4RDYA

Crystal structure of vmolac bound to 3-oxo-c10 ahl
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
312
Chain Sequence
VRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
molecule keywords Parathion hydrolase
molecule tags Hydrolase
source organism Vulcanisaeta moutnovskia
total genus 124
structure length 312
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4rdyA00
2HPMA 5CH9A 1FWJC 2F6KA 2EG6A 4IG2A 4EPEC 4G7EB 3MKVA 4C6LA 4E3TA 3JZEA 3IRSA 4LEFA 4QRNA 3URNA 3GUWA 1XRFA 1NDVA 3GU2A 4H9MA 4ZSUA 4DZIA 4EPBC 3RHGA 4J35A 3PAOA 4I6KA 4H00A 3TN3A 4HK7A 2FVMA 4GYFA 4IFKB 3HM7A 3C86A 3QY6A 4WGXA 4IFOA 3A3WA 1XRTA 1J6OA 4C6QA 3LU2A 2QPXA 4GX9A 2VUNA 1EF2A 3B0YA 4KETA 1S3TC 4QS5A 3TN5A 1RA0A 4C65A 4C6MA 1UBPC 2BB0A 4Z42C 3E2VA 4R88A 3GU1A 2VM8A 1EJUC 4GY0A 4B90A 3RN6A 1FWEC 3F2BA 4LCRA 2QS8A 1NDYA 3GTHA 1O12A 3E74A 4QS6A 4IG2B 2HBXA 2R1KA 2D2HA 1I0DA 3G77A 4C6DA 4DLMA 4C6KA 4DNMA 3MPGA 4J5NA 1P1MA 3OJGA 4PCPA 3CAKA 3URBA 1ONXA 1YIXA 3GRIA 4CQCA 1EZ2A 4EPDC 1PTAA 4XD5A 4EPKA 4LAMA 4LCSA 5AKQA 1GKQA 2R1MA 1FWIC 3OVGA 4B3ZA 3B40A 4PBEA 4LALA 3S2JA 1E9ZB 3UR2A 3QY7A 3EWDA 3PBMA 3HTWA 3IARA 3UR5A 3F4CA 4ERGA 4QTGA 3O7UA 3QY8A 2HNHA 4H9VA 4UB9A 1HZYA 1XGEA 4NP7A 4V1XA 3OQEA 2Z00A 3T81A 2PGFA 4GXWA 2FFIA 3S2MA 2AQVA 2PUZA 2FTWA 4WVXA 4KEUA 3OODA 1ADDA 4V1YA 3MSRA 2OGJA 1A5KC 1EJTC 4PBFA 3TN6A 3FDKA 4C60A 4WHBA 2WJDA 1FWHC 4XAGA 2KAUC 4C5YA 1FKXA 2VR2A 4KESA 1GKRA 4BKNA 1PB0A 2ANUA 3MDWA 4DIAA 4MUPA 1FWBC 3DC8A 3IV8A 1V77A 4CEUC 2Q09A 1RAKA 3ITCA 4J2MA 2HQAA 2DVTA 3IJ6A 1M65A 4IGNA 4C6NA 2O4QA 1NDZA 4I6VA 1EJSC 3AUOA 3IPWA 2GOKA 1EJWC 4RDZA 1J79A 1P6BA 4JOMA 2Z2BA 3GIPA 2P50A 1ITQA 2ZC1A 3LY0A 1J5SA 4BY3A 1EJXC 4H9YA 4RE0A 2PGRA 1UIOA 1V51A 1FWCC 1DPMA 3F2CA 2WJEA 1R9YA 3WMLA 1YNYA 2ADAA 3LSCA 2YXOA 2UBPC 3LS9A 2AMXA 3E0FA 2Z7GA 1KRCC 3WYZA 1VFLA 1O5RA 4IFRA 4C6FA 1YBQA 3MTWA 5FSEC 3S4TA 4H9XA 4KERA 4H9UA 2QT3A 2DVUA 1FWAC 3IACA 3O0FA 4GBDA 2A3LA 3MJMA 2AQOA 3R0DA 4GC3A 1ONWA 1P6CA 2Z26A 3E3HA 3BE7A 4LAOA 3LGDA 5HMEA 3UF9A 2O4MA 3SO7A 3B0XA 1V7AA 3QGKC 3GIQA 1RK6A 2D2JA 2IMRA 3GTIA 2YZ5A 4GK8A 4PCNA 2OQLA 4XAZA 4GZ7A 2OOFA 4CQDA 4EP8C 1RA5A 2Z25A 4LCQA 4B92A 1WXYA 2GZXA 2XIOA 1YBQB 3SFWA 3T8LA 3MVIA 4H9TA 3AU2A 4C6PA 2P53A 3QGAC 4LH8A 1PO9A 2Z24A 3OOQA 1V79A 4ERIA 3K4WA 3IGHX 2HPIA 4UBPC 3TN4A 4AQLA 4CQBA 5E5CA 2I9UA 5A6TC 1RJPA 1A4LA 3GU9A 4XD6A 1FWFC 3LNPA 4INFA 4DLFA 3UBPC 1M7JA 1M68A 1FWGC 4KQNA 2ICSA 4RDYA 5LXXA 2E25A 3NURA 2OB3A 2E1WA 4XD3A 4LANA 3A3XA 3DCPA 3GTXA 2G3FA 4CNSA 1KCXA 4DI9A 4C6EA 4C6OA 1R9XA 4HJWA 2EG7A 3PNZA 4ZSTA 2Z29A 2D2GA 4XD4A 5HMDA 4L6DA 4C5ZA 4DO7A 2VHLA 3LGGA 4CNUA 1KRBC 3N2CA 1E9YB 1QW7A 5G4HC 1K6WA 1K70A 3MDUA 2PLMA 2QVNA 2WM1A 4DZHA 4GOAA 4F0LA 1FKWA 4IGMA 3URAA 1ZZMA 3ID7A 3V7PA 1ITUA 2Y1HA 4ICMA 3GTFA 3S2NA 2VC7A 4H01A 4R7WA 2W9MA 3T1GA 3LSBA 1RJQA 4QSFA 3FEQA 3K5XA 2R1NA 4R85A 4XAFA 3UPMA 1KRMA 4PE8A 3ISIX 4HK6A 1A5OC 4C6JA 4F0SA 1GKPA 3NQBA 2GWNA 2OODA 1R9ZA 3EWCA 1K1DA 3MVTA 2FVKA 4QROA 2YB1A 3DUGA 1UIPA 3NEHA 4KEVA 3KM8A 2Z28A 4GY1A 2RAGA 2YB4A 4TQTA 3GG7A 4H9ZA 4ERAA 3A4JA 4XAYA 1J6PA 1XWYA 1EYWA 2VC5A 3HPAA 4G2DA 4RZBA 2R1LA 2BGNE 4YIWA 2I5GA 3RYSA 4IF2A 3WZ0E 2Z27A 4KIRA 4NI8A 4P5UA 1YMYA 3ORWA 1A5MC 4L9XA 1I0BA 3ICJA 4KEZA 1EJRC 5HMFA 1FWDC 1W1IE 2Q01A 3D6NA 4NG3A 1YRRA 2Z2AA 3E0LA 1KRAC 1EJVC 4F0RA 2HBVA 1POKA 4AC7C 4CEXC 5FSDC 3PANA 4GX8A 4C6IA 1V4YA 1IE7C 4CNTA 3S2LA 3EGJA 4LFYA 4GY7A 4IH3A 1WXZA 1A5LC 4HK5A 4G7EA 1A4MA 1NFGA 1UMLA 2GWGA 2GSEA 4OFCA 2Z4GA 1RK5A 3LA4A 4RDWA 2PAJA 4C6BA 4B91A 3F4DA 1RJRA 4D8LA 4IQJA 1PSCA 3OU8A 3TNBA 4IFKA 1QXLA 3F2DA 4KF1A 2WJFA 3CJPA 4DYKA 1BF6A 4M51A 2DVXA 2CZVA 4HA0A 3AU6A 2R1PA 1JGMA 1POJA 2UZ9A 4RDVA 3E38A 3RCMA 3CS2A 4C6CA 3K2GA 2FTYA 3FDGA 4DI8A 3PNUA 1NDWA 2EG8A 3URQA 1A5NC 4LAKA 4BJHA
chains in the Genus database with same CATH superfamily
1TPC1 4TUFA 1WZLA 3SN4A 4P7OA 1H7XA 1QWKA 4X9SA 4JHMA 5HBFA 1NP2A 4LEFA 3NSXA 2UY5A 4F9DA 4EPBC 4ML4A 4US6A 1TJ1A 3PZMA 4EKJA 1WDWA 2RDWA 2HE8A 5FI8A 3S6TA 3V1PA 4KWOA 2DORA 1VJIA 1Q8AA 4QS5A 1X8CA 1CXKA 5H8PA 5KINA 2V63A 5E09A 2BB0A 2XZ7A 3CU2A 5IBXC 4MB3A 4I7WA 1E0WA 3MI6A 4B90A 4MF4A 2J66A 2WYSA 1ZENA 3G1YA 2XISA 5FAGA 3G77A 1LYXA 4J5NA 9CGTA 4HP5A 1JCNA 2J78A 4JIQA 1YXCA 4LAMA 4P7QA 2VX5A 2A21A 4S3JA 3EEGA 2OGYA 3O15A 4PB5A 3M44A 1PYFA 1TUXA 2GQ3A 1RLCL 2WVVB 3W6LA 4GFSA 5T9BG 1UR2A 5GJMA 1CLKA 1MFVA 1R3RA 3KX6A 3NZGA 4DUVA 3WLKX 3L66A 3S2MA 1UMYA 1U30A 3MUIA 1C9DA 4J3VA 4LOCA 8XIAA 4V1YA 3KCLA 1LQ0A 2P8BA 4RUBA 2OOGA 4ZE5A 2P76A 2YDRA 4KESA 2X1UA 1XV8A 2VCCA 4HU0A 3F4VA 2GJLA 3D5HA 4DAFA 1HW6A 3TW9A 1HVQA 4HSOA 1GCYA 2RDUA 4DBUA 3QSRA 4YYCA 1H50A 3OLIA 3EEZA 1EJSC 3HGRA 3STEA 3C2YA 2D3NA 3GBEA 3UR8A 1Z48A 4REQA 5IXEA 4ZVJA 4NUWA 2JALA 1PL9A 1LP6A 2DUXA 5LHFA 1ZAIA 1K6AA 2WC4A 4NZ1A 3GR8A 2QYGA 2EPKX 1R9YA 1IEWA 3CC1A 4UTUA 3M7SA 1TTQA 1DQUA 1EXPA 4LRSA 2ZQ0A 3Q4DA 4TTUA 4NRRA 4UQCA 3CGTA 2ISWA 2FMOA 4GH1A 4KERA 5HATA 1HKIA 3O0FA 2P5NA 1UD4A 2VENA 5BRBA 4IX2A 1JD9A 1E6RA 7REQB 1E4MM 2FJKA 3NQGA 5LYRA 1QHPA 2XIIA 2VC9A 3T08A 1TG7A 3VMPA 1IGWA 4F9JA 1JZ5A 3N2OA 3QGKC 4KCWA 3SY1A 4X60A 3NZ1A 4MPKA 3CUHA 3U8GA 1W91A 2YZ5A 1NWTA 2AGKA 3MMDA 5D9PA 3KBNA 4GZ7A 3CZLA 4IGSA 3N9RA 1FHDA 1SYTA 3NL5A 1K02A 1I1XA 3T8LA 4HYRA 1D2KA 4MWAD 1SM9A 1E56A 2PDYA 4IOTA 3GDMA 1TWIA 2OEKA 2EO7A 2O92A 3WBWA 3EOEA 1DJIA 1DP0A 4C1NB 3EMCA 2E5DA 4AQLA 2XH0A 3SRHA 1U83A 5BWAA 4LVFA 2VDIA 1JUEA 3LTSA 2NVDA 4INFA 4B5UA 3UBPC 2PRMA 1M68A 1XLHA 5CPQA 1A5CA 2Y7EA 1GVSA 4E2VA 4XBJA 2OVLA 3PULA 2AGTA 5I06A 2ZUNA 4ZFCA 1DJWA 3LZ3A 3AJ7A 2ALRA 2IKHA 1BKSA 2DZUA 3PNZA 2R14A 1D3CA 4ZQPA 2VXNA 2G50A 3TTYA 4YN5A 3U5YA 4A6GA 1RD5A 3SAZA 3B04A 1UKOA 1K70A 2PLMA 1QHOA 5LKYA 3GKFA 2ZRZA 1G69A 7ENLA 2GGGA 3UA4A 2WCGA 1G0CA 2ZZ5A 1IXNA 1A3XA 1J96A 2YA0A 3STGA 5MKGB 2VGGA 3ARRA 3QW3A 2OWWA 3CMGA 3DFOA 4R85A 4GHRA 1NH6A 2PE4A 1PDZA 3SUTA 2ZUSA 1T41A 4QGCA 2BOEX 1I2NA 2WVTA 4GPNA 3MVTA 2FVKA 3TU9A 4AD5A 4QROA 3MZNA 1HO4A 4Y2WA 2QCFA 3C3UA 4ERAA 1MI3A 2Q8LA 3FV9A 4X22A 3WBXA 5TQLA 4KRUA 1C8YA 2ZRYA 4IQEA 4QHRA 3HMJG 2G95A 3FAXA 5DMLA 1TMQA 4MOZA 1C7TA 4UR7A 1XIMA 1J0JA 1CNVA 1JQVA 1TZ9A 5LZLA 3L2IA 4F0RA 2HBVA 4PSRA 1SO3A 4PB4A 1UZ4A 3T0AA 4CNOA 1R6WA 1LOSA 1WXZA 2I17A 5DMYA 1AFSA 4RNJA 1GW9A 1UMLA 4JD4A 5ECUA 5FEWA 1JYVA 4HMEA 5LIUX 1GOIA 3LZ5A 3CPUA 3O3RA 1QVBA 4ZO7A 3SBFA 1DJHA 5C0QA 3M5VA 1PSCA 3ZJ8A 1K7XA 1JYNA 5EB8A 1P0EA 1K7EA 3WF4A 2XU2A 3CJPA 1TYGA 2WNQA 4N2YA 2DVXA 3M5ZA 1UA3A 4O15A 2A4AA 1OG0A 5GJPA 1XIEA 2DT0A 1MRAA 3PBUA 2V2HA 5CPTA 3ZWSA 2J75A 4ZFMA 1EDGA 3VKDA 1J93A 2INEA 4XWUA 4KWWA 1FWJC 2V30A 1A5AA 2XGIA 3QZEA 1I2QA 2NQJA 3JZEA 3W7RA 3PPGA 3NEVA 4ZSUA 5I5RA 1VFOA 1E15A 3IAQA 3NL6A 4Q8PA 2QULA 4MKSA 3DFTA 1X1NA 4OBTA 1DHKA 4FR6A 3GHRA 1S2TA 1VFHA 1IEVA 2I16A 3WD1A 4WX2A 4GX9A 3KOXA 3GAYA 4OBRA 3WL0A 5JMUA 3BSMA 5CSYA 4B3LA 1H60A 4GY0A 1FWEC 4BA0A 1N8FA 2E8ZA 1R3QA 3N4AA 1VYRA 2GJNA 4HIBA 2R1KA 9XIAA 4LYKA 3WBEA 3AYTA 1VJSA 3M64A 3DESA 5AYXA 3RJYA 3GQYA 4FXRA 4YHEA 1BQGA 3LD5A 3SCRA 3DHFA 4PC8A 1UUOA 1XCWA 4M6PA 3KBMA 4HTBA 2X1RA 4TR9A 4AD0A 5A8MA 2Y6ZA 1S5WA 3IVSA 4V1XA 4B5XA 5HA7A 2J7FA 1YTEA 2FZ8A 3UZZA 6ENLA 4ICNA 5D2VA 2PBGA 1CDGA 1N7KA 2UY2A 3PHAA 3VILA 3STFA 3TN6A 4RXFA 3D3FA 4ZOBA 3CXOA 1EX5A 1HFBA 3MY9A 3S6OA 1LORA 4MUPA 3CZJA 4LB4A 4LB3A 1I2RA 3N15A 1GQIA 4CEUC 3LLFA 4X0NA 1TVPA 5KZ6A 2DVTA 1JYWA 1B1YA 2ZXBA 4MGGA 2Z0IA 1H63A 4X61A 8CGTA 2QIIA 5TIMA 2ZC1A 4ILSA 4E4PA 5G2WA 5JIWA 3PPHA 4JZ5A 2HDJA 2KX9A 4DEFA 2ZTJA 1HG3A 2Z6JA 4JEQA 3PG9A 1SW0A 4EXQA 1VFLA 3ABQA 1KB3A 1BVWA 1JAEA 6REQA 5FL0A 1UHVA 4J3WA 3LCFA 3RM8A 5FEZA 1BXNA 5IBXA 1EHNA 2PA6A 2Z1BA 1X7IA 4XIMA 3B0XA 2Z7KA 4REQB 3XINA 4GI9A 3UWVA 2ZA2A 1ZB5A 1F76A 4ONVA 1PX4A 4AF0A 5CCZA 4AMCA 3G6LA 3CUJA 2VKZG 3LXCA 1EEXA 3SI9A 1Q66A 4LX4A 1G01A 3WD0A 4B92A 1XBVA 3C52A 1NQKA 1UWRA 1UWTA 4ZMGA 1SJAA 3MVIA 2NLYA 3MMUA 4MM1A 2FIQA 4G8TA 5EYWA 3UU0A 3CZEA 2NW0A 1CI1A 4FSAA 3UETA 2Q6ZA 4LF2A 3UERA 4RJEA 4PEKA 1A4LA 4WKFA 1ZP4A 1JCLA 1BLIA 2FKPA 3DFYA 1FWGC 4BI7A 3PUOA 3PZIA 2EJ1A 1XINA 2OXNA 4GIYA 4UZSA 2WKLA 4HPXA 1PDYA 1GT8A 3CUZA 4XUYA 3ZLHA 5JVLA 3GTXA 1QNVA 3NPVA 3LTPA 3HU7A 2C0HA 1RZMA 2FTPA 4I8DA 3KRSA 1DWJM 2QCNA 4ZO6A 3H4GA 4HKPA 1WBHA 3QZ6A 1G94A 5EMLA 2OYMA 5AYBA 1RQEA 3GFXA 2W67A 1MUMA 1OX6A 3IIXA 4F0LA 3HA1A 3R8GA 3URAA 4WCJA 3VOCA 4KCUA 1OT2A 2Y8UA 3CMJA 4V28A 3UY7A 1W9PA 3NO1A 3GTFA 1XUZA 4ICCX 3T1GA 3TXZA 4W4QA 2BGQA 4Z2LA 2C79A 5G4EA 3WLJA 4PE8A 1OCBA 1NTHA 4F66A 1YDVA 3S2CA 4DUOA 1JF5A 4JQ2A 1SZFA 2J47A 4XZHA 1MO0A 3BW2A 5LA0A 2YB1A 3VOIA 3W7IA 4FX8A 2PMQA 1R30A 4LWWA 1T0OA 1KFLA 3N34A 5I7GA 3WQ4A 1EYWA 3HPAA 3U3HA 3FA5A 4QJ1A 4YIWA 5C55A 4NI8A 4P5UA 4X9YA 3TMQA 3VI2A 3GG8A 2MANA 2WSKA 3FVMA 3K8MA 3MI2A 5JUVA 3TCSA 3KRUA 3S9YA 2AKMA 3VDGA 4BF7A 3LI0A 3A4AA 1TPVA 1G6CA 4Q32A 1XLCA 2WV8A 3L4YA 1B9ZA 5KZMA 2WKJA 5EMYA 2XIQA 2E68A 4CQ8A 3BUVA 2Y85A 3LRKA 3T2PA 1QI2A 2J7BA 3KLKA 1BF6A 4G7FA 4GVIA 5AYIA 3VNZA 2ZZ4A 1TWZA 1GOWA 3UJRA 3PG8A 4ROPA 3LLDA 4ROQA 1TWWA 2PU0A 4DO5A 2WSPA 4JTTA 2ALDA 2XPKA 4AZIA 3LCIA 1AW1A 3LMYA 4C6LA 4CGTA 3A12A 4NILA 3TH6A 3AJXA 1UR0A 1YPIA 2DU2A 3K13A 3SCWA 2Q3RA 1YNPA 2L5HA 2VURA 2Z6IA 2I5QA 1BHGA 4MDOA 1UC4A 1O1HA 1QPKA 3TTQA 3VO0A 3V3WA 6PTDA 3H2EA 1NF0A 1S3TC 1VEPA 1KTNA 3LBOA 1FWWA 4GUFA 4O8AA 3GFYA 2QUVA 1XBYA 1BWVA 3ZM8A 1FRBA 1S2UA 5I3HA 1OT1A 2XVGA 3BL3A 3OJGA 5CC3A 3GRIA 3TYUA 2PWUA 5IM51 1OX5A 2CHOA 3DFHA 4UTLA 3WDHA 3UZJA 1GONA 2VX6A 3O63A 3UYIA 4Q4RA 2CHRA 3AHTA 4JKLA 4H2HA 2EF9A 2XWEA 3APYA 4C1KA 4GI4A 5I24A 3T81A 4AWEA 1V93A 1JZ7A 5D38A 2RFGA 2YKKA 3E9AA 3T7VA 4JXCA 4I90A 1ALDA 3EWXA 1OGGA 1SFSA 2JEPA 3C0SA 4O14A 4XAGA 4AZ7A 1Q6DA 1A50A 3WLTA 1E5NA 1FKXA 1SR9A 3QSTA 4S3BA 1QI3A 2DT3A 5BCAA 1RBLA 3G1RA 4XG1A 2BXZA 1C8XA 1US2A 2ZXDA 1QCWA 1ZCCA 5M1TA 4JYEA 1NDZA 4FNRA 3V5FA 3WUEA 1U5JA 7CGTA 4Z0JA 2WBKA 1VR6A 3M0IA 1Q63A 4LYQA 2GQ8A 1HF6A 5AY7A 1ISVA 3MZ2A 2P50A 3TTOA 4P7LA 1EDQA 2RGLA 4AZHA 3G5EA 5HR6A 1QI4A 3QFEA 3S5YA 1ENUA 1CXLA 3D3AA 4LW7A 3PN8A 3FXYA 3VK5A 1HTIA 1RQHA 1QT1A 5BRPA 3NQVA 1A5BA 3VIKA 2I7GA 4A35A 1I4NA 1QATA 4NJGA 4U31A 3LCXA 4R7OA 4IFRA 2F6UA 5HPCA 2XHYA 2ZX6A 1MNZA 4QLKA 3S1UA 2VR4A 4I9MA 1JZ2A 2WKGA 4GC3A 4ZO8A 2PSNA 3ZT5A 1F07A 1XLMA 3G8EA 3ZJ6A 1C8VA 3QKZA 3V18A 3CWHA 1N82A 3LM7A 1V7AA 2BHZA 4DRSA 3TC3A 4A3RA 5G5IA 5I07A 3APGA 2VD9A 4PMDA 3U57A 1XR2A 1FWTA 1VBRA 4NZJA 3KFTA 3W0KA 3VIFA 1XH2A 5IOBA 1XLKA 3S0CA 3RO8A 2A3BA 4WOZA 3B8VA 2ZDSA 6REQB 3UGVA 5D30A 3EDJA 4JFTA 4Q6XA 4RV8A 1LWHA 3WH6A 3BLEA 2HVNA 3E12A 3ENLA 3XISA 2BTMA 1QHZA 5E5CA 3AIEA 2DT1A 4XD6A 3L4XA 2NX3A 4YNGA 3N29A 2NVAA 5ABFA 1ZAHA 4AF0B 3I4KA 3M47A 5LNSA 2BBFA 2VUYA 2QIWA 2V0TA 2JKAA 1KCXA 2IKIA 4B9ZA 2J6VA 3NQ2A 1TV2A 2YJQA 4H1ZA 4XSLA 5CSSA 1NM9A 1K77A 3CYJA 1QNOA 1VB9A 4BQ2A 2VTFA 3LGGA 4LNYA 2XZ9A 4P8WA 4ZOCA 5FAJA 2GOUA 4DZHA 1W56A 3V7PA 4CVWA 4E8DA 3WUGA 1NSJA 3LEPA 1KM0A 3NSMA 1TRIA 4P8UA 4R7WA 3AS1A 1ZFJA 3KZPA 3T2QA 1J0KA 6XIAA 3UPMA 2VP8A 3LPOA 2PP1A 3T09A 2YYTA 1XQLA 4UFKA 2JE8A 3OHIA 1OC6A 3EX6A 1JCJA 2CLOA 2PLJA 1B9BA 3TSDA 4DM1A 2E28A 3CUGA 3UZ5A 2A79A 3AIWA 3AC0A 4R27A 4XAYA 2GGEA 2VGIA 2W66A 1MSSA 3P80A 3WZ0E 4E4FA 3LN3A 3ORWA 3RAOA 1GQNA 4E0CA 1I0BA 2PB1A 1I6NA 1QK0A 3W01A 3P8IA 2BHUA 2Z2AA 3PWIA 4TVUA 3QQ1A 1BEUA 2ZYFA 3AXXA 7XIMA 1Q13A 1QNRA 3R4IA 4DJDA 1LT8A 2FZ9A 2OSWA 1UKTA 1IE7C 4GY7A 2QJGA 3BLOA 4NT0A 3PZ9A 2A85A 3KWSA 1W5PA 3TA6A 4HU3A 3WLRA 3ZS4A 3L0KA 4QDWA 1JRBA 4QEEA 4QFUA 2WB5A 2BY3A 3VAVA 5C71A 4L7ZA 2F84A 2PWHA 2CZVA 4PEEA 3C3NA 1KFBA 4TO8A 1QWGA 1CX9A 4B5NA 2QF8A 2IKJA 3PZVA 1LG2A 2J25A 3KWXA 1B3VA 1QNPA 2F6KA 3BC9A 4ADUA 1SJBA 4FHAA 2Z1VA 4PTMA 4QRNA 4WRHA 4FNQA 3GUWA 1O5QA 3RHGA 3SURA 3QMTA 5CEWA 4H00A 3ALFA 3F5LA 3CL6A 3WFLA 4I7VA 3MCMA 4O1AA 2FPYA 4LBSA 3EAUA 3HGSA 5DCDA 3GLCA 5HK4A 1L6SA 4KETA 4KFOA 1JI2A 3E2VA 1NF7A 1F73A 1EGZA 4DBDA 2WBGA 1LBLA 2XIBA 1DV7A 3LI1A 3DYPA 1K8XA 1FDYA 4GUJA 4S1FA 4RE4A 4NKCA 5I09A 1TCDA 4EX4A 1KM1A 2YDQA 3GVWA 4B3ZA 1F8IA 1TTPA 5A1AA 3HTWA 4QE1A 3DG3A 5CBJA 1B90A 1PUDA 2XFYA 5BXSA 3NR0A 2HV5A 5K9CA 1W3KA 1GYLA 1NARA 4FX7A 2R94A 4WXYA 4A3YA 2PZNA 1IZJA 5CPOA 3AAMA 1DJYA 3MSRA 1E3ZA 4CD4A 3R79A 2HVMA 4HN8A 3LB0A 3G2GA 4MYXA 1PTDA 2WAGA 3G1XA 1TPFA 2W92A 1KXVA 4LUIA 3I6EA 4WJEA 5EL1A 1ZJBA 2Q09A 2C13A 3PUEA 4AH7A 4MJ2A 3IJ6A 1LL7A 2O4QA 1HIZA 2BOGX 4MB1A 2FFCA 3A4WA 1EJWC 3DOPA 2R6OA 4MY1A 1CBGA 3ABXA 4BWLC 4NXKA 1V51A 2PDCA 1E5JA 1FWCC 1QPRA 3L5MA 2CNCA 4MWAE 1QBAA 3GXTA 1HQTA 2E6AA 2J77A 3LSCA 3N11A 4PRTA 5D8ZA 3LOTA 2X41A 3CUFA 3GH4A 2C71A 3AOFA 4QE5A 3CT7A 4PTXA 1PWMA 1AD1A 1XPYA 3EBVA 1H5YA 4B2DD 3I4EA 1W0MA 3WELA 2EPLX 1A5UA 1S46A 3KUMA 3T6CA 1GQLA 4LAOA 3QGVA 5C5YA 1GNXA 2XUCA 3VNMA 3W2NA 1LUCB 3VM5A 4GI8A 2IMRA 5DFAA 4WDTA 1JZ3A 1CZ1A 4L1XA 3D46A 4KWSA 1JF6A 3ITGA 1WYIA 3C2RA 1PJ9A 1V3JA 4PBGA 3MO4A 3VZXA 3G1DA 4IJRA 4M7TA 3RJXA 2BFGA 3OGSA 3RUBL 1H5VA 1OC7A 4X3ZA 4FNTA 4LYRA 1MYRA 3NZQA 7TAAA 1JZ8A 4M6QA 5F1UA 4RL3A 1GVYA 2QCLA 3UA3A 2WMHA 4LH8A 3VMOA 2W62A 4BK9A 3USZA 4FALA 2UV8G 3KE0A 3CWOX 4UBPC 3R2GA 1X1ZA 3PBYA 3N4FA 2D0GA 2DUAA 3LM3A 4J2PA 4MSSA 5A2CA 3S6DA 2ACRA 4IISA 2XH7A 2JK2A 4CN1A 3QMSA 1JZ6A 3L5LA 3LYEA 4O19A 4RNHA 5HJLA 2OB3A 4JIEA 3P8JA 3LHWA 3EX4A 2CIPA 2NQ9A 2ZDRA 4G1NA 1QPOA 1FXQA 2I14A 4JIRA 4WLCA 5LA2A 5HR7A 3KBJA 4M1BA 6TIMA 1GQKA 4HPJA 1X6UA 1OCNA 2GJXA 1N8IA 1UW9A 2A7RA 1L8PA 3TYZA 4CD6A 3AIVA 1EWEA 5HMDA 2PDMA 3L4WA 4W5UA 1DE5A 4YLWA 4H6RA 4TVCA 4DO7A 1OIFA 2VFGA 1WCGA 2QCEA 4NVTA 5K7JA 1DHPA 3MDUA 3GDBA 5C70A 4EAMA 4GOAA 4O1EA 4IMFA 4PCFA 1QU4A 4LQ1A 4JGDA 4ZZ9A 4WKAA 3JU2A 1QNSA 2OT1A 5ABFB 3W81A 3PTMA 2POTA 3GAKA 4UTWC 3FSUA 1IGSA 3I7SA 1KBBA 5G2IA 2X7VA 4FEZA 4GC4A 2WO5A 3ZVHA 2HEJA 2X1IA 3AMDA 4ZQMA 4Z0SA 3DFSA 3UZYA 2HS8A 3HB9A 5IHSA 3LPGA 3M7WA 4ZB5A 3HO8A 2XFRA 2VC5A 1PS9A 2I5GA 1OF6A 4IF2A 4KIRA 4ZQNA 4E6MA 1YMYA 2BHYA 2Y8KA 1MMFA 1UD8A 3QM3A 1UD5A 2OJPA 3CT2A 1MVYA 4JL2A 3TJLA 3U2CA 3W7KA 1QUMA 2GGIA 4FLSA 1POKA 2INFA 2XSBA 4B5TA 3ARUA 1FH9A 3PANA 5CZSA 1C8QA 1ZTVA 3QC3A 4WY0B 4JTAA 1WDPA 4CNTA 2GK1A 1ITXA 2Z4GA 1RCXB 3ZWTA 5J5RA 4HA4A 4F0MA 4RPQA 1EOKA 4NNCA 3GW3A 2G4JA 2TAAA 3H53A 3SDOA 2D22A 1R47A 3ITLA 4NX0A 3C0JA 3F4WA 5AZ1A 3M4HA 2UZ9A 5F2LA 4DF1A 1KTCA 3LHZA 2QLYA 2WWCA 2WZHA 4UFLA 1LG1A 2JGYA 4GFIA 1KCZA 1P0KA 4M82A 3WH7A 3W1XA 3NXLA 1FH7A 3H12A 2Q8XA 4QIUA 4GLEA 1KGXA 4MTVA 2ABAA 3ITXA 1LDCA 4J3ZA 3WCZA 3EDDA 3IRSA 4IIFA 4ZB2A 3URNA 4H9MA 4BF5A 4ZODA 3HG2A 3W86A 6TAAA 4I6KA 5DELA 3OA3A 3AISA 4DELA 2OPJA 2CERA 2H6RA 3PJUA 3RM4A 4FF5A 4IFOA 2NT1A 2QCCA 3BLDA 1E51A 3T07A 4FLOA 4C6QA 1GOOA 3BMXA 4PTWA 3HBLA 3UJEA 3W75A 3TXVA 4K36A 3OA5A 2NX9A 3W2UA 2UY4A 5EMKA 5H8MA 2VM8A 3VC5A 3F2BA 5FEXA 3I68A 2YW4A 3KOWA 3WG6A 4N9EA 2P1FA 2G8ZA 1IXQA 1E6PA 3QV7A 4YWSA 1HKWA 4ZOAA 4EPDC 4JDBA 3JUGA 2VRQA 3APTA 3WMBA 4L4PA 3I6RA 1R38A 1A80A 4AD3A 4CN4A 3H22A 5I3JA 3TCEA 3N2BA 3HG3A 1ZJIA 4YJ5A 4QTGA 3O7UA 4HGXA 3UY8A 3CEPA 4A29A 4JX5A 2PCQA 1XG4A 1K8YA 2PDIA 3GNXA 3AROA 1F61A 1GJUA 1K8CA 3GHSA 3OODA 3MKCA 1KQZA 1ADDA 2QDHA 4L1WA 1EJTC 2GGJA 2QR6A 3MU7A 4HCLA 1LROA 5I00A 3B4UA 3CK5A 3W2KA 2YW3A 2B7OA 3ARVA 1IWAA 3HMCA 4DBEA 3SW6A 3L21A 1LCOA 1HNYA 1S3HA 2ZCGA 1Q7QA 3CO8A 3GSMA 2GSHA 3WQ5A 2HQAA 2WMJA 4YPJA 3IPWA 3SCOA 3T55A 3NPXA 5C9RA 4J4KA 1QBBA 4NAEA 3GB6A 1WX0A 2Z2BA 2YL9A 4HTYA 1QW9A 3NWRA 5TNVA 4JY9A 1T99A 5CJ5A 1G5AA 1WV2A 1QNQA 4HNTA 3SY8A 3ARTA 1Y65A 1V03A 4JAWA 2OQHA 5DQPA 4YVXA 4MKNA 3OYXA 3V4BA 2WW5A 4RLIA 4GQRA 1KFKA 4C6FA 3B4YA 4WZHA 4Z17A 3G8RA 4AVOA 1E72M 5FF2A 3P6LA 1DWFM 4H9UA 2ISDA 1KBKA 1J4EA 5FF0A 2AQOA 2Q8ZA 3DX5A 2JKEA 1VBGA 2CLIA 1KLZA 2W4XA 1AZ1A 1A3HA 5KITA 3OYZA 3A13A 1GVOA 1QK2A 2NV1A 1VD6A 1Q85A 5AHLA 2NUXA 3GXPA 1XPGA 1TIWA 3CH9A 4PUNA 4AAJA 4S23A 3VNDA 1IT7A 3FHAA 4QQUA 1UQZA 2YCKX 4ZR8A 1RA5A 4LCQA 5KETA 1E9IA 3DKLA 3TQPA 4CNNA 2VT0A 4UQDA 4XVDA 4H9TA 1JPMA 4IMEA 1LJYA 2CXGA 5LXEA 3BO9A 3GG0A 1IZCA 3LCGA 3ZJ7A 4M0XA 3HPSA 5A6BD 1Q2SA 3K4DA 2CZEA 4EXAA 2ZUWA 4U5IA 4GABA 3MCNA 3GYCA 4MAZA 1I75A 5AZ0A 3G1HA 3W84A 1U1UA 3HQ1A 2ICSA 4S3AA 3ZR5A 4Q8QA 1EP3A 1T5AA 2YBVA 1GQJA 1DTUA 4CNSA 4PL2A 3WNPA 1YXDA 4QR6A 5D9OA 2Y24A 1OZMA 2EG7A 4ZSTA 3DH7A 1J0YA 2HXUA 2Z29A 4UTKA 3EWWA 3NG3A 3MI3A 4AWSA 1RH9A 3IJQA 4QEHA 1MDRA 5GVJA 2H9AA 1KRBC 3GW0A 2OKOA 4BWLA 2WM1A 4MFDA 3DGBA 4IGMA 4MMWA 4R53A 3TA9A 1FQ0A 4CQ9A 1ZZMA 1Z41A 4KT2A 1HJSA 2CBIA 4UFMA 2YCEA 3K5XA 9RUBA 1K9TA 5GQBA 1Q6FA 3EB3A 5A8OA 1LM1A 5GNZA 4HOWA 3LERA 1VENA 4L9ZA 2GJXB 2EPNA 3GDLA 1TJ2A 4GKTA 3SM0A 1UIPA 3MA8A 3ZR4A 3GG7A 1TQXA 1LWIA 1J9YA 1F6PA 7A3HA 1L8NA 1FCQA 1FDZA 4BQ4A 1DIEA 1EIXA 3GVRA 4LVDA 4RZBA 3RYSA 1YKWA 4W88A 1D7FA 1QOQA 4JTLA 5AOUA 4LXFA 2PP3A 1KRAC 1DXEA 4MWAA 4O12A 4D72A 4B4FA 1OFOA 4U4MA 4O17A 1YE4A 3ZVHB 4D6HA 4OWGA 2OYKA 4ECLA 5IHRA 4ZL1A 3W7GA 1T96A 2Z2UA 4JCMA 2D23A 3SQMA 2GSEA 2V38A 3E02A 2QPSA 2PAJA 4B91A 4AIOA 3MSYA 4QG8A 2H8ZA 1QO5A 1JNEA 3H2OA 3EOUA 4GNJA 5D2TA 2CLMA 4BS0A 1NY1A 2ZA1A 2V5DA 4PRRA 1WZKA 4G6CA 3WQ8A 3AMLA 5JQ9A 3W7JA 5D33A 1DWGM 4HVXA 5CSRA 3BLPX 3VNLA 1EGMA 3FDGA 2QW5A 4M8UA 3AWOA 1NWUA 2ZUTA 5CJNA 2D2OA 2E67A 1OCQA 3VINA 1A5NC 2POZA 4FB7A 2BODX 2XG9A 5DO8A 4QNEA 3HGOA 4IG2A 4HOXA 1EQCA 4LEQA 2PTXA 2GK1B 2WLZA 4KRTA 4E2OA 1QW8A 4JKKA 4XZIA 3ZXWA 2BSLA 1O5KA 2DZXA 3IUIA 4XKYA 4HSHA 1WKDA 3SCQA 3FJ6A 1CB7B 1GTHA 3ERPA 4LY4A 1NOUA 1VIZA 3LTYA 1JDEA 3E5PA 4JFWA 3KBSA 4MIMA 4E4UA 1Y0EA 2PDFA 5TF0A 2Z1SA 5CC5A 4KBXA 4WSHA 4UR9A 3W7DA 2YCJA 1GG0A 2PLCA 3UR7A 4YHGA 1NDYA 1XKJA 1H7RA 2HBXA 2CU0A 4C6KA 5EMJA 2VEGA 1KCKA 2O56A 1G4TA 3M0MA 3KRZA 2E5BA 2HCVA 4QITA 1XISA 4Y9MA 3N9KA 2ZADA 3RIKA 1H41A 3EPMA 3CIWA 3T40A 2R1MA 3FS2A 1YE6A 1TJRA 3PBMA 1CGTA 2V5JA 3CZGA 4D2JA 4H9VA 5HWMA 4UMCA 3TROA 1FBAA 4UTMA 1KXQA 4HHMA 3HV8A 4F0KA 4ORIA 4O8RA 4N4PA 2DW7A 4JTRA 3SCNA 2FTWA 4O0ZA 1SO6A 5I03A 2EJAA 2Y5EA 3ZIZA 1W1PA 3H26A 2XM1A 4LGXA 3VNYA 2BVWA 3C2EA 1IEIA 5AC4A 4DUWA 3DG7A 1DBTA 1REQB 2D0FA 3OBKA 4NASA 2X1TA 4BF9A 1XLGA 3LHUA 1WZAA 4JHZA 2ISSA 1XCXA 2PDWA 2EPHA 3CH0A 4JTKA 3Q67A 4LT9A 3FFSA 1EDTA 3VA8A 3A6OA 3CV2A 1UB3A 4PMQA 2WHLA 4HNOA 1XG3A 1YW1A 1J79A 1P6BA 2HVOA 4JOMA 1EJXC 1AZ2A 2DIJA 1KM2A 3LXBA 4JTJA 3VOGA 3DERA 1CPUA 4AXNA 2ZRXA 1Z69A 1U22A 3MT1A 3WJSA 3OLDA 1I2PA 2O55A 2J7DA 1OJXA 3PR2A 4WDXA 2E3ZA 4FR1A 3TYAA 3H55A 4Y9NA 4QP0A 1W32A 1EO5A 1XUUA 2FGZA 1W5QA 4PGLA 3BXWA 2QT3A 4S3EA 1OFQA 1O4UA 2J8GA 3ATZA 2G3JA 2YYUA 1KKRA 3LV6A 4Z1YA 4FS9A 3WQDA 4MHBA 4PUKA 3CTTA 3EDFA 4NAEB 2JF6A 5A8NA 3VCRA 3GIQA 4JTUA 4GQ0A 1XDLA 3H6OA 4XV0A 4GQQA 4JQ3A 3C0LA 3N6QA 3PBWA 1X98A 5DXYA 4F40A 2W0UA 1MXSA 3DENA 3VU2A 2ZWZA 2QUTA 2ACQA 1KR0A 4M29A 2P8CA 3HN3A 2GL5A 4F79A 3PZUA 3WDQA 2J6XA 2VC6A 2TSYA 2BMBA 3NAVA 3PVFA 1SFTA 3LK6A 2P53A 3QGAC 3L2MA 1UZDA 1L6YA 1R3TA 1RVGA 1V79A 2VELA 2GLKA 2VX4A 3UWUA 4J40A 4IXHA 4CCCA 1EOMA 3P7YA 1F3XA 1BKHA 3LNPA 1W9DM 2FH6A 1RALA 2Y61A 4FPSA 1TV5A 2PFHA 3BSGA 4OTKA 1TPWA 3SN0A 1YDYA 4XD3A 3DCPA 4YL2A 3UXIA 4IIDA 1Y8BA 1YLVA 1M3UA 2WZMA 3BW3A 4HJWA 5K9DA 1GTEA 3A47A 4B3KA 3TE9A 3BAWA 3IAPA 5DRIA 1JDFA 3WQGA 2QGYA 4AISA 5HANA 3M9YA 3QRHA 3QV8A 3SUUA 2Y1HA 4FNSA 4H01A 3VIMA 4GKLA 2PDLA 1RJQA 3JRKA 3EB2A 3WENA 3QBUA 3CNYA 3ISIX 2E9MA 4U2ZA 1UOKA 2OODA 1X38A 3OTRA 3WLLA 4W9TA 3EX3A 1M1BA 2V9DA 5I6SA 4I3GA 2C1IA 1D3HA 1RD6A 4L1GA 3HFYA 4KPLA 3L4ZA 1AH0A 3M43A 4U28A 3PTQA 2Y7FA 3N19B 4GZIA 1UP3A 2OX4A 2Z27A 4AYSA 2C0AA 3B8UA 4Z1AA 2YSWA 4L9XA 3ICJA 3S5NA 2DUZA 3D6NA 1VBJA 5FJPA 2E09A 2H3BA 5L9FA 1KGWA 4OT7A 1F6KA 2J4GA 2FB3A 4OE7A 1J2BA 3PJXA 2DSZA 2RKXA 1IT8A 1UD3A 3WO8A 1E6SM 3PWAA 3H4XA 1A0DA 3VM7A 3EGJA 3Q58A 3EXRA 4AD4A 1M6JA 4TOQA 1A4MA 3M0XA 1XLFA 4IM4A 1W9UA 2NWSA 1RK5A 4ZQCA 2V2DA 3LA4A 5FD0A 5AB3A 4FA3A 4PL1A 1RJRA 3CV6A 4D8LA 4CKQA 4UTIA 1XXXA 3GE7A 2G3IA 3ZR6A 5AHFA 1XLEA 1S5VA 3OG3A 3ZLFA 3WLSA 1TFVA 3GHUA 4IPPA 1LZOA 2OSXA 4ZTXA 4GYJA 1R7AA 2WZEA 1Q6EA 4MWAB 4XO7A 1D3GA 1VZWA 2PEVA 5HXMA 3N2MA 4XZ9A 2DZTA 1XYBA 2CBJA 3SB0A 3C2VA 1XIDA 3CHVA 4W89A 5E9AA 3NTYA 2FVMA 4GYFA 4UMBA 4DJED 4D6CA 3KW3A 2QNEA 3BLLA 4NJKA 1D8WA 4JL1A 4JIIX 1YDNA 4IMAA 3RX2A 3A22A 4EWND 4XBSA 4AD2A 2QPXA 2W61A 5LGXA 4MLJA 3B0YA 3EA2A 3TN5A 5BROA 1YEYA 1P0BA 3B97A 3M6DA 4AZCA 1MQRA 3BWWA 3RR1A 2DQWA 4OHQA 3WEMA 5CPMA 3F7JA 2PDGA 1LTDA 1XDJA 1UZHA 3GUGA 2QJHA 2PP0A 2QS8A 3R8HA 1EC9A 1BYCA 2VZSA 4IG2B 4HMNA 1NU5A 4NZ4A 2DZAA 1PKLA 4KFPA 4DNMA 2VI0A 3URBA 3CAWA 1YIXA 2QDGA 5A2BA 2YGYA 4CQCA 3N13A 1WA3A 4TVDA 4JQAA 1R7OA 1T6MA 2PURA 3UR5A 3IARA 1OYAA 3BZJA 2QXWA 4P7RA 5D2WA 4NP7A 2ZC8A 4I8YA 2WMIA 2BVYA 3SQSA 3E2RA 3BURA 2PDPA 3A9IA 3DGRA 2C3ZA 3S46A 2PDJA 3WEZA 3WDIA 4G1KA 3NO5A 1XBZA 1A5KC 3BAJA 4M6UA 1JCTA 3IJ9A 4TIMA 1EA9C 3DDMA 1OB0A 5BU6A 3RM9A 2VNCA 1V0MA 1VAHA 3GDTA 4Y9OA 3V75A 4RE2A 3OBEA 3CEUA 3BDKA 3F5KA 3RLHA 1PKMA 1GOKA 1ML1A 4H8VA 4IIHA 3IV8A 4PMXA 1KWGA 4Y96A 4DF0A 1RAKA 5AVNA 3UG8A 3ITCA 4J2MA 2Q02A 1B31A 5A94A 4P61A 3I6TA 4MKVA 1QI5A 4RDZA 3EDEA 2QCHA 1R2TA 4ZCWA 4GQBA 2IKGA 2D24A 1VFFA 5BZAA 2HZGA 1K03A 1OGSA 5BNKA 3WLIA 5ECVA 4WSJA 1S1PA 3NQMA 3WYZA 3PTDA 2YLLA 3TONA 1JFHA 3WN6A 3VGEA 4Q7BA 2ZZ6A 2G3NA 4GVGA 2H8XA 1PBGA 5FSEC 3S4TA 4EF9A 4DXVA 2CESA 4L65A 3M07A 3IEBA 1FFQA 1Z3NA 2QJNA 2V3GA 3KTXA 3UPBA 3RLVA 2PLKA 4D71A 1XLDA 3GNDA 1RUSA 1CXFA 3ANVA 4E38A 5CZTA 2PGEA 2HNEA 2OLHA 3TJ4A 2DZPA 1US0A 3T42A 1WUFA 3BJFA 4O11A 2WJZA 4FNUA 4F48A 3O05A 3OB8A 4OJYA 4DJFD 3T4CA 1OFAA 1K9DA 4QAIA 1W3TA 3UGRA 1M7PA 2IQ0A 1E6XM 3RK8A 2PCEA 4PTNA 1KM5A 1XYMA 1UD2A 1PZ3A 1FA2A 4Z1DA 2YCLB 3H7RA 4AZBA 1W1ZA 1CENA 3IGHX 3NZRA 4TMBA 3VD3A 3O16A 4UIOA 1QDSA 4S2CA 1XD0A 3USBA 4BCEA 4N6EA 1W1TA 4F2BA 4OOZA 3C56A 3PC0A 3NOYA 2E25A 2J62A 2RDXA 1AUSL 3IJ7A 3UT0A 1GOXA 4QSHA 3WNOA 4HNNA 3R89A 5AC5A 1OQFA 3DHPA 2WMGA 3PBVA 1QO2A 2PTWA 4LYPA 3WJWA 4XTIA 2OELA 3HG5A 2PBOA 1W5OA 4FOJA 4O16A 2VHLA 4LUYA 5AHNA 2NUYA 1FWSA 1VLIA 1HVXA 4MDPA 3UP8A 2F7FA 3M0YA 1MW1A 2YZRA 1AH4A 3P14A 4M56A 4HU8A 3QR3A 3TAOA 1RXOB 1W3LA 2W9MA 4O0QA 4QJ4B 4QSFA 4G56A 3KL5A 3PZGA 1P7TA 3CHDA 5LIYX 3VKAA 1LLOA 2BLEA 2XVKA 1X8FA 1W1B1 5U7SA 1TIMA 4NRSA 1V8EA 4AIBA 2QJJA 5LNRA 1Y5VA 2YB4A 4IQDA 5ABTA 4D6IA 1H62A 1J6PA 1XLIA 1XM3A 5BRQA 1E40A 1JNDA 1QI0A 1RR2A 1LRNA 1TR1A 4PFMA 1IR2A 1XX1A 4ZE4A 1F6YA 4L80A 1W1IE 4OUIA 1X96A 1CXHA 1A0EA 3NIYA 3WK3A 5B80A 3TNOA 1QFEA 1WBJA 3CZKA 3IJDA 5CGTA 4BHYA 3W37A 1W8SA 1ZBCA 2PRLA 2VRJA 2QF7A 1R3WA 3VPLA 1B3ZA 4S38A 4ZQOA 1C90A 1XF0A 4H8HA 4K8HA 3L65A 3N14A 4HQVA 3R5EA 3QLLA 3W70A 3ZSTA 3F03K 4GO8A 3TNBA 3PB2A 3M0VA 1TQJA 1YTKA 2IW0A 3FKRA 3RPDA 3PB0A 4P7NA 4W8AA 2FVLA 1W3JA 1XCFA 1LQ2A 1A47A 1R8LA 3OPSA 4QNWA 3P5YA 1O94A 3KVLA 4D1JA 1E0VA 3WF0A 2VWSA 4RX0A 4BJHA 4K38A 4ADSA 4CCZA 4UQAA 1Q8JA 5CSUA 3UJSA 4H19A 3SY5A 3II1A 4Z1CA 1G9HA 5D09A 3NDZA 3OVRA 3HQNA 2OLAA 4PUWA 4JR5A 3CO4A 4RPPA 2INZA 5D8WA 3WNNA 5HQLA 3GC4A 4GMEA 4PCTA 4MY8A 4K1WA 3BG3A 1KFJA 2WVUA 1OHLA 3VCNA 2R82A 3QKEA 5D9NA 3OLEA 4RK8A 4MJZA 3UCDA 1ZS2A 3MANA 2NQ5A 4LC6A 1JQXA 5E1QA 1KBIA 3GTHA 4N9CA 3RX3A 3UWQA 2OWCA 1M9HA 2A0NA 3C5QA 4QLJA 3ARSA 4E8GA 4MJ4A 2D2HA 4Y8EA 3P62A 3QHMA 4HZ7A 3G24A 2PTYA 4GVHA 5LGZA 4Q4OA 4Z2KA 1TV4A 2B7NA 1IXPA 1CEOA 1ZHAA 2FZMA 2BY2A 2OYLA 3IIVA 1LT7A 2OEJA 3UR2A 3ATYA 2HISA 4M81A 4QQ3A 5D4YA 3QZAA 2HNHA 4L4OA 3B03A 3LNMA 3HFTA 3UG3A 5FJUA 3VMNA 1P6WA 2GPTA 2VDGA 2G5WA 5IFPA 2FFIA 2WVSA 4AY8A 2NV2A 3OGRA 3W29A 2FGLA 1FDJA 3RGTA 4C60A 3TKFA 4W93A 2WJDA 3DEQA 1OGBA 1A5SA 4AHQA 4AX6A 4KW2A 5F4SA 4D6EA 2ANUA 4PUDA 3DI0A 2BZNA 3XIMA 3BOLA 2GYIA 5TAOA 3RO6A 1QAPA 3BK0A 4O57A 4IHCA 3KBWA 4ES4A 1LL4A 1BSLA 3VDHA 3UFYA 2ISVA 4C6NA 2ON3A 1OSEA 1OD8A 1QTWA 1SQ7A 2WC3A 4Q8NA 1BVNP 2WMIB 3V16A 2REQB 4IPIA 4F4RA 3L23A 3L9CA 4YTSA 3T78A 4RE0A 2PGRA 1F2JA 3ARPA 1H0GA 2OQYA 1KCLA 4JTEA 2ADAA 2BVDA 2A6NA 5CKSA 2BDQA 3LHYA 4I5XA 2PD9A 5FACA 2Y5SA 2WHKA 3U9IA 1MUCA 5HNTA 4K3ZA 2A3LA 3GYEA 3E3HA 3BE7A 2VQUA 3QVQA 1F7BA 5EU9A 1L2QA 1JR1A 3MUY1 3O6AA 4P8VA 1SR0A 4O4VA 4S3GA 1RK6A 3LCWA 3O2LA 3WQVA 3FIGA 3TW7A 2HS6A 3OVPA 4C7DA 1R85A 5A6SA 3NL3A 4PCNA 1YTDA 1YXYA 1Q2RA 1ICSA 1KR1A 3E2SA 5M03A 7TIMA 3RDKA 4HBKA 2O9TA 3O1NA 3CASA 3R6IA 1QPQA 3VVGA 4C6PA 1XYCA 1DIOA 3B0UX 3E2QA 4U10A 2HSAA 1JL8A 1PO9A 5AYZA 1UKSA 1ESWA 3PZOA 4RCXA 2AL1A 3N3TA 1FVPA 3GDRA 4BQ3A 1V6UA 3MS8A 3N2XA 1B4EA 3GU9A 1FH8A 2QPUA 1AL7A 3WLHA 4CUCA 3CAVA 3BVJA 4GYPA 1DXFA 4KQNA 3R1ZA 5C2XA 1Q6LA 5KMYA 2DQXA 1JPHA 4KWUA 2ZX7A 1AQFA 2PDBA 1IV8A 3NL2A 2WC7A 4DF2A 3MHGA 1GZGA 1IT0A 2BV9A 1EPVA 4I9JA 2JQXA 4MPQA 3LG3A 1K6WA 3LHVA 3LUTA 4W7VA 3BGAA 1TVLA 3VNIA 1XL9A 2FZNA 3DKJA 4W7WA 2C16A 1KW1A 4F8XA 2BG5A 4B16A 2NQZA 3OEXA 1ZNNA 4TX9A 1NFPA 3FEQA 3H2FA 3W82A 3FAWA 4YVPA 1H7PA 2GVEA 2CW6A 3TC7A 5BXTA 4B2DA 2WLYA 1HX0A 5KSWA 1Z44A 1R3YA 1W9XA 2NWRA 1EQPA 1TWSA 1LLWA 1PX8A 4A2RA 4TQTA 3UXLA 1PKYA 1LF1A 1XLLA 2PDKA 4UTJA 1GZ1A 4DXKA 3S9ZA 5BOFA 4UQEA 4NNBA 1K9FA 3ITTA 4CU7A 1T8XA 4LY8A 1B3WA 1PCWA 2NXHA 1P7TB 4NNAA 3NQEA 3W7LA 3KL3A 4DWSA 1CT5A 3VDAA 1J8VA 4HB7A 5LIKX 4MFEA 4PN2A 2YDAA 4GCXA 3E49A 1Z8AA 4NAFA 4JFUA 1SO4A 3G3DA 5I3DA 3LRLA 4JHOA 1KTBA 2YPIA 3W76A 3TYEA 5BWFA 3W1RA 3E38A 2J7GA 1L9WA 5GNXA 2YL6A 2G41A 2KZHA 4F3HA 5HPOA 5I78A 1VHNA 3C4UA 5E9XA 1EO7A 1DWIM 3TDFA 1HUVA 3IJLA 4FOKA 4Y6GA 1SZGA 4PMUA 3V36A 1IXOA 3ZYZA 5DCEA 3OHMB 1EL3A 4W7UA 3W6YA 2UY3A 4RZ5A 1XJBA 4S2BA 1FHLA 2ZZ7A 1Q45A 4E2BA 2OZ0A 1VGAA 4KGLA 3NVTA 5HUPA 1SW3A 4D6DA 3GNPA 3HZ3A 5CAHA 1DYSA 1EUAA 1QOPA 1VPXA 3MP4A 1VKFA 1TB3A 1XFBA 5M17A 4Y9AA 4Q3MA 3QH2A 3QYSA 1FY6A 2PU1A 3EWYA 3WH5A 1DJZA 2QJIA 1UR8A 4QS6A 3NFUA 4HA3A 3S1XA 4IGHA 3QTPA 3AMCA 4IIGA 4M6VA 4B15A 2J7EA 2OTDA 2YIHA 4FK9A 1M41A 2XH2A 3UG5A 3ZJKA 2EPMX 4V15A 2VQTA 3SGZA 2PTDA 5DMMA 4U2YA 1Y7VA 3GVVA 2QZRA 3VX0A 3THCA 1SGJA 4TX8A 3BAXA 1XIBA 4ERGA 3IANA 2PI6A 4ATDA 3EZ4A 1Q6RA 3CL8A 3VIOA 4Q8VA 3NDOA 2TRSA 3SUWA 4DJDC 2J88A 2Z00A 4NF7A 2PGFA 2J8TA 3OW1A 3UNDA 2WCAA 3FX4A 5FJRA 3QF0A 4KEUA 4DXXA 2XVNA 1JCYA 2OU4A 3CBWA 5CZKA 1B5TA 2VL4A 2JEQA 3FDKA 3EPOA 3KVJA 1FHVA 1H09A 2VFFA 3H24A 5HWNA 2KAUC 4WR3A 1Y5XA 3W4RA 4W85A 3SR7A 4Z2JA 1H1YA 3H4WA 2XSXA 1VCFA 3CHFA 3UWEA 4DIAA 5EFFA 1EX1A 1V77A 1NEYA 3WNKA 4IUOA 2E9LA 1T8QA 3W27A 4QCEA 2NLIA 4B4HA 1UOZA 1Z7AA 2J79A 5AN7A 1YADA 1BSIA 3GC2A 1ITQA 1Q7MA 5FJOA 3ES8A 3I3BA 2ASHA 1C29A 3EB4A 5FIPA 1VPYA 3FSTA 1WUEA 1ZALA 3VD9A 2YXOA 3QHOA 2CBUA 1P5BA 2D3LA 3VD7A 3CUIA 3ABZA 1BFNA 5CPNA 3NGFA 4K68A 4C91A 3PUGA 3ZZ1A 2V5KA 3CZ8A 3O8AA 4RNFA 3A4XA 2YA2A 1XYAA 3P82A 4JICA 4H8NA 3WLMA 1GPWA 1JDDA 3G0XA 3EDKA 3O6YX 1B3XA 1HL8A 3WK0A 2ATSA 4ACYA 5HWJA 1S2VA 5DX7A 5AFDA 4N0RA 3TYCA 1GW1A 4PTVA 4GK8A 1EB3A 1U5HA 3BGJA 1YNQA 4I7UA 2OQLA 3UCCA 5CJMA 1KGUA 3CUXA 3VIJA 4R7JA 4DBSA 4YCPA 4FXJA 3DYMA 2ZRVA 3LPPA 1QPNA 3RRXA 3FCPA 1BWLA 1WXYA 2XIOA 5J5DA 4L4MA 1BF2A 5CPLA 1RV8A 2BX7A 4XZBA 2FGBA 1TSIA 1VQTA 4JNZA 1PKNA 2HPIA 1XRVA 1E4NA 3W02A 1SJCA 1H49A 1FOBA 1XC6A 4H04A 5CGMA 3Q37A 1NFBA 5KEZA 2X40A 2XIJA 3P74A 5AECA 3G1FA 1DORA 4M5PA 1R9XA 2XH4A 3W7PA 4Q7IA 4A8NA 1DTNA 1R5YA 5A8QA 3VYLA 5I0DA 1E55A 1EPXA 3TQ0A 1SMAA 2VFDA 1QW7A 3W23A 2B0MA 1W37A 4XB3A 1B2YA 4WEVX 4XVEA 3T0DA 3CV7A 5I3FA 4GXMA 4GJ1A 5XIMA 4Z2HA 3GH5A 1ZBWA 3WJZA 4CD7A 2NXGA 1AQMA 4XAFA 3AHXA 3BGGA 4Q4MA 1W5NA 3NQCA 3M46A 4IPJA 3NNTA 4C1NA 3FJ4A 2FYMA 3T9PA 3WF2A 3BV7A 1E9LA 3WQPA 3CQIA 2WZTA 2OCZA 3N73A 3LQGA 3A21A 3I65A 1B3YA 4TMCA 2IPWA 3FK4A 3CIXA 1DL3A 2CZFA 3E0VA 4JN8A 1J12A 1V08A 3S42A 4YU1A 1JI1A 3LCLA 1A5MC 3VKCA 3C8FA 3RMEA 3E0IA 5T91A 1CXEA 3IJIA 2FB2A 1JEZA 4CEXC 3POHA 3QQWA 4W87A 1PWLA 3W88A 1VH7A 5A6BA 3AZTA 3AZSA 4IH3A 2NUWA 1NFGA 2WANA 3W83A 1XRSA 3RMJA 4GH3A 5FESA 4JYDA 2CFFA 3ZQ9A 4QCFA 1N2VA 3F2DA 3CIVA 3HJEA 2J7HA 3VXGA 3DZ1A 4J1OA 3PSVA 4WJXA 2WXDM 3THDA 4HYVA 4O0KA 2FPTA 4RDVA 3VGDA 3DN5A 2ZUVA 3PNUA 1DXIA 8XIMA 4DWSB 3S5ZA 3TAKA 3VD4A 4EWJA 2HK1A 2B7QA 1WXJA 3T44A 2HXTA 4NAFB 2XIMA 2R24A 2A2IA 3ANYA 4XBKA 3HV9A 3TYDA 3ALGA 3R0UA 1HJXA 3TN3A 4IMDA 3NDYA 3KDOA 2YX0A 3W74A 5H8UA 4AEEA 2FHCA 5B7YA 3LMZA 4Z08A 4C6MA 3BJTA 2FDSA 3ZFHA 2JGQA 3FOKA 5KZDA 3ZMRA 2Y4SA 4PYSA 3KZSA 4XAPA 2HWGA 4UR8A 4GUIA 3RN6A 2GQ9A 4JTHA 3BOFA 4WJ8A 1OBAA 2DZSA 1TREA 1IEQA 3RCNA 3U5UA 3SGGA 3W7OA 3MWCA 3NOEA 3BJSA 1EZ2A 3UZWA 2A3HA 1YYAA 1KFEA 1B3OA 3PM6A 1MQQA 2BOFX 3DFNA 2F6XA 3VDCA 4GVFA 3QV6A 2J27A 2RJGA 1GZJA 3IWPA 4BQ5A 3S2JA 3CQKA 4AZ5A 2DGAA 2NQHA 3FLUA 3M0KA 3TZNA 5EBAA 4B5WA 4KFNA 5LIWX 4BEQA 1HKJA 1GJPA 4UB9A 2GDUA 2PWDA 2QMJA 4KH2A 4OVXA 3L0GA 1BG4A 2PUZA 4J7RA 5LSMA 2NQLA 1VJZA 3VC6A 3TR9A 2XWDA 1XP3A 2YDSA 3AIRA 1XFCA 4DZ5A 5EA9A 1EC7A 5I3KA 4A05A 3BTNA 3AO0A 1F5ZA 4NHVA 1OYCA 3AIQA 3TFCA 1JPIA 1ODUA 2V5BA 4C5YA 4O10A 1G4PA 4DO6A 4Z1BA 3PPCA 1CLVA 3B9AA 1MW3A 1E71M 2FPVA 3T0CA 3GY1A 4H6QA 4LUSA 4MNMA 2X05A 2GOKA 1K3UA 3OVQA 2A7PA 3TJXA 3VD5A 1NAL1 2J9ZA 3COTA 2TMDA 4H9YA 1XIJA 3NYZA 4AU0A 1IIGA 2VZTA 2VZVA 1OFPA 3F2CA 3IS4A 2VVSA 4HA1A 1VHCA 1JYXA 2FMNA 5DCBA 1EF3A 3BMWA 2MNRA 5AYYA 3QPEA 3H2NA 4JTGA 2VEMA 2AAMA 2RJHA 2VZOA 1W2VA 1CW2A 3B8IA 4QJ5B 3EOSA 4JTSA 2DVUA 4HU4A 1UA7A 4UOJA 4AVNA 1GK8A 2CCRA 2OR2A 3AHVA 1ONWA 3OZPA 1SVDA 2V69A 1H61A 4FMVA 5HMSA 2MUCA 4CN6A 4W8BA 3MSDA 4DJFC 4PFHA 5CGQA 3SO7A 3S5OA 3WLOA 4OGZA 2W5FA 4L4LA 2OFJA 5A6JA 4MYAA 3QHNA 3WKZA 1ISXA 4PR4A 5DY2A 3KTSA 1PCKA 2F61A 2QUUA 2Z25A 1ISWA 3P93A 3R25A 4MZ1A 4H2CA 3SQLA 5K4XA 1M03A 4N42A 2Y0FA 3VZZA 5U4NA 3VOJA 4IICA 1OFDA 3ARXA 5E6ZA 2D1ZA 1E4LA 2X2YA 3N3MA 3TN4A 4AW7A 3HPZA 3A3HA 2XSAA 1SSDA 2P10A 3LPFA 4A3UA 2IPGA 2W63A 2PWVA 4NX5A 2BXYA 3M41A 2WMKA 3RXZA 4TU1A 2Z1KA 2BVTA 3C6CA 3L2LA 1CGXA 2XYLA 4ZOEA 1U33A 3GDKA 3GWQA 5HNRA 4LANA 1UR9A 4K37A 4C6EA 3B3DA 1UH2A 1Z89A 4I5UA 5A6AA 3QPYA 1MW0A 1VEMA 3HQOA 2ZRUA 4FLQA 1OVDA 4CNUA 1JVNA 1VYSX 2HROA 3M5YA 1DJGA 4PMJA 1B4KA 1QASA 5F4WA 4H6EA 1ME7A 1OM0A 3W53A 9XIMA 3STPA 1THFD 1CTNA 3WJYA 3KL0A 4QAWA 1R3VA 4Q4PA 4HZMA 4D6JA 1UASA 4UTTC 2GDQA 3ITYA 7ODCA 3KAOA 2E5CA 4C6JA 3NQBA 4NJIA 1R9ZA 1CXIA 4JPGA 2E40A 2Y8VA 4CCDA 3TYBA 2Y62A 4MZ8A 2E9BA 3H21A 2NX1A 4LJ3A 3A9BA 4HCHA 4J3TA 3DUGA 3BICA 3VZYA 3KM8A 3E96A 3TK7A 1KA9F 4A2SA 2F2KA 4WUIA 2VEFA 3EWBX 3ECQA 1G7UA 2GDVA 1RQBA 1BXBA 4JCLA 1TKKA 1ADOA 3G1SA 4GXPA 2R1LA 2WNNA 3PK7A 3PBGA 4U5KA 4S39A 3IIPA 4POCA 1C3FA 1EA0A 4RNIA 5E0CA 1IWPA 1TZZA 1R2RA 3ZT6A 5BU9A 5JXQA 1IHIA 3VIIA 3PWGA 3W1PA 1PPIA 3QN3A 4JN7A 2BY1A 4LF1A 3SFKA 1TPDA 4UOZA 3SCTA 4AHPA 5MF5A 1OX4A 3KXQA 2G97A 4AXKA 3WQCA 5FEPA 3KOYA 3SCPA 4BI6A 5CC6A 4QDPA 4PUEA 2AL2A 3HOJA 2PF0A 3BMVA 1EKOA 2W79A 4L5ZA 4UTFA 4EAYA 4WK9A 4F0HA 3IUDA 4JX4A 4HA0A 3UNTA 4HPGA 2D69A 5JU6A 4C6CA 4FLRA 1JXKA 2FTYA 1E43A 3C2FA 1DJNA 2LLEA 2TPSA 1Z32X 4GUHA 4UQBA 1I60A 2QV4A 1J0IA 4K7VA 4XTDA 1CIUA 1ELSA 3T2OA 3A5FA 1ZLPA 2VYOA 1OD0A 2WPBA 2V5CA 1XIFA 4FIQA 1FCBA 1IWBA 1T40A 4X63A 1IYXA 4PMVA 1VFSA 3VE9A 3BG9A 2W91A 4ML9A 1XRTA 4J28A 4RZ4A 3GG1A 4OUEA 4GNKB 4DYJA 2VUNA 1EF2A 3VIGA 1RA0A 3QQ0A 5EPDA 4K1GA 3M0ZA 2V6AA 5C54A 3TQKA 5A6MA 1GVRA 5HQMA 4ZGYA 3WDJA 2QJMA 1L6GA 3FXGA 3GM8A 5IFTA 4AD1A 3M0HA 1O12A 2GVLA 4HHPA 1TE6A 4FO4A 3LLXA 1G67A 2QDDA 3AMKA 4PCPA 5MHBA 1ONXA 4LRTA 4EPKA 1X1OA 1SZEA 1V3KA 1WKYA 5K9XA 4YVVA 3WJXA 4LCSA 2TYSA 3BOXA 1UQYA 3MQTA 4FP1A 4GNVA 5DBUA 3HJZA 4AUBA 4GE8A 2B7PA 2C18A 3U48A 4LALA 1FCVA 3NZPA 3QY7A 3EWDA 1GHSA 3UWWA 2FHBA 1M01A 4FI4A 3QY8A 4MWAC 1V3LA 4EF8A 3Q65A 4US5A 2ZWYA 3MBFA 1S1RA 3OQEA 4J3UA 1GHRA 4RE3A 3N9SA 1XH1A 1AK5A 3W7NA 2F2HA 3S1WA 4N9DA 3KP0A 1XDMA 1ECQA 3BAYA 4NZFA 4Q4SA 3MYOA 3S8HA 4DWSD 3P81A 3DXIA 1AJ0A 2E6YA 1TVNA 1OFRA 3V35A 5B7ZA 3TWAA 3BPWA 4LNCA 1GKRA 4BKNA 1PIFA 3K30A 3REQA 3PFMA 4DY1A 4Q33A 3W1NA 5FF4A 1ONRA 4NI3A 3OQ8A 1R46A 2CHNA 3WUFA 4KKXA 2VOTA 3GVGA 5ABGA 4QM1A 1SUXA 2YXGA 2AMGA 5LNWA 5FKYA 3NYDA 4ATWA 2E6DA 4IL0A 4O53A 2GVJA 5EY5A 4NJJA 3V1HA 2IPJA 4UMAA 4AEOA 4HMCA 5A6KA 1W6TA 3OZMA 2C8NA 4DJEA 1KFCA 1KD0A 4PUUA 3UXKA 3B06A 3GR4A 2YBTA 2PDXA 1KRCC 1UBSA 1UKPA 5H91A 3WNMA 5ENLA 3R10A 4YXGA 2J74A 4PODA 1I2OA 3MB9A 4Q8TA 4MG4A 1AODA 1E1EA 3RRAA 4LUSB 4JY8A 1RCQA 1KXTA 5BYWA 2VGFA 1P4CA 3RILA 3AHYA 5L6UA 3ZT7A 2WWDA 5JBFA 5G2HA 2EPOA 4GIRA 5DANA 1J01A 5FJTA 1W9BM 5DT7A 1ZUAX 4KRZA 4A3HA 4S3KA 1WDDA 3CQHA 1P43A 3RNDA 3KOFA 2W6RA 2CZ5A 3K46A 3ABOA 1XSJA 3RPMA 4AWTA 4RW5A 3FA4A 1V0KA 4BFAA 2GZXA 4A3QA 4IIEA 3N17A 5BXRA 4FF7A 1D9EA 1WAWA 2V3FA 1H0IA 1M53A 4FX6M 1MXDA 4OZOA 4ENLA 2DY3A 3PS7A 3SCSA 2Z24A 1L6FA 1Q5MA 5JBEA 2XN0A 1O60A 1ISZA 3R94A 3UVAA 1GVFA 4A8RA 2IS7A 2I9UA 3GKAA 1UP2A 1PAMA 4M19A 4DLFA 1K8ZA 5TD4A 2Y63A 5PTDA 5LXXA 5AHIA 1TMLA 1UR4A 4D9PA 3A3XA 5CLWA 3AZRA 2ZRWA 1WKEA 2AAAA 3WF3A 1XW8A 3EA1A 4O1DA 1S2WA 2VX7A 1ODZA 1M04A 1V6XA 4KMQA 4HJFA 3B9NA 1FKWA 3O07A 1ITUA 2G3MA 3GO2A 2DSUA 3LSBA 4BR1A 3C0QA 1XLJA 1XC4A 4MZYA 3QJAA 3B05A 1AD4A 1A5OC 2GWNA 1YQ2A 3T0TA 3UD6A 3R11A 1SPQA 2AQWA 3NEHA 3PAJA 4KEVA 2Z28A 4GY1A 4PA8A 2RAGA 5CPSA 3V0SA 4JTIA 4W84A 3W9ZA 4DJFA 1I8JA 5K3VA 5D37A 3TSBA 3S3GA 2GSJA 1F3EA 2BNJA 3LBMA 1HGWA 3P61A 1V3MA 4M80A 4YTQA 2Z1XA 4NU7A 1J0HA 3U4AA 1S5TA 1XIGA 4LS0A 2YR1A 3RITA 1JULA 2XM2A 5C7HA 4K39A 3TTEA 1SSGA 3UXAA 3E6EA 1W9VA 3EMQA 2RUSA 1W1YA 5LA1A 4HNVA 2O9OA 1AG1O 2CEQA 1ECEA 3MW7A 2UWFA 3A64A 4ZBCA 2C15A 4RV3A 5FJJA 3VIHA 4C6BA 3PTKA 3L12A 4IQJA 4XKMA 3FHQA 1RP8A 2EAWA 3QR0A 5HULA 3W7QA 4DX3A 3SRFA 2CLPA 3AYSA 4DYKA 5DLCA 1AW2A 4W5ZA 3P67A 2R1PA 3K1DA 5JH1A 2CWXA 3RCMA 4IWWA 2WNZA 1J5TA 3K2GA 3UJFA 4PCSA 4DYEA 3KS5A 2OMAA 5HDRA 1RCOB 3MKKA 3GTNA 4LAKA 4HZ8A 1H7NA 4E8CA 1TCMA 1V0NA 1W2PA 4MB4A 1WOBA 1JDCA 1GEQA 4IUGA 5D02A 3NXFA 1OX4B 4LPCA 3RLUA 1XRFA 5EMMA 3LDVA 1BQCA 1E73M 2AL2B 2E4TA 3AHZA 3B9EA 4HK7A 3V0UA 4GCAA 3E5BA 2OO6A 2VZUA 1U5VA 4WGXA 5E93A 1V0LA 4I9AA 1BGGA 3GNOA 2A3CA 4ZXOA 3HQPA 1J6OA 1LBMA 2OEMA 4O13A 4UTTA 1IQ8A 3HPFA 2BP1A 3G0SA 3EWZA 2F9RA 4LBRA 4IJBA 4C65A 2JIEA 3PPFA 5HUOA 3EX1A 1XYLA 1BXCA 2YA1A 5I77A 5J8LA 1X6LA 4C6DA 1ZSXA 3MPGA 1P1MA 2A3EA 4L61A 4PMNA 2FQIA 4FAMA 3FKKA 1GYNA 3H2CA 3VNKA 1O66A 5H1WA 2DIKA 3O9NA 5AKQA 5A95A 2PRHA 2V81A 1GKQA 1AQ0A 4NQ1A 2EQDA 1FWIC 4QXIA 1XKYA 3W7EA 3U7VA 3SIMA 1OEPA 4YTRA 5AHMA 3CB8A 1UP0A 1E9ZB 4AMAA 3SRDA 1W8GA 4NIRA 4HNLA 1ZRQA 3WQOA 3AYVA 1BG9A 3W26A 4JKMA 3GZAA 3NM3A 4IL2A 1ZPTA 2XJ7A 1FWRA 1LBFA 2CLFA 3LGEA 1M7XA 1W31A 3R0KA 1NELA 1WOAA 5HNNA 3AQUA 3RPTA 1GOQA 3UZXA 3AXIA 3ARQA 4WDWA 5XIAA 3WK2A 4Q4KA 3KP1A 2DDXA 3TX9A 2XVLA 4IXXA 2WSQA 4UUIA 1FWBC 1LOQA 1KV5A 1VBHA 3TOYA 2B81A 1M7OA 1TZ7A 2PWEA 1B54A 4HNUA 4IGNA 4Z2GA 1UUQA 4I6VA 1V6VA 2J7CA 5BOOA 2ACUA 1XS2A 4EIVA 1LL6A 2VEIA 1KO0A 4KGJA 4TV5A 1WQ5A 1AL8A 3GIPA 3W1MA 1HO1A 3WX7A 2XGBA 3PFRA 1YNYA 1B57A 2OZTA 3IGXA 1UPMB 4YCOA 1I1WA 3EYPA 5I23A 3EOLA 1HJQA 1IEXA 3LS9A 3UPWA 3E0FA 3H7VA 5CG7A 3SUSA 5GJNA 2QVHA 3H2MA 4ZEPA 1B30A 1ZBVA 3REQB 1FP9A 3TFXA 5JBDA 3EKGA 2DP3A 4E5TA 3MTWA 3KEHA 1UR3M 3M1ZA 4A21A 3C61A 3K8LA 2PDHA 3SN1A 2DSWA 2ONEA 3GXIA 1OADA 3BSHA 3TUUA 1CWYA 3VFLA 4I5RA 5F2IA 1HJWA 5D05A 5F2MA 2X8RA 4UQ9A 4HPHA 2RH9A 2RGMA 2O4MA 5IDIA 2D2JA 1NVMA 3GTIA 1S5NA 4GGBA 2YCIX 4XAZA 1CB2A 3EX2A 1NWSA 3W1TA 1A49A 2ZKMX 5LIXX 4GI6A 1MEWA 1WNOA 4N7QA 4K8GA 5C7VA 4LVAA 8A3HA 3SSZA 4XZWA 1XQKA 3AU2A 2C91A 2CLEA 2WPGA 4ERIA 2RDTA 5LNVA 5FJIA 2IXUA 3NA8A 3EWUA 3Q45A 4MUZA 7PTDA 2PWGA 4CQBA 3U6WA 3HGJA 3VOHA 2P0OA 1VBUA 2OX1A 3WH9A 1E1FA 3GIYA 3PZTA 1PHWA 1WAUA 4BEUA 3K1GA 3AS2A 1GORA 2ZBTA 1XLAA 4JYFA 2NVCA 5D32A 1ME9A 3CLWA 2ZVIA 3JW7A 4DUXA 4NZ5A 1LUCA 2Q3OA 4DN1A 3W28A 1DJXA 4C5ZA 1I9CB 1CGWA 4EACA 1JRCA 3R43A 3K4AA 3N2CA 1D8CA 3WF1A 1E9YB 4HN4A 5G4HC 5BMWA 5C8BB 3L67A 1E0TA 2DH2A 4KWVA 3DBPA 3B8TA 2CLKA 2O0TA 1QRQA 4NXSA 1V6WA 4GJIA 3AMGA 1GVQA 1N55A 3I7QA 2BASA 5REQA 3H7UA 2O7SA 3THQA 4HK6A 3H54A 4F0SA 3CPRA 1S5MA 1PIIA 1JZ4A 1K4GA 3W38A 4HT3A 3TLQA 4GJJA 3IUHA 2F8QA 2HJPA 1J11A 3MJYA 3G6MA 2E77A 1AW5A 3WDRA 4H3DA 3TQVA 1N8WA 4O28A 4PMZA 3UWZA 2BGNE 3MP5A 1BYDA 2GUBA 4IJCA 5CBBA 1J10A 2D20A 3MBDA 4UFIA 1EBGA 2V67A 3O6DA 5D2XA 1V3IA 2XN1A 4KEZA 5DF0A 4ACZA 2WQPA 1HKVA 2BGSA 1CECA 3A23A 4PMRA 4URIA 1EJVC 2PDNA 1EUNA 3QV9A 4AC7C 3NCOA 1MUWA 5D9MA 1UWQA 1PXGA 2P3EA 3S2LA 5I3GA 4DBWA 3QW4B 2QCDA 1A5LC 4G7EA 1W54A 2VMFA 4OQVA 4R9XA 4GIAA 4RDWA 2P88A 4GUGA 2ZVRA 4LV9A 2XN2A 1QXLA 4JTFA 5LNUA 3B8DA 2E0PA 4OV9A 1GJWA 2YOCA 1TJ0A 1XI3A 2X0YA 3TSMA 1JGMA 2VFIA 2CKSA 4IIBA 5FF7A 3CPGA 4AFYA 2CBVA 3S1VA 1EGVA 3AIBA 3BW4A 2DEPA 5C9ZA 5E70A 1S38A 4EK7A 4RZ6A 5CAKA 5IRPA 4JNYA 1TA3A 5CQ1A 3ZSSA 1KV8A 5J04A 4EPEC 3DHUA 5CG0A 2YLAA 3GU2A 2G37A 4Y90A 5A3HA 1KNWA 4OBSA 4GISA 4D1IA 1HJVA 3HM7A 2EBNA 5AHEA 4UXDA 4H7ZA 4IP7A 2O9PA 4WY0A 3WLPA 3KHJA 4AB4A 4AVFA 1WB0A 1UBPC 1TX0A 3TV8A 3J7HA 3JVAA 4KCVA 3LBCA 4OIFA 4FOUA 1HKMA 4LCRA 2VFHA 1DWAM 3E74A 1UWSA 5M5DA 3D0CA 3SUVA 3NQ6A 2NSXA 1XGZA 3DG6A 2QAPA 1ZCOA 2IXVA 1UH3A 2GUUA 4WSKA 4DNHA 4WQ6A 2VVNA 4I9TA 3BAIA 3OVGA 1R2SA 2VWTA 3FJLA 4U3AA 4PBEA 2CYGA 3W7CA 4O52A 1A3WA 3A5VA 1HZYA 1OK4A 1XSIA 3TLLA 8TIMA 3QEZA 1FFRA 1G4SA 1P0DA 3DECA 2I1OA 3FGCA 1SW7A 2QAFA 4WVXA 4YTUA 3EKLA 4B5VA 5D03A 3QYQA 2QEZA 4LAUA 1XICA 1H1NA 1UCWA 5I79A 3KVMA 4GINA 5CC7A 5FF3A 4YS1A 2VR2A 5BXPA 3OZYA 1PB0A 2QGHA 1EYEA 4N4QA 4JS3A 1EIBA 4HYWA 2DIEA 3DC8A 3M0LA 3KCOA 1BYAA 2FH8A 4ZA0A 2HK0A 3R8RA 5AC8A 5CLTA 4ZTYA 5K2ZA 3N2TA 3SJNA 1DWHM 3P60A 4PMOA 2HTMA 4ZO9A 4O54A 3EKZA 5HJYA 4C7FA 1OY0A 3VX1A 3SEPA 3F5JA 2WJEA 1R0MA 1ITCA 3NSNA 3WMLA 1IR1A 1UJPA 1XIIA 5BMXA 1AJ2A 3VUSA 3VNJA 5HINA 3CLMA 4HSNA 1VIWA 3RLGA 4L6OA 3AFBA 5DBTA 5T26A 3WLNA 1A53A 3AS0A 1FWAC 3SADA 3OZOA 3ONCA 1PIGA 3R0DA 3V5CA 4O50A 1XLBA 1P6CA 1V6YA 2Z26A 3M16A 4LVBA 3LGDA 2DJLA 4MNKA 3FVDA 2E7FA 2YFNA 3QMRA 5A2AA 1OZQA 4XSMA 4UCFA 4O18A 4WKHA 3KCJA 3P5ZA 2XFFA 1VFUA 2H9AB 2CKRA 4YWIA 2GJRA 3SECA 4G9PA 1MNSA 5JH2A 2XVPA 4IZGA 3Q94A 4EP8C 2WQDA 1ZL1A 3MYPA 3JS3A 5EGRA 1E3XA 4MVAA 1WZMA 2PC4A 4M3PA 4Z2IA 1PEZA 4H83A 4D8AA 4DM2A 2PF8A 4AG0A 4XIAA 3U0HA 1F74A 4XUGA 4US5D 1C7SA 2VFEA 3L4UA 4IP5A 2IQDA 1M7JA 4MNLA 2Y88A 1AQHA 3SJ3A 4R33A 3S1GA 3MUCA 4P2VA 4JFVA 2G0WA 4DI9A 3UVIA 3CB3A 1ICPA 4XD4A 2FHFA 4L6DA 2RHGA 3U2ZA 4JQ4A 3P0WA 3SZ8A 1TE1A 2DH3A 2V2CA 1JUKA 1C92A 3B8SA 3HPXA 4J3XA 3RFAA 5G1YA 4LBUA 2QVNA 2VJXA 4IPLA 1YX1A 3G0UA 4HNCA 4HOZA 1XD1A 3H23A 4ORMA 2QUMA 3ID7A 2OWXA 4ICMA 2VC7A 4NSBA 3MO7A 3ELFA 1UG6A 2X1SA 2R1NA 1YPXA 1TV8A 1R3SA 3S9IA 3KLLA 1KRMA 4DQWA 3DFPA 1JXJA 5C2GA 5M2FX 2F38A 1PV8A 1TWDA 2NV9A 1PTGA 2I9EA 3HF3A 3MP3A 1RLDA 2XGZA 1NOWA 2Y70A 1Z42A 1RHCA 2V68A 3HG4A 3WQWA 1PZ0A 1LQAA 1Y5WA 4S3CA 2DZVA 2JFEX 4PULA 3MHFA 2ZXAA 4HZ6A 3YPIA 1EXBA 3CM4A 1RVKA 3DYOA 3NM1A 5CXPA 5HMFA 1DVJA 1DEDA 1BVZA 1FTXA 4XKYB 2C1HA 3D47A 5HNUA 1O5XA 4O1BA 5REQB 1UUMA 4C7GA 3T05A 1W1VA 3E1F1 2Y7GA 4MAVA 5LHEA 4C6IA 2NXIA 1ISYA 2V82A 3W1LA 4KS0A 1K4HA 3U2EA 3UXDA 5D04C 4NYYA 1EH9A 4HK5A 2X16A 2GWGA 3WMSA 1M5WA 4PMYA 3VGGA 3ZO9A 4EVZA 4A8IA 3AALA 4N6FA 3F4DA 3VGFA 3G1AA 1NP0A 4IFKA 1CGVA 2E8YA 4KF1A 3ES7A 2DT2A 5C9UA 1EHAA 2PGWA 3VGHA 4TXEA 1TPUA 2VOMA 4GWEA 4GYPC 3AU6A 4ACZB 1POJA 3W72A 4YTTA 4IX0A 3THAA 5RUBA 3SIZA 1VCGA 3BLFA 3BLIA 3T4WA 1JG9A 3RCYA 1Q6QA 3I3DA 3UYCA 2CLHA 2ACSA 4RKAA 1X97A 1E6QM 3FA3A 2HPMA 1DOSA 1MRQA 1SZRA 5C2CA 3TEVA 1F4AA 1UD6A 2QCDB 3L4VA 4G7EB 3MKVA 2X30A 1SO5A 2BXVA 2PDUA 3P2VA 3W24A 2Z1WA 1RY0A 3DIPA 4M24A 1FCUA 1ME8A 4MJMA 3GHTA 4DZIA 4J35A 4GGHA 3ANUA 3PAOA 5GPRA 4CD5A 2CWNA 3A24A 1FHUA 2PC8A 1OC5A 3C86A 4CU8A 1DIKA 1O68A 1KLYA 1VPQA 5CZJA 2ZX9A 4Q8WA 3ZLGA 3KRBA 1WDRA 4UOQA 4GRSA 3GXNA 3VE7A 5G1MA 4R88A 2DJXA 2J9YA 4GA8A 1JGIA 1HL9A 5FOOA 1JUBA 1GYMA 1NWRA 1PYMA 3VGBA 1TA3B 3NGJA 1AMYA 5DT5A 4DLMA 1I0DA 4DHGA 3IIZA 3U4FA 5JIPA 2ZZ1A 3MWAA 2V5LA 3TTSA 1XH0A 4DVOA 1PTAA 1Z6KA 2GQAA 3IGUA 1Q6GA 1BYBA 1C93A 3B0VC 2A6LA 1Q6OA 3W6MA 1L2UA 2QQ6A 4M7SA 4ZQRA 3UJ2A 2OG9A 1SFJA 3VCCA 3R12A 1OINA 1GPFA 3WSUA 2ZZ2A 4DWSC 3TIMA 3ARZA 3W71A 3P3BA 3KOZA 1H2JA 1AVAA 3NVDA 4HCDA 4BI5A 3SSJA 1WPCA 5CBIA 4Q6JA 1FWHC 3IK4A 3CL7A 1OABA 3FYPA 2X0HA 3MDWA 3PJTA 2A5HA 2ABBA 1JPDX 4OECA 2EKCA 1CGYA 1HL2A 1VFMA 4CQAA 1M65A 4GQGA 1ZJAA 3WQEA 3SCVA 4AHOA 1BRLA 1QR7A 1H51A 3L0NA 1JJKA 2NZLA 1RBAA 4HMDA 4N9BA 3LY0A 3KHDA 1E0UA 3PSWA 4BY3A 3FGCB 2J13A 3DAQA 2GVYA 3QLDA 5AVHA 4XO6A 1WO2A 4A22A 1TUFA 3CWNA 2UBPC 1PHQA 2JBMA 6XIMA 2CLLA 4QG9A 1PZ2A 1VC4A 3N1AA 5FA5A 2DPEA 2FLIA 3QPZA 1YBQA 1F8MA 4AIUA 5ABHA 1I45A 3MV01 3IVTA 2ISFA 4WY0F 3FYOA 2YBUA 1G7VA 1P0NA 4GBDA 1F3WA 1HXJA 2DW6A 4IMCA 2PZ0A 1EP1A 1CCWB 5CZ0A 2ZFAA 2I5IA 2WOQA 1YPFA 4AYGA 3AI0A 1EFZA 3UG4A 1PX3A 3RG6A 3W7HA 3VKKA 4AX7A 1TR9A 4MY9A 1REQA 4XZLX 3GZ3A 3QOMA 4R5EA 2WSRA 2YFOA 4D6FA 1EJ7L 4ATLA 3VFCA 3N12A 3GH7A 2V3EA 2VDHA 1UWAA 4CQDA 3RF9A