4RDJA

Crystal structure of norovirus boxer p domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
297
structure length
293
Chain Sequence
KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGPQTLPINGVFVFISWVSRYYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
source organism Human calicivirus nlv/boxer/2001/us
molecule tags Viral protein
total genus 68
structure length 293
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdjA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdjA01
3BY2A 5J3OA 3Q38A 4X05A 4QV2A 3ONUA 4RDLA 3ASPA 4RLZA 5IYPA 3PA2A 4Z4WA 3BY1A 4QVAA 4X0CA 4P1VA 5BSYA 2OBSA 4OOXA 4Z4RA 4P26A 5J35A 4X07A 2ZL7A 3ASSA 4QUZA 4Z4YA 4RDJA 5KW9A 5HZAA 5IYQA 4OPVA 4Z4VA 4X7FA 2ZL5A 3R6JA 3LQEA 4WZEA 3PVDA 3SJPA 3RY8A 3PUNA 4RDKA 3ONYA 4Z4ZA 3Q6RA 4WZKA 4P12A 5IYWA 3ASTA 4WZTA 5F4MA 3SLDA 2OBTA 3D26A 5E6TA 4P2NA 2OBRA 2ZL6A 5BSXA 3ASRA 5IYRA 4OP7A 4RPDA 5F4OA 4OPSA 4X7DA 3SLNA 4OOSA 3Q6QA 4ROXA 3PUMA 3V7AA 4RM0A 5F4JA 4Z4UA 4X06A 3Q3AA 3SEJA 4WZLA 4X7EA 3SKBA 4Z4TA 4OPOA 3PA1A 3LQ6A 3Q39A 5HZBA 3ASQA 3BQJA 5IYNA 4Z4SA 4P3IA 4RPBA 4X7CA 4OOVA 3R6KA 4QVJA 4P25A 1IHMA
chains in the Genus database with same CATH superfamily
1TLLA 5J3OA 4YALA 4BPRA 1AMOA 5A88A 1F60A 2DETA 4WQMA 3CTAA 3U6BA 2ZZFA 3E20A 3A1PA 4PC3A 4F7DA 1K9MD 4B3XA 2ZZEA 4G7WA 1EFTA 2EIXA 3ONUA 4PAAA 1A8PA 2WJVA 3OKXA 2VYQA 1H85A 3CCMB 5CDFA 2BMWA 3A3BA 1EXMA 1WSVA 4DQLA 1KZLA 1FRNA 1V0EA 2QTLA 3U2QA 4XKWA 2XZLA 2F43A 4P1VA 1Q7YD 3KL9A 4Y9RA 2X53S 5J35A 4TMZA 3PENA 4WWVA 3OEHA 4QUZA 2PMDA 1QFJA 2GK6A 3GQBA 4RDJA 1K28D 2F1MA 5FIUA 1UD3A 4P6VF 1VQNB 1WU8A 2X6WA 5IYQA 4II3A 1R5OA 1D2EA 3R6JA 4XL9A 2V7QA 5GV7A 4RD3A 3VO2A 1WDTA 3VR6A 4ZCLA 4FXUA 1WSRA 3SJPA 3P27A 4M1KA 5FNZA 5HXBA 3BC9A 1VQ6B 1BX0A 1ZM9A 2HMAA 4FK8A 1KK1A 1T6XA 3JU4A 1CNFA 4Y7CA 1EP3B 2QTZA 4N3NA 4XKVA 1FDRA 2OBTA 4XQFA 4TMWA 4B43A 1WOOA 2WSSA 1YI2B 1HZEA 5E6TA 4XLAA 2GK7A 2PE3A 2PLFA 1UMKA 3G6EB 2CNDA 4MYTA 4DQKA 1YJWB 2ZL6A 1VF7A 1AIPA 3CP8A 2WR8A 1KK2A 2BM0A 1UD5A 3CPWB 1VQOB 4YAUA 4PGOA 4XNFA 2VBUA 5DS0A 3W2FA 1BJKA 1IB0A 1EP1B 1QUEA 1UD2A 1UD6A 1V5VA 3W5UA 4X7DA 3U6KA 1EFRA 2CBXA 3A8KA 3Q6QA 3I55B 1KQSB 4PC1A 1OGJA 4KKUA 2V7TA 3OZWA 4HE5A 4PABA 3V7AA 1KC8D 1R5BA 4TN1A 2BM1A 2Q6LA 4G6IA 1CQXA 4Z4TA 4M0LA 3WNCA 4EH1A 4OPOA 3B78A 4XOTA 3VO1A 3CMAB 1N08A 2QDXA 2VZLA 2J7KA 3WBKA 2C2WA 4AVZA 1QG0A 4P3IA 4UZEA 3ZUGA 2C4UA 1N0VC 1E1RA 4GQNA 2XNCA 1Q81D 4UAJA 4QVJA 4TMXA 2D9RA 1IJFA 2BV3A 3P26A 3CC7B 4QHYA 4P3YA 4X05A 1YJNB 1N07A 1NRKA 3GSIA 2VJIA 3GVLA 1E63A 1T6ZA 4RLZA 3CB4A 1NDHA 4ZCIA 1EFCA 2GJPA 2OK8A 1VQ9B 4Z4WA 1QFZA 1I7PA 1KK0A 2D3NA 2VJJA 3T53B 2VNHA 1Q86D 2VBSA 2HLDA 3BY1A 3J81k 3H9NA 4J0QA 4MYUA 1VJSA 3W2EA 3MHPA 1OHHA 4UZUA 4AF6A 4OOXA 4B44A 5BSYA 2ZBVA 3CCQB 2Z6BD 3AGQA 1GR1A 3ASSA 2RC5A 1VQKB 1UD8A 4Z4YA 1QVFB 5KW9A 3W5VA 1EP2B 3FJOA 2OTJB 5FA6A 3CESA 3OW7A 1Y0YA 3LVBA 3OEEA 4P9SA 2EFGA 2ZL5A 4B48A 2C5BA 4P6YA 1OB0A 1E3XA 3LQEA 3AVVA 2C5HA 4JMQA 2B7BA 2GREA 4HIZA 1S72B 1GAWA 1D8TA 2B5OA 4ACAA 4Z4ZA 2W6IA 4R71A 1HA3A 4P12A 2B7CA 5TV2A 5IYWA 3FKSA 3V76A 2GPJA 2KVOA 5H5JA 3CCLB 5HKKA 1ZM3A 1YJ9B 4M4SA 3AVYA 3G71B 2DOGA 4NCNA 3ZIAA 2OBRA 2V4DA 2YWFA 3B82A 3OPOA 2ZTGA 2VBVA 1D1NA 2FVGA 3WY9A 3OJXA 3ZZUA 3CCVB 3CCUB 1VLOA 3W2HA 5F4OA 4RD1A 1DG1G 2Q6IA 1W87A 4Z1MA 3OZUA 3CCJB 4NBSA 1T5EA 2QE7A 3CPXA 3LO8A 4XMYA 3T51B 1WPCA 1GVHA 2JJ1A 1IJEA 2CK3A 4LBVA 4ROXA 3AGPA 1H8EA 2JDIA 1G7CA 5TR9A 2GJRA 4RM0A 2VNJA 5F4JA 4WZLA 5FL7A 4CQJA 1ZUNB 1OB5A 1W35A 3ASQA 3I1FA 1N06A 1YX2A 1QX4A 4Z4SA 3I56B 1VQ8B 4XN3A 3JQRA 2FX3A 4YELA 1KK3A 2RC6A 1VQ4B 3W5HA 1QGZA 1E79A 3OZVA 1FNDA 4H9GA 1PJ5A 1WOPA 4X7CA 2X8KA 3R6KA 4PC6A 2NPFA 3ZC3A 1K8AD 4XD7A 1IHMA 4C43A 3SJZA 2BGJA 3CCSB 3CRZA 2XGJA 2C4TA 3BY2A 4XLFA 3Q38A 3WQZA 4YAFA 3OOCA 1FNBA 5FO1A 1NBMA 4FWTA 4RDLA 3ASPA 3NE5B 1FNMA 1WTHD 3E1YE 3CXCB 4YXWA 2GQFA 4RCZA 4G7XA 4II2A 2W6JA 4PC7A 2AHOA 2JIZA 1VQLB 4DK0A 2V7XA 4RD0A 5L46A 4ASUA 2OBSA 3OJWA 4Z4RA 3QFRA 1NB9A 5TRDA 4U9UA 2C77A 4NNJA 2VNIA 2ZL7A 4G5GA 1E3ZA 3ZPNA 5KSWB 5THXA 2P3MA 1FNCA 1ZM2A 4TMTA 1WORA 1JNYA 3HAGA 1W0JA 2E1RA 2VNKA 2DEUA 1P4MA 1U2RA 4M53A 3B8HA 3BNWA 4X7FA 3WNDA 1NB0A 2I1LA 3WBJA 3OE7A 4DNRB 4AF7A 1DDIA 2CC2A 2WPDA 3ES9A 3FPPA 4Q7JB 3CCRB 2QGGA 4XOPA 1XE1A 3PUNA 5TY0A 4M2LA 1DDGA 4RDKA 4TKOB 5A89A 3ONYA 1GJRA 1VHOA 3VNVA 4E0FA 4L8JA 4K1XA 4WZKA 2WYRA 3ASTA 1S0UA 3CC4B 4YHBA 2Q6KA 4XN0A 1JB9A 1VQPB 3CD6B 2V31A 3ISXA 1TVCA 1V0FA 1YIJB 1BLIA 1M90D 1SKYB 3WYAA 2HDNB 2ZXHA 1G7TA 3DDYA 3FPKA 1E43A 2BF4A 4DK1A 5BSXA 5GV8A 3KEWA 2DY1A 3LNNA 4P22A 3ASRA 1K73D 1PJ7A 3BCFA 2WJYA 1GAQA 5IK2A 1Q9SA 4IW3B 1RQPA 5IYRA 4OP7A 4YAWA 1TUIA 4RPDA 2LZJA 2BPOA 4FN5A 5B6IA 4YEJA 2XEXA 2X0KA 4OPSA 4RCYA 4XLHA 4ZV4A 1JA1A 2DERA 1JJ2B 4B3GA 1W0KA 4HE6A 3AVWA 2ZZQA 1KMHA 4OOSA 2F1LA 1QGYA 1HVXA 4B3FX 4Z4UA 1BMFA 5H59A 1H8HA 1QH0A 4X06A 4X7EA 3SKBA 2XNJA 5DSZA 3W2IA 2V7UA 3CP2A 3A3GA 4XLEA 4ZCMA 1YLOA 3PA1A 4ZGNB 3LQ6A 3Q39A 3A8JA 5A8AA 4B4DA 1T6YA 1W9XA 2F4NA 4XONA 3CC2B 1B23P 2DYIA 2V7VA 1EWYA 1JA0A 4G1BA 4ZGQB 3OP1A 3G4SB 3CCEB 2HCJB 1YHQB 4RPBA 2X85A 1N05A 2ZTNA 4KKSA 5KNLA 2QA4B 4OOVA 5LMZA 4P25A 5FO0A 1N8RD 1NJID 2R9VA 1QFYA 5DN6A 1OB2A 4QFMA 3WNBA 1WP6A 1BX1A 2ZZGA 1G7RA 1E64A 2QN6A 4QV2A 1TTTA 3QE2A 4UZFA 1Y0RA 2M5SA 1VHEA 1UD4A 1PJ6A 3G05A 1VQ7B 5IYPA 3A35A 2OTLB 1BPLA 3PA2A 3GVKA 3OAAA 1XFOA 3AVXA 3OFNA 2CF4A 2CRVA 1DARA 2BVNA 4QVAA 1ELOA 2C78A 1KD1D 1PKVA 2BN4A 4X0CA 4N3GA 1SM4A 2WZPP 1SKQA 4TMVA 2QMUA 1WOSA 1XQBA 2QEXB 4P26A 1M1KD 1KTVA 1B2RA 4X07A 2XZOA 1N0UA 2JJ2A 5AN9A 2YWHA 2Q6OA 1FRQA 2XZPA 3CW2A 1CNEA 1W2BB 5HZAA 3T56B 4OPVA 1VQ5B 1R5NA 3VNUA 4Z4VA 3CMEB 4RD6A 4LBZA 1QVGB 1J9ZA 4RD2A 4WZEA 3PVDA 3BH4A 3ZZTA 1RQRA 3GVJA 2D74A 2YWEA 4G1VA 4LC0A 4PC2A 3RY8A 4XORA 5JBQA 3OW2B 1BQEA 4RD4A 3Q6RA 4TSFA 2VBTA 2CW5A 4XR6A 3CMMA 1VQMB 2DIEA 2WZNA 4WZTA 5F4MA 1EFUA 1YITB 3SLDA 2ZITA 3D26A 4XLCA 1MRZA 2BSAA 4Y9UA 2OYNA 4LBYA 1KRHA 3GIRA 1I18A 1ZM4A 4P2NA 4YAOA 1GO2A 3ZBUA 4C0SA 2NV4A 1F20A 3JQQA 2BGIA 2ZBUA 3JQPA 4XM3A 3A8IA 4RJLA 2DCUA 2YWGA 4AC9A 3ZBTA 1VLYA 4KKTA 1FX0A 3BCDA 3SLNA 2PIAA 4LBWA 4TT3A 3PUMA 2OK7A 1KJZA 3QFTA 4X8IA 2ZXIA 2V7WA 2X3UA 2X6YA 3Q3AA 3SEJA 3WXMA 2E1BA 3AVTA 1QUFA 1QGAA 2JN9A 3QFSA 1MABA 4DNTB 1I8DA 5HZBA 2XNDA 3BQJA 5IYNA 1W34A 3QSYA 4ACBA 2GJKA 3MMPA 2X6XA 4B47A 1H42A 1COWA 1OGIA 2XOKA 5EMNA 1E1QA 2D3LA 1XB2A 3H94A 3W2GA 3MCAA 3VMFA 1Q82D 2R6HA 3ZZ0A 3AVUA 3QFCA 1E62A 1S4MA 1G7SA
chains in the Genus database with same CATH topology
3BY2A 5J3OA 3Q38A 4X05A 4QV2A 3ONUA 4RDLA 3ASPA 4RLZA 5IYPA 3PA2A 4Z4WA 3BY1A 4QVAA 4X0CA 4P1VA 5BSYA 2OBSA 4OOXA 4Z4RA 4P26A 5J35A 4X07A 2ZL7A 3ASSA 4QUZA 4Z4YA 4RDJA 5KW9A 5HZAA 5IYQA 4OPVA 4Z4VA 4X7FA 2ZL5A 3R6JA 3LQEA 4WZEA 3PVDA 3SJPA 3RY8A 3PUNA 4RDKA 3ONYA 4Z4ZA 3Q6RA 4WZKA 4P12A 5IYWA 3ASTA 4WZTA 5F4MA 3SLDA 2OBTA 3D26A 5E6TA 4P2NA 2OBRA 2ZL6A 5BSXA 3ASRA 5IYRA 4OP7A 4RPDA 5F4OA 4OPSA 4X7DA 3SLNA 4OOSA 3Q6QA 4ROXA 3PUMA 3V7AA 4RM0A 5F4JA 4Z4UA 4X06A 3Q3AA 3SEJA 4WZLA 4X7EA 3SKBA 4Z4TA 4OPOA 3PA1A 3LQ6A 3Q39A 5HZBA 3ASQA 3BQJA 5IYNA 4Z4SA 4P3IA 4RPBA 4X7CA 4OOVA 3R6KA 4QVJA 4P25A 1IHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY2 A;  5J3O A;  3Q38 A;  4X05 A;  4QV2 A;  3ONU A;  4RDL A;  3ASP A;  4RLZ A;  5IYP A;  3PA2 A;  4Z4W A;  3BY1 A;  4QVA A;  4X0C A;  4P1V A;  5BSY A;  2OBS A;  4OOX A;  4Z4R A;  4P26 A;  5J35 A;  4X07 A;  2ZL7 A;  3ASS A;  4QUZ A;  4Z4Y A;  4RDJ A;  5KW9 A;  5HZA A;  5IYQ A;  4OPV A;  4Z4V A;  4X7F A;  2ZL5 A;  3R6J A;  3LQE A;  4WZE A;  3PVD A;  3SJP A;  3RY8 A;  3PUN A;  4RDK A;  3ONY A;  4Z4Z A;  3Q6R A;  4WZK A;  4P12 A;  5IYW A;  3AST A;  4WZT A;  5F4M A;  3SLD A;  2OBT A;  3D26 A;  5E6T A;  4P2N A;  2OBR A;  2ZL6 A;  5BSX A;  3ASR A;  5IYR A;  4OP7 A;  4RPD A;  5F4O A;  4OPS A;  4X7D A;  3SLN A;  4OOS A;  3Q6Q A;  4ROX A;  3PUM A;  3V7A A;  4RM0 A;  5F4J A;  4Z4U A;  4X06 A;  3Q3A A;  3SEJ A;  4WZL A;  4X7E A;  3SKB A;  4Z4T A;  4OPO A;  3PA1 A;  3LQ6 A;  3Q39 A;  5HZB A;  3ASQ A;  3BQJ A;  5IYN A;  4Z4S A;  4P3I A;  4RPB A;  4X7C A;  4OOV A;  3R6K A;  4QVJ A;  4P25 A;  1IHM A; 
#chains in the Genus database with same CATH topology
 1TLL A;  5J3O A;  4YAL A;  4BPR A;  1AMO A;  5A88 A;  1F60 A;  2DET A;  4WQM A;  3CTA A;  3U6B A;  2ZZF A;  3E20 A;  3A1P A;  4PC3 A;  4F7D A;  1K9M D;  4B3X A;  2ZZE A;  4G7W A;  1EFT A;  2EIX A;  3ONU A;  4PAA A;  1A8P A;  2WJV A;  3OKX A;  2VYQ A;  1H85 A;  3CCM B;  5CDF A;  2BMW A;  3A3B A;  1EXM A;  1WSV A;  4DQL A;  1KZL A;  1FRN A;  1V0E A;  2QTL A;  3U2Q A;  4XKW A;  2XZL A;  2F43 A;  4P1V A;  1Q7Y D;  3KL9 A;  4Y9R A;  2X53 S;  5J35 A;  4TMZ A;  3PEN A;  4WWV A;  3OEH A;  4QUZ A;  2PMD A;  1QFJ A;  2GK6 A;  3GQB A;  4RDJ A;  1K28 D;  2F1M A;  5FIU A;  1UD3 A;  4P6V F;  1VQN B;  1WU8 A;  2X6W A;  5IYQ A;  4II3 A;  1R5O A;  1D2E A;  3R6J A;  4XL9 A;  2V7Q A;  5GV7 A;  4RD3 A;  3VO2 A;  1WDT A;  3VR6 A;  4ZCL A;  4FXU A;  1WSR A;  3SJP A;  3P27 A;  4M1K A;  5FNZ A;  5HXB A;  3BC9 A;  1VQ6 B;  1BX0 A;  1ZM9 A;  2HMA A;  4FK8 A;  1KK1 A;  1T6X A;  3JU4 A;  1CNF A;  4Y7C A;  1EP3 B;  2QTZ A;  4N3N A;  4XKV A;  1FDR A;  2OBT A;  4XQF A;  4TMW A;  4B43 A;  1WOO A;  2WSS A;  1YI2 B;  1HZE A;  5E6T A;  4XLA A;  2GK7 A;  2PE3 A;  2PLF A;  1UMK A;  3G6E B;  2CND A;  4MYT A;  4DQK A;  1YJW B;  2ZL6 A;  1VF7 A;  1AIP A;  3CP8 A;  2WR8 A;  1KK2 A;  2BM0 A;  1UD5 A;  3CPW B;  1VQO B;  4YAU A;  4PGO A;  4XNF A;  2VBU A;  5DS0 A;  3W2F A;  1BJK A;  1IB0 A;  1EP1 B;  1QUE A;  1UD2 A;  1UD6 A;  1V5V A;  3W5U A;  4X7D A;  3U6K A;  1EFR A;  2CBX A;  3A8K A;  3Q6Q A;  3I55 B;  1KQS B;  4PC1 A;  1OGJ A;  4KKU A;  2V7T A;  3OZW A;  4HE5 A;  4PAB A;  3V7A A;  1KC8 D;  1R5B A;  4TN1 A;  2BM1 A;  2Q6L A;  4G6I A;  1CQX A;  4Z4T A;  4M0L A;  3WNC A;  4EH1 A;  4OPO A;  3B78 A;  4XOT A;  3VO1 A;  3CMA B;  1N08 A;  2QDX A;  2VZL A;  2J7K A;  3WBK A;  2C2W A;  4AVZ A;  1QG0 A;  4P3I A;  4UZE A;  3ZUG A;  2C4U A;  1N0V C;  1E1R A;  4GQN A;  2XNC A;  1Q81 D;  4UAJ A;  4QVJ A;  4TMX A;  2D9R A;  1IJF A;  2BV3 A;  3P26 A;  3CC7 B;  4QHY A;  4P3Y A;  4X05 A;  1YJN B;  1N07 A;  1NRK A;  3GSI A;  2VJI A;  3GVL A;  1E63 A;  1T6Z A;  4RLZ A;  3CB4 A;  1NDH A;  4ZCI A;  1EFC A;  2GJP A;  2OK8 A;  1VQ9 B;  4Z4W A;  1QFZ A;  1I7P A;  1KK0 A;  2D3N A;  2VJJ A;  3T53 B;  2VNH A;  1Q86 D;  2VBS A;  2HLD A;  3BY1 A;  3J81 k;  3H9N A;  4J0Q A;  4MYU A;  1VJS A;  3W2E A;  3MHP A;  1OHH A;  4UZU A;  4AF6 A;  4OOX A;  4B44 A;  5BSY A;  2ZBV A;  3CCQ B;  2Z6B D;  3AGQ A;  1GR1 A;  3ASS A;  2RC5 A;  1VQK B;  1UD8 A;  4Z4Y A;  1QVF B;  5KW9 A;  3W5V A;  1EP2 B;  3FJO A;  2OTJ B;  5FA6 A;  3CES A;  3OW7 A;  1Y0Y A;  3LVB A;  3OEE A;  4P9S A;  2EFG A;  2ZL5 A;  4B48 A;  2C5B A;  4P6Y A;  1OB0 A;  1E3X A;  3LQE A;  3AVV A;  2C5H A;  4JMQ A;  2B7B A;  2GRE A;  4HIZ A;  1S72 B;  1GAW A;  1D8T A;  2B5O A;  4ACA A;  4Z4Z A;  2W6I A;  4R71 A;  1HA3 A;  4P12 A;  2B7C A;  5TV2 A;  5IYW A;  3FKS A;  3V76 A;  2GPJ A;  2KVO A;  5H5J A;  3CCL B;  5HKK A;  1ZM3 A;  1YJ9 B;  4M4S A;  3AVY A;  3G71 B;  2DOG A;  4NCN A;  3ZIA A;  2OBR A;  2V4D A;  2YWF A;  3B82 A;  3OPO A;  2ZTG A;  2VBV A;  1D1N A;  2FVG A;  3WY9 A;  3OJX A;  3ZZU A;  3CCV B;  3CCU B;  1VLO A;  3W2H A;  5F4O A;  4RD1 A;  1DG1 G;  2Q6I A;  1W87 A;  4Z1M A;  3OZU A;  3CCJ B;  4NBS A;  1T5E A;  2QE7 A;  3CPX A;  3LO8 A;  4XMY A;  3T51 B;  1WPC A;  1GVH A;  2JJ1 A;  1IJE A;  2CK3 A;  4LBV A;  4ROX A;  3AGP A;  1H8E A;  2JDI A;  1G7C A;  5TR9 A;  2GJR A;  4RM0 A;  2VNJ A;  5F4J A;  4WZL A;  5FL7 A;  4CQJ A;  1ZUN B;  1OB5 A;  1W35 A;  3ASQ A;  3I1F A;  1N06 A;  1YX2 A;  1QX4 A;  4Z4S A;  3I56 B;  1VQ8 B;  4XN3 A;  3JQR A;  2FX3 A;  4YEL A;  1KK3 A;  2RC6 A;  1VQ4 B;  3W5H A;  1QGZ A;  1E79 A;  3OZV A;  1FND A;  4H9G A;  1PJ5 A;  1WOP A;  4X7C A;  2X8K A;  3R6K A;  4PC6 A;  2NPF A;  3ZC3 A;  1K8A D;  4XD7 A;  1IHM A;  4C43 A;  3SJZ A;  2BGJ A;  3CCS B;  3CRZ A;  2XGJ A;  2C4T A;  3BY2 A;  4XLF A;  3Q38 A;  3WQZ A;  4YAF A;  3OOC A;  1FNB A;  5FO1 A;  1NBM A;  4FWT A;  4RDL A;  3ASP A;  3NE5 B;  1FNM A;  1WTH D;  3E1Y E;  3CXC B;  4YXW A;  2GQF A;  4RCZ A;  4G7X A;  4II2 A;  2W6J A;  4PC7 A;  2AHO A;  2JIZ A;  1VQL B;  4DK0 A;  2V7X A;  4RD0 A;  5L46 A;  4ASU A;  2OBS A;  3OJW A;  4Z4R A;  3QFR A;  1NB9 A;  5TRD A;  4U9U A;  2C77 A;  4NNJ A;  2VNI A;  2ZL7 A;  4G5G A;  1E3Z A;  3ZPN A;  5KSW B;  5THX A;  2P3M A;  1FNC A;  1ZM2 A;  4TMT A;  1WOR A;  1JNY A;  3HAG A;  1W0J A;  2E1R A;  2VNK A;  2DEU A;  1P4M A;  1U2R A;  4M53 A;  3B8H A;  3BNW A;  4X7F A;  3WND A;  1NB0 A;  2I1L A;  3WBJ A;  3OE7 A;  4DNR B;  4AF7 A;  1DDI A;  2CC2 A;  2WPD A;  3ES9 A;  3FPP A;  4Q7J B;  3CCR B;  2QGG A;  4XOP A;  1XE1 A;  3PUN A;  5TY0 A;  4M2L A;  1DDG A;  4RDK A;  4TKO B;  5A89 A;  3ONY A;  1GJR A;  1VHO A;  3VNV A;  4E0F A;  4L8J A;  4K1X A;  4WZK A;  2WYR A;  3AST A;  1S0U A;  3CC4 B;  4YHB A;  2Q6K A;  4XN0 A;  1JB9 A;  1VQP B;  3CD6 B;  2V31 A;  3ISX A;  1TVC A;  1V0F A;  1YIJ B;  1BLI A;  1M90 D;  1SKY B;  3WYA A;  2HDN B;  2ZXH A;  1G7T A;  3DDY A;  3FPK A;  1E43 A;  2BF4 A;  4DK1 A;  5BSX A;  5GV8 A;  3KEW A;  2DY1 A;  3LNN A;  4P22 A;  3ASR A;  1K73 D;  1PJ7 A;  3BCF A;  2WJY A;  1GAQ A;  5IK2 A;  1Q9S A;  4IW3 B;  1RQP A;  5IYR A;  4OP7 A;  4YAW A;  1TUI A;  4RPD A;  2LZJ A;  2BPO A;  4FN5 A;  5B6I A;  4YEJ A;  2XEX A;  2X0K A;  4OPS A;  4RCY A;  4XLH A;  4ZV4 A;  1JA1 A;  2DER A;  1JJ2 B;  4B3G A;  1W0K A;  4HE6 A;  3AVW A;  2ZZQ A;  1KMH A;  4OOS A;  2F1L A;  1QGY A;  1HVX A;  4B3F X;  4Z4U A;  1BMF A;  5H59 A;  1H8H A;  1QH0 A;  4X06 A;  4X7E A;  3SKB A;  2XNJ A;  5DSZ A;  3W2I A;  2V7U A;  3CP2 A;  3A3G A;  4XLE A;  4ZCM A;  1YLO A;  3PA1 A;  4ZGN B;  3LQ6 A;  3Q39 A;  3A8J A;  5A8A A;  4B4D A;  1T6Y A;  1W9X A;  2F4N A;  4XON A;  3CC2 B;  1B23 P;  2DYI A;  2V7V A;  1EWY A;  1JA0 A;  4G1B A;  4ZGQ B;  3OP1 A;  3G4S B;  3CCE B;  2HCJ B;  1YHQ B;  4RPB A;  2X85 A;  1N05 A;  2ZTN A;  4KKS A;  5KNL A;  2QA4 B;  4OOV A;  5LMZ A;  4P25 A;  5FO0 A;  1N8R D;  1NJI D;  2R9V A;  1QFY A;  5DN6 A;  1OB2 A;  4QFM A;  3WNB A;  1WP6 A;  1BX1 A;  2ZZG A;  1G7R A;  1E64 A;  2QN6 A;  4QV2 A;  1TTT A;  3QE2 A;  4UZF A;  1Y0R A;  2M5S A;  1VHE A;  1UD4 A;  1PJ6 A;  3G05 A;  1VQ7 B;  5IYP A;  3A35 A;  2OTL B;  1BPL A;  3PA2 A;  3GVK A;  3OAA A;  1XFO A;  3AVX A;  3OFN A;  2CF4 A;  2CRV A;  1DAR A;  2BVN A;  4QVA A;  1ELO A;  2C78 A;  1KD1 D;  1PKV A;  2BN4 A;  4X0C A;  4N3G A;  1SM4 A;  2WZP P;  1SKQ A;  4TMV A;  2QMU A;  1WOS A;  1XQB A;  2QEX B;  4P26 A;  1M1K D;  1KTV A;  1B2R A;  4X07 A;  2XZO A;  1N0U A;  2JJ2 A;  5AN9 A;  2YWH A;  2Q6O A;  1FRQ A;  2XZP A;  3CW2 A;  1CNE A;  1W2B B;  5HZA A;  3T56 B;  4OPV A;  1VQ5 B;  1R5N A;  3VNU A;  4Z4V A;  3CME B;  4RD6 A;  4LBZ A;  1QVG B;  1J9Z A;  4RD2 A;  4WZE A;  3PVD A;  3BH4 A;  3ZZT A;  1RQR A;  3GVJ A;  2D74 A;  2YWE A;  4G1V A;  4LC0 A;  4PC2 A;  3RY8 A;  4XOR A;  5JBQ A;  3OW2 B;  1BQE A;  4RD4 A;  3Q6R A;  4TSF A;  2VBT A;  2CW5 A;  4XR6 A;  3CMM A;  1VQM B;  2DIE A;  2WZN A;  4WZT A;  5F4M A;  1EFU A;  1YIT B;  3SLD A;  2ZIT A;  3D26 A;  4XLC A;  1MRZ A;  2BSA A;  4Y9U A;  2OYN A;  4LBY A;  1KRH A;  3GIR A;  1I18 A;  1ZM4 A;  4P2N A;  4YAO A;  1GO2 A;  3ZBU A;  4C0S A;  2NV4 A;  1F20 A;  3JQQ A;  2BGI A;  2ZBU A;  3JQP A;  4XM3 A;  3A8I A;  4RJL A;  2DCU A;  2YWG A;  4AC9 A;  3ZBT A;  1VLY A;  4KKT A;  1FX0 A;  3BCD A;  3SLN A;  2PIA A;  4LBW A;  4TT3 A;  3PUM A;  2OK7 A;  1KJZ A;  3QFT A;  4X8I A;  2ZXI A;  2V7W A;  2X3U A;  2X6Y A;  3Q3A A;  3SEJ A;  3WXM A;  2E1B A;  3AVT A;  1QUF A;  1QGA A;  2JN9 A;  3QFS A;  1MAB A;  4DNT B;  1I8D A;  5HZB A;  2XND A;  3BQJ A;  5IYN A;  1W34 A;  3QSY A;  4ACB A;  2GJK A;  3MMP A;  2X6X A;  4B47 A;  1H42 A;  1COW A;  1OGI A;  2XOK A;  5EMN A;  1E1Q A;  2D3L A;  1XB2 A;  3H94 A;  3W2G A;  3MCA A;  3VMF A;  1Q82 D;  2R6H A;  3ZZ0 A;  3AVU A;  3QFC A;  1E62 A;  1S4M A;  1G7S A; 
#chains in the Genus database with same CATH homology
 3BY2 A;  5J3O A;  3Q38 A;  4X05 A;  4QV2 A;  3ONU A;  4RDL A;  3ASP A;  4RLZ A;  5IYP A;  3PA2 A;  4Z4W A;  3BY1 A;  4QVA A;  4X0C A;  4P1V A;  5BSY A;  2OBS A;  4OOX A;  4Z4R A;  4P26 A;  5J35 A;  4X07 A;  2ZL7 A;  3ASS A;  4QUZ A;  4Z4Y A;  4RDJ A;  5KW9 A;  5HZA A;  5IYQ A;  4OPV A;  4Z4V A;  4X7F A;  2ZL5 A;  3R6J A;  3LQE A;  4WZE A;  3PVD A;  3SJP A;  3RY8 A;  3PUN A;  4RDK A;  3ONY A;  4Z4Z A;  3Q6R A;  4WZK A;  4P12 A;  5IYW A;  3AST A;  4WZT A;  5F4M A;  3SLD A;  2OBT A;  3D26 A;  5E6T A;  4P2N A;  2OBR A;  2ZL6 A;  5BSX A;  3ASR A;  5IYR A;  4OP7 A;  4RPD A;  5F4O A;  4OPS A;  4X7D A;  3SLN A;  4OOS A;  3Q6Q A;  4ROX A;  3PUM A;  3V7A A;  4RM0 A;  5F4J A;  4Z4U A;  4X06 A;  3Q3A A;  3SEJ A;  4WZL A;  4X7E A;  3SKB A;  4Z4T A;  4OPO A;  3PA1 A;  3LQ6 A;  3Q39 A;  5HZB A;  3ASQ A;  3BQJ A;  5IYN A;  4Z4S A;  4P3I A;  4RPB A;  4X7C A;  4OOV A;  3R6K A;  4QVJ A;  4P25 A;  1IHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...