4RDYA

Crystal structure of vmolac bound to 3-oxo-c10 ahl
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
312
Chain Sequence
VRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
molecule tags Hydrolase
molecule keywords Parathion hydrolase
total genus 124
structure length 312
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4rdyA00
2R1LA 4H9UA 3O7UA 3WMLA 2Z25A 4IGMA 3F4CA 4QRNA 4J2MA 3GTXA 4KEUA 1YNYA 3CJPA 5HMDA 3GG7A 1EJSC 3URQA 2G3FA 3GTHA 4GXWA 4WVXA 3MVIA 3SO7A 4PCNA 4C6OA 1XGEA 4E3TA 5A6TC 3UF9A 4WGXA 4NI8A 3UPMA 2GOKA 3UR5A 1POKA 1I0DA 3QY8A 4B90A 1XRFA 2XIOA 2Z7GA 2OB3A 3UBPC 2YB4A 3URNA 4KIRA 3GU9A 2D2GA 1P6CA 4CQCA 1V4YA 1UBPC 1O5RA 2ANUA 2FTYA 4R85A 1NDZA 3IV8A 1FWEC 3D6NA 1A5LC 3E74A 4QTGA 4AQLA 5AKQA 2BGNE 2VUNA 3B0XA 1HZYA 4QS5A 3GRIA 2PGRA 1PB0A 2Z28A 4KF1A 4QSFA 4F0LA 4GYFA 2FTWA 3B40A 2F6KA 5G4HC 1RJPA 2Z00A 3RYSA 3RN6A 3A3WA 4C5ZA 1A5MC 2VC7A 2HPMA 4BJHA 4CEUC 4I6VA 3ORWA 4B3ZA 1FWGC 4F0SA 3EWCA 2FVMA 3OQEA 4LAOA 4GY1A 1P6BA 4LH8A 1EJVC 3UR2A 1GKRA 1XRTA 2DVXA 1POJA 2YZ5A 4DLFA 1RA0A 1EJWC 4P5UA 4G7EB 1R9XA 3NEHA 4H9TA 3FEQA 2OOFA 3TN6A 1IE7C 2O4QA 4DZHA 2GWGA 1J5SA 1V77A 1WXYA 4C6PA 2Z4GA 3LSBA 4ERGA 4TQTA 1FWCC 2R1MA 2VC5A 4AC7C 2R1KA 4LFYA 2EG6A 2VM8A 1J6OA 1J79A 3IPWA 2PUZA 4YIWA 2O4MA 3IRSA 4ZSTA 3EGJA 4D8LA 1EF2A 3S2JA 1K70A 4C6IA 1DPMA 4GY0A 4RDYA 4GX9A 3CS2A 1VFLA 3S2LA 4XD5A 3HTWA 2D2HA 3QGAC 4LEFA 1FWBC 2RAGA 4RDWA 4Z42C 4KETA 3F2DA 4H9XA 1FKXA 2YB1A 2IMRA 5HMEA 2Z24A 1RK5A 1GKPA 1RJRA 2FFIA 4EP8C 4G2DA 1YMYA 4PCPA 3QY6A 1FWDC 2GZXA 4GY7A 3WZ0E 2Q09A 4QROA 5E5CA 2UBPC 3ID7A 3T81A 3TNBA 4L6DA 2WJFA 4M51A 4UB9A 3E3HA 4PE8A 3MDWA 1O12A 3MPGA 4H00A 4DO7A 3F2BA 4XAYA 3K4WA 4EPDC 4LCSA 1FKWA 2HPIA 4GX8A 2DVUA 3NURA 3DC8A 3OJGA 3RCMA 3A4JA 1UIOA 1YRRA 4IFRA 1KCXA 3OVGA 1XWYA 1R9YA 4L9XA 1V79A 4UBPC 2BB0A 2WJDA 4KESA 4XAGA 1NDYA 2AQVA 1PSCA 2R1PA 4DI8A 3GTIA 2Z2AA 1V7AA 1FWFC 3B0YA 3TN3A 1QXLA 1ADDA 4R7WA 4H01A 3F2CA 3GU1A 1A5KC 2Z26A 3FDKA 3G77A 3F4DA 3LS9A 4CEXC 3PNZA 4J5NA 3ITCA 2CZVA 3TN4A 4LALA 2EG7A 2AQOA 3PAOA 1V51A 3MJMA 2VHLA 4GOAA 1YIXA 2A3LA 4IFKB 2HBXA 3KM8A 1W1IE 1KRBC 3QY7A 1PO9A 4IQJA 3GIPA 1R9ZA 2Q01A 3CAKA 5FSDC 2QVNA 4C6DA 4KEZA 1ONXA 1I0BA 2QT3A 1QW7A 4B91A 4EPBC 4DZIA 1A5OC 4IG2A 5FSEC 1YBQA 3MVTA 3AUOA 4C6CA 3QGKC 1E9ZB 4DNMA 5CH9A 1UMLA 2QS8A 1JGMA 3ICJA 3JZEA 1ITUA 2Z2BA 4R88A 4KERA 1E9YB 2P53A 3E0FA 3E0LA 3RHGA 1RAKA 1GKQA 4C6MA 3LGGA 2WJEA 4RDVA 2GWNA 2FVKA 1NDWA 4CNSA 4C6KA 4OFCA 2HQAA 3S2MA 2P50A 3E38A 3S2NA 1FWHC 4CNUA 2PAJA 2OODA 3IGHX 3K5XA 1NFGA 4I6KA 2PLMA 3URAA 2ICSA 2PGFA 4RE0A 3N2CA 4C5YA 4C60A 3C86A 4IFKA 3AU2A 3OODA 2HBVA 4C65A 3OOQA 4DYKA 2Z27A 4LAMA 1A4LA 1UIPA 3LSCA 1PTAA 1ITQA 1A4MA 4GC3A 4LCRA 4CQBA 1EYWA 3A3XA 3MTWA 4EPKA 4HK6A 2OGJA 4NG3A 2E1WA 4C6JA 3GUWA 2ZC1A 2OQLA 1EJUC 2D2JA 2I5GA 4H9MA 1K1DA 3MSRA 4ERAA 3E2VA 4H9ZA 4ZSUA 4HJWA 4HK5A 4LANA 3PBMA 4HK7A 3LY0A 3GU2A 2HNHA 4IFOA 1EJTC 1BF6A 1EJRC 4XD6A 1EJXC 3LGDA 3ISIX 1ZZMA 1K6WA 4F0RA 4IGNA 4CQDA 4H9YA 1NDVA 2Y1HA 3LNPA 4XD3A 4J35A 4IG2B 3SFWA 1KRCC 1S3TC 3T1GA 2EG8A 1J6PA 4IH3A 3BE7A 1M65A 1EZ2A 4CNTA 4MUPA 4DIAA 4EPEC 4BY3A 3GTFA 3GIQA 2UZ9A 4PBEA 4INFA 1WXZA 2ADAA 3EWDA 2R1NA 3O0FA 4BKNA 3R0DA 3LA4A 4XAFA 3HM7A 2I9UA 2E25A 4DI9A 2KAUC 2WM1A 4C6LA 4ERIA 4HA0A 3IARA 3LU2A 3S4TA 2GSEA 1FWIC 4NP7A 1RJQA 3PNUA 4KEVA 1P1MA 4LCQA 2QPXA 4XAZA 3MKVA 4V1YA 3IJ6A 1RA5A 3PANA 3DCPA 4JOMA 4XD4A 3HPAA 3AU6A 1M68A 4ICMA 5HMFA 3URBA 1KRAC 2YXOA 3FDGA 2VR2A 4B92A 4G7EA 3V7PA 3NQBA 4V1XA 4C6EA 2Z29A 4RZBA 4DLMA 1ONWA 3OU8A 5LXXA 1A5NC 4IF2A 4C6NA 4C6FA 3WYZA 4C6QA 2W9MA 4KQNA 1M7JA 4GBDA 3T8LA 2AMXA 1RK6A 4LAKA 4RDZA 1YBQB 4PBFA 1KRMA 3MDUA 4GZ7A 1FWAC 4QS6A 4H9VA 3TN5A 2DVTA 4WHBA 4C6BA 3DUGA 3IACA 1FWJC 3K2GA 4GK8A
chains in the Genus database with same CATH superfamily
1LYXA 3TC3A 4H6RA 3A13A 4QJ3B 3RCYA 4A2RA 2C91A 4W4QA 3GG7A 1MEIA 2OO0A 3TNOA 3N4FA 4GXWA 5AC4A 3MKCA 2X2GA 2QW5A 4DHGA 3FXGA 1QNVA 2VQTA 3W1LA 1BXCA 3UWYA 4Q22A 1U5HA 5IBXA 4ACZA 1W37A 4EACA 2I17A 4MIMA 2W6RA 3AMDA 4UOJA 2PRLA 1JCJA 2FHCA 4HIBA 2WBKA 3G1VA 2OB3A 1UZDA 2V68A 5FAGA 4MPKA 1NTHA 1UQYA 3CIWA 1FY6A 1NDZA 2XH0A 2J47A 3K4AA 3D6NA 3QGVA 4JIIX 5I09A 3GNOA 1LRNA 4HNUA 1HJWA 4H2CA 4I5RA 4Z2KA 1JZ3A 4LAZA 3WD1A 1VHNA 3CWNA 1EP2A 4Q33A 4BJHA 3IGXA 3CQIA 4NAFA 1EKOA 3GXTA 4KRZA 1XH0A 1FBAA 3GB6A 3MQTA 1LORA 4DF0A 1EJWC 1JAKA 1MRQA 5M03A 1GPWA 3Q37A 4RNIA 4H2HA 4UR7A 1K8ZA 2CW6A 1XINA 2DZVA 4C6PA 1R2RA 5RUBA 2Z4GA 3W88A 1CNVA 3B9OA 3POCA 4PMRA 4C7DA 2PDBA 3A3HA 1P7TB 3ABOA 4FLRA 4F48A 4XB3A 1KO0A 3DN5A 1FOBA 3UZXA 3BW4A 1TE1A 3CQHA 5LIWX 2XIBA 4RDYA 4GX9A 1ZBVA 5A6BA 1Q8AA 3W7KA 4RDWA 3VM5A 5D38A 2FDSA 1JDDA 2FGLA 2DT0A 2PRHA 3TEVA 1RJRA 4R9OA 1DE6A 4US5A 3ZSSA 1TRDA 4IPPA 2UBPC 5JBEA 3ABSA 3WQ8A 1LJYA 1L2UA 1EFZA 3BLIA 4WQ6A 3H2AA 3JR2A 4EPDC 4AW7A 4AD3A 4NIRA 5TAOA 3BLDA 2O55A 1IGWA 3WQGA 2OX1A 3GR7A 1KTBA 2RHGA 3BAJA 3IAPA 4WSHA 5I7GA 2OYLA 4LS2A 2WNQA 4ZENA 1IT0A 4A8LA 4AF0A 1AL8A 1MW3A 2JQXA 4UTKA 1IXOA 5CAHA 1Q6EA 1W32A 3CLWA 4L1WA 2YCLA 3TX9A 1GYMA 1V0MA 2WVUA 4PUNA 4UR9A 1UD2A 1HG3A 4FXFA 3EX3A 3V5FA 3ARTA 3WCZA 1UC5A 4M5PA 2QCHA 4HYVA 1DWAM 3ZWTA 3PNZA 1CXKA 1DJZA 3ITCA 2YDAA 3DBNA 1KFWA 2CLPA 1EDTA 5AYXA 1H0GA 3EA1A 1IQ8A 2VVSA 1SZEA 1E72M 3DI0A 1MXDA 5SWUA 3BSMA 4HP5A 3GIPA 1BVWA 3C2RA 2OZTA 4L4OA 1QW7A 1QPKA 3MUZ1 3L66A 5BROA 3GXDA 4UQDA 4L1GA 3G3MA 4JTRA 2V2CA 1E9ZB 5FAJA 3H23A 1FTXA 6XIMA 1JCYA 4FNTA 4V28A 1B90A 5CLTA 2HXUA 1JZ5A 4HU4A 4JZ5A 4UCFA 1VAHA 2VFGA 3FHQA 4IZGA 1F6YA 3MUIA 4Q6JA 3AHZA 3M0LA 3OP2A 1J18A 3WF3A 2VR4A 5DRCA 3S2MA 1YPFA 4M1RA 2DSUA 3L9CA 1IWBA 3EA2A 1JDFA 3G1XA 2EQDA 2ZWZA 2PLMA 3DFTA 5CJMA 3CV7A 3P8IA 4FF7A 1K4HA 2FJUB 1TELA 5CSRA 3C2EA 3N13A 5ENLA 5I3HA 1FWTA 1ISZA 5FF3A 3EPNA 4GC3A 2NLYA 4AD5A 1QPNA 4CQ9A 1OX4B 1U1UA 4K8EA 3GFYA 2WMGA 3QYQA 2UY5A 2I5GA 1KBJA 3MY9A 4UMBA 3QFEA 1GVQA 1CLKA 1A80A 4DBWA 5C9XA 2BVWA 2XGBA 3N2MA 1EDQA 3P74A 1RQBA 2ZZ5A 4MHBA 1KM3A 1RCQA 1G7UA 1EJ7L 3KAOA 3GDKA 2QPUA 5AOUA 4PR4A 1Y5VA 3Q4DA 3TR2A 5K9XA 1OHLA 1KM4A 1E6QM 4XKYB 1PHWA 3THUA 3TFXA 4W5UA 3W7IA 3VIOA 3FAWA 3TW7A 4LOCA 4HBKA 2BNJA 1XM3A 4K36A 2C1HA 2ZRYA 3HMCA 3PZIA 3W7LA 3I10A 2PC4A 3PANA 2ZX6A 2QF8A 1QPOA 3PWGA 2X40A 1M68A 5D33A 1JYWA 1KRAC 4YCOA 2VGFA 5BXTA 3ZLHA 1XCWA 1BEUA 2LLEA 1I8JA 1BYBA 1VFHA 3W1XA 1EC8A 1IR2A 1TIWA 4WUIA 1WBHA 3CH9A 3RX2A 1XIFA 1XIEA 3BLLA 3S1XA 1VYSX 4MY9A 1Z42A 2CLIA 4JXCA 1V6UA 5LNVA 1XBZA 1DTNA 3TROA 1S2WA 3ZR6A 4LV4A 4NKCA 3UXDA 4P61A 4U5IA 3AS2A 1E15A 2G3FA 3W2UA 3CAWA 1EXBA 2CCRA 3SO7A 2FZDA 2VVNA 4ZE5A 1W31A 4B5NA 3RPTA 3UF9A 1ZENA 1AH4A 3LPPA 2HWGA 3GR8A 3W26A 1CLVA 1M7OA 1AH3A 1R8LA 4GGHA 4BZYA 5I3JA 4HNOA 2Z2UA 1DXIA 1K7EA 5ABTA 6XIAA 4DXKA 1TIMA 4AH7A 3VKBA 4JIEA 3EA3A 5D9MA 1FHVA 2V5LA 3PZGA 1FXPA 1HW6A 1W1PA 3SUUA 3L65A 1KQZA 3G5EA 1CGUA 3DX5A 3GYEA 3T6CA 4M19A 2F9RA 5FD0A 2F6UA 2XIJA 2DH3A 4HZ7A 1XD1A 1F3XA 1F4HA 1XW8A 3OQEA 3RJYA 3RRAA 4JFWA 3BWWA 3ONCA 1FUYA 3D0CA 1HGYA 3SCTA 1L6GA 4DLFA 1D9EA 1XD0A 4E5TA 4TVUA 2PGWA 4MB1A 5K7JA 2HE5A 3S47A 1WAUA 5A2BA 1PBGA 2CC0A 3CHVA 1H5YA 1HT6A 2ON3A 1ZJBA 1VBHA 4MWAE 2OT0A 2MUCA 2J88A 2ZXQA 1TV8A 1PUDA 5DCBA 2WHLA 1DQWA 4P8WA 4JHZA 1TJ0A 4XSMA 3ZJ6A 2GVGA 2HEJA 4D6CA 3ZR4A 3AOFA 4X0VA 1SZRA 1DPMA 5F2IA 5G1TA 3SQSA 4EXBA 3HTWA 1ZAJA 1I1WA 4AVFA 4CUCA 3BLFA 3CB8A 3F2DA 5CLWA 1G9HA 3KRUA 4LYQA 1W2VA 5HMEA 3ENLA 1RK5A 2Z24A 2FFIA 2ZUVA 3KE0A 3N2OA 4WX2A 3GZ3A 1SFJA 3QV6A 4QROA 1UA3A 3CYVA 4PC8A 3RX4A 4WJ8A 3W6MA 4I7VA 3EX4A 2GJLA 3SJ3A 1F5ZA 4LCSA 1P0EA 2EHHA 3OG3A 3E2QA 4O11A 2XH7A 3CB3A 1WZMA 2YA2A 4L4MA 5C7VA 4NZ5A 1FHLA 1R7AA 4ZQNA 1AA1B 2D0FA 4R33A 3FJNA 2D3LA 3S0CA 1TPFA 5FF7A 4B2DA 2O92A 2HVNA 4ML4A 4QCEA 4KT2A 4CU6A 4S3AA 4IIBA 1VFMA 1XG4A 4Z17A 3F2CA 5AYZA 1TYGA 3M47A 5I3IA 4Y90A 3M9YA 4MAVA 4YWSA 3TOYA 4FAMA 1FCQA 3M0ZA 3GXMA 3MUXA 1UPMB 3T42A 1NWRA 3WEOA 4PUEA 1Q63A 1JUBA 2WMIA 5AC6A 3HV8A 1VBJA 4KEZA 4HPNA 1E9LA 3UZJA 3THDA 2W67A 3ZQ9A 3PP7A 4Q32A 1UWUA 1A47A 2QV4A 3K1DA 4M1BA 2A3HA 2BSLA 3GXNA 1R46A 3ES7A 3ICJA 3JZEA 5CSSA 1ME8A 1XLIA 3B8WA 3QC3A 3RG6A 1XBVA 3RM9A 3SRKA 2DT3A 5LA0A 5GNZA 2X0HA 2I1OA 1GYLA 3MSGA 4WDUA 4BI5A 1AZ1A 1JF6A 3A6OA 4E8GA 3VNMA 4I6KA 2J77A 3QZAA 4S2BA 4KRUA 3G3DA 4JS3A 1XGZA 3OBEA 5F4WA 4RXFA 5ECVA 1VFUA 1B9ZA 3AU2A 1V3MA 3W82A 4DYKA 4LAMA 2ZZ1A 4NZCA 3VA8A 5AZ1A 2BY0A 5DCDA 4BQ4A 1RH9A 3N04A 2VOMA 2YXGA 4K6AA 2VCAA 1E0VA 2PSNA 2G37A 3EMZA 3ZLFA 3RMJA 2OCZA 3UWWA 3WLPA 4DF1A 1QRQA 3DKLA 1E9IA 3GNPA 5EBUA 1H1ZA 4JNYA 4ZSUA 4HK5A 3OG2A 3CUIA 4ZVJA 2B4GA 5AHIA 2WSYA 2HNEA 1Q6RA 3LGDA 4NILA 4J1OA 3EYPA 5IFPA 3G1FA 5B7ZA 4S39A 1TR9A 3LI1A 2PC8A 3UXLA 1XLEA 2DIEA 2YGYA 3N3MA 1S2CA 3IJLA 3JU2A 2A21A 2J6VA 4IP7A 4W89A 4GIEA 4Z1AA 2EG8A 3AS0A 1W3HA 3CAVA 2EKCA 3BZJA 5ABFB 1Y8BA 2FH8A 2PDJA 4IIHA 2WSPA 5E6ZA 3CWOX 4CN4A 1XDLA 1JYVA 1JDAA 3HM7A 3L5LA 3EWZA 5EMKA 4K39A 1RVGA 4AX7A 4NP7A 4XO7A 4B3LA 4RZ6A 2DZXA 4A05A 3EWWA 1V0LA 1YX1A 4LVBA 3SRDA 1QO2A 3HPAA 3NSMA 3AXKA 3CBWA 4NXSA 4ZFMA 1GG0A 2A3AA 1JZ8A 1UBSA 3EEZA 5I02A 3QF0A 3KCJA 1OZMA 5CGMA 3WF4A 4Z0SA 1X7IA 2XIMA 3W76A 1RK6A 4JQ3A 4RDZA 3VGEA 1B3YA 3K4DA 3NXFA 2CXGA 2G95A 3CUJA 1FWAC 1XIHA 3LPFA 4Q8MA 4G5DA 2G4FA 2V69A 5DBTA 2DH2A 3IACA 1GQNA 3N34A 3MS8A 3AXHA 3K2GA 4V33A 4QDWA 3GDLA 2WLZA 3ONBA 4IGMA 1BSLA 3M64A 4QITA 4GVHA 3CUZA 2QPSA 3BARA 2GDVA 1VJSA 5I78A 3BDKA 1OT1A 1RPXA 3MBFA 3ZT5A 4E2OA 2FHFA 1ZP3A 4QJ1A 3ZFHA 1C8YA 4D6HA 3BCFA 5IHRA 3RPMA 4ES4A 2I5IA 4OIFA 3LCGA 3UPMA 2YW3A 2XJ7A 3KP1A 2VELA 4HT3A 4B90A 2CBIA 2J7GA 4AZGA 3URNA 1GVFA 3GU9A 4M7TA 1LF1A 1O5RA 2W4XA 2HV5A 1RUSA 1EQCA 4H3DA 3S6TA 1E0TA 3VDGA 4JN7A 1SM9A 2DPEA 1V8EA 3FCPA 2IW0A 5MHBA 3TYUA 3LBMA 1A5MC 1JCMP 4LS0A 3CHDA 3GNNA 3GYCA 1X39A 3UJEA 3YPIA 1TE6A 4HB7A 4R7JA 2PWEA 1B4KA 3H70A 3UA4A 1B4EA 2CWNA 3SFKA 1TRIA 4AZIA 1WA3A 5I23A 4MNLA 1GWJA 1TV5A 1W1ZA 2Y8VA 3M41A 4MJ2A 4OBTA 1LRTA 1C90A 7XIMA 1FWRA 2J9XA 1Q6OA 4HQVA 2W66A 2V5JA 1HP5A 3Q45A 1GCYA 3W02A 1NP0A 5A6SA 4NASA 1PS9A 3GUGA 3WK2A 2FDMA 2R1KA 4WIWA 3WG6A 1TA3A 1UKPA 3NEVA 2GK1B 5EY5A 1EB3A 1OGSA 3IPWA 2PUZA 3A64A 1V6VA 3O6AA 1BKSA 1QI2A 3WUBA 3QOKA 4PB5A 1W5PA 3WLKX 3LV6A 2WZEA 1LG1A 4KETA 2NSXA 1PE1A 4IMDA 2PWFA 4M6VA 3RK8A 1M03A 5E5CA 1F3WA 1D7KA 2NV1A 4MM1A 3DYMA 1QTWA 3DG7A 1LG2A 4L6DA 1I2RA 4GIYA 3K4WA 1KWKA 5A2AA 4IIDA 1GQKA 2BMBA 1VFSA 1OC7A 1WZAA 3ZR5A 1HUVA 1VEPA 3WEMA 2G8ZA 3N6QA 3WBAA 3WQPA 5EB8A 3VABA 2VEKA 2I14A 4S3JA 3CWHA 1EX5A 3HFYA 2UV8G 4HD5A 1XSIA 1ODUA 4AVOA 1PSCA 3EKZA 1TVLA 1KR0A 1W0MA 2ALRA 1OT2A 3TN3A 1IV8A 1P6WA 3LM7A 1ZUAX 5B80A 1A5KC 3FDKA 2DZPA 3WH6A 4GH1A 2VYOA 2QR6A 1K9TA 2CLHA 3B8IA 1PTDA 1T8QA 2VWTA 4LUSB 1YTDA 3VCNA 3NAVA 3TWAA 2VFHA 4Q4PA 1R9ZA 1MFVA 1PX4A 1W3NA 4G8TA 3PFRA 3THQA 3UWVA 4JNZA 2YBTA 1JCLA 4NRRA 3QGKC 3LGEA 4P2VA 1M6JA 4O10A 4YJ5A 1YDNA 4RCXA 3QKEA 2QNEA 4WEVX 1RAKA 3HG5A 4BWLC 3OZPA 3UJRA 2VJXA 2PDQA 3BGGA 1UR3M 4AIEA 4OGZA 2OKTA 2PP3A 1F6PA 4JX6A 5C2XA 1S5NA 3LPOA 3W7QA 2TPSA 1KGWA 4C7FA 1R3RA 1HXJA 1LLZA 1HL9A 4YTSA 4MFEA 1EYWA 3IIPA 1MW0A 2OGYA 1R3WA 3R5EA 5IOBA 4J3SA 5A8QA 3LXAA 2XVNA 1BWVA 3GKAA 3OVQA 4IIGA 4LANA 4HK7A 1G4SA 3BW3A 3N6JA 3EOUA 5M1TA 1JFHA 4JFVA 3ECQA 1ZZMA 2FH6A 2RDXA 2OXNA 4PEEA 1NDVA 1KA9F 1HKWA 1TWIA 2WLYA 4K1GA 3SFWA 2J79A 3RFAA 1OFQA 1V3KA 1XBXA 4AG0A 3BQ6A 1F05A 1ZBWA 3VUPA 2JKPA 3H4XA 3R6IA 4CNTA 4YNGA 4J3VA 3ITGA 2V5DA 1PYMA 5XIAA 1ZTVA 1EGZA 3MWAA 3WH9A 3FGCB 1CTNA 1KW1A 4PUWA 4S3GA 1MNZA 2PB1A 5U4NA 2WKLA 4PUUA 1O94A 3WK3A 2FMOA 3FA5A 3R8GA 3W7EA 3KWXA 4JTJA 4W86A 3G18A 1E1FA 1YTEA 4G7FA 3VIGA 4F0MA 4J3WA 3HJZA 2A3EA 1J0YA 4FXSA 3I7QA 3R13A 1SO5A 1E4MM 5LXXA 4I3GA 1DKWA 2Q71A 4C6QA 2QJMA 4C6NA 4NZJA 3SGGA 3WFAA 4DWDA 4NNAA 4DVOA 3CO8A 5FEWA 1IXNA 4IT1A 3C0QA 1V02A 3R10A 1UZHA 4X3ZA 3BG3A 3MP5A 1H50A 4PH6A 4XZ9A 1EJSC 4LQ1A 1UUMA 3GTHA 1UD3A 4GVIA 2FPTA 4OT7A 2I9EA 5AHMA 1XGEA 4IUGA 4EWND 2CNCA 3KDOA 4G9PA 3GDBA 3UPWA 3O63A 4M8UA 3TVAA 3G8RA 3W23A 4HHPA 1E70M 3VAVA 3QR1A 3JS3A 4NQ1A 2C1IA 4CQCA 3O3RA 1UBPC 3WD4A 5IXEA 3C2FA 4R85A 4XO6A 1RV8A 1MDRA 2XIIA 3MI6A 4QTGA 2X30A 2O9PA 2VUNA 3P61A 2Z28A 5HNNA 4XSLA 3M6YA 4MWAD 3W7OA 2F6KA 5G4HC 4FX7A 4EK7A 4DXXA 3IJQA 4S3DA 4FEZA 4D6EA 3UQNA 5CZ0A 1U30A 3VKCA 4QJ5B 3ARSA 1HVXA 2V6AA 3AHXA 3WJWA 3B0UX 3OB8A 3PM6A 1S1PA 4E2BA 2C79A 3U48A 4EX4A 2W3ZA 3SCVA 3WQCA 3F4WA 1UD4A 4UMCA 2Z1BA 2Y88A 1IE7C 2ZE3A 3UYIA 2O4QA 3IAQA 2GWGA 1J5SA 1NOUA 3NQFA 4QM1A 3WQWA 1QNPA 3DECA 3VNYA 3W7PA 1XPGA 2E5DA 4NNCA 2VM8A 1DORA 3ARPA 1D3GA 1KXTA 2WW5A 2IQDA 1XIDA 1AG1O 4US6A 5GJNA 3MO7A 4MVAA 2RAGA 4B15A 3W1PA 3EB2A 1FDYA 2V82A 3T2QA 3DZ1A 1Z32X 1TREA 4JHOA 3RR1A 4YTTA 1OFAA 2XTKA 1QNQA 4ONVA 3K1GA 3QQWA 4Y7EA 4CNOA 1O12A 1V7YA 3TKFA 1FKWA 1L0PA 4NZ3A 3RO6A 3LX9A 4BWLA 1OG6A 2VR5A 3NURA 4TUFA 2GQ9A 1QWKA 3EWUA 3UD6A 3M4HA 3STCA 3GAKA 4RK8A 2B7PA 3E02A 3N2XA 2VGBA 2XWDA 3FJLA 4A3HA 1ISYA 1CGWA 4H7ZA 4QDMA 5LZLA 4LBUA 3RM8A 5DMNA 1G4TA 4IHCA 2JGYA 3PBWA 3CIVA 4BI6A 2NSOA 3AIUA 3LG3A 3RU8X 5PTDA 3FX4A 3AALA 4O4VA 3QN3A 3LCLA 3TJLA 4Y9MA 3TTOA 3GFZA 5I77A 4UNIA 1YIXA 2NX1A 4JIHA 3GG8A 4R5EA 4S3CA 4JTSA 3KLLA 1V6XA 1SVDA 2V9DA 3HBLA 1X6LA 3GHRA 1WE5A 1SFTA 1YE6A 1QO5A 2X8RA 1I9CB 1T7LA 1Z44A 3T07A 4ILSA 1YBQA 2QJHA 2XSXA 5A3HA 1FDZA 1PAMA 1LP6A 2E7FA 3ABQA 2IS7A 1UP3A 2ISVA 1LTDA 2WKGA 4CNSA 1D2KA 3LLDA 3H4WA 3NQVA 1P0DA 5U7SA 3IGHX 3D46A 1TKKA 4ZXOA 4RE0A 4C60A 4MWAC 4PMJA 5A94A 5GQBA 1Q2RA 1UIPA 4UZSA 1J2WA 3VGHA 2XFFA 4QLJA 4JX5A 2E1WA 4BEUA 3PZQA 1QBBA 3LXBA 5ABGA 3E2SA 3FXYA 2DFAA 1K1DA 3N4EA 1BWLA 4DYEA 2YDSA 5G2HA 5E0FA 3WBXA 2BLEA 4EXQA 2P0IA 3UCDA 1YXDA 1TTJA 3NO3A 3R11A 1GEHA 3ALFA 5DEZA 3U4FA 3EX6A 3IIZA 2EPKX 3NQ8A 1K6WA 2WMKA 4XIMA 1X1NA 2GVYA 3Q58A 2DU2A 3P5YA 1QDSA 3P67A 4FALA 3VI2A 1U22A 1TJ1A 3FLUA 2O9TA 3STEA 4P8XA 4GXMA 3KOXA 4NX5A 5D2VA 2QIIA 3B9NA 1SQ7A 3MU7A 1AUSL 2Y7GA 3RNDA 2GGIA 4PTNA 3W29A 1NJJA 1UHVA 2EPLX 4PZVA 1J0IA 4INFA 1L8PA 1TTIA 2R1NA 3TWBA 3T09A 2KAUC 4ERIA 2DZBA 3VOCA 3M16A 1UWSA 4I7WA 4LY4A 5JBDA 4HHMA 4RJEA 1JD9A 4UTWA 1X97A 3MKVA 1CXIA 3QYSA 3P3BA 4N42A 3CZGA 1NM9A 2GFTA 1IYXA 3NL2A 4E0CA 1MNSA 4PMVA 2VMFA 4JR5A 3NCOA 4HHLA 1TPC1 5D37A 2AL1A 4OU1A 3LUTA 2W9MA 2OQHA 4I8YA 4O1CA 4GBDA 3F1QA 4K7VA 4RLIA 4PBFA 2YL9A 3GH4A 4TR9A 4XIAA 4XBKA 1EHNA 3OIHA 2HVOA 3ITVA 2W63A 3PHAA 3TJIA 3SQLA 3MUY1 4NY2A 5A6LA 2E1DA 4PB3A 1G67A 5IRPA 3TTYA 4DJFC 3OVPA 1OVDA 3C2VA 4GA8A 5HUOA 3S9ZA 4LSBA 4WOQA 3BJSA 1EZWA 4ZQMA 3FHAA 4LUYA 3C0LA 3K46A 4P7OA 5GJPA 4MB3A 5LNUA 2I16A 3VD4A 1XLGA 4RL3A 7REQB 4U2YA 4WDWA 1E6RA 1DYSA 1XLKA 2FGBA 1UZ1A 2WYSA 4Q8WA 1BFNA 4IOTA 9RUBA 3O07A 1KQYA 2OLHA 1GVEA 4HYRA 4A8RA 1GVIA 1QCWA 5AECA 1JZ2A 3QPEA 2WAGA 1QNSA 1FWEC 1RLDA 1ZLPA 4HHHA 3W7DA 5C9ZA 3KX6A 4EAYA 3LRKA 4LUTA 4RZ4A 5L9FA 5D09A 2Z00A 2ZUNA 3RN6A 3A3WA 2G50A 4AHPA 4GCAA 4LV9A 3EOOA 1PIGA 4NJIA 2H8ZA 3T78A 3APTA 4B3ZA 1AW5A 4OVXA 3R12A 3L4ZA 1ADSA 3CZJA 2C0HA 3K8KA 1RALA 4Z1YA 3PBVA 2BGQA 2C7FA 3A9IA 2GL5A 2PD9A 2QCCA 4LBSA 4G7EB 2VOTA 1YKWA 3NEHA 1D3HA 5HBFA 3WBEA 4QE1A 1GW9A 1MQPA 3D3FA 3UZWA 2OU4A 3VKAA 4QXIA 2QDGA 3G24A 4YTUA 3MZNA 4LYKA 3N1AA 1L6WA 2EG6A 3KVJA 1UR4A 1Y5XA 1J6OA 1NFBA 2ZVRA 3QEZA 3IRSA 2V3EA 5T9BG 1XLLA 3M5ZA 1VCVA 1ISWA 3QGAC 3I7SA 3VCCA 7PTDA 2L5HA 5D05A 3W6LA 5AFDA 2WCAA 4U2ZA 3U57A 1NH6A 2VI0A 3MP4A 4AYSA 3MT1A 1WXJA 1ICQA 4S3FA 4ASTA 3BAKA 3H7RA 4JNMA 3IWPA 1MVYA 2HTMA 3HIJA 1UWQA 3PVFA 3B05A 3E3HA 5CG0A 3MDWA 3QQ0A 1VC4A 3SEPA 1QI4A 3A21A 2ZRXA 5BWFA 3DOPA 1OG0A 2FFCA 3SBFA 1DJWA 4F66A 4GH3A 3DENA 1R3QA 4L9XA 3MZ2A 2JEPA 1W8GA 4XAGA 6REQA 3SCOA 2P10A 4O16A 4X2RA 2QCDA 3O16A 5I03A 2AL2B 3MI2A 2Z26A 8XIMA 3G77A 3KVMA 3LCHA 3QZ6A 3M7WA 1UW9A 4O0QA 2V2DA 3PULA 3TSBA 1V08A 3W0KA 1PO9A 4DPPA 7TIMA 4Q7IA 3GBDA 4C6DA 1H63A 3TSDA 2HMCA 2QT3A 5HNTA 1OIMA 4QIUA 3FOKA 1A5OC 4HA3A 4F2TA 3UCQA 4IPJA 3BUVA 4A29A 4REQB 3NPXA 1LUCA 1J0KA 1DWGM 1TV4A 1ITUA 2Z2BA 3LMZA 2FVLA 4BQ5A 1JNDA 3RCNA 2AKMA 3F4VA 3LGGA 2WJEA 3IUDA 5AC5A 3VFCA 1ALDA 2XN0A 4YHEA 1DWFM 4C6KA 1QHOA 2OSWA 1VLIA 3R0KA 1OFDA 3HV9A 4HCHA 4QDPA 3W53A 2QAFA 3TV8A 1H41A 9XIAA 3PPCA 4LAUA 1CLXA 2NT0A 5BXPA 2OODA 1EO7A 1UMYA 3U2EA 2XFYA 1C3FA 3VDAA 3BOXA 1R7OA 2C0AA 1K3UA 3PZNA 3PWAA 5LYRA 2EF9A 1UH2A 1VBGA 1B3VA 1WUEA 2NUXA 3LSCA 3M07A 3KS5A 3CUFA 1AL7A 1X98A 4QP0A 1JPDX 2ZC1A 5C2GA 4FOJA 3M43A 1OFOA 3ARUA 5DMYA 5FACA 1JVNA 2QUVA 4O53A 3CH0A 3BZGA 1G69A 2IKGA 4PL1A 1EP3A 4F0RA 4HCLA 5D2WA 2QCMA 4IGSA 4Q4QA 3FW6A 4G1KA 2VXNA 2Y1HA 4QG9A 3LPGA 3TH6A 1H1NA 2VD9A 4CD7A 1M65A 1M01A 4YN5A 3HQNA 3W07A 3RXZA 1XFCA 2ODOA 4O1EA 1WXZA 1EEPA 2BTMA 4ZO6A 3LA4A 1Q8JA 1GOOA 1QVBA 2CIPA 1E40A 1JRCA 4KMQA 3IARA 4EVZA 4DJDD 3NZGA 5GJMA 1K03A 7REQA 1ESWA 2ZUSA 5CKSA 1O1ZA 3N9SA 1E6ZA 4HZMA 3WK0A 4XD4A 5JMUA 5REQB 3VMOA 2ACRA 3W7NA 2CFFA 4JTUA 3CQKA 2HXTA 1S39A 4DZ5A 2MANA 1XIJA 4G7EA 1Q45A 3H7VA 4O52A 3E12A 4V1XA 4IQLA 1OIFA 3MMTA 1AQHA 1TPWA 4FSAA 4QLKA 3W85A 3DESA 4ALDA 3BLOA 4MNJA 2OT1A 4MY1A 1TV3A 4IMGA 1SYTA 5ABFA 1J10A 4DUVA 4WHBA 1ZY9A 1OYCA 1XS2A 4M0XA 4C6BA 1FWJC 1QOQA 2Z6JA 5EKYA 1NQKA 4LRSA 4GXPA 1YNYA 3CJPA 5D2XA 1HKVA 1OEPA 3TXVA 1CZ1A 4Y8FA 4C1NA 2C13A 4DJFA 4WVXA 2RGLA 3SAZA 2UY3A 4PYSA 2PCEA 3WDPP 4GYKA 1E73M 1W9XA 3FYOA 1UC4A 2X7WA 2YFOA 3TONA 3W7HA 4NI8A 2GOKA 3MUCA 1KR1A 1NP2A 1QU4A 3GY1A 1DJYA 1TWSA 2BG5A 4Q3MA 1QT1A 8XIAA 5HDRA 3V0SA 2WK2A 5BXSA 1MUMA 4UTIA 4UOQA 1V03A 2R14A 5AKQA 3W38A 4ZOAA 2C14A 1S1RA 2DGAA 3ABZA 1JI2A 2DSVA 5EFFA 1EOMA 4FR6A 6PTDA 1VQTA 4RE2A 4PRWA 4LF1A 3KL0A 5AYYA 1IHIA 4F0SA 2P8CA 3NOYA 4MFDA 4LTSA 4NAEB 5DELA 3WLHA 4U10A 2WQPA 1GOWA 2CZDA 4UQBA 2IPWA 4HKPA 2Q8LA 1R5YA 2XVKA 3GFXA 3QZEA 5KZDA 3ATZA 3LHVA 3WENA 3UG5A 5DXXA 1JZ4A 5FEPA 4LUJA 3LSBA 4N2YA 5T9CE 1HL8A 2QUUA 2FB3A 4HNTA 1BYDA 2OYKA 4LUSA 5BW6A 4Q4MA 3ITOA 4F8XA 2X42A 4ICNA 5MKGB 3M6DA 3NQ7A 3OLEA 2PDMA 4P8UA 1OFPA 4I90A 5GNXA 2E9BA 4XZNX 2Y6ZA 4MZYA 1OADA 3R94A 4C6IA 1I6NA 1BPLB 1BG4A 1A49A 4LEFA 3GIYA 1QJWA 2E28A 3L23A 1BGAA 3ME3A 2P5NA 1ZFJA 2NQHA 4TMCA 3U0HA 4O0KA 1B3XA 2PPGA 2P3ZA 5BNKA 3IS4A 5EGRA 2JBMA 3T81A 4ACZB 2WJFA 3BOLA 1V6YA 3PS7A 2DDXA 3PBYA 3RX3A 4GX8A 1ZNNA 1M5WA 1MUWA 3A12A 4O19A 1LQ2A 3LOTA 1U1HA 2ZVIA 1RLCL 3A4JA 3GVRA 3GC2A 2YCIX 4I5XA 2R94A 2XYLA 3FJ6A 5J5RA 4G56A 3O6DA 4X60A 3EB4A 2AQVA 1XV8A 3TLLA 3S9YA 5H91A 1W1TA 1T6MA 3IJDA 1G94A 1GVOA 3W9ZA 1HJSA 1IWPA 5FOOA 2YBVA 3AXIA 1XXXA 2H8XA 3TQ0A 4Q8TA 3VD5A 4A2SA 1V0NA 1KCLA 1KB3A 2Z7KA 3HU7A 1KBBA 1U5JA 2J7FA 1B54A 2V38A 4EF8A 3AYSA 3OPSA 3CT7A 4UMAA 4KS0A 2EO7A 3KBVA 3TQKA 2RKXA 1UWTA 1AW2A 4Z2IA 3WQ6A 1A3XA 1ONEA 2J7DA 4WXZA 1ONXA 4TX8A 3VIMA 2NV9A 5CBIA 2VGGA 2VGIA 6ENLA 3WNMA 3OQ8A 3E0WA 4AISA 1BSIA 1OCBA 1FHDA 3I65A 4DNMA 4EOUA 2QDHA 3LEPA 5A69A 4WGHA 5LNSA 2OYMA 1JF5A 4M24A 4D1JA 1EWEA 4L9ZA 1KLZA 1KM2A 4B2DD 1H09A 1AZ2A 3I3EA 3T05A 3JZUA 1BRLA 2DJXA 2E4TA 3FSTA 4CGTA 4ZA0A 1X1OA 3AS1A 5AC8A 5M3WA 1Z9AA 3EAUA 3VXGA 4Y9AA 5I0DA 4JD4A 2YL5A 3N2CA 3B97A 3N11A 1YXCA 1W5MA 5H8MA 2VEPA 3HB9A 2CLLA 4B4HA 1O4UA 1ZAHA 2JIWA 1O5QA 3WEZA 3HQOA 2GJNA 5CXPA 2ATMA 3LHTA 3TC6A 4NG3A 4EAMA 4LGXA 1ENUA 3VCRA 1TPEA 4DUXA 4X61A 3NL3A 5HNUA 4HJWA 3HA1A 1YDYA 3L0NA 5A6KA 3LY0A 5JVLA 1XC4A 4IFOA 3WF2A 1CDGA 3PK7A 4FLQA 1BTMA 2PDGA 3LB0A 1JNEA 3IJ7A 3VZXA 3L5MA 2XVLA 1US2A 3LNPA 1X1ZA 2J78A 1IIGA 1WKEA 2E5CA 1EX1A 4LVAA 4Y6GA 3SDOA 1N7KA 1UR1A 5JH1A 3G1DA 2P88A 4AYGA 1XLJA 3WQVA 1BQGA 4HN4A 2QAPA 1E3XA 1OYBA 4PBEA 3O0FA 1R87A 1I60A 3T55A 4C6LA 3LU2A 3CMJA 4BS0A 1FWIC 5K9DA 1VBUA 4DX3A 2ZUWA 3R7MA 3THCA 2FTPA 1CT5A 1F7BA 1T5AA 4RE4A 2JALA 5D8ZA 3AZRA 4RZBA 1J9YA 3NOEA 1W91A 1TWDA 4C6FA 2IPGA 3TN5A 4NL1A 4PGLA 5EFDA 4MYXA 3WH7A 1WCGA 3CPRA 3HQPA 4UXDA 3TP4A 5LNRA 4GO9A 4J2MA 1O68A 3GTXA 4LEQA 4NYUA 1MO0A 1PKNA 1EC7A 3PTMA 1W9UA 1BYCA 3AFBA 3PZ9A 3LRLA 5AVNA 1NOWA 2GVLA 4N9DA 1HF6A 2QXWA 3CM4A 3W73A 3WUGA 2PLKA 1K9FA 3SN0A 4QG6A 3UBPC 2X16A 4J3XA 2J8FA 3WDHA 2G97A 3SM0A 1V4YA 2BOEX 4LY8A 3AYRA 2ANUA 1KXHA 5F2LA 3E2RA 1A5LC 4XKYA 1SR0A 1HZYA 1VFTA 2E40A 4KF1A 3RYSA 3QXBA 1ZB5A 4MADA 2PDFA 2VC7A 3BV4A 3KBJA 3O6CA 3WJXA 4MZ1A 1K02A 4ZCWA 2AGTA 1TPDA 2D0HA 1BYAA 1K8YA 4LAOA 2OLAA 1RY0A 1J0JA 2Z1SA 4JTKA 1U5VA 4FXRA 3VIHA 3P81A 1IEXA 1H7XA 3UXIA 2VC6A 3FK4A 2Z0IA 2VEIA 8RUCA 3UWEA 1RA0A 1SFSA 1VGAA 5JUVA 3UERA 5FJUA 3SUVA 1N8FA 2Q02A 4V27A 4JL2A 2SFPA 4GQGA 2XN2A 1CB7B 4AIBA 4I5UA 4W93A 4D8LA 3LV5A 3CPUA 3EDEA 4AWSA 2QGYA 1FP8A 1UPPA 5D2YA 3I4EA 2ZXAA 3BAXA 3M5VA 1LQAA 5HPOA 2QMKA 3BJTA 4IMFA 1DVJA 1KFKA 5B7YA 4PODA 1WDDA 1YMYA 5K4ZA 4UC5A 1R30A 5LIXX 1W6TA 1RQHA 4GBUA 4N9CA 3GG0A 4Z0JA 3MHGA 4HMEA 3A5VA 3SCPA 3WFZA 3NO5A 4DO6A 3LYEA 4JIPA 1Q65A 4JY9A 4AZCA 5HQEA 1YRRA 2E5BA 2QKFA 3DHPA 1LROA 3TQVA 1A5SA 3N15A 2WJZA 4B9YA 4GD0A 1OK6A 5F2GA 2WJDA 4MB5A 4FNSA 4DY1A 2NQJA 2OZ0A 1QXLA 1A5UA 1ADDA 1F76A 2FZ9A 1UD5A 1TTPA 2DSZA 3BCDA 3GW0A 1ME7A 3LS9A 1R0MA 1Z89A 1NF7A 4GRSA 1Q6CA 4HPHA 1AJ0A 4TTUA 1LT7A 4CQAA 5HANA 1RD5A 4GOAA 3STPA 3N2BA 3CXOA 2HZGA 1KFBA 5C6MA 3P80A 2R91A 4IQJA 2Y61A 3UETA 4KGJA 4YWIA 4GCXA 3QM3A 4R27A 4IG2A 3IIVA 5FSEC 2X1IA 4YYFA 3S83A 4GG9A 2R24A 3W6YA 3TJXA 4WJXA 3CTLA 4WJEA 3AZSA 1AJ2A 1E0UA 4L61A 1JPHA 1YDVA 1L6SA 2VURA 4H6EA 4GKLA 3EOEA 2HQAA 3CUXA 3R0UA 5XINA 3MMWA 1FWHC 2W27A 4Q8UA 4C1KA 4C90A 4DAFA 1CGVA 3KL3A 1XLHA 2GJXB 2NVAA 3VC6A 2HBVA 2E68A 4WSKA 3FSUA 1FCBA 5M5DA 2FGZA 3L0GA 3E96A 3TW9A 3TMLA 2D3NA 2Q3RA 2WC3A 4EKJA 4EPKA 3L67A 1R47A 3VIIA 4XBSA 1XC6A 5G1MA 1XH1A 2OQLA 4KIEA 4RPQA 1P0NA 2WVSA 2NWRA 3TA9A 2ZA1A 2CBVA 1UG6A 1EJTC 5IDIA 4DXVA 2AGKA 3WNKA 3NYDA 1Q2SA 5FJIA 2YLLA 5TQLA 3WL0A 1UWRA 4J28A 4JDBA 2PRMA 3F5JA 3M5XA 3LBOA 3UCCA 1PPIA 1AFSA 4WSJA 4H7VA 3QC0A 2J7EA 2W61A 3AS3A 1MEHA 4O54A 4AVNA 2ZTJA 3W72A 4Q6XA 3W7JA 4ZQOA 3G1AA 1IR1A 1ZU8A 4O1DA 5CC7A 4FI4A 1ICPA 2QIWA 1OGGA 2YOCA 3WLTA 2NLIA 2OPJA 5A5WA 4UIOA 3EDKA 3KP0A 3CQ0A 3SUWA 4MPQA 2QPXA 4H8NA 4JTDA 1RA5A 2G3JA 3W75A 2VRKA 4ZB5A 4PTDA 1REQB 1PX8A 2WV8A 5AZ0A 4HU0A 1SJBA 2WHMA 3XINA 5CEWA 5HWJA 3NQBA 4NZFA 3N2TA 2GDQA 1DIOA 4O17A 1RP8A 3NVTA 3SCSA 1Q5MA 4JFSA 2Z1VA 1SZFA 1ZGDA 4HZ6A 1XICA 3TXZA 2ATSA 4QS6A 1WBJA 3PSWA 3HURA 2NQZA 1RCOB 4HMNA 4Q4KA 2WXDM 3O6YX 2BY3A 1OQFA 4RXGA 2HJPA 1B31A 3M44A 3GC5A 3PJUA 4P7NA 3DKJA 2YX0A 3T4WA 1QFEA 4FK9A 2XUCA 2E6YA 4FS9A 1JYNA 3G6MA 4H8VA 4JQ4A 4I8DA 4C6OA 3TU9A 4YVXA 2H3BA 4CN1A 4U31A 2Y70A 2DP3A 2QF7A 3VDBA 5ECUA 4Z1BA 1I4NA 3BGJA 1GEQA 4KPLA 3O2LA 3GDMA 4AWUA 1I0DA 4TXEA 2WNNA 3ZWSA 4EWJA 4OBSA 4ZZ9A 1RCXB 4RKAA 4TO8A 3S8HA 2YL6A 3V4BA 5C71A 3BAWA 3AJXA 1LL4A 2ESCA 2J62A 3OEXA 2XZ9A 3MO4A 4DB7A 2WSKA 4L4LA 3LDVA 1TA3B 1Q66A 4QS5A 3SY5A 1Z8AA 3T2OA 3CZ8A 1AD1A 4Q8PA 3WJZA 2AQWA 4F0LA 3B40A 2ISDA 3DGBA 2PDCA 1R6WA 4HOWA 1FFQA 1DXEA 4D8AA 5DRIA 2PTWA 2FVMA 4IXXA 4W8LA 2A6LA 4JEJA 4GY1A 1US0A 2PFHA 1WNOA 4HNNA 1JCTA 2RJHA 4BCEA 1TPVA 1UA7A 1HJUA 1QWGA 1TX2A 5AYIA 3TR9A 4JL1A 1AQMA 2QCDB 2TMDA 2ZICA 3MB9A 1O66A 1WDQA 1MW1A 3AXXA 1VR6A 2GJPA 4HZ8A 2EEXA 2HSAA 1KFLA 4BF9A 1V77A 2Y7FA 3SRFA 3VUSA 2I7GA 1WO2A 3SR7A 1BGGA 1GJPA 4QLLA 1O60A 5D03A 2PDNA 3NPVA 3MYOA 1C92A 5CPTA 3CHFA 5JBFA 2XVPA 4ATLA 2O4MA 1EF2A 1O5KA 1PVNA 4O15A 3LHZA 4YVVA 4PMZA 3NG3A 1DIKA 2C15A 4OOZA 4P7LA 5EU9A 5CBBA 3ANVA 3VOJA 4BQ2A 3M0XA 3UNDA 1VB9A 3VZYA 4GIAA 3VKJA 4Z42C 3FN9A 3LCFA 4Z1DA 4XX6A 3EOSA 2IMRA 2P3EA 1HFBA 1YTKA 2PTZA 1W9VA 1E5NA 3GSMA 1S5MA 1A50A 4XZWA 3FVMA 3LZ3A 2QJIA 5K3VA 5AHLA 2NUWA 2TAAA 3P60A 1UH4A 2V81A 2WO5A 3FNDA 3ZYZA 1NARA 4JN6A 3HPSA 4HCDA 1N55A 3OJGA 1E6XM 1XSKA 4PFMA 2V5KA 2TODA 5E0CA 4D6GA 2VCCA 3NQMA 1RBAA 2V0TA 3EXSA 1KBLA 4RX0A 2J24A 4JYFA 2WNZA 4ZO7A 3UNTA 7A3HA 4Q8VA 4H01A 2ZX8A 3GU1A 2J4GA 1J0ZA 3NJ3A 1BRLB 5CZTA 3WN6A 3O0KA 3OW1A 4FIRA 2C71A 2VHLA 4DBEA 3ZJKA 3B8VA 1IT8A 1WAWA 3KL5A 3QY7A 2BVDA 4P8VA 3G22A 2FZMA 3DBPA 3IVUA 2VCBA 2VUYA 4DZIA 4Y9OA 4BF5A 2NWSA 1YLVA 4CVUA 1MEWA 1XRSA 3QLLA 1VHCA 3DFHA 4ZO8A 7ODCA 2GGEA 5CH9A 1R85A 1UMLA 4J7RA 3UVIA 3G1YA 1M7XA 1E9YB 3HZ3A 3P82A 3IIOA 3PJWA 3GH7A 4M82A 3A5FA 2IPFA 4RDVA 3GNXA 2PDLA 5D9NA 4WLCA 3NO1A 3R2GA 2WPGA 2ZYFA 4FA3A 3COTA 1H11A 4B9ZA 2WWDA 4AEEA 4KWWA 5CZKA 1H49A 5HWNA 4HPGA 3C86A 5F4XA 2QLYA 3MI3A 3RLHA 1OC5A 2WKJA 3EB3A 4NU7A 4L80A 3AIEA 2RUSA 3LQLA 4JAWA 2QJGA 1UP2A 3WFLA 4X22A 1QI3A 2OGJA 3GBEA 5DQPA 1E55A 5C9WA 1TSIA 1N8WA 5D30A 4NAEA 4O13A 4XKMA 3W28A 4XK2A 1OZQA 4ERAA 2I5QA 4DWSD 2D73A 4WDXA 4DBDA 4PSPA 3PBMA 3M0YA 2WQDA 1C9WA 4TIMA 1BF6A 3QHMA 5DN1A 1EJRC 4DO5A 3EDFA 3L4VA 1TV2A 4XVDA 4U3AA 4IGNA 4CQDA 4MAZA 4IJCA 1SSDA 3OVRA 2V30A 3VE7A 1JAEA 2F61A 4DJDA 1WP6A 1WDRA 2DIKA 1S3TC 1QK2A 2F6XA 4ZQCA 4M80A 3CQJA 1GT8A 4KEMA 4WKAA 3SURA 4KH2A 5I2UA 1FH9A 2ISWA 3GTFA 3FGCA 2ZA3A 3WLRA 4GVFA 2ZDSA 1DWJM 1C8VA 3EWXA 1MRAA 2PU1A 3W2MA 5CSUA 2P8BA 1HNYA 2D1ZA 4IXHA 4GVGA 4W7VA 3LTYA 3KZSA 1ZP4A 1TWWA 2WZMA 3T44A 1JUKA 4LVDA 2QV5A 3VOHA 1CI1A 3MW7A 1F74A 1U1JA 2E09A 1E5JA 2E6FA 3PR2A 1S2AA 3PPFA 4JTQA 2YYTA 3TFCA 1IIHA 5EMMA 3W2LA 1EDGA 4F0HA 2Q8XA 1H7PA 3OU8A 3AISA 1PTGA 6TIMA 3T8LA 4K2SA 1DJNA 4H9VA 1GK8A 5BMWA 2YZRA 4FZIA 2XU2A 5ABHA 2PWUA 4FNPA 1ITXA 3UVAA 2NVCA 1QHZA 3O7UA 4UTWC 3DH7A 3UWUA 2CZFA 4TX9A 4G1NA 5CGQA 1CB2A 2X1SA 1SO4A 3EPOA 1PWMA 4N7QA 3DXIA 3RLVA 2RDTA 1DEDA 1GZJA 3B8UA 3MSYA 2VX6A 5H8UA 1JUEA 2NX3A 3AIRA 1UH3A 1YDOA 2EPMX 4HNVA 1DJXA 3KXQA 1XCFA 3E9AA 1JPKA 1L6FA 5FESA 1VD6A 4IX2A 1E4NA 1S5WA 3HG2A 1LCOA 1GQIA 2D2GA 4S23A 3W70A 3TE9A 1A5AA 3SRHA 1W9PA 2YIHA 2PDKA 4A3YA 3ZVIA 1B2YA 4HOXA 5HQLA 1NY1A 4FX6M 4AAJA 3RIKA 1PKMA 2A0NA 4CD5A 1IGSA 1YXYA 4QSFA 1RJPA 5DFAA 4GFSA 3T2PA 1T0OA 4W7UA 2GSJA 4J3TA 3EWCA 3RM4A 1JDEA 2FB2A 2FLIA 1DJIA 5AY7A 7TAAA 3ERPA 2IPJA 1TPH1 1EH9A 4R3UA 5FA5A 1UD6A 1LL7A 2BXYA 3GR4A 1V93A 1E43A 3DEQA 3TN6A 6CGTA 2DSKA 1CXLA 1XKYA 1F61A 2GOUA 5DMLA 1DQUA 1KV5A 3RUBL 1XYBA 4YS1A 3K8MA 4UFKA 2J13A 3CGTA 1DHKA 2A2IA 4ERGA 4N9BA 4WR3A 1OX5A 2XGIA 5CQ1A 3BTNA 4KFOA 3SGUA 4DJEA 1CEOA 3BGAA 2E8YA 4H8HA 1MSSA 3EPMA 4YLWA 2WNWA 1FWBC 3CZEA 1FHUA 3NQ2A 3P6LA 4ROQA 3W86A 3GH5A 4FB7A 4PUMA 3F03K 1JPMA 2D23A 1GKPA 1C7TA 4IP5A 1A0DA 2Q09A 4KWSA 1M7PA 1EA9C 3CUHA 2QCNA 4AD0A 4UTJA 1IZJA 5EBAA 1G01A 4Q4SA 1J0HA 3F2BA 1EIBA 1H7OA 2OZ3A 4GUGA 4UQAA 3PZUA 3REQB 3AI0A 3LM3A 3KOFA 2VZVA 4MJ4A 3FYPA 1QW8A 2GGHA 5JU6A 4HSNA 2WZIA 4NJKA 2NT1A 3NVDA 2D2OA 1RQEA 3FA4A 3GTIA 3H2CA 4XAPA 2UY2A 1NWUA 2ISFA 1MMFA 5D04C 1GORA 2DJLA 4Q4OA 4L9YA 3MHUA 4HNLA 5TF0A 3V5CA 2AQOA 3PAOA 2PP0A 1ISXA 1ZSXA 2HDJA 2Q3OA 1BWKA 1VEOA 2A3LA 4AXKA 3N6HA 3B8TA 3IUIA 3OLGA 3FJ4A 1F3EA 3IGSA 4L56A 3C5QA 3WLIA 4JTEA 3MUAA 4UCGA 3WBYA 1UOZA 4LNCA 5BZAA 1FXQA 4TV5A 4K68A 1MXGA 3LENA 3BANA 1YW1A 4Q8OA 2YCKX 3MVTA 2PODA 2XHYA 2VL4A 5LHFA 1U33A 8CGTA 1CYGA 3G8EA 4IISA 3GM8A 1JULA 3CMGA 1AODA 3UPBA 4HMDA 4D1IA 3E0FA 3NQ6A 3LD5A 1DWIM 3RHGA 4ZO9A 3KRZA 3B8SA 2GQ3A 4OFCA 3BMWA 4NJGA 3GXIA 4ORMA 4MJZA 3EEGA 1CGXA 4MZ8A 4PCFA 3I6RA 3ZT6A 2AAAA 4ECLA 4P7RA 3LZ5A 2C6QA 2D69A 1N2VA 4U4MA 4W85A 3G2GA 4GI9A 4MSSA 2AOSA 1Q4NX 2ASHA 2ISSA 3ABXA 5BOOA 1CPUA 2GGGA 1EJUC 2OWWA 2CLFA 1JPIA 2CKSA 5I07A 4XZHA 2DQXA 4HA4A 2YFNA 3AHTA 5REQA 3CL7A 3NSNA 5T8GA 4ZOBA 5FCZA 2I57A 3WMCA 3N9RA 5KZEA 2CKRA 4J27A 1RHCA 4XV0A 5E0KA 5C70A 3G1SA 4KCVA 4Y8EA 3CEUA 5A1AA 4J40A 4TVDA 4IH3A 1E1CB 5FEXA 3FVDA 2HS8A 1EZ2A 1PJ9A 1CX9A 1XLAA 3VGBA 1L2QA 3TYCA 4MDPA 1VPXA 3R0DA 3P0XA 4A3RA 1GNXA 1EL3A 3ZS4A 3E5PA 5HR6A 1A0CA 1QBAA 4PTVA 2KZHA 3SN4A 1GOIA 3QSTA 2XN1A 3S6OA 2HCVA 5TIMA 3S1VA 1RJQA 1LLWA 1LUCB 2XISA 4LCQA 1TVNA 4XAZA 3FS2A 5A8MA 4O8RA 1WKYA 3S5OA 3ZLGA 2OEJA 3O9NA 1TWZA 4E6MA 1IEWA 1XX1A 1GVYA 2H9AA 3ARQA 5A6JA 1WX0A 5HMFA 1SO3A 3WH5A 3FDGA 2B81A 3BXWA 1YE4A 4C6EA 3NA8A 3KTCA 1FX6A 4OJYA 1ONWA 3NDOA 4HN8A 1A5NC 2YA0A 3JVAA 2OMAA 1I45A 1JJKA 3UY7A 2AMXA 2FYMA 3AWNA 1UJQA 5LKYA 3ANUA 2E9LA 2GYIA 3ARZA 2QJNA 3P8JA 2VZTA 3SB0A 2C18A 2PEVA 4UTLA 4ICCX 3F4CA 4WY0B 1V6WA 2Y63A 4HOZA 2ZE0A 4N0RA 5BOEA 1GGOA 5HMDA 4GLEA 3HO8A 3W37A 3GTNA 2ABAA 4NHVA 4CCDA 4PMQA 5CC3A 1H61A 4E3TA 1EUNA 2B7NA 4WGXA 1Q85A 3KRSA 3LTSA 3S42A 4MLRA 5CPQA 4AWTA 4XZMX 1A0EA 3BSHA 1XRFA 1JYXA 3KVKA 5E93A 1EXPA 4TU1A 4I7UA 4WKHA 1XF0A 3CLMA 3PUDA 4DNHA 2FTYA 3W22A 3MV01 4L6HA 1UROA 1W3KA 3C52A 3CNYA 4FO4A 1Q6LA 1JG9A 2PGRA 3H7UA 1PB0A 4LXFA 4Z2HA 3KVLA 4HPJA 4CU7A 2REQA 2WWCA 1XUUA 3PB2A 5D2TA 1FWGC 3W1MA 2Y5JA 3U5UA 1KKRA 1GQJA 3GD6A 2ZOXA 2J8GA 3ZVHB 3QTPA 4LYPA 4TV6A 2EGZA 1P6BA 4LH8A 3UR2A 4UFJA 2ACSA 1OFRA 1RD6A 2A6NA 2YZ5A 1YADA 3S5YA 3S5SA 3VO0A 2W92A 5JH2A 1XISA 2PDUA 3GNDA 4PMUA 4F9JA 3W2JA 3ARWA 3RF9A 1XL9A 1KLYA 2BFGA 1AJZA 1WXYA 4AHQA 3S2CA 2ZA2A 3USBA 3EMQA 1RBLA 2NUYA 1KM0A 3LI0A 4ML9A 5FL0A 2ACQA 4JBRA 1R2TA 5DANA 4JKMA 2WCGA 3CEPA 3DIPA 1Q7ZA 5FIPA 1ZALA 4IM4A 4XD5A 2O9RA 3GQYA 1H2JA 5JXQA 1JEZA 3QPYA 5AC7A 1JCXA 1BXNA 4Z08A 3A23A 1EGMA 3I4KA 2WB5A 2UWFA 1LZOA 2A4AA 4IMEA 3PC0A 4G2DA 1ME9A 1EIXA 3QY6A 4PCPA 4JYDA 3FYYA 2FKPA 3WZ0E 4LPCA 1F07A 1LM1A 1UUQA 2NXIA 3BV7A 1MXSA 4V15A 4HPXA 2VKZG 4H00A 4C7GA 3GHTA 1GOXA 1WUFA 4KWOA 1IZCA 1XIMA 4Z2LA 3PF3A 2OELA 3QKZA 4JQ2A 3NQEA 2CBUA 2NXGA 1VJZA 3HPFA 1NELA 3ITYA 3NL5A 5FJOA 4M3PA 3ANYA 1L6YA 2ZADA 1KCXA 2V3DA 1GQLA 1KM5A 3RRXA 1FCVA 5HOSA 2BHZA 1UR8A 3N73A 1NDYA 3PB0A 3WNNA 1H3GA 2REQB 4O28A 2PLCA 3W1NA 4DWSA 4GI8A 3RLGA 2X7VA 1UJPA 3FAXA 1B3ZA 2CZVA 3H12A 5CPNA 5A95A 3SCUA 1OSEA 4DUWA 3WH8A 4GZIA 7ENLA 4MGGA 4EF9A 3VNIA 3KWSA 4GWEA 1TV7A 5EMUA 1SJAA 4H6QA 1FWWA 1JXKA 3G6LA 3RAOA 3C3NA 1HO4A 2JKEA 3QR3A 1F4AA 3ITTA 3N9KA 1QAPA 4QNEA 2WOQA 4KERA 1W3IA 1GUVA 3N3TA 4MWAA 3WDRA 4S3KA 1NEYA 1I2NA 4C6MA 2XZ7A 3S9IA 5EMLA 4X63A 3U3HA 1CIUA 2WSQA 3VTRA 3KRBA 4UQCA 3QV7A 1FVPA 1CECA 1FRBA 3MANA 1VBRA 3C6CA 5E9AA 1GVSA 4C65A 4F0KA 3UZZA 2GUYA 2INFA 4K37A 3MYPA 4B5TA 4GQ0A 3VINA 3D5HA 2OO6A 4A4AA 1LBMA 4O0ZA 3O1NA 2PF0A 2O9OA 3STGA 1X6UA 3S1GA 3PZOA 4JTTA 3QSRA 4WKFA 3PG8A 5AHFA 2BXZA 3MKKA 2H3DA 3KOYA 5HWMA 1PEZA 1B9BA 4KBXA 4IICA 1ZCCA 4F3HA 1JXJA 1XIGA 3R8RA 1B30A 3EXRA 4E8CA 4W87A 3PUGA 1EJXC 3W27A 4LNYA 3APYA 2J25A 3DHUA 3UG4A 2VEMA 4GMEA 3P93A 1XQKA 3GVWA 3IIXA 2NQ5A 1A5CA 4JTIA 5BCAA 5G2IA 3TYZA 5TNVA 1XLDA 2OEKA 1HJQA 2X0YA 4GNJA 3FKRA 1S5VA 1OC6A 3NIYA 5XIMA 3VM7A 4WF7A 2GLKA 3PUOA 2DEPA 2OG9A 4WZHA 4AIUA 1FFRA 2R6OA 3VNKA 1SR9A 1MUCA 5E6YA 3CHCA 3E0VA 4B4FA 4DZAA 3QOMA 4W9TA 4PRRA 2WM1A 3W2KA 2VENA 2YDRA 5F1VA 3PNUA 4ZE4A 1VJIA 4OQVA 2F2KA 4AY8A 3OHMB 3GKFA 4CNNA 2F8QA 3A4WA 1DOSA 3C2YA 1TCMA 1TZ7A 3I68A 5IFTA 4Q4RA 2EBNA 5FJTA 1KXQA 2BODX 5JIWA 5F1UA 3WYZA 5FF4A 1Q6FA 1FP9A 3R25A 2VX7A 1VFOA 1W54A 1RPKA 4LAKA 5MF5A 1FWSA 3QV8A 3MDUA 1MQRA 1EQPA 1Z69A 2G3NA 4K8GA 4YL2A 3DUGA 4GK8A 3PSVA 1W1A1 4OHQA 1P1XA 1HJVA 3MHFA 1UD8A 3CMFA 4ZBCA 3UG3A 1KGUA 3C0SA 2ZZ2A 1ONRA 3MVIA 1OD8A 4YTRA 4W7WA 3THAA 4NNBA 3IANA 1K8CA 2Y4SA 1PZ0A 4H83A 1XLMA 5I00A 5AHEA 2A5HA 2JEQA 4HYWA 3SZ8A 3B9DA 4JTAA 1XUZA 3VC5A 2DUAA 3ATYA 3IV8A 4F9DA 1OWQA 5CPLA 1YNQA 3W25A 3HPZA 3DDMA 5I24A 1BTCA 3OO2A 1OY0A 4BFAA 4GZEA 3W1UA 3W71A 3W7CA 1LL6A 5FJRA 4PBGA 2J7CA 3GHUA 1G1YA 3W2NA 1VH7A 1I1XA 2BVTA 1ECEA 1SZGA 4XZIA 4JFTA 1SFLA 3NXLA 1K6AA 3RITA 4DJDC 4XTDA 1S46A 4AY7A 3H26A 3WNLA 2V5CA 1XPYA 4WDTA 2ZRWA 2VDHA 3TQPA 3B03A 3B4UA 4AD4A 5HATA 3BL3A 5HA7A 5T26A 1KXVA 1R9XA 5DX7A 5CSYA 1US3A 4RW3A 3PTDA 1NIUA 3W7MA 2W79A 3MSDA 3WUEA 2EJAA 3KOWA 2WVVA 4AZCB 1JZ6A 4LC6A 1LBFA 1EP1A 1ECQA 2FPYA 4AF0B 4RPPA 4O1AA 2WMHA 3S2JA 3C0JA 3LTPA 2HISA 3OA5A 3FY1A 4DM2A 1DJHA 1B57A 2A3BA 1SUXA 5A6AA 1TJ2A 3LCXA 2GDUA 2QHAA 3VX0A 3UWZA 5C55A 3OLDA 4UFMA 5CZSA 2Y8KA 1J11A 4NVTA 4ENLA 4UFIA 1F73A 3NGFA 1KFCA 5DT7A 2PZ0A 3R89A 2VTFA 1KCZA 4O4WA 4RV3A 2XVGA 2GPTA 1OBAA 1VFFA 1F3TA 4QJ4B 3BVJA 4CN6A 3L4YA 3QVQA 4MNKA 2PGEA 3NUKA 1R9YA 2O7SA 1ZRQA 3ARXA 3FA3A 3P84A 3ARYA 3S6DA 3GX9A 3DI1A 4YYCA 3BCJA 1UB3A 1H62A 1NF0A 1THFD 3ARRA 1ZL1A 4KW2A 3TOPA 2EPHA 2A3CA 1TQJA 3V75A 4CEXC 1DV7A 3QRHA 3FKKA 4LALA 4AU0A 3F7JA 4RUBA 3BMVA 1Y7VA 3GZAA 4FF5A 3TCEA 3KM8A 2DZUA 4LS1A 5K2ZA 1W1IE 1K7XA 1XLBA 2ONEA 3H2OA 4JFUA 2ZX9A 4LVFA 1RZMA 5K4XA 3BAIA 4D6IA 4GQBA 1PDYA 5BXRA 3B0VC 3WD0A 1VCGA 3H8AA 4LVGA 1XI3A 3KTSA 1S2UA 4TVCA 4RW5A 2BY1A 5DMMA 3MBDA 2OX4A 3E5BA 3KCLA 4DN1A 1VRDA 2GSHA 5I3DA 1JGMA 2XINA 3EKLA 2C19A 3VNLA 4M6QA 2ZFAA 3G0XA 2GWNA 1NDWA 1QHPA 5I3GA 3BJFA 3MA8A 4UTUA 1VIWA 3E38A 4ZL1A 2GQ8A 5DT5A 1G5AA 4LU0A 1HQTA 4Y9PA 1M3UA 4JQAA 2V5BA 3URAA 1VPYA 4KFNA 3KBWA 2I56A 4IMAA 3LRMA 4FNQA 3CV1A 1W5NA 3OOQA 4S2CA 3QH2A 1G7VA 4CVWA 4ZQPA 1V5XA 5HJXA 3SSJA 1UYQA 4DUOA 4TTGA 3APGA 1HL2A 1ICSA 4HK6A 3GLCA 1LWJA 2D2JA 2Y5SA 3MWCA 4H9MA 3SCNA 2NZLA 3V5OA 3MCNA 1C29A 1H5VA 3S1UA 4F79A 1YYAA 3OHIA 3VYLA 4QG8A 1GVRA 3RILA 1J12A 2VEGA 4XD6A 3BPWA 3TJ4A 1QATA 4PN2A 2ZC8A 2FZ8A 5HINA 1LOLA 3BLPX 1RY8A 1CGTA 5TBOA 3UG8A 1KRCC 1N82A 3UU0A 2BOGX 2XSAA 4PCSA 3UR8A 1UKTA 3TTQA 1EBHA 1EEXA 2ZRVA 5AB3A 5FEZA 2FZBA 2ZX7A 4GHRA 4MUPA 2QCLA 4KKXA 3LN3A 2P76A 1PHQA 1R38A 4KCUA 2WMJA 2XFRA 1CW2A 1OFBA 2WHKA 3WJYA 4MTVA 2GUBA 4XAFA 3MCMA 2I9UA 1TZ9A 4W8BA 5E1QA 2H6RA 1D3CA 2VD8A 3S4TA 2GSEA 4ATDA 4HJFA 3IJ6A 1LWHA 1YEYA 3DFNA 1XHGA 5EPDA 3BOFA 2BV9A 1UWAA 4ICMA 3TYEA 4HVXA 4OTKA 3INPA 2CHRA 3W1AA 2CZEA 3V7PA 1UQZA 2RFGA 1UP0A 3SCWA 2PTYA 4K1WA 1P48A 2ZZ6A 5C9UA 3F5LA 3KFTA 2ZX5A 1J4EA 4UTTA 1D7FA 4Y9NA 2XGZA 1QR7A 1W9BM 1HKIA 3G0UA 1X96A 2Y5EA 1EPXA 2B7QA 1UR9A 2DZSA 4GQRA 4V2XA 3WMLA 5CJ5A 3PZMA 1DL3A 3AMKA 1M53A 4UQ9A 3RMEA 3URQA 3KDNA 1HJXA 3QJAA 5I79A 3NPUA 5BU6A 3T0AA 5C54A 4W88A 4B5XA 1MW2A 3L4WA 3W4RA 4JICA 3HGJA 4IJBA 1KCKA 3CL6A 4GC4A 2NXHA 3UA3A 1NFPA 1AK5A 2QULA 4FP1A 2Z1KA 5E70A 3OBKA 3WNPA 3WLMA 4KIRA 1BAGA 1KV8A 1VEMA 2E0PA 3DHDA 1PIFA 3KBSA 5CZJA 5IHSA 4GQQA 5F7UA 4FOUA 3E74A 1DBTA 3T08A 2BP1A 2W0UA 3NL6A 2WMFA 5LA1A 3CO4A 3BSGA 1T96A 9XIMA 4XISA 3A4XA 2PBOA 4GGBA 3WDQA 2E6DA 3KHJA 1ZCOA 3IUHA 2DUZA 1KKOA 3TAOA 3AC0A 3DC0A 1AQ0A 2HROA 1BHGA 1PKLA 3TCSA 1TJRA 5D02A 4H9TA 2OOFA 4PMDA 1GOQA 3U8GA 4KWVA 1WDPA 3B0PA 1QPQA 1V3JA 2CHOA 2X2YA 4DAIA 1SMDA 1C8QA 3L12A 3VDHA 5KEZA 3WMBA 3PTQA 2DY3A 3ITXA 5CG7A 4CD6A 2R8WA 3AJ7A 4TMBA 4L6OA 2CLEA 2F38A 4LUTB 1JIBA 1K70A 3DFSA 1W3TA 4PFHA 2OZ8A 1QI0A 2NVDA 3TYAA 4Z1CA 4JDYA 4NAFB 3QW4B 4BA0A 4IGHA 4H9XA 4FMVA 6A3HA 4TX6A 3U7BA 2V67A 4L4PA 2PDWA 1SZNA 3TAKA 4GY7A 5H6HA 1P43A 4PRTA 3F4NA 3ID7A 1K9EA 2DZAA 2X0SA 3TNBA 2Y7EA 1AMKA 1H1YA 4PE8A 2DW6A 3AWOA 1U83A 4A22A 2CLKA 4XUGA 1GTEA 4ZTYA 2DVUA 2OSYA 4POCA 1H51A 4L7ZA 1Q3NA 3OVGA 4AD2A 4AB4A 4URIA 4GUFA 4KFPA 3V18A 4PTWA 2CLMA 4LT9A 3UZYA 5CCZA 2NQ9A 3FEMA 1XBYA 2CWXA 1V7AA 2Z2AA 4LYRA 3B0YA 1OX4A 3WLJA 1BXBA 3Q65A 2OTDA 3OYXA 3N14A 2PE4A 3IRDA 1E6PA 3WUFA 2VT0A 5L6UA 2VZOA 1HTIA 4XQ6A 3TN4A 2EG7A 1O7AA 1V51A 1MQQA 3B4YA 1QOPA 1TMHA 3WLSA 2HBXA 3L5AA 4BHYA 4CCZA 4ATWA 2YJQA 2VRJA 3EOLA 3CZKA 1YQ2A 3DFOA 3B04A 4NRSA 3KW3A 2E3ZA 1AMYA 3VNJA 4EPBC 2PCQA 2Y62A 1I2QA 4GJ1A 2PWHA 5C8BB 3LXCA 2B0MA 2OR2A 1WOAA 3BAYA 1UKOA 3Q2DA 4UWMA 3MMUA 2A79A 3EKGA 3LHUA 3BG9A 1OCQA 7CGTA 1LOSA 3WBWA 1C8XA 3UJSA 2ALDA 3V0UA 2G41A 3G0SA 1AVAA 5KINA 1Q4WA 1NFGA 1FA2A 3GNRA 1TG7A 4E3VA 3WF1A 3DG6A 2Y7DA 3ALGA 4UFHA 4H4IA 3NZQA 2Z27A 3QTGA 1A4MA 4QAWA 3LCWA 4W8AA 4BEQA 4B5WA 3VIKA 2PMQA 4OKDA 1DHPA 4C6JA 3Q67A 4QSHA 3U7VA 2YCJA 1TMLA 3C8FA 3PBUA 1UKSA 2TYSA 2VRQA 1MDLA 1E71M 3IJ8A 1C9DA 1NU5A 3ITLA 3M46A 1UR0A 3EMCA 1O6IA 4NZ1A 5F2MA 4KWUA 4UTTC 1V3HA 2PU0A 3LK6A 2CZ5A 1SJCA 2PS2A 5DBUA 3PWIA 2PWDA 2DZTA 2FZNA 3CL8A 4IG2B 4X2PA 3VKKA 3VE9A 3BH4A 1J6PA 3BE7A 2VNCA 3WF0A 1R3SA 1MWOA 4HGXA 2CYGA 4ZEPA 2CETA 3VK5A 1GOKA 4JTFA 3GIQA 2UZ9A 3UT0A 1I75A 3H4GA 3SIMA 1XYCA 3A24A 4OUIA 4IQDA 3QBUA 4ZFCA 4FXJA 2X1TA 4OBRA 4CD4A 2A7RA 3UR7A 3TLQA 1TPUA 3AICA 1X7FA 5AN7A 3WKZA 1PZ3A 1VLWA 4MY8A 4V1YA 1QW9A 2HK1A 4Y96A 3DCPA 5I6SA 6ALDA 1PXGA 4ZR8A 3GVGA 1KTCA 3URBA 1P5BA 2YXOA 3SQMA 2ZKMX 1W5OA 5T91A 3PJXA 4IF2A 3L2MA 4FLOA 5LSMA 4M6PA 1LWIA 4M56A 4UNKA 1KRMA 3EWYA 3PG9A 3NSXA 2ZBTA 2Y24A 3SI9A 3AMGA 1WPCA 2R1LA 2XIQA 4H9UA 3VMNA 3T40A 4H41A 4ZXLA 2EPOA 4AY1A 2VX4A 4KEUA 4OWGA 5JIPA 3HFTA 3GC4A 4MG4A 5AYBA 3U4AA 2AL2A 5C5YA 2A85A 1H0IA 4NXKA 4GISA 4EANA 2AAMA 3R58A 5A8NA 1XR2A 4HNCA 3IEBA 3L68A 4F2UA 4GINA 1HKKA 5A6TC 3ZIZA 5H8PA 1IF2A 2NW0A 2OKOA 1VP5A 1FH8A 5KZMA 2YYUA 4KRTA 3T7VA 2F7FA 4OOUA 4ZOEA 1LBLA 3QY8A 5J04A 2DT2A 3NNTA 3HQ1A 4O50A 4YHGA 5CGTA 1UOKA 2YB4A 3DYOA 3L0KA 3OTRA 1WKDA 2PLJA 1NOFA 4YPJA 3RDKA 3REQA 4PUKA 4DWSC 3VZZA 5JQ9A 3II1A 2CBJA 4I9AA 1O1HA 4CCEA 1P7TA 4ZOCA 5LXEA 1F8MA 1PL9A 1F2JA 3WQ4A 4GYFA 1AD4A 1YNPA 3LNMA 1KM1A 4WY0A 5KETA 6REQB 2YCLB 1ELSA 2HPMA 5AVHA 1W17A 2VFIA 4PA8A 1XYAA 5A8PA 1R3YA 2DV0A 3SUSA 2CLOA 1CXFA 2EAWA 1VF8A 4XZBA 3W1RA 5M2FX 1Q7QA 3N25A 5HJLA 4IPLA 1A3WA 3I3BA 4P5UA 2PDHA 5KMYA 1Y5WA 4GABA 1NQ6A 4E4FA 1NVMA 1SJDA 2WM0A 2UY4A 3ABRA 3W3OA 4FNUA 4JN8A 4AZBA 1Q6QA 2BX7A 2R1MA 4AC7C 1YPIA 1P4CA 2WPBA 3R4IA 4AZ6A 4AHOA 1CWYA 2ZQ0A 4X0NA 3BO9A 5G1YA 4HSOA 2BBFA 3OGVA 3TDFA 3VIPA 3CS2A 4OE7A 3AUJA 2RGMA 1CCWB 2PD5A 2QZRA 5CPOA 2XM1A 1BG9A 2G96A 3QQ1A 3T0TA 1KM6A 4GKTA 2BGSA 3P5ZA 4GFIA 3VILA 1XIIA 3AYTA 3NQAA 2X09A 3LQGA 1V6TA 2GZXA 5FF0A 2XFWA 3OLIA 3H21A 4GUHA 3GW3A 4AMAA 3EDJA 4WK9A 4MDOA 3QR0A 5BU9A 1LQ0A 3N17A 3UW6A 5FF2A 3VD3A 1FH7A 1Q13A 4X9SA 3AIQA 3W83A 3IVSA 4MMWA 3AYVA 3W01A 1VRXA 5HAOA 4YVPA 1XLCA 4L65A 1HKJA 4IFRA 1W9DM 1M04A 2VWSA 4HU3A 3BLEA 4MLJA 1V79A 2QMJA 4IPNB 1JCNA 4DJED 3EXTA 4WXYA 2ZXDA 5C2CA 2WC4A 4AEOA 2J74A 3GG1A 1TB3A 4FPSA 1FWFC 3UP8A 4R7WA 3ZJ7A 4QGCA 1DIDA 4QE5A 3F4DA 1F6KA 4W5ZA 1XQLA 2G5WA 4ADUA 3KLKA 2RH9A 2PP1A 4GYPC 4B5SA 2C3ZA 3ARVA 2ZCGA 1U2YA 4D8ZA 3EX1A 3GWQA 3CAKA 1W8SA 1EHAA 1LOQA 3WLOA 3ZJ8A 3WIJA 3UYCA 5HJYA 1WDWA 3W24A 2PBGA 1IEQA 4IPIA 1QASA 4GACA 3V36A 4C6CA 3WELA 1PX3A 4GNVA 3MCOA 1AQFA 1EWDA 4O1FA 1J8VA 2VZSA 1YHTA 4ZQRA 4LF2A 4I9TA 3DAQA 3E0LA 3HGOA 4GIRA 1UASA 1QNOA 3I6EA 4OUEA 1GJWA 3E1F1 3S2NA 4PEKA 3HG4A 3WD2A 3CASA 2YR1A 3G1RA 1TO3A 3GHSA 4PTXA 4D6FA 3SIZA 2ICSA 2O0TA 3AIWA 4O12A 5HQMA 3PPHA 3HOJA 3IJ9A 5A2CA 2IXVA 3L7RA 3V1HA 3W7RA 1EA0A 1A4LA 4LCRA 3ZMRA 3A3XA 3LLFA 2ZXBA 3MTWA 4QISA 4DEFA 4RNFA 2PDXA 3UEQA 4N9EA 1J01A 2BHYA 1J93A 4F4RA 3UJFA 2QDDA 1EYEA 1P0KA 3IK2A 1KC7A 3LLXA 3S46A 1ZPTA 3BG5A 1BD0A 2E6AA 3UWQA 4D6DA 1SO6A 3SCRA 3ZOAA 3QV9A 3PZTA 5HMSA 5A6BD 1GHSA 3DHFA 2OWCA 4MNMA 4LB3A 4UQEA 2PTDA 2QCGA 3WDIA 3GO2A 3T1GA 4YCPA 2YPIA 4HTYA 5LIKX 3SADA 4DYJA 4US5D 3WL1A 3SUTA 3M0IA 2HK0A 4YXGA 4J4KA 2CU0A 3JUGA 1CXEA 4Q8QA 3VD7A 4EPEC 5C7HA 3EWDA 3PZVA 5LGZA 3M0JA 2ZTKA 4W84A 3WMSA 1DIEA 2EPNA 3W1TA 1H4PA 1B1YA 2D22A 3CK5A 3L2IA 1MZRA 2F2HA 5BWAA 3CT2A 1MFUA 1I2PA 4JOMA 4R53A 1KWGA 1NAL1 2JIEA 1OJXA 2CESA 2W62A 4FIQA 5D4YA 4MYAA 3UFYA 1JFXA 1VYPX 1TR1A 5E9XA 4H8UA 2VP8A 2ABBA 4A8IA 3VFLA 1YBQB 2Y85A 3VMPA 2YL8A 3NTYA 2BVYA 1E1CA 4S3EA 2GK1A 2DVTA 2YKKA 2HVMA 1K77A 3H22A 1E4LA 3C56A 4H1ZA 3WSUA 1S2VA 1XDMA 2OJPA 3PN8A 1ZJAA 4IIEA 2C1GA 4JCLA 4AUBA 4ZTXA 5HULA 2OVLA 1V02E 4GYJA 5CBJA 4PCNA 2WCSA 3ZVHA 2BY2A 3W81A 2J7HA 4QAIA 2O7QA 1IEVA 9CGTA 4UNLA 1ADOA 4R34A 3CV2A 2GVEA 1H7WA 1WQ5A 1XKJA 4MKNA 5IDZA 3M7SA 2PWVA 2XIOA 3KEHA 2Z7GA 3M1ZA 4LWWA 4AMCA 1P6CA 4R7OA 1V3IA 8A3HA 4A3QA 3NZPA 2XPKA 1Y65A 1BQCA 3R8HA 1OX6A 3AMLA 3WNOA 1M1BA 1PZ2A 4AQLA 1K7FA 1X8FA 1G0CA 2BGNE 3B0XA 3QHOA 1K4GA 2FIQA 4Q7BA 2PURA 4A8NA 1JI1A 3POHA 2CPUA 5DXYA 3P7YA 1B3OA 4E8DA 4IMCA 3WO8A 2WBGA 3RLUA 1XYZA 3P62A 2QVHA 2XSBA 1EJVC 3PUEA 1POJA 1E51A 5H2ZA 2OQYA 3DU0A 2IXUA 3AXMA 1E3ZA 4GYPA 4QBXA 2J27A 2QCFA 4C91A 4RNHA 3R79A 1CBGA 4ORIA 4MF4A 4H6KA 2BXVA 1DE5A 3ZM8A 3WQEA 1Q7MA 3M0VA 4TQTA 1FWCC 1ZHAA 4QCFA 2H90A 1J79A 4ZB0A 4YIWA 1OF6A 1J2BA 3S5ZA 4OZOA 4QR6A 2RJGA 4MWAB 4DF2A 1GOMA 5CPSA 3W00A 1OM0A 4PMNA 1IEIA 1W3JA 3LHYA 4AC1X 3IGUA 3HPXA 2Z1XA 1XGDA 4GZJA 4A35A 4RNJA 3U5YA 4EXAA 2YW4A 1DXFA 2D20A 4F2BA 5CC5A 1KFEA 3VGFA 4QQ3A 5GVJA 2P1FA 1TPB1 4BF7A 3BK0A 4E2VA 4C1LA 3C8NA 1D8CA 4M51A 4UB9A 1QNRA 5LA2A 4XUYA 4OV9A 3E6EA 1IXQA 4DO7A 2X1UA 3V35A 2HPIA 1OCJA 1NWTA 3KBNA 4PSRA 3WY1A 2HE8A 1W2PA 4MOZA 1UIOA 3SECA 2G3IA 3NR0A 3LMYA 2Y0FA 1TTQA 3TA6A 5LGXA 3KOZA 3NQCA 4NJHA 2R1PA 4E38A 3NZRA 2D24A 3N29A 1WKFA 2CITA 4CQ8A 1BKHA 3A4AA 1HX0A 2D0GA 3V16A 1EUAA 4MJMA 2QQ6A 3VNZA 2YA1A 4J5NA 3O06A 3NZ1A 1GHRA 4JTHA 3O8AA 2ZUTA 4AEFA 3VDCA 1TMQA 3Q94A 1PYFA 4UR8A 2KX9A 4PMYA 4H04A 1NWSA 4XG1A 5BYWA 5A6MA 1OD0A 1WV2A 2JGQA 1OINA 2X05A 3BQ5A 1GJUA 2E9MA 1JL8A 1ZBKA 3WDJA 5I5RA 2QVNA 1Y0EA 4GO8A 3DFYA 4D6JA 3GS6A 2ZZ3A 3BLKA 3OGRA 3WQDA 2BHUA 3AUOA 2QUTA 4DRSA 3NDYA 3L21A 3KHDA 2QS8A 3B9AA 1J96A 1MZHA 1F8IA 3SGZA 2V3FA 4O1BA 2DZWA 2P53A 2J75A 1RXOB 1XFBA 3KUMA 3W74A 1GKQA 2VX5A 3CPGA 4AZHA 2FVKA 3D47A 1JD7A