JMQA 1V0FA 1WSRA 2X3UA 4OOXA 4P3YA 1M90D 1YJNB 3W5UA 3SEJA 4FWTA 4QVJA 2PLFA 4ZCIA 1I7PA 4B47A 2W6JA 2QTZA 1F60A 2F1LA 2X0KA 3OEHA 1KZLA 1G7CA 2GQFA 4G7WA 2BGIA 4M4SA 4Z4YA 1Y0YA 4Z1MA 5IYNA 1VQ9B 2BSAA 1G7RA 3CCEB 2J7KA 2YWGA 3LQEA 1VQMB 2JJ1A 4PC2A 3T53B 3ZZ0A 3A8JA 1Q9SA 3PUNA 1NRKA 5TRDA 2XNJA 3I56B 2VNIA 4M2LA 4C43A 2ZZFA 4Q7JB 3V76A 1E1RA 2V31A 1YHQB 3ZC3A 1JB9A 3OAAA 1MABA 1QGAA 3QFCA 3JQRA 4PGOA 4N3NA 4XLHA 4DQKA 2ZBUA 2D3LA 4P6YA 2B7CA 2DETA 3BY1A 5KW9A 2EIXA 2GK6A 3E1YE 3CCRB 1WDTA 3ZUGA 4XR6A 2ZXIA 4NBSA 4XLEA 3NE5B 5A8AA 3OEEA 3AVTA 2PIAA 2F1MA 3WQZA 4RPBA 3ASTA 3WYAA 1N05A 2V7VA 4QFMA 2GJPA 3PUMA 3Q39A 4Z4TA 4QUZA 1E3ZA 5TY0A 2Q6LA 2FVGA 1BJKA 4BPRA 1DDIA 1Q7YD 1P4MA 1G7SA 2R6HA 2VNKA 3BNWA 2Q6OA 1OB2A 3FPPA 1W2BB 3ASSA 4OPSA 2BM1A 3MMPA 3FPKA 3OPOA 4U9UA 1RQPA 4WZTA 4P1VA 3W2GA 3CC2B 1W9XA 3GSIA 3ASPA 3GQBA 2D9RA 2WR8A 4YXWA 1V5VA 3JQPA 3CPWB 2X53S 2PE3A 4GQNA 3OW7A 1VQOB 1R5BA 4YELA 4UZUA 1I8DA 5DS0A 1F20A 2ZZQA 2OK7A 3AVUA 2ZL5A 3ASRA 1FX0A 3WBKA 3BH4A 4RDJA 4ASUA 2ZTNA 2M5SA 3RY8A 1OGIA 2DIEA 4XKWA 4XOPA 5EMNA 2C4UA 3A35A 1KC8D 4PABA 2X8KA 1ZUNB 5GV8A 4X7DA 1UD3A 3CTAA 4MYUA 4P25A 5E6TA 4AVZA 2W6IA 3ZBTA 3QE2A 1TTTA 2BF4A 1EWYA 3ISXA 1W34A 4YEJA 3Q38A 2GJRA 1N07A 3Q3AA 1GO2A 4X7EA 1I18A 3OE7A 3QFTA 1S72B 4PC3A 3HAGA 3OJWA 1H8HA 4X06A 4XOTA 1UD4A 1JJ2B 3R6JA 3CMEB 1WU8A 5J35A 2GREA 4G1VA 5IYRA 1G7TA 4PC1A 2XZOA 2V4DA 3ONUA 4PC6A 2R9VA 2BGJA 2DOGA 2VYQA 4YAWA 4P3IA 2AHOA 1R5NA 1WPCA 5BSXA 1BQEA 1FRQA 3D26A 3V7AA 5DSZA 4MYTA 3WNBA 3H9NA 1GVHA 2VJIA 1NDHA 4RD1A 3W2FA 5DN6A 4XONA 4X0CA 4Y9UA 3ASQA 3W5HA 3CD6B 1XE1A 2HMAA 2C4TA 4G6IA 2VBUA 2YWEA 4QHYA 3AGQA 3LO8A 4X07A 5GV7A 3PENA 4KKUA 4X7CA 1KRHA 3I1FA 4FXUA 4Z4UA 1W0KA 1HA3A 2I1LA 3VNUA 4RLZA 3OZWA 1PJ7A 3BC9A 2HLDA 1R5OA 4Z4RA 2CW5A 2C78A 4J0QA 2OBTA 3CC7B 3OOCA 3CB4A 2OYNA 5KNLA 3CP2A 1YI2B 2B5OA 4II3A 5F4JA 1XB2A 4KKSA 2ZL6A 3VMFA 4ZGQB 1OHHA 2C5HA 4DK1A 3LQ6A 2Q6IA 1W87A 3W5VA 4B48A 1S0UA 3G71B 1KQSB 1N0UA 5AN9A 1VQ6B 2XGJA 1BMFA 1EP1B 3B82A 1PKVA 1BPLA 2V7TA 2V7QA 1MRZA 4XLAA 3SKBA 2ZXHA 3DDYA 1QH0A 2B7BA 1HZEA 4P22A 1NB0A 5IYQA 2HCJB 4TMWA 1VQ8B 3QSYA 5A88A 1N8RD 4ROXA 1DDGA 5CDFA 1HVXA 3CCUB 4G5GA 4DNRB 1NBMA 1H8EA 3U6BA 1J9ZA 4XM3A 4YALA 4AF6A 4B3XA 2JJ2A 3CMAB 3VO1A 1IJFA 2XZPA 1ELOA 2CK3A 4XMYA 1BX1A 1VHOA 4TKOB 4Z4SA 1EFCA 1N0VC 1WOOA 5J3OA 4XN3A 1DARA 4F7DA 2QDXA 3LNNA 3WY9A 4QVAA 1B2RA 4WQMA 2D3NA 2ZZGA 3OW2B 2QEXB 3OZUA 1K8AD 1EFUA 1UMKA 2GJKA 4X05A 2QE7A 2EFGA 4ZCMA 2CRVA 1V0EA 1SM4A 4B44A 4Z4ZA 3VO2A 3GVJA 1E62A 4LC0A 3WBJA 1UD8A 4OPOA 3ZPNA 2BVNA 1TVCA 4OOVA 2XNCA 4RPDA 4RD3A 2WZPP 4HIZA 4CQJA 2QN6A 1NB9A 4ZCLA 3G05A 5LMZA 3BQJA 4RM0A 3QFRA 4N3GA 3B8HA 1FNDA 5THXA 1FNMA 3OP1A 1M1KD 5F4OA 5F4MA 5KSWB 2ZITA 2WYRA 3OFNA 4OP7A 4P2NA 2ZTGA 2F4NA 1WORA 2XNDA 2ZZEA 5FNZA 4G7XA 2QMUA 1YIJB 1Q82D 1KMHA 5FA6A 2VNJA 1JNYA 2ZBVA 3B78A 1OB0A 2BV3A 1UD6A 2ZL7A 2KVOA 4M1KA 3VR6A 1WP6A 1QGYA 1ZM3A 1JA1A 1QFYA 4AC9A 4XL9A 1W35A 4B4DA 1QVFB 5TR9A 4WZKA 1VQKB 4PC7A 1K9MD 4LBZA 4P12A 1IJEA 3W2IA 2WSSA 2C2WA 2DCUA 4M53A 1YJ9B 3PVDA 1Q81D 3CCJB 3G4SB 2DYIA 1VQPB 1KK2A 2JDIA 1IHMA 2FX3A 2YWFA 4RCYA 4Z4WA 4XD7A 2C5BA 1FRNA 2VJJA 3I55B 4H9GA 1QUFA 2CNDA 3CCQB 1VHEA 3A3GA 3SJPA 1VQLB 3CCMB 3A8KA 2CBXA 3FKSA 3WXMA 1VLYA 3CP8A 2GPJA 1EXMA 4B43A 4FK8A 2GK7A 5H59A 4B3GA 2XEXA 3H94A 3A1PA 2QGGA 3BCFA 3MCAA 3ZIAA 3A3BA 1Q86D 4LBYA 2X85A 3JU4A 3P26A 3CCSB 2LZJA 3PA2A 3CPXA 4P6VF 3CESA 2Z6BD 1EP3B 1B23P 1CNEA 1JA0A 1OGJA 1QGZA 3CXCB 2VBTA 1E64A 1D8TA 1H85A 2Q6KA 3LVBA 1CQXA 4EH1A 3CC4B 5A89A 2HDNB 1E63A 2X6YA 4LBVA 2CC2A 5FO1A 3GIRA 3ZZUA 1K28D 4M0LA 3OJXA 3Q6RA 3CCLB 1QUEA 3AVVA 3ZBUA 1GR1A 1PJ6A 2BPOA 1BLIA 1U2RA 1RQRA 2D74A 2WPDA 1BX0A 3CRZA 1VLOA 1VQ4B 1QFZA 2VBVA 1EFTA 1KTVA 1T6ZA 4AF7A 1VQNB 1S4MA 4TMXA 2E1BA 5HZAA 1YITB 4K1XA 4KKTA 4OOSA 1EFRA 4XKVA 4HE6A 1KK1A 2RC5A 3A8IA 4P26A 4WZEA 4Z4VA 3W2EA 5JBQA 3U6KA 1WSVA 4WWVA 4OPVA 3G6EB 2OTLB 1E1QA 1W0JA 4RCZA 3AVYA 1GAWA 1KK3A 1XFOA 5HZBA 1AMOA 2OBSA 3PA1A 2WZNA
chains in the Genus database with same CATH topology
4RPDA 5J35A 5IYRA 3ONUA 3BQJA 4RM0A 4P3IA 5BSXA 3D26A 5F4OA 5F4MA 4OP7A 4P2NA 3V7AA 4Z4YA 5IYNA 3LQEA 4X0CA 3ASQA 3PUNA 5IYWA 3Q6QA 2ZL7A 3R6KA 4X07A 4X7CA 3SLNA 4RDKA 5IYPA 4Z4UA 4WZKA 4RLZA 3BY1A 4P12A 5KW9A 4Z4RA 3PVDA 2OBTA 5F4JA 2ZL6A 4RPBA 3ASTA 1IHMA 4WZLA 4Z4WA 2OBRA 3LQ6A 3PUMA 3Q39A 4Z4TA 4QUZA 3SJPA 5BSYA 3SKBA 4QV2A 4X7FA 3ASSA 4OPSA 5IYQA 4ROXA 4WZTA 4P1VA 3ASPA 3PA2A 3ONYA 3BY2A 4Z4SA 2ZL5A 3ASRA 3Q6RA 5J3OA 4QVAA 4RDJA 3RY8A 4X05A 4X7DA 4P25A 4RDLA 5E6TA 5HZAA 4OOSA 3SLDA 4Z4ZA 3Q38A 3Q3AA 4X7EA 4P26A 4OOXA 4WZEA 4Z4VA 4OPOA 4OPVA 4OOVA 3SEJA 4QVJA 4X06A 5HZBA 2OBSA 3PA1A 3R6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPD A;  5J35 A;  5IYR A;  3ONU A;  3BQJ A;  4RM0 A;  4P3I A;  5BSX A;  3D26 A;  5F4O A;  5F4M A;  4OP7 A;  4P2N A;  3V7A A;  4Z4Y A;  5IYN A;  3LQE A;  4X0C A;  3ASQ A;  3PUN A;  5IYW A;  3Q6Q A;  2ZL7 A;  3R6K A;  4X07 A;  4X7C A;  3SLN A;  4RDK A;  5IYP A;  4Z4U A;  4WZK A;  4RLZ A;  3BY1 A;  4P12 A;  5KW9 A;  4Z4R A;  3PVD A;  2OBT A;  5F4J A;  2ZL6 A;  4RPB A;  3AST A;  1IHM A;  4WZL A;  4Z4W A;  2OBR A;  3LQ6 A;  3PUM A;  3Q39 A;  4Z4T A;  4QUZ A;  3SJP A;  5BSY A;  3SKB A;  4QV2 A;  4X7F A;  3ASS A;  4OPS A;  5IYQ A;  4ROX A;  4WZT A;  4P1V A;  3ASP A;  3PA2 A;  3ONY A;  3BY2 A;  4Z4S A;  2ZL5 A;  3ASR A;  3Q6R A;  5J3O A;  4QVA A;  4RDJ A;  3RY8 A;  4X05 A;  4X7D A;  4P25 A;  4RDL A;  5E6T A;  5HZA A;  4OOS A;  3SLD A;  4Z4Z A;  3Q38 A;  3Q3A A;  4X7E A;  4P26 A;  4OOX A;  4WZE A;  4Z4V A;  4OPO A;  4OPV A;  4OOV A;  3SEJ A;  4QVJ A;  4X06 A;  5HZB A;  2OBS A;  3PA1 A;  3R6J A; 
#chains in the Genus database with same CATH topology
 5H5J A;  2JIZ A;  4IW3 B;  4YAO A;  4DQL A;  2V7W A;  1D1N A;  2JN9 A;  1ZM2 A;  4XLC A;  1ZM9 A;  2PMD A;  1UD2 A;  2E1R A;  1NJI D;  3GVL A;  3KL9 A;  3CCV B;  4NCN A;  4XLF A;  2WJY A;  5IYW A;  1DG1 G;  3GVK A;  4G1B A;  3Q6Q A;  4TMT A;  1OB5 A;  1CNF A;  2CF4 A;  2BN4 A;  2X6W A;  3R6K A;  2P3M A;  4II2 A;  4TMZ A;  3SJZ A;  3WNC A;  4XN0 A;  5FIU A;  2NPF A;  3SLN A;  4RDK A;  4TT3 A;  1QFJ A;  5IYP A;  2DER A;  1K73 D;  1H42 A;  1KK0 A;  2OK8 A;  3CMM A;  1COW A;  2X6X A;  4RD0 A;  3FJO A;  4XOR A;  3U2Q A;  1E3X A;  1VJS A;  2VZL A;  4HE5 A;  2BMW A;  1E79 A;  2WJV A;  4UZF A;  1QG0 A;  4LBW A;  5HXB A;  1WOP A;  5HKK A;  2QA4 B;  2DEU A;  2YWH A;  3VNV A;  5FL7 A;  4ZV4 A;  1A8P A;  4WZL A;  3W2H A;  3T51 B;  2OTJ B;  4YAU A;  5B6I A;  1T6Y A;  3MHP A;  2OBR A;  3AGP A;  1D2E A;  4ACB A;  3T56 B;  4FN5 A;  2F43 A;  2C77 A;  1IB0 A;  4X8I A;  4P9S A;  4UZE A;  4DK0 A;  4RD6 A;  4ZGN B;  5L46 A;  3OZV A;  2XOK A;  1SKQ A;  1YLO A;  4RJL A;  1KJZ A;  3KEW A;  5BSY A;  1YX2 A;  4QV2 A;  4X7F A;  4B3F X;  4C0S A;  2V7X A;  4XQF A;  4E0F A;  2DY1 A;  1QVG B;  1VQ5 B;  1WTH D;  3JQQ A;  3BCD A;  1QX4 A;  4NNJ A;  4TMV A;  4DNT B;  4YHB A;  5TV2 A;  1VF7 A;  3ES9 A;  4YAF A;  3OKX A;  1FNC A;  1KD1 D;  2VBS A;  3CW2 A;  3ONY A;  4PAA A;  3BY2 A;  3WND A;  3ZZT A;  4UAJ A;  1AIP A;  1EP2 B;  1T5E A;  1N08 A;  3QFS A;  4R71 A;  4Y7C A;  1VQ7 B;  1SKY B;  4RD4 A;  3AVW A;  1T6X A;  4TN1 A;  4TSF A;  1YJW B;  2V7U A;  1FNB A;  5IK2 A;  4RD2 A;  1Y0R A;  1XQB A;  2VNH A;  1UD5 A;  4L8J A;  1WOS A;  1PJ5 A;  1GAQ A;  2XZL A;  1N06 A;  5FO0 A;  3J81 k;  3AVX A;  4Y9R A;  4RDL A;  4XNF A;  1GJR A;  2RC6 A;  2NV4 A;  1ZM4 A;  1TLL A;  2BM0 A;  3SLD A;  1E43 A;  3P27 A;  1TUI A;  2QTL A;  1FDR A;  3E20 A;  4ACA A;  4JMQ A;  1V0F A;  1WSR A;  2X3U A;  4OOX A;  4P3Y A;  1M90 D;  1YJN B;  3W5U A;  3SEJ A;  4FWT A;  4QVJ A;  2PLF A;  4ZCI A;  1I7P A;  4B47 A;  2W6J A;  2QTZ A;  1F60 A;  2F1L A;  2X0K A;  3OEH A;  1KZL A;  1G7C A;  2GQF A;  4G7W A;  2BGI A;  4M4S A;  4Z4Y A;  1Y0Y A;  4Z1M A;  5IYN A;  1VQ9 B;  2BSA A;  1G7R A;  3CCE B;  2J7K A;  2YWG A;  3LQE A;  1VQM B;  2JJ1 A;  4PC2 A;  3T53 B;  3ZZ0 A;  3A8J A;  1Q9S A;  3PUN A;  1NRK A;  5TRD A;  2XNJ A;  3I56 B;  2VNI A;  4M2L A;  4C43 A;  2ZZF A;  4Q7J B;  3V76 A;  1E1R A;  2V31 A;  1YHQ B;  3ZC3 A;  1JB9 A;  3OAA A;  1MAB A;  1QGA A;  3QFC A;  3JQR A;  4PGO A;  4N3N A;  4XLH A;  4DQK A;  2ZBU A;  2D3L A;  4P6Y A;  2B7C A;  2DET A;  3BY1 A;  5KW9 A;  2EIX A;  2GK6 A;  3E1Y E;  3CCR B;  1WDT A;  3ZUG A;  4XR6 A;  2ZXI A;  4NBS A;  4XLE A;  3NE5 B;  5A8A A;  3OEE A;  3AVT A;  2PIA A;  2F1M A;  3WQZ A;  4RPB A;  3AST A;  3WYA A;  1N05 A;  2V7V A;  4QFM A;  2GJP A;  3PUM A;  3Q39 A;  4Z4T A;  4QUZ A;  1E3Z A;  5TY0 A;  2Q6L A;  2FVG A;  1BJK A;  4BPR A;  1DDI A;  1Q7Y D;  1P4M A;  1G7S A;  2R6H A;  2VNK A;  3BNW A;  2Q6O A;  1OB2 A;  3FPP A;  1W2B B;  3ASS A;  4OPS A;  2BM1 A;  3MMP A;  3FPK A;  3OPO A;  4U9U A;  1RQP A;  4WZT A;  4P1V A;  3W2G A;  3CC2 B;  1W9X A;  3GSI A;  3ASP A;  3GQB A;  2D9R A;  2WR8 A;  4YXW A;  1V5V A;  3JQP A;  3CPW B;  2X53 S;  2PE3 A;  4GQN A;  3OW7 A;  1VQO B;  1R5B A;  4YEL A;  4UZU A;  1I8D A;  5DS0 A;  1F20 A;  2ZZQ A;  2OK7 A;  3AVU A;  2ZL5 A;  3ASR A;  1FX0 A;  3WBK A;  3BH4 A;  4RDJ A;  4ASU A;  2ZTN A;  2M5S A;  3RY8 A;  1OGI A;  2DIE A;  4XKW A;  4XOP A;  5EMN A;  2C4U A;  3A35 A;  1KC8 D;  4PAB A;  2X8K A;  1ZUN B;  5GV8 A;  4X7D A;  1UD3 A;  3CTA A;  4MYU A;  4P25 A;  5E6T A;  4AVZ A;  2W6I A;  3ZBT A;  3QE2 A;  1TTT A;  2BF4 A;  1EWY A;  3ISX A;  1W34 A;  4YEJ A;  3Q38 A;  2GJR A;  1N07 A;  3Q3A A;  1GO2 A;  4X7E A;  1I18 A;  3OE7 A;  3QFT A;  1S72 B;  4PC3 A;  3HAG A;  3OJW A;  1H8H A;  4X06 A;  4XOT A;  1UD4 A;  1JJ2 B;  3R6J A;  3CME B;  1WU8 A;  5J35 A;  2GRE A;  4G1V A;  5IYR A;  1G7T A;  4PC1 A;  2XZO A;  2V4D A;  3ONU A;  4PC6 A;  2R9V A;  2BGJ A;  2DOG A;  2VYQ A;  4YAW A;  4P3I A;  2AHO A;  1R5N A;  1WPC A;  5BSX A;  1BQE A;  1FRQ A;  3D26 A;  3V7A A;  5DSZ A;  4MYT A;  3WNB A;  3H9N A;  1GVH A;  2VJI A;  1NDH A;  4RD1 A;  3W2F A;  5DN6 A;  4XON A;  4X0C A;  4Y9U A;  3ASQ A;  3W5H A;  3CD6 B;  1XE1 A;  2HMA A;  2C4T A;  4G6I A;  2VBU A;  2YWE A;  4QHY A;  3AGQ A;  3LO8 A;  4X07 A;  5GV7 A;  3PEN A;  4KKU A;  4X7C A;  1KRH A;  3I1F A;  4FXU A;  4Z4U A;  1W0K A;  1HA3 A;  2I1L A;  3VNU A;  4RLZ A;  3OZW A;  1PJ7 A;  3BC9 A;  2HLD A;  1R5O A;  4Z4R A;  2CW5 A;  2C78 A;  4J0Q A;  2OBT A;  3CC7 B;  3OOC A;  3CB4 A;  2OYN A;  5KNL A;  3CP2 A;  1YI2 B;  2B5O A;  4II3 A;  5F4J A;  1XB2 A;  4KKS A;  2ZL6 A;  3VMF A;  4ZGQ B;  1OHH A;  2C5H A;  4DK1 A;  3LQ6 A;  2Q6I A;  1W87 A;  3W5V A;  4B48 A;  1S0U A;  3G71 B;  1KQS B;  1N0U A;  5AN9 A;  1VQ6 B;  2XGJ A;  1BMF A;  1EP1 B;  3B82 A;  1PKV A;  1BPL A;  2V7T A;  2V7Q A;  1MRZ A;  4XLA A;  3SKB A;  2ZXH A;  3DDY A;  1QH0 A;  2B7B A;  1HZE A;  4P22 A;  1NB0 A;  5IYQ A;  2HCJ B;  4TMW A;  1VQ8 B;  3QSY A;  5A88 A;  1N8R D;  4ROX A;  1DDG A;  5CDF A;  1HVX A;  3CCU B;  4G5G A;  4DNR B;  1NBM A;  1H8E A;  3U6B A;  1J9Z A;  4XM3 A;  4YAL A;  4AF6 A;  4B3X A;  2JJ2 A;  3CMA B;  3VO1 A;  1IJF A;  2XZP A;  1ELO A;  2CK3 A;  4XMY A;  1BX1 A;  1VHO A;  4TKO B;  4Z4S A;  1EFC A;  1N0V C;  1WOO A;  5J3O A;  4XN3 A;  1DAR A;  4F7D A;  2QDX A;  3LNN A;  3WY9 A;  4QVA A;  1B2R A;  4WQM A;  2D3N A;  2ZZG A;  3OW2 B;  2QEX B;  3OZU A;  1K8A D;  1EFU A;  1UMK A;  2GJK A;  4X05 A;  2QE7 A;  2EFG A;  4ZCM A;  2CRV A;  1V0E A;  1SM4 A;  4B44 A;  4Z4Z A;  3VO2 A;  3GVJ A;  1E62 A;  4LC0 A;  3WBJ A;  1UD8 A;  4OPO A;  3ZPN A;  2BVN A;  1TVC A;  4OOV A;  2XNC A;  4RPD A;  4RD3 A;  2WZP P;  4HIZ A;  4CQJ A;  2QN6 A;  1NB9 A;  4ZCL A;  3G05 A;  5LMZ A;  3BQJ A;  4RM0 A;  3QFR A;  4N3G A;  3B8H A;  1FND A;  5THX A;  1FNM A;  3OP1 A;  1M1K D;  5F4O A;  5F4M A;  5KSW B;  2ZIT A;  2WYR A;  3OFN A;  4OP7 A;  4P2N A;  2ZTG A;  2F4N A;  1WOR A;  2XND A;  2ZZE A;  5FNZ A;  4G7X A;  2QMU A;  1YIJ B;  1Q82 D;  1KMH A;  5FA6 A;  2VNJ A;  1JNY A;  2ZBV A;  3B78 A;  1OB0 A;  2BV3 A;  1UD6 A;  2ZL7 A;  2KVO A;  4M1K A;  3VR6 A;  1WP6 A;  1QGY A;  1ZM3 A;  1JA1 A;  1QFY A;  4AC9 A;  4XL9 A;  1W35 A;  4B4D A;  1QVF B;  5TR9 A;  4WZK A;  1VQK B;  4PC7 A;  1K9M D;  4LBZ A;  4P12 A;  1IJE A;  3W2I A;  2WSS A;  2C2W A;  2DCU A;  4M53 A;  1YJ9 B;  3PVD A;  1Q81 D;  3CCJ B;  3G4S B;  2DYI A;  1VQP B;  1KK2 A;  2JDI A;  1IHM A;  2FX3 A;  2YWF A;  4RCY A;  4Z4W A;  4XD7 A;  2C5B A;  1FRN A;  2VJJ A;  3I55 B;  4H9G A;  1QUF A;  2CND A;  3CCQ B;  1VHE A;  3A3G A;  3SJP A;  1VQL B;  3CCM B;  3A8K A;  2CBX A;  3FKS A;  3WXM A;  1VLY A;  3CP8 A;  2GPJ A;  1EXM A;  4B43 A;  4FK8 A;  2GK7 A;  5H59 A;  4B3G A;  2XEX A;  3H94 A;  3A1P A;  2QGG A;  3BCF A;  3MCA A;  3ZIA A;  3A3B A;  1Q86 D;  4LBY A;  2X85 A;  3JU4 A;  3P26 A;  3CCS B;  2LZJ A;  3PA2 A;  3CPX A;  4P6V F;  3CES A;  2Z6B D;  1EP3 B;  1B23 P;  1CNE A;  1JA0 A;  1OGJ A;  1QGZ A;  3CXC B;  2VBT A;  1E64 A;  1D8T A;  1H85 A;  2Q6K A;  3LVB A;  1CQX A;  4EH1 A;  3CC4 B;  5A89 A;  2HDN B;  1E63 A;  2X6Y A;  4LBV A;  2CC2 A;  5FO1 A;  3GIR A;  3ZZU A;  1K28 D;  4M0L A;  3OJX A;  3Q6R A;  3CCL B;  1QUE A;  3AVV A;  3ZBU A;  1GR1 A;  1PJ6 A;  2BPO A;  1BLI A;  1U2R A;  1RQR A;  2D74 A;  2WPD A;  1BX0 A;  3CRZ A;  1VLO A;  1VQ4 B;  1QFZ A;  2VBV A;  1EFT A;  1KTV A;  1T6Z A;  4AF7 A;  1VQN B;  1S4M A;  4TMX A;  2E1B A;  5HZA A;  1YIT B;  4K1X A;  4KKT A;  4OOS A;  1EFR A;  4XKV A;  4HE6 A;  1KK1 A;  2RC5 A;  3A8I A;  4P26 A;  4WZE A;  4Z4V A;  3W2E A;  5JBQ A;  3U6K A;  1WSV A;  4WWV A;  4OPV A;  3G6E B;  2OTL B;  1E1Q A;  1W0J A;  4RCZ A;  3AVY A;  1GAW A;  1KK3 A;  1XFO A;  5HZB A;  1AMO A;  2OBS A;  3PA1 A;  2WZN A; 
#chains in the Genus database with same CATH homology
 4RPD A;  5J35 A;  5IYR A;  3ONU A;  3BQJ A;  4RM0 A;  4P3I A;  5BSX A;  3D26 A;  5F4O A;  5F4M A;  4OP7 A;  4P2N A;  3V7A A;  4Z4Y A;  5IYN A;  3LQE A;  4X0C A;  3ASQ A;  3PUN A;  5IYW A;  3Q6Q A;  2ZL7 A;  3R6K A;  4X07 A;  4X7C A;  3SLN A;  4RDK A;  5IYP A;  4Z4U A;  4WZK A;  4RLZ A;  3BY1 A;  4P12 A;  5KW9 A;  4Z4R A;  3PVD A;  2OBT A;  5F4J A;  2ZL6 A;  4RPB A;  3AST A;  1IHM A;  4WZL A;  4Z4W A;  2OBR A;  3LQ6 A;  3PUM A;  3Q39 A;  4Z4T A;  4QUZ A;  3SJP A;  5BSY A;  3SKB A;  4QV2 A;  4X7F A;  3ASS A;  4OPS A;  5IYQ A;  4ROX A;  4WZT A;  4P1V A;  3ASP A;  3PA2 A;  3ONY A;  3BY2 A;  4Z4S A;  2ZL5 A;  3ASR A;  3Q6R A;  5J3O A;  4QVA A;  4RDJ A;  3RY8 A;  4X05 A;  4X7D A;  4P25 A;  4RDL A;  5E6T A;  5HZA A;  4OOS A;  3SLD A;  4Z4Z A;  3Q38 A;  3Q3A A;  4X7E A;  4P26 A;  4OOX A;  4WZE A;  4Z4V A;  4OPO A;  4OPV A;  4OOV A;  3SEJ A;  4QVJ A;  4X06 A;  5HZB A;  2OBS A;  3PA1 A;  3R6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...