4RDYA

Crystal structure of vmolac bound to 3-oxo-c10 ahl
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
312
Chain Sequence
VRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parathion hydrolase
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
molecule tags Hydrolase
total genus 124
structure length 312
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4rdyA00
1EYWA 4L9XA 1ZZMA 2FTYA 1ONXA 2GZXA 3HPAA 3S2JA 4J35A 2OQLA 3QGAC 1JGMA 3WMLA 2P50A 3CS2A 2PLMA 1K6WA 4Z42C 3ISIX 2R1NA 3KM8A 2I5GA 1M68A 4XAFA 4MUPA 2Z27A 3SFWA 1YBQB 2VM8A 1ADDA 4B90A 1S3TC 3GIPA 3T8LA 4P5UA 3MTWA 5FSEC 4PE8A 5G4HC 2GWGA 3GRIA 3FDKA 2CZVA 3EGJA 3A3XA 3F4DA 2R1PA 4IG2A 2PUZA 4GC3A 4ERGA 3F2DA 4GX9A 1EJTC 1A5NC 4CNTA 4EPKA 1K70A 1NFGA 3BE7A 2YB4A 3LGGA 4C6CA 3RN6A 4LAMA 4UB9A 4V1XA 3E38A 1A5KC 1YIXA 2OODA 2Z4GA 3UBPC 1UBPC 4B91A 2DVTA 3DC8A 1POKA 4EPDC 1R9ZA 3D6NA 4DI9A 3E3HA 2QS8A 3C86A 1PSCA 3IJ6A 1XWYA 3PANA 4INFA 4C6KA 2WJFA 2HBXA 2Z28A 1FWHC 4HK5A 3AUOA 3ID7A 2Q09A 4WHBA 2ANUA 4KETA 4CNUA 1NDZA 1P1MA 4V1YA 1XRFA 4H9UA 1E9ZB 3ORWA 2E25A 4J2MA 4H9TA 4HK7A 4KEVA 3GG7A 3K2GA 2Z00A 3UF9A 3OODA 5HMEA 4I6VA 3QGKC 3O7UA 1A5OC 4C6PA 3URAA 4DLFA 2OB3A 1RAKA 1RJQA 1GKQA 3E0FA 3GU1A 4KF1A 4DLMA 2HPIA 3JZEA 4H9YA 4GK8A 2DVXA 2G3FA 3ITCA 3WYZA 3EWCA 3LS9A 1E9YB 1EJWC 3E2VA 4HJWA 4RE0A 1EZ2A 4KIRA 4C6MA 4L6DA 2YB1A 3V7PA 2D2JA 4KERA 3RCMA 4H01A 2Q01A 2Z26A 3MPGA 4QS6A 2Z7GA 4LCQA 5FSDC 2EG8A 1POJA 4DIAA 2KAUC 1V79A 1FWCC 4H9XA 1QXLA 4XD3A 4KEZA 2QVNA 4DZIA 2PGFA 3PNUA 4C6FA 3TN5A 3UR5A 4XAZA 3IACA 1J6PA 1KRBC 2A3LA 4IFRA 4UBPC 4AQLA 4H9VA 3S2LA 4YIWA 1EF2A 2IMRA 2P53A 1YBQA 4XD5A 4KQNA 4G2DA 4R7WA 4TQTA 4GYFA 4CEXC 3F4CA 1XRTA 2EG6A 2OOFA 4IF2A 3NEHA 3RHGA 4LFYA 4QRNA 3ICJA 2HQAA 4NG3A 2VUNA 3B0YA 3A4JA 2I9UA 4CEUC 3UPMA 3LY0A 2AQOA 5HMDA 4I6KA 4C65A 3E74A 3R0DA 1P6BA 3RYSA 1EJUC 3LGDA 1UIPA 1YRRA 1FWGC 3N2CA 4IG2B 1R9XA 2VC5A 4PBEA 4LAKA 4R85A 3F2CA 4RDYA 5A6TC 2O4QA 1M65A 3FDGA 4DYKA 1O12A 3A3WA 3S2NA 3GUWA 4LCRA 3PBMA 4XAYA 4IFKA 2DVUA 4B92A 1FWAC 4F0LA 3HTWA 2QT3A 3HM7A 4DZHA 3QY8A 2EG7A 1RA5A 4IGMA 2R1MA 2PGRA 4G7EA 4DO7A 4IH3A 2AMXA 2BB0A 1J79A 4CQDA 1WXZA 2ZC1A 1YNYA 4BJHA 3EWDA 4R88A 4LALA 1ITQA 2HPMA 3IV8A 3B40A 1R9YA 4PCNA 2ICSA 1O5RA 4CNSA 4PCPA 3AU2A 2FVMA 3GU2A 3PAOA 4LEFA 2UZ9A 3QY6A 1V4YA 1NDYA 4JOMA 1ITUA 4IGNA 3SO7A 2VHLA 2W9MA 4ERIA 2FTWA 3S2MA 4C6NA 4M51A 4RDZA 1A4LA 3TN6A 2WM1A 1HZYA 2Z2AA 4RZBA 4QS5A 1K1DA 1A5LC 1FWBC 4QTGA 3G77A 2UBPC 3MSRA 4EP8C 3URNA 4B3ZA 4GZ7A 4C6DA 4C5ZA 4H9ZA 4D8LA 1FWDC 4F0RA 3CAKA 4IQJA 3IARA 3LSCA 3MDWA 4PBFA 4WVXA 2D2HA 4WGXA 4DNMA 3LSBA 2VC7A 3QY7A 2VR2A 3IRSA 4GOAA 1W1IE 1EJVC 3UR2A 2E1WA 1IE7C 3OU8A 4F0SA 4IFOA 4OFCA 1FWEC 4ERAA 1KCXA 1RA0A 3K4WA 4E3TA 1NDWA 1GKRA 3AU6A 3TN3A 1EJSC 3MVIA 2RAGA 4GXWA 1FWFC 1A5MC 2FVKA 4GX8A 4C60A 1ONWA 4KESA 4LCSA 4RDWA 1PTAA 2Z24A 1PB0A 4NI8A 5E5CA 1KRCC 4BY3A 2Z2BA 1V51A 1RK6A 3PNZA 3MVTA 4GY7A 4AC7C 2HBVA 3B0XA 3MJMA 2ADAA 2WJDA 4GY1A 1FKXA 2D2GA 3GIQA 4HK6A 1VFLA 1BF6A 1EJRC 2PAJA 3T1GA 3NURA 2HNHA 3IGHX 3NQBA 3T81A 3URBA 1NDVA 5HMFA 3K5XA 4C6OA 1V77A 1FWIC 1WXYA 4KEUA 4EPBC 4GBDA 1EJXC 2GSEA 4C6QA 2R1KA 1J5SA 4IFKB 2XIOA 3E0LA 4C6EA 1KRAC 3F2BA 3DUGA 1V7AA 2WJEA 4QROA 4C6LA 4XD4A 4ZSTA 1I0BA 1PO9A 3GTHA 4G7EB 4NP7A 3GU9A 5AKQA 3DCPA 4C5YA 1UMLA 4GY0A 3WZ0E 4RDVA 1FKWA 1RK5A 1XGEA 2Z29A 1A4MA 3FEQA 3URQA 3TNBA 1RJRA 2Z25A 2AQVA 3GTIA 1GKPA 4J5NA 1M7JA 4CQBA 3GTFA 3O0FA 3IPWA 4CQCA 3S4TA 2FFIA 4ZSUA 1RJPA 1I0DA 4C6BA 5LXXA 2GWNA 3OJGA 4ICMA 3OOQA 4LAOA 2OGJA 3TN4A 4LH8A 3LU2A 2R1LA 4XAGA 2QPXA 2Y1HA 1DPMA 2GOKA 4BKNA 4C6IA 2F6KA 4XD6A 1FWJC 3LA4A 3MDUA 4EPEC 3OQEA 4C6JA 1QW7A 4H00A 4DI8A 1KRMA 2YXOA 3LNPA 1YMYA 2O4MA 4HA0A 3CJPA 2BGNE 3OVGA 3GTXA 3MKVA 1J6OA 4LANA 4H9MA 5CH9A 1P6CA 4QSFA 1UIOA 2YZ5A
chains in the Genus database with same CATH superfamily
4P8XA 3S46A 1WZKA 1ZZMA 1W17A 4MYAA 2X2GA 3MUAA 5A8QA 3LV6A 3EA3A 3CS2A 4Z42C 4E8CA 1K9TA 2I5GA 3MHUA 3U7VA 1XISA 1DIOA 2OQYA 4CKQA 3ZMRA 1DHPA 3TWAA 1MRQA 3OYZA 3H2CA 3MO4A 3UFYA 5DO8A 1XJBA 1WQ5A 4AH7A 1WO2A 3NSMA 2GVEA 1ISWA 4PSRA 3RN6A 1QASA 2YPIA 1GQNA 4DWSD 1QR7A 2FZMA 1B5TA 2WVVA 1R9ZA 2XTKA 3U5YA 3KTCA 4DO4A 3CYVA 4BHYA 5EL1A 2PI6A 3UJRA 2HWGA 2ZVIA 4F0HA 2E28A 2Y5EA 2DUXA 1J0YA 3PPFA 3LMYA 5AYYA 5E93A 1F6PA 3PG9A 3VOIA 3QN3A 1EH9A 1XFCA 4C1NA 3SN0A 3N2TA 4L9YA 3PPHA 1EXBA 2XIMA 4PL2A 3ZSSA 4PMDA 1XSKA 4B5WA 1MXGA 1XLAA 5KITA 5HNNA 4CU6A 4OBTA 3BO9A 3W84A 3JZEA 3UYCA 3BDKA 4HA1A 1MRAA 1JI1A 1LT7A 4FNTA 3CPUA 1R38A 2W66A 1LCOA 7REQB 1TV5A 3KL5A 3COTA 3VNYA 3UWUA 1KQZA 1KFCA 4CQ9A 1UB3A 2Z7GA 5CQ1A 1V79A 3VCRA 1FCQA 3NWRA 2PSNA 2JQXA 1OY0A 1AL8A 3KL0A 5EMLA 4J3WA 3KOXA 3IGUA 3CT2A 4FNSA 2YL9A 1PZ1A 1RVGA 3V18A 1KRBC 1YADA 2A3LA 5FL1A 3KBJA 3R25A 1O5XA 3CWOX 4DF0A 3IGSA 4XZHA 2ZX7A 4HHHA 4Z2GA 2WCSA 1UPMB 3LI1A 4UFJA 1QUMA 5I24A 3RHGA 1LQAA 4A8LA 3B0YA 1L6YA 1T8QA 2WNWA 3T42A 3UG3A 3FX4A 4K8HA 1GQJA 2PMQA 1Y8BA 3FA4A 1TJ1A 4TMBA 4F66A 1DIKA 1FA2A 1EJUC 1TO3A 4A3QA 3M43A 3R5EA 4C90A 1ZB5A 3Q65A 1TJ2A 3UVAA 4HGXA 3HJEA 3UNDA 1E9IA 1LTDA 2XWEA 3NQGA 1YE4A 5JU6A 3NZ1A 1UH3A 3GDRA 3FDGA 4S2BA 5ABHA 2ZQ0A 2Z2UA 5HWNA 5G2IA 3BCFA 1GT8A 1QU4A 3LTYA 3PBMA 5FJUA 3VD4A 2DVUA 4AHOA 1QTWA 3BLDA 4QNEA 3VM7A 2FZ9A 2PGRA 3U57A 2O92A 3TQ0A 5KEZA 3W85A 1XG4A 3W1RA 1JDEA 1S1RA 5ABGA 3L4ZA 4JY8A 2ZC1A 3VKBA 5DQPA 1IEVA 3ITOA 1TVNA 1UD2A 1E3XA 5D9NA 1FTXA 3WLPA 3RU6A 4JKKA 4HNCA 3VCCA 2YBVA 2P0IA 3OBEA 1RY8A 4WF7A 4LBRA 1D7FA 3W7PA 2QIWA 3L0GA 4MJMA 1EP1A 9XIAA 4DJFC 4GZEA 3TEVA 1DJHA 3LXCA 2WMKA 1NWRA 1JZ7A 2UBPC 4JX6A 4PSPA 3VOFA 2ZWYA 4MMWA 3UGVA 5CBBA 4UOJA 1W5PA 4QM1A 4UZUA 1BWVA 3CH0A 1HO4A 1UWRA 5JUVA 1Y7VA 3KE0A 4RPQA 2HZGA 3QY7A 5G4EA 1O5QA 1PX8A 3RIKA 4J4KA 2E77A 1DEDA 1M6JA 3TMQA 3W1PA 3R7MA 4DVOA 4RV8A 1GKRA 3NFUA 1SZRA 3AAMA 4RNJA 2BX7A 4M82A 2H9AA 1O66A 3HA1A 1A5MC 1KM2A 3NL3A 1PTAA 3SRDA 1R3YA 1W9BM 4ZO9A 5DMYA 3QR0A 3N9RA 4GUGA 1KLZA 4DNHA 1X7IA 3CV2A 3W1QA 4QAWA 1IZJA 3SR7A 4BI7A 2HNHA 4WY0A 2BZNA 1FVPA 4NAEB 1DJIA 1ME9A 2BWGA 3QM3A 5HMFA 1BVNP 3U9IA 2YFOA 5HWJA 1OF6A 2WSKA 1S5NA 3UPBA 5HATA 4MIMA 4F0MA 1ZJHA 2R1KA 4GHRA 1QHOA 2C1HA 3EOEA 1PXGA 3TJIA 3EZ4A 4XWUA 4GD0A 3GHUA 1TV8A 2O7QA 3DCPA 1WV2A 2QCMA 3WZ0E 2O55A 3I4EA 1CTNA 1PCKA 2VGFA 2PDIA 2I7GA 2WJZA 5CZSA 1VEOA 3BARA 1JCMP 4AD2A 3WNLA 3ZYZA 4J3TA 1P0EA 3S42A 2BY1A 3PN8A 4TVCA 3DESA 4Q4PA 3SCRA 1HGWA 1Q2SA 3USZA 1KWKA 4KCUA 1GOOA 4BQ4A 4BKNA 4QXIA 2Y5SA 4JCMA 4TVDA 2UY3A 5HQEA 5BU6A 2DJLA 3QOKA 4GQGA 4IP7A 2X30A 1P6CA 4POCA 1E4MM 1JCLA 2GZXA 3FN9A 3T55A 4UR9A 2OQLA 5ABEA 1ICQA 1DV7A 2GUYA 3UG4A 1ZLPA 3O3RA 1Q6CA 1B3WA 3W7CA 2CERA 3MTWA 4WK9A 2PWHA 2JEPA 2V5JA 4MAVA 2GWGA 3EGJA 3LB0A 4DZAA 1R3SA 1SJAA 3C2RA 4O13A 3NO3A 1A5NC 3PFMA 4OV4A 1PS9A 2GDQA 3G3MA 1HT6A 3QKZA 4BF5A 3OZMA 3BJTA 4UC5A 3SUSA 4AY8A 4QE4A 2F2HA 1UC4A 2VVNA 3HFTA 3NYDA 1OADA 4RUBA 2P88A 4LQ1A 3SBFA 2CHOA 1TV7A 2VKZG 5HUPA 3SQLA 4G8TA 1K02A 4JQ1A 2Z28A 3GG8A 3T4WA 2PFHA 3L21A 1E70M 1CPUA 3QR1A 5K4ZA 4FK9A 3BZGA 3CQKA 3IS4A 2BOGX 2RGMA 5BWAA 2V9DA 4LYKA 4BI6A 1OT2A 3R4IA 3V0TA 2GGHA 3UF9A 3SB0A 5AC7A 3VD7A 1UWTA 4LBUA 3ELFA 3QGKC 3WH6A 1WDPA 3O7UA 2GJXA 2BV9A 3QMSA 5AN7A 2F84A 3GXMA 1R86A 3BWWA 4Z2IA 3P67A 5LA0A 4H9YA 5D2WA 4GK8A 3L0KA 3WF1A 2D0HA 1ITCA 1SQ7A 3OHIA 3ZSTA 1JPHA 4JHZA 4MAZA 3V7PA 2WWCA 3PBVA 1CNVA 1QPQA 3AALA 4L4PA 3RM4A 3ZZ1A 1TWIA 4TO8A 2J77A 3HG5A 3O06A 3D47A 3AHXA 3KRUA 1EWEA 2J47A 2NUXA 2QVNA 3LCHA 1AH3A 1P7TA 5FEZA 3IACA 2OYKA 1GVEA 3WH8A 1VBGA 1DXIA 2IMRA 2P53A 3FLUA 3LZ5A 1EBHA 2RDXA 5HWMA 3UWQA 1CT5A 2ZUUA 2F61A 1HW6A 3MANA 1E6ZA 4FEZA 3EDFA 2YDSA 1EB3A 2X0YA 2Z6JA 4AAJA 2YLLA 2F2KA 3L2LA 3LGDA 2VELA 2EPOA 1HJWA 2V2DA 1MFUA 1OF8A 2JK2A 2VC5A 2CLPA 3MUIA 1GG1A 2YL8A 2NW0A 3VKCA 4HYVA 2RJHA 2PWDA 3OZYA 2VYOA 4YCOA 3CUGA 3LHVA 1DQWA 4NJKA 1V93A 1K4HA 1SZGA 5KZMA 1KBLA 1H5YA 3PJXA 2REQA 4IGMA 1UP0A 4O8AA 3INPA 2WHMA 3VD5A 3V1HA 4LV4A 1AG1O 3Q94A 3HURA 4UMBA 4A4AA 2IXUA 1EA9C 4E5TA 3DENA 3EWDA 1QBAA 2WWDA 4HU8A 4JTGA 5IBXA 1ICPA 3GQYA 1PL9A 1QPRA 1JNDA 4DXVA 2UZ9A 1SZNA 4HCHA 5HJYA 1QWGA 4O11A 3KOFA 2A7PA 2WM1A 4IIGA 1LZOA 4OT7A 4DAFA 1WDWA 1WAWA 4UIOA 4JIRA 1SM9A 1W3JA 3IRDA 1DTUA 3UJFA 7ENLA 3AJXA 4AZCB 1LQ0A 3CAKA 4PA8A 4WLCA 1OZQA 2NX3A 1UZ4A 4JN6A 2MNRA 3T08A 3M07A 4U31A 3IJ9A 3QC3A 1BYDA 3WF2A 1EJVC 3UR2A 1LLWA 1P4CA 4IUOA 4M56A 4DM1A 3RLHA 1MEWA 2Q8XA 4OFCA 3WLNA 4ERAA 5LHFA 1IEWA 3NXLA 2DDXA 2BXYA 3P84A 2VC9A 2PP1A 3NQAA 1PYFA 4FR1A 1HTIA 4Q4OA 4GX8A 2QV5A 4JXCA 1HKVA 1L8NA 4NRSA 1G5AA 2WPBA 3WLIA 4MWAB 4DRSA 1UG6A 1QO5A 1D8WA 1V51A 3H4XA 3MVTA 2NLYA 4AX6A 3ARXA 4PEEA 4PMZA 3BGGA 3B9OA 3E0IA 3NQBA 3TDFA 3VU2A 1F8IA 3A4XA 1OX5A 1Q6GA 1UA7A 1MMFA 3NUKA 1KA9F 1FX6A 4I8YA 2FVLA 3W1TA 1E1EA 2JBMA 4IT1A 4GUHA 3NQEA 3E5BA 2QQ6A 4A8RA 3RPMA 1A0EA 1EGZA 3UZWA 1XYFA 2ZOXA 3W0KA 3TAKA 1U1UA 1QNOA 5D37A 5C55A 3NQDA 1C93A 1M03A 4NKCA 3GC4A 1UUQA 2X0HA 3BAYA 3CUFA 2PDCA 2DQWA 3AXIA 5E6YA 3L65A 4EAMA 2GVYA 4DBWA 2BNJA 3PSWA 2CU0A 3ES8A 4B3LA 1HJQA 1V3LA 2FQIA 4MZ1A 4MDOA 3MYPA 3E2SA 5AC4A 2VFHA 4HA0A 5K3VA 4GE8A 4U3CA 5REQB 1E56A 3C2FA 2YZ5A 3QW3A 3S2JA 4CLMA 4Q7BA 1T96A 1UZDA 3FS2A 2J9ZA 3BL3A 3DFQA 2AL2B 4AU0A 3GC2A 2POTA 2VTFA 3QSRA 3UJSA 4Y9NA 1Z7AA 3SFWA 1H11A 2A79A 1EHAA 1ADDA 4HOWA 1WDSA 4MJ2A 1NQKA 1W9XA 4WJEA 2Y24A 2GQ8A 2XN1A 3QW4B 1ZU8A 3MP5A 2YA0A 3TLLA 4TMCA 1XGDA 4QLLA 1YXYA 3IJIA 2PRHA 2QJMA 3EWUA 1UW9A 1YIXA 3M16A 3LHYA 4C7FA 2VQUA 5DMMA 4B91A 1RCOB 4RNHA 2BVYA 2E1DA 3BAWA 3ITGA 3VKJA 3M6YA 3WQWA 4HNTA 2F9RA 3R79A 2CNCA 1R3QA 3T0TA 3EPNA 4F2UA 3IJQA 4B16A 4E2OA 1FDZA 3L7RA 2WVTA 2QUTA 3ORWA 1F76A 3NL5A 4HNLA 4LX4A 1GK8A 3UZJA 3BG5A 1F2JA 3G1RA 2Z00A 1VEMA 4IWWA 2VZOA 2W4XA 3P0XA 4YTTA 4ZQRA 4R27A 3L5MA 5LZLA 1EBGA 2E8YA 4MYXA 3RITA 4C1LA 4AD5A 3WYZA 2O0TA 2E6YA 2QPUA 2QUUA 4JX4A 4XTDA 4HNUA 3ME3A 1AD4A 3IIVA 3RCMA 1VENA 2VURA 3J7HA 3A6OA 3NEVA 4K3ZA 3K4AA 4F4RA 2IS7A 4DIAA 2ZUSA 1LYXA 5D2VA 4GZJA 3D0CA 2FB3A 1F6KA 4MHBA 5HPOA 1W0MA 4S3KA 1REQB 4LXFA 3W7NA 4KQNA 1BTCA 4URIA 4A05A 3ITTA 2DZSA 3W81A 5IM51 1K7FA 4X9SA 3LY0A 5EU9A 4I6KA 4PMRA 3KAOA 3T0AA 3QTPA 4I7WA 4GVGA 4AVOA 3W7DA 1XSIA 2EGZA 1TELA 4WSHA 3HQNA 4PBEA 3G22A 3AHZA 5BROA 5T9CE 3NVTA 4R85A 3KFTA 4XVDA 3IV3A 1B0IA 2ZTKA 4NZCA 1ZP3A 1E51A 3L0NA 4J28A 2IQTA 1KCLA 4JTQA 2X1TA 3VGGA 4D6IA 4DZHA 2A3EA 1FHLA 3IVUA 2V5CA 3QV7A 2FHBA 2AL1A 3VVGA 1UKOA 4WKFA 5EPDA 4JTDA 1H7NA 3GAKA 3WQEA 3WLJA 2QCLA 2H3BA 3WJYA 2HPMA 4TTUA 1JCTA 1MW0A 1H62A 3W86A 2WSRA 3EWZA 4LEFA 4IGNA 5I09A 1E15A 2ZRWA 1QNPA 4HTYA 3MMDA 1RVKA 2FTWA 4M51A 4RDZA 2WW5A 4LAZA 3TN6A 1YTKA 1IWPA 4X22A 4EACA 1OGBA 5BXSA 4LOCA 2HK1A 4UTTC 1JQXA 2ACRA 3WL1A 5ABTA 3URNA 3WUFA 1UP3A 2XGIA 3DFOA 3DYMA 1E0UA 2RFGA 1ZCOA 3BGAA 1Z32X 1S5VA 3P81A 1WX0A 4WVXA 1FH9A 1EX5A 3LCXA 3OU8A 1W3LA 2H6RA 2YJQA 1Q7MA 1KR0A 3UCQA 4HHPA 2QCNA 4L1GA 1YDOA 2YDQA 2BY2A 3NPXA 4RDWA 4Y96A 3RF9A 3PTQA 4NI8A 4XBSA 2B7QA 3TW7A 3MSDA 1RK6A 3WDHA 3NAVA 2VEFA 2ZXBA 4P61A 5CSRA 5F2GA 2BDQA 4HK6A 2EHHA 3MCOA 2PAJA 4OVXA 3TC7A 4W7UA 4PUMA 5DANA 2J13A 1LORA 2VL4A 4O0ZA 2V3EA 4LVBA 2A6NA 4ML4A 2BHUA 1BKHA 1UASA 1GNXA 1UQZA 4CNOA 1XBXA 4K37A 5LA2A 2NXGA 1JDDA 1W9VA 3S1UA 1M7PA 1Q6EA 1TVLA 3T0BA 5A8MA 1JD9A 3KVLA 2F8QA 1E6QM 3AXHA 4CCZA 3PHAA 1JCXA 4L65A 1W54A 3PZ9A 2XH2A 1NP0A 4PMVA 1UMLA 2VFDA 2Z7KA 4WD0A 4D6EA 1J0JA 3TNBA 1LWHA 4MNJA 1XXXA 1M7JA 3C2VA 1MXSA 5I78A 2FFIA 3B8VA 2C0HA 4V33A 4PUNA 3WQDA 3C52A 5AYZA 5C54A 3STFA 3VFLA 3WH5A 4P2VA 4QFUA 1X7FA 3ARSA 2QPXA 4NZ4A 2HV5A 1K4GA 1G0CA 2PF0A 5D2XA 3KS6A 4GYPA 3DBPA 3A47A 4C6JA 3VGEA 1QW7A 3LNPA 4G1NA 2BGNE 2HCVA 3LM3A 1KGUA 5AZ0A 1TPDA 1ONXA 1E43A 3WMLA 3CT7A 2V3GA 2VENA 5D04C 1PIIA 4AD0A 1CLVA 5MF5A 1JQVA 2HK0A 3W7HA 1ZBWA 4WCJA 1DJYA 2BFGA 3CIXA 3OLDA 3ATZA 3FDKA 2Y8VA 3STPA 1U2YA 4IXXA 5AVHA 2X7WA 1LOLA 2ZICA 4AXNA 4DM2A 2WMFA 1X8CA 1Z69A 5EBAA 4AVFA 1R30A 3UZYA 4AZGA 5AC6A 2C8NA 4ZTYA 1YPFA 2A21A 2DU2A 1CGXA 2G37A 1PZ0A 3GHRA 2KZHA 4N6FA 2B4GA 4LB4A 2A3HA 2HRWA 3EXSA 3N9SA 1JPIA 3EX6A 3VGHA 3PUOA 3I6TA 3QV9A 2O56A 4EX4A 4WIWA 2RGLA 4HMDA 5EMKA 1LF1A 4YTSA 3TFCA 3TJXA 2P5NA 1P1MA 3E1F1 3ATYA 3TZFA 1VFOA 1Z48A 2C6QA 4H9UA 1C8XA 4H6KA 3UXLA 5D4YA 4QDWA 3N6JA 4LUIA 1MUMA 2E6AA 1EL3A 2INZA 1QHZA 3VGDA 5M5DA 3ITYA 4L1WA 3W74A 4HT3A 1ZBVA 1QOPA 1DXEA 1UJQA 4GFIA 3HIJA 1QWKA 2XIBA 1JZ8A 3SRKA 3G1FA 3RCYA 2DVXA 3W7KA 3ARUA 3NZPA 3W82A 8TIMA 4W84A 2E67A 1NOWA 4XISA 4Z1YA 4XZWA 3EX4A 4KIRA 2J79A 3RLVA 4HZ6A 1XDMA 3RR4A 4PMNA 5FSDC 2EPLX 4AX7A 4GBUA 3MHFA 4XD3A 4M81A 1TYGA 3AMDA 3LPPA 3LLDA 3PNUA 4DJDC 4O12A 3UR5A 3I4KA 4AF0B 2OYMA 1HJXA 4UBPC 3E5PA 5MKGA 5HNRA 3ZFHA 2DORA 1VPQA 3KP0A 1Z44A 2ZFAA 3ICJA 3GNNA 4D6GA 2OZTA 3N19B 3O6AA 4ZO8A 5G1TA 1QI0A 1LBLA 4Z2HA 3V36A 3VPLA 3O0KA 1PVNA 2W5FA 3RYSA 3KUMA 3RAOA 4H8UA 4LU0A 2GYIA 1LOSA 4UFKA 1R9XA 3KCLA 3P7YA 2DW7A 4UOZA 2GJLA 5A6TC 4Q8UA 5IDZA 4S3BA 2WC7A 3I65A 3VUSA 3MCNA 1FWAC 5CPLA 4HVXA 2G5WA 2VD9A 3AHVA 2VDGA 1RA5A 4ZXOA 3BJFA 1Q6QA 3PULA 3KEHA 2WAGA 1X6UA 4DO7A 3ZO9A 1CW2A 5I7GA 1YNYA 4BEUA 5EBUA 2OOGA 1HG3A 1EX1A 2YL6A 2PS2A 1V3KA 2WMHA 4PCNA 2O9RA 4MLRA 4DXXA 1GOIA 3VGFA 5JBDA 2VT0A 1ODUA 4R34A 1U83A 3W2MA 4DELA 3OTRA 3M4HA 4O1AA 2WVUA 4PTWA 3EYPA 4RZBA 1EC7A 3OZPA 4HPGA 2GQ9A 2H90A 4TV5A 3SCPA 2E09A 1OC5A 1XBYA 2FMNA 3ZLFA 4ES4A 4H41A 4PUUA 2PDHA 5T9BG 3WJZA 1EO5A 2OLSA 3DH7A 4NZFA 4Z2KA 1JAKA 3V0UA 4LUTB 5FOOA 2E1WA 4ZVJA 1UUOA 4DPQA 4A2SA 1RA0A 1NAL1 3BGJA 2D69A 3SJ3A 4S3FA 2DSUA 4A35A 4JFUA 1FWNA 3M0HA 3MUXA 2RAGA 1HQTA 4GXWA 3FIGA 1TIWA 3WNOA 1TPC1 4LVDA 2Z24A 3QVQA 4BWLC 2PC4A 4AB4A 1D3CA 4HPJA 1JZ2A 4LVAA 1VYRA 4LW7A 5K9XA 4IL2A 4K1GA 2NT1A 1ZQ5A 4JQ4A 5B7ZA 4NNBA 3F5KA 1C7TA 2GDUA 4QGCA 3WY1A 4V28A 3K5XA 3VABA 3FFSA 2YLAA 3A21A 2DJXA 1XKYA 2GDVA 5B7YA 3H4WA 1JRCA 4IM4A 3VOJA 2YKKA 3GXPA 4Q8OA 4X0NA 2EKCA 4JNZA 3SSJA 3KHDA 3G24A 5F2IA 3DUGA 1U5VA 2VP8A 3M7SA 4C6LA 1I0BA 1PO9A 5F4SA 1W5NA 2D73A 1LL4A 3GU9A 1V8EA 1E6RA 4C5YA 2VI0A 2HROA 5K9DA 5JIPA 2OPJA 1RJRA 3P5YA 7REQA 1QRQA 1VYPX 3KXQA 3EX3A 5A2CA 1RBAA 2PLJA 3OA5A 3W2NA 3BJSA 5CJMA 1U22A 5D05A 2FZ8A 3UCDA 4HB7A 5AECA 2IQDA 1WBJA 1WPCA 4W89A 3SW6A 4GYJA 4P7QA 4A3HA 2OELA 5C2GA 2OFJA 3B0UX 4QSFA 2TYSA 2FTYA 1O6IA 3BG9A 4G1KA 4LY8A 3LBCA 3ISIX 4MFEA 4HQVA 4YMZA 5A94A 1P0NA 4QX4A 3WLSA 1I60A 1W1YA 4JL1A 2CZVA 2J25A 1LQ2A 3F4DA 4ERGA 3W53A 2QCDB 3BE7A 1S1PA 1W9PA 1TR1A 3KRZA 3MWCA 4L61A 1XCXA 1IYXA 2BVWA 4XZMX 3QPYA 3QZAA 3DC8A 5BRBA 1SZFA 3QSTA 1PSCA 4A22A 2J66A 4WZHA 2FIQA 1OFDA 3ID7A 3G0UA 4FLSA 5ECVA 2BS9A 4BQ5A 4KW2A 1X8FA 3NDOA 1QNSA 1UR3M 3N6HA 2DY3A 1GTEA 3WBXA 4HSHA 4GQQA 3EB3A 3LHZA 3Q37A 4X0VA 5LIWX 3B8IA 3H7UA 5GVJA 3ARTA 5AYIA 3SJNA 3R94A 4GI6A 3UZ5A 5I3IA 1YTDA 1YEYA 3OODA 3IJLA 4ATLA 5A8OA 1DWIM 4PUWA 5C2XA 2PCQA 3GBEA 1IT7A 3K30A 3URAA 3SUVA 2GJRA 4MNLA 4D2JA 1JUEA 4WX2A 3W6LA 5C9UA 1OFEA 5TNVA 3HGJA 1MW3A 3L4TA 2BBFA 1ODZA 5F4XA 1EZ2A 5FACA 3C8FA 1VFUA 5FJRA 1D8CA 3QQ1A 4FO4A 3DFHA 1AZ1A 1POJA 1RHCA 2XIJA 2KAUC 4H6EA 1ZUAX 1GVFA 5K9CA 1GPFA 4DZIA 4GC4A 2JF6A 2ZADA 3ITLA 3LEPA 3LG3A 4IJCA 3TN5A 2VX4A 1WBHA 1BXCA 3AZRA 3CZJA 1J6PA 4IFRA 2ODOA 3UYIA 1YBQA 4AISA 3BLPX 4AMAA 3QV6A 1YDYA 6A3HA 1J0IA 1J0ZA 3RO8A 3UXAA 5E0CA 2QUNA 3BK0A 3NEHA 1B3YA 3L5AA 3B05A 3POHA 4CD8A 1CI1A 1XSJA 2NQ9A 2QAPA 1AW2A 4C65A 2NT0A 1XYBA 3AS2A 4AZ6A 1R46A 3PB2A 4AWUA 4HHLA 5EA9A 3HPXA 5C9ZA 5BCAA 1E73M 4IG2B 5FEPA 4LUSB 1JI2A 4DWDA 2TSYA 3QYQA 4RZ5A 1XIJA 4KS0A 1O12A 4QCFA 2QUMA 2YCIX 4C1KA 1FCVA 3FOKA 3QY8A 1BD0A 1QFEA 5J5DA 2B31A 1FHUA 1KLYA 1RSCA 2GJNA 4Y9OA 3RJYA 3H55A 4IQLA 1A5SA 3G1YA 3SDOA 1Z3NA 3T40A 4H4IA 3C0LA 5HUOA 2TMDA 3IV8A 4KWWA 3FA5A 1WE5A 1V6WA 1ECQA 1G4TA 1PTDA 5AHNA 1NDYA 3OW1A 3AMLA 3DZ1A 3PJWA 1DJGA 4YVVA 3SO7A 1DYSA 4J27A 2W9MA 1UD8A 1CCWB 3MSYA 4Q4QA 4IZGA 2WZEA 3FJNA 1A4LA 4E8GA 1ZTVA 4DB7A 3MYOA 4CQAA 3DN5A 3GHTA 3MZ2A 3K4DA 3W2JA 5G2WA 1E1FA 4XO6A 5E70A 2HXTA 4IHCA 1TPVA 4J3SA 1SR0A 4D8LA 4GZ7A 3GX9A 3MCMA 3E96A 3NCOA 2A7RA 3IARA 3S1GA 2ZUTA 3MDWA 3VIMA 2D3LA 3MI6A 1TX2A 1TFVA 4WKHA 1KFEA 4WGXA 3AZTA 3CYJA 4S3DA 4FXRA 2I16A 1IXQA 3PZQA 3TROA 2PBOA 2ASHA 5I00A 1I4NA 1KCXA 1I2NA 2AKZA 4M7SA 1CGTA 3ECQA 4JTCA 5A8GA 3WBAA 1EJSC 3SRHA 2G0WA 1FWFC 3BW3A 4XG1A 1ONWA 2VC6A 1XLHA 3BCJA 5E5CA 3UVIA 4JCLA 2PEVA 5IHSA 3LRKA 1FFRA 5T26A 4HOXA 2CIPA 3P6LA 4HN4A 4AD1A 1I75A 4YPJA 3WQPA 5C8BB 4KRZA 2J8FA 1F73A 1XV8A 4Y9MA 1UUMA 4KEUA 3MKCA 3KTXA 1C8QA 1RV8A 1XDJA 1I9CB 4MLJA 3B3DA 4WQ6A 4IFKB 2IPFA 4O16A 3TQKA 2C18A 4K7VA 2J27A 4O18A 2WV8A 3N1AA 2Y2WA 2QJHA 3VIJA 3EKZA 1KFLA 2ZUNA 3GTHA 4ZQOA 4B4FA 4JTRA 3B8UA 5A1AA 4QAIA 1RBOB 5BXTA 5I03A 3VINA 3UG5A 1XF0A 1VJZA 3O0FA 3WQGA 5CZ0A 2QV4A 3BQ6A 1XLGA 5A69A 3DG7A 5DF0A 2UV8G 2GWNA 5DXXA 4JN8A 3SURA 2YCLA 3XINA 3AIUA 2Z1SA 2XFRA 1Y5VA 3OZOA 5BU9A 4DHGA 4PC8A 3TE9A 4X63A 1LG1A 5CC5A 4NNAA 4DEFA 4FS9A 1WP6A 1F07A 1FWRA 5E0KA 2CZEA 3OBAA 4H00A 1MNSA 3W01A 5C0QA 1VGAA 3OVGA 3GTXA 4GO8A 3GXNA 1DE5A 5BOEA 3PPGA 3I3EA 1RCQA 3UZXA 2PGEA 5IRPA 1LL6A 4L9XA 4IGHA 3QHOA 4MNKA 2WPGA 1SW7A 1V3JA 1C92A 3WH9A 2P50A 2J74A 3UWWA 3U7BA 5G5IA 1CB7B 2C79A 1GZJA 2BVDA 4IOTA 2V5BA 4NIRA 2VM8A 2PU0A 4N4QA 3WELA 1TX0A 2ZZ3A 2JIWA 3ANVA 2X1SA 4UFIA 2G4FA 2PUZA 1LWIA 1WDRA 2W61A 4DY1A 1OB0A 2PB1A 2VX7A 4AHQA 1A5KC 3W02A 1HGYA 2IPWA 4NZ3A 3N04A 4DBSA 3M5XA 2DVTA 4I7VA 1MFVA 3VI2A 1RALA 1H0IA 3D6NA 4DI9A 4JQ3A 1ZBKA 3VMNA 2V0TA 3SY8A 3WNPA 5DX7A 1VFFA 1TV2A 1V0LA 3NA8A 3NQFA 1YHTA 4M6UA 1TPEA 3EPMA 2DQXA 3MKKA 4RJEA 2YL5A 3TV8A 1XBZA 3QHNA 4JIQA 1H1YA 1DWGM 3U0HA 3BZJA 3S1XA 1AJ0A 2BODX 2OSWA 3JRKA 2E25A 1PPIA 1Q45A 2BGSA 2XWDA 1R85A 3O05A 1OG6A 4RZ6A 3TYCA 2F38A 1TTPA 3B06A 1B9ZA 1E6NA 4MWAE 3WD1A 1EDGA 4RZ4A 4H3DA 3GNRA 4ZO7A 1J4EA 6ALDA 3ZLGA 1IIGA 4JX5A 1IGWA 3C3NA 4DLMA 3UQNA 4AC1X 1ONRA 1GEHA 3ABRA 2JGQA 3LS9A 1NTHA 2ZIDA 3LERA 2Y88A 1EJWC 3QRHA 3VUPA 4EWND 5JBFA 2Z0IA 4AZCA 3QQ0A 3TU9A 4LRTA 2D2JA 2XINA 4KERA 2C13A 2I9EA 4JTTA 4TIMA 4CVWA 1K77A 5CPQA 3W83A 4QS6A 1SFTA 4JIPA 2HTMA 3W76A 4ML9A 1EC8A 3R8GA 4ATDA 1GG0A 5FL0A 3U4FA 1XLCA 1W1B1 3U5UA 4GXMA 3NGJA 3H26A 3UETA 4MPQA 5A6LA 5C70A 3GH7A 5DBTA 3VNDA 4MWAA 3O6DA 3NG3A 1B31A 4QRNA 1ZGDA 3W1LA 2I9UA 3IGXA 1OD8A 3RDKA 5GNXA 4TV6A 5HMDA 1AQMA 2PURA 3TVAA 3STEA 2XISA 3R0DA 2CXEA 3GE7A 4XZ9A 1MW2A 1ADSA 5KMYA 1XI3A 1LROA 3SI9A 4E4UA 3LXBA 4FXSA 1NOFA 3WF4A 4DF1A 2E9LA 3C0QA 4WDWA 2BMBA 2O4QA 3LMZA 4DYKA 4MB3A 2EF9A 3QLDA 3KDOA 2UY4A 2YBTA 2WMGA 4B92A 1RCXB 2QJJA 4QDPA 1UR2A 1BPLB 4O28A 1LRTA 4H04A 3VOGA 1JD7A 1VFTA 2WSQA 1HXJA 2AMXA 1IWAA 5CLTA 4NX0A 2YSWA 4XO7A 4EAYA 2B7NA 1XIGA 1UP2A 3DGRA 1H60A 1B2YA 1R0MA 1GVSA 2HNEA 3EWBX 4TVUA 2ICSA 5FKYA 1K8ZA 3PSVA 1ISVA 4JOMA 3JS3A 2J7FA 1AW1A 1FY6A 4GUIA 1T7LA 2QVHA 2MUCA 1DVJA 5AC8A 1EOMA 4DWSA 3C6CA 2E68A 3L12A 4QR6A 1QNVA 4XV0A 1F61A 3G77A 1S2AA 5REQA 2X41A 1A0CA 4IMDA 2CZDA 1GEQA 1UZHA 3G0SA 4GCAA 1JYWA 3PP7A 2AL2A 1I8JA 2A5HA 1KM0A 1B54A 5I3KA 2WZMA 2PWEA 3DU0A 4DNMA 4C7DA 3ZJKA 2D2OA 1AQFA 2D22A 3W1AA 3RX3A 2PDQA 4J9JA 4RNFA 2CW6A 1FWEC 3V5CA 3OA3A 4WUIA 1BKSA 2I5IA 2BHYA 3VIHA 4D8ZA 1KCKA 1GCYA 2XFWA 3BOLA 3U2OA 1J2BA 2PLCA 2VR4A 5LIUX 5LXEA 3NM1A 2JKAA 2C1IA 3EB4A 4JTKA 3B0XA 2WYSA 2YA1A 2ZVRA 1XLJA 3HU7A 4MY8A 3OO2A 1EJRC 3REQA 3TTQA 1JCNA 3I3DA 5AZ1A 1H49A 2YIHA 3RGTA 2WQPA 2W0UA 1NM9A 2FPVA 1AA1B 3CIVA 4CU8A 1WUEA 3B9DA 1VIWA 1MUWA 1WOBA 3B8DA 2GGGA 3EA2A 4HP5A 4HSNA 4HZ7A 2GK1B 1V7AA 3C3UA 2I17A 2ACQA 3FHQA 3EDDA 4LF1A 1GVQA 3EMZA 2DSKA 5BW6A 1NSJA 5CPNA 5FJOA 4O52A 2WLYA 1UKQA 2HVMA 5M03A 2XHYA 3S4TA 1FQ0A 5M17A 3H8AA 4ZSUA 3TTSA 4IQEA 4UTHA 4LYQA 1JPDX 4NZJA 4S3CA 1EDQA 4V15A 1XYAA 3WF0A 4KBXA 4YVXA 2WQDA 1UD4A 4JTFA 4C6IA 3W26A 3N15A 4GO9A 1JDCA 1EF3A 4DI8A 4I5UA 4WXYA 1YDVA 3PTMA 2C14A 1G67A 1AJ2A 1XH2A 4HMNA 5DRIA 2R8WA 4KFPA 5TD4A 1SO5A 4NJIA 5EMMA 1M53A 1OK6A 1SW0A 3ABXA 4N9CA 3B9EA 2OZ8A 3TZNA 3F2DA 1ZSXA 2YB4A 3W28A 3L4VA 3UR7A 3OLEA 4JTHA 1K7XA 2YDAA 2B81A 4E4FA 5DCBA 1SGJA 1PZ2A 1UWQA 4PGLA 4EF8A 2HDJA 3B0PA 2VGGA 3HV8A 3H7VA 1XLIA 4F9DA 2FB2A 3GH5A 2NQZA 3W1UA 5EMJA 3AIWA 3BSHA 1T40A 3OGSA 1YPXA 2WJFA 2J88A 3GS6A 1DJQA 4FHAA 2EPHA 4KCTA 5B80A 1U5HA 4KKXA 1NDZA 1NY1A 5CSSA 7TAAA 1N82A 4H2CA 4K38A 1XX1A 5CPTA 2HVOA 1CBGA 2GQAA 4DUWA 2WKGA 1US3A 1R47A 1KTCA 4WOQA 1V03A 2YGYA 3WFLA 2VDHA 2QDDA 3H53A 3QXBA 4O1EA 4HU0A 1RJQA 3B8TA 3A23A 4PR4A 1CWYA 3WUEA 4EKJA 3ITVA 5F2MA 1P0KA 1PWLA 1RP8A 4FZIA 4ZENA 4B5XA 1XQKA 3E2VA 4LT9A 3VTRA 1UWSA 3TTOA 2FZNA 3FYYA 1GYMA 2YB1A 4FPSA 2V81A 4RXFA 1K3UA 3NJ3A 3AQUA 2RJGA 4KEZA 2V8ZA 1XRSA 1XC6A 4AVNA 3WFAA 5FF3A 1W1VA 3LQLA 2PRLA 1JXJA 2DUZA 1ZAJA 3HOJA 3JR2A 1XRTA 3WLOA 1VRDA 2WXDM 3NQCA 3JVAA 3TC3A 5BRPA 3CO8A 4L56A 1W9UA 3VOCA 4RXGA 5CZKA 3TXZA 1ADOA 2CBVA 1BRLB 5C9RA 4AZIA 1HKIA 3EPOA 3MV11 2NQ5A 3CHVA 3NTYA 1Q4NX 1RQBA 4AFYA 1YRRA 8XIMA 2PDXA 4DX3A 1KB3A 4OBSA 5LIKX 4GCXA 1VJSA 3GUWA 5E0FA 4K8GA 4WY0B 2JFEX 3BPWA 3NQ7A 2OWWA 2PTXA 2BTMA 1EA0A 9CGTA 4BS0A 1JPKA 3R1ZA 3WBEA 1QPNA 5DFAA 4IXHA 3UY7A 5DMLA 2WKLA 4W8LA 1PEZA 1AH0A 1IWBA 3BTNA 1XIBA 3VM5A 1EGVA 4KEMA 5CKSA 3ZJ6A 4FX8A 5KSWA 2VCBA 3VNLA 4LALA 2QCGA 4RW3A 4HYRA 4MWAD 1JJKA 2OR2A 4PCPA 4RCXA 3PAOA 3WJWA 4E4PA 4OJYA 2G3IA 3CUXA 4AW7A 1S2TA 4PBGA 1C29A 2E7FA 2FMOA 2V63A 3M0YA 2VGIA 1E5JA 2QDGA 1L6FA 3UEQA 5AHMA 3Q67A 4NF7A 2A1YA 4RE3A 3NIYA 4S3AA 3BAKA 4Q3MA 3DI1A 1TUFA 5EFDA 4PL1A 3RRAA 1W3NA 3WF3A 5F1UA 4P7LA 4MB4A 3RFAA 3T78A 3DEQA 3LSBA 3GZ3A 3IRSA 1PJ9A 2V2CA 2NSOA 2VXNA 1WOAA 1OFQA 4LS0A 2XSBA 4AHPA 1B57A 4HHMA 1C8VA 3K4WA 3ONBA 1AFSA 4FR6A 1RR2A 4PMJA 4PRRA 2A85A 4OGZA 5LIYX 4C60A 5IFPA 3CV6A 3TQPA 3WL0A 4LCSA 1UD3A 1JG9A 3A9BA 3RX2A 1UWIA 1I2QA 1MSSA 2VUYA 2NX9A 2DZXA 3W1XA 1FWSA 5A5WA 4O4VA 4D8AA 1FKXA 2XJ7A 3APYA 3CHFA 1XICA 2FGBA 1Q85A 1BGGA 3NURA 4KRTA 1LBMA 1QOQA 3NOEA 2VQTA 4F2BA 4XUYA 5HOSA 1KM3A 1PKYA 3YPIA 1KV5A 1W56A 2ZA2A 3CL7A 1LG2A 4XBKA 4HN8A 4WSKA 1CXHA 1XR2A 3C61A 4GQBA 1J5SA 1R7AA 3P93A 1KM1A 1UKPA 2H8ZA 4XAPA 2NQJA 2BVTA 1RPXA 2PTZA 4ZSTA 2FDMA 4ACYA 3GIYA 2VFGA 2ZBTA 1S5MA 2PRMA 3WMCA 5J5RA 3CMJA 3BV7A 3CWHA 3MB9A 1A4MA 1M41A 3MMTA 1W1A1 1AMKA 1UKTA 2ZTJA 3GDBA 3FK4A 3HG3A 5D2TA 1PYMA 3GG1A 4F40A 4K68A 1GVIA 4WRHA 3H4GA 4ZFMA 3LLFA 2R1LA 3VDCA 3WUBA 5IBXC 3HJZA 1FRBA 1PBGA 2X8RA 2NVDA 1QBBA 1IT0A 3V1PA 3CK5A 3ARPA 4AF0A 3MI2A 4AIEA 3WH7A 4V27A 3NM3A 3MKVA 1BVWA 4MKNA 3V75A 4H9MA 5JQ9A 3CIWA 3T44A 4TUFA 4J35A 2P8CA 3ZR5A 3T0DA 3UD6A 1EUAA 1JFXA 1P7TB 1RUSA 3AWOA 3CUHA 4FLOA 3ZM8A 2AAAA 4NRRA 3GIPA 4P5UA 4WDTA 5G4HC 2ABAA 3AS1A 1PX3A 1Y5WA 2ZZ6A 4UTLA 3SUUA 4D6FA 3I6RA 3N3TA 4YCPA 1QHPA 1CGUA 1RQEA 4K36A 1OC7A 3UT0A 3QFWA 2VRQA 1E0VA 4I8DA 2V38A 4O50A 5I07A 4Q4SA 4JBRA 3MV01 2XYLA 4B9ZA 3PJTA 4OOUA 5CPOA 2ANUA 6XIMA 2NWRA 3W7JA 4NL1A 1FCBA 4PCSA 4UCFA 3PAJA 2REQB 4FX6M 3TA9A 3UXDA 4H7ZA 3ES7A 4QIUA 3GZAA 4ZQNA 3N2MA 1ISXA 3GD6A 3R0KA 3K2GA 2E4TA 5HMEA 2BY3A 2P3EA 2FJKA 3EDKA 1O60A 3HGOA 3SFKA 3WDPP 1GORA 1TSIA 4JN7A 4QJ5B 4Q8TA 3EWWA 5LGXA 2VO5A 1B30A 2WMIB 3D3FA 4UQEA 1S39A 3VNJA 1A5BA 4LTSA 1T0OA 3TFXA 2D0FA 1RD5A 3O16A 1V7YA 1XW8A 4C7GA 2ON3A 3H21A 1SO6A 3R13A 3FA3A 4GKLA 1V6VA 2NUWA 4LUTA 2E6DA 4KGJA 4YLWA 4XKYA 2CWNA 3W25A 3FYPA 4GGBA 4QCEA 4Z2LA 3EA1A 1YNQA 4Z0SA 1XP3A 4YIWA 1EF2A 3QZ6A 2Y89A 2CZ5A 1A5CA 3W7GA 2LLEA 1BSIA 4WKAA 2CWXA 4WDXA 1GW1A 2D20A 3CPGA 2NV9A 2POZA 3PB0A 4W87A 2YR1A 1US2A 4AEFA 3CASA 1VBRA 5L6UA 3G1VA 2RHGA 3K8KA 5IFTA 3W7EA 1F9CA 1CGVA 1HNYA 2GLKA 1FWGC 3WBYA 1GOQA 3QMTA 4LAKA 4U2ZA 2C7FA 5CSUA 2A3BA 3F2CA 4NXSA 4RDYA 2W27A 1M65A 1BXNA 4ZO6A 1BF2A 3CU2A 4O1CA 2G8ZA 4HZMA 2EG7A 4KFOA 3PUDA 5FAJA 4QG8A 1R3RA 3ONCA 4B3KA 4IH3A 4XUGA 3M5YA 5K2ZA 3EXRA 3WD0A 3UJ2A 4CQDA 5CSYA 4EXAA 3MMWA 5DT7A 2AOSA 3OGRA 1G9HA 2EQDA 3TA6A 4LAUA 3FCPA 5HQLA 3LYEA 1OWQA 3IIZA 1F05A 4NY2A 2OX1A 1QPOA 4PFHA 4ZCWA 1NARA 5HPCA 2A6LA 3U6WA 3H2EA 3VDHA 3IJDA 3I7RA 1Q8AA 5CPSA 3HGRA 1JRBA 2EKGA 4F2TA 3L4YA 1NWUA 5I23A 3GWQA 1K1DA 1LDCA 2XVLA 1FWBC 3M0KA 3WEOA 1FXPA 4FIQA 4KFNA 3FSUA 1LUCB 1FDYA 5HDRA 4O17A 1TMHA 1XHGA 5F1VA 3EKLA 4AG0A 4IQJA 4GISA 3C56A 6CGTA 4US6A 1RZMA 2VR5A 5AHEA 4NYUA 3PJUA 3WD3A 4GOAA 1XYLA 3KVJA 4LC6A 3QF0A 4Q6JA 4QISA 4IFOA 4U10A 3I3BA 4ZB5A 1DTNA 5M1TA 2INFA 2F7FA 1TPB1 2DSZA 2E9BA 1NDWA 2UY5A 4BCEA 1VJIA 1A53A 1C9DA 3N17A 4TX9A 4U28A 5ECUA 4Y2WA 1TQJA 1FH8A 2F6XA 1SVDA 4CQ8A 4XIMA 3SCVA 1XM3A 2V5LA 3MJMA 3GDMA 1CXFA 4XIAA 4GINA 5D03A 1KM4A 1L6WA 2WJDA 4JQ2A 3PM6A 1H2JA 1VFLA 3THUA 4DN1A 2ALRA 2CLMA 4LYPA 1XYMA 1H7PA 5TBOA 4GIYA 2XUCA 1G4EA 4MY9A 4NHVA 2Y8KA 4QLJA 4IJBA 3DFNA 3ABOA 1WXYA 2WZTA 2WSYA 1XRVA 3VFCA 1EIXA 4N42A 5D9MA 4C6QA 1QJWA 2JKEA 1XYZA 2D0GA 4C6EA 4OHQA 2V68A 3QLLA 1CECA 1E4NA 4Z1DA 5LNSA 4QJ3B 3DFYA 4G7EB 4IPLA 2QHAA 3Q2DA 1SFSA 5HR6A 5A95A 1RK5A 3WJXA 3K13A 3WK2A 3GBDA 5HA7A 4LGXA 4I90A 3NO1A 1Q6LA 4W8BA 3OIHA 5EFFA 3IIXA 4BK9A 1XIIA 4H7CA 4C6BA 1EEPA 2VCAA 1OX4B 3LV5A 3MS8A 4M0XA 3JW7A 4H6RA 2OT1A 4UZSA 2Y5JA 4ICNA 3S6DA 3CO4A 2V67A 1IZKA 3WQOA 3MDUA 3KBWA 3WLLA 5J04A 3GNDA 1HF6A 1UJPA 2YXOA 1KM6A 4BR1A 3THCA 1I2OA 1W9DM 3APTA 3M0ZA 4GG9A 1ALDA 2Y6ZA 4W5ZA 5LSMA 1J12A 1UIOA 3SM0A 1WCGA 1CLKA 1EYWA 4GH3A 5FEWA 1VCVA 2IXVA 1VD6A 2VVSA 3CZKA 3W9ZA 4H2HA 4KGLA 3DAQA 5AHFA 4LF2A 1UA3A 4B90A 3PY2A 3T8LA 3FGCB 5KINA 1ITXA 4UWMA 4KIEA 4UTKA 1HJSA 3SCNA 1PTGA 1TTQA 4CGTA 2QXWA 2ISVA 2R1PA 4IG2A 1W32A 4LUSA 4HU3A 4EPKA 1OT1A 5DELA 1E6SM 3PBGA 5H2ZA 2Z4GA 1ZL1A 3BAIA 3B8SA 1RP9A 4B4HA 2XGZA 3P61A 3NXFA 2HVNA 3CWNA 1C9WA 4IX2A 3BH4A 3PANA 1HKMA 1ZBCA 2DIKA 4C6KA 2ZE0A 2X40A 3GC5A 4QJ1A 1W37A 5A3HA 4ORMA 2EJAA 2OXNA 4KETA 1UR9A 4CNUA 2OKTA 1VPXA 1IXOA 1MQPA 4YWIA 3V0SA 5HK4A 5CC3A 4P8UA 1UCWA 2PDFA 1WKFA 5GPRA 2NV1A 4M80A 3TCEA 3NZRA 4P8VA 3AYSA 3TYEA 4R3UA 3NDYA 4N9BA 4MG4A 1GVRA 1N2VA 3HZ3A 3SSZA 2JGYA 4OQVA 1H41A 1B3VA 2G3MA 1P48A 2G3FA 3EWCA 3ZWSA 4QQ3A 3L5LA 4RKAA 4ADTA 3BMXA 4L6DA 1DJXA 1HX0A 1FHDA 1YLVA 4LCQA 3N4AA 1FWCC 5CJNA 3TW6A 1QXLA 3PFRA 5AYXA 3WQ6A 5J8LA 5A6BD 5A6AA 1KXVA 1QI2A 4HNVA 4GJIA 2E3ZA 1LOQA 5GJMA 1WDDA 3GUGA 3VIGA 2GGIA 2WBGA 3A64A 2YYTA 1Q65A 4UMAA 5AC5A 1JULA 1DP0A 3E02A 5D8ZA 3NO5A 4Z1CA 1JZ4A 5CJ5A 1PZ3A 1CXEA 1G7VA 4GYPC 2FGLA 4X9YA 4I7UA 2VUNA 1ZFJA 3AWNA 1THFD 3UPMA 2AQOA 4EVZA 1PDYA 1J11A 2QULA 3B4UA 2E9MA 5DRCA 3ZJ8A 3ZLHA 3LPGA 5G2HA 2PTDA 5TQLA 7XIMA 4IMAA 2YCJA 3W07A 4XKMA 1PUDA 1EPXA 2YW3A 4FAMA 5DMNA 1VFSA 4IJRA 4N9DA 1XBVA 1ZP4A 2CHNA 2YOCA 4HBKA 3W7MA 5FJJA 4A8NA 5I5RA 4GRSA 4IFKA 3UWEA 1R6WA 1BQCA 1DQUA 1IQ8A 5LNWA 3G8RA 4FNQA 2I57A 2DPEA 2VZUA 2XN0A 1TMQA 3FXYA 3B0VC 3S47A 4M29A 2BB0A 3L9CA 1JYXA 4G9PA 1JFHA 2W3ZA 1JNEA 2XZ7A 4MPKA 4ORIA 3H2OA 3LCGA 2ZKMX 3N18A 3P60A 4E3VA 4GXPA 4GMEA 3B40A 2L5HA 4HPXA 5HNUA 3RCNA 3VE9A 3AU2A 1QCWA 2OLHA 3B03A 1V4YA 3BMWA 3CV7A 1O1ZA 3W2KA 3F5LA 1Z9AA 3GSMA 3NZQA 3G5EA 2INEA 4O54A 4ERIA 3OIXA 1QOXA 3DG6A 4K6AA 4PTMA 1H5VA 5DY3A 4DO6A 3HV9A 3UNTA 1MUCA 3FKKA 1HL9A 2ABBA 3CQ0A 2WK2A 4ZMGA 1Y0EA 4MOZA 1LWJA 3LCWA 4C6DA 3WDJA 4PTDA 1XUUA 4REQB 1TWSA 2Z1XA 3S9YA 2UWFA 4HMCA 4M24A 2QMJA 3ENLA 3WMSA 4FI4A 3TONA 1FBAA 3M5ZA 1XD0A 3ZJ7A 3PZOA 3PK7A 3I6EA 2OGYA 3CAVA 3TSMA 4NU7A 1IE7C 1QI5A 4AYSA 1ESWA 2VZVA 1KXQA 4S1FA 4ZBCA 4DJEA 3GY1A 3NGFA 1MXDA 2QNEA 2ZUVA 3B8WA 3IEBA 2GJPA 2ZRVA 1UKSA 1TTIA 3AIVA 1UC5A 2OTDA 4M5PA 1VHNA 4CN1A 4GY7A 4AC7C 3L2IA 5EY5A 4W88A 3N3MA 3W7RA 3GXTA 1BTMA 4O53A 2BY0A 3MUZ1 2JIEA 8CGTA 3CC1A 3KTSA 3URBA 3SGGA 3BLEA 3DYPA 3F4VA 5G1YA 3CZEA 3OVQA 3ZVHA 1WKYA 2EPKX 5CGQA 2VX5A 2NSXA 4GBDA 3VNMA 1EJXC 3ZR4A 2YYUA 4PMYA 1H1NA 1KBJA 3S6OA 6PTDA 3WX7A 3EOOA 4XD4A 4HSOA 3QTGA 4LJ3A 5CAHA 4Q4MA 4NX5A 3I7QA 1TZZA 1VCGA 3TSDA 1M7OA 1BWKA 2ESCA 4UTMA 3URQA 4WGHA 2BXVA 3ZS4A 4TU1A 3O15A 3LRMA 3N14A 3TMLA 1PCWA 2XG9A 1E4IA 2VD8A 3HPFA 1B1YA 2V3FA 1U33A 5RUBA 3H6OA 1HL8A 3EWXA 5TAOA 3UXKA 2X05A 4XAGA 3WD4A 2X1IA 2Z1VA 1G94A 1E3ZA 5MHBA 4B5SA 3PTDA 3RM8A 4AUBA 4OOZA 3OQEA 3AICA 4IPPA 4CU7A 3P14A 5I3FA 1V0NA 2WVSA 2DZAA 1J93A 1JUBA 4BQ2A 5T8GA 1M5WA 2Y0FA 3C5QA 4Q4KA 3MUCA 4LANA 2CPUA 1OX6A 3NQ2A 1O94A 1VB9A 3HO8A 4WEVX 4G56A 3LCIA 3UU0A 4KCWA 3GM8A 4ZA0A 2G4JA 3Q4DA 4K1WA 3DYOA 3N9KA 1GJPA 3E0WA 4PUJA 5MKGB 1F7BA 1SSGA 4W7VA 2Q6ZA 3T2OA 1SW3A 3W72A 3M44A 1B90A 3GRIA 3FVDA 4RE4A 2IUZA 3EWYA 5U4NA 2V82A 3GFXA 4NAFB 3LZ3A 4FLQA 4Q8VA 3TOPA 1K70A 4W7WA 5D33A 1J9YA 3LPOA 4FF7A 2ZRZA 3OB8A 3AS3A 1V3IA 2PWUA 2ZZ7A 2X7VA 3RRXA 2P10A 3QQWA 3BLFA 4JFVA 4W5UA 1LM1A 4INFA 4ZQCA 3WQ5A 1O68A 3PWGA 1XPYA 4QJ4B 2ONEA 5BRQA 4FALA 1K9EA 3CXOA 3L4WA 2AGTA 3P74A 4IMCA 4V1YA 3CUIA 2PU1A 1E0TA 2VWSA 4UTWA 1XRFA 3SAZA 2ZA1A 1TE6A 2VEGA 1VFHA 2G95A 4JHOA 3VNIA 1LRQA 5LIXX 1MQQA 1OBAA 1X98A 4LWWA 2FFCA 3S3GA 2Q02A 3O6YX 1PHQA 1PDZA 4GFSA 3VIPA 4PTXA 3NZGA 3WNNA 4YVPA 3JU2A 2A0NA 1F3TA 4E8DA 3MI3A 3TSBA 1UR4A 3HMJG 4MTVA 1ZENA 1Q7QA 2PP0A 1HL2A 1DOSA 3D3AA 3RXZA 4I9MA 5BOOA 4I5RA 4JDBA 1MO0A 4H19A 1WB0A 2I56A 4FX7A 4XZLX 3WMBA 7PTDA 1VLIA 2C1GA 2ISSA 5EYWA 3ZXWA 1XC4A 4RX0A 4GWEA 4DUVA 2IKGA 3S2CA 3KVMA 3IIOA 4U4MA 8RUCA 4Q8WA 2X0SA 1IF2A 3BSGA 3CZ8A 2E5BA 1OINA 2EG6A 3WQFA 4IF2A 1BAGA 3R11A 2HQAA 1AH4A 1HKJA 3TC6A 1AD1A 2QKFA 4Q22A 4FA3A 3R43A 1J2WA 3WLKX 2HJPA 1GTHA 5A2BA 1RH9A 4GIRA 5FIPA 3E0VA 1TPH1 3QOMA 2PBGA 1OCJA 3WO8A 3S6TA 4O19A 5FCZA 1UBSA 2Q8ZA 4HPHA 1TR9A 3KOZA 5FF7A 1PAMA 4OECA 3FAXA 5CXPA 3QMRA 3HTWA 3LI0A 2DH2A 3OPSA 3I10A 2GK1A 4UFMA 1AMYA 3HMCA 2IW0A 2XM1A 4UQBA 1JXKA 2A4AA 3GR4A 1IR1A 3V5FA 5D09A 2OMAA 2GUUA 3IWPA 4RV3A 4M6QA 1Q63A 5H8PA 2GL5A 4R88A 2V30A 4XK2A 3W7QA 4JNYA 1XIMA 4IPNB 5EMYA 1MDRA 5CAKA 2NWSA 2EAWA 2YFNA 4B5NA 4FMVA 2FVMA 2A7NA 3QPEA 1FWWA 2DUAA 1KXHA 3AOFA 4DZ5A 2FJUB 1J18A 1XIFA 1ME8A 5E09A 4H6QA 4JY9A 3CLMA 4O15A 1WUFA 4OUEA 3EEZA 1NWSA 1S5TA 4R7OA 2W6RA 4QDMA 1BYCA 1QI4A 5A6KA 3CZGA 4PFMA 3B9NA 2G3NA 2QCFA 1OVDA 3SRFA 1Q5MA 4HYWA 3F4WA 1FWDC 1Y65A 3SADA 3QHMA 3WQVA 5LNRA 3AJ7A 4MNMA 4F9JA 2Y7FA 3WLTA 2BXZA 4QEEA 3W75A 1EHNA 3GKAA 1LL7A 4LB3A 2CFFA 1G4PA 4TTGA 1W91A 1VS1A 3NYZA 3UPWA 4PUKA 1A50A 2CLFA 3VC6A 3KX6A 4DUXA 1R3VA 2J9XA 3VNKA 3VIOA 4DYJA 1I2PA 2WNQA 1VHCA 3PNZA 1VC4A 3G1HA 4Z1BA 4PCFA 3RLUA 2QIIA 2QPSA 2ADAA 3A4AA 4D6DA 3KVKA 4E2VA 3BICA 5XIMA 1OFAA 1PHWA 1DORA 4NJJA 1BF6A 2ACUA 3KBMA 1J10A 3L23A 1QT1A 5DBUA 4W8AA 1VZWA 2FZDA 3GXIA 3O1NA 1KKOA 4YU1A 1W8SA 4NNCA 4ZOAA 1F6YA 4AIUA 2FPYA 2C15A 3W38A 2VEMA 3E12A 3IUIA 3WN6A 1YE6A 2V2HA 3CL8A 3DI0A 4JTJA 3POCA 1XIDA 3LNMA 1TV3A 4V2XA 3MO7A 3DFSA 1GPWA 1H50A 2CLOA 4I5XA 3RMEA 1GVOA 3SGUA 2NVAA 1EPVA 3KL3A 1W1ZA 4GY0A 5FI8A 4FNUA 4DJED 1J0KA 3AI0A 3DDMA 3LHWA 4J3ZA 4Q7NA 2ZDRA 1XLFA 2GVJA 2AQVA 4JZ5A 2FPTA 2R82A 3UJEA 1RXOB 4H7VA 3TNOA 2NXIA 3WIJA 3CGTA 3TLQA 2C19A 3GXDA 1PE1A 2PE4A 5JMUA 1I1XA 3HBLA 4PMOA 2XZ9A 1K7EA 1UH4A 4EPEC 1V6YA 3DHUA 3WDRA 1F74A 1YW1A 2QW5A 3WQCA 2TAAA 2ZRYA 1QAPA 3NNTA 3ARYA 1ZJBA 1E6XM 4RE2A 1QW9A 4HMEA 5E6ZA 1V02E 3CBWA 5CH9A 1ZRQA 4R9OA 4YS1A 3OYXA 5KZDA 4DBUA 3V4BA 1SMAA 1JF5A 1K6WA 4ZB2A 3KM8A 3PPCA 3CTLA 1YBQB 1BRLA 5DCEA 1M01A 2O9PA 4B5TA 1TMLA 3AFBA 2AAMA 1GUVA 3M9YA 3V5OA 3QZEA 3T09A 4BQ3A 3IK2A 1CZ1A 3RM9A 4ZFCA 2PZ0A 1G4SA 3KP1A 1BQGA 3MSGA 2E6FA 4J3XA 2WHKA 4IMFA 5KTLA 3TR9A 2IPJA 1GZ1A 2QMKA 4GABA 5EMUA 3GR8A 4MGGA 1W5OA 2J24A 1KFBA 1TZ7A 3GAYA 1GVYA 3LN3A 1QO2A 3BLLA 3IJ6A 1UMYA 1HVXA 1X6LA 4HK5A 4AIBA 1RBLA 4OUIA 3TYDA 1AW5A 4JYDA 1GW9A 1V02A 4DPPA 3LTPA 4J3VA 4R7JA 4QSHA 3SN4A 3UWZA 2ZZ1A 3WQ8A 3T8QA 3DECA 4S3GA 4WSJA 3GG7A 4H83A 5HQMA 4A3RA 2ZZ5A 2NUYA 4EXQA 3ARVA 4KWVA 3TW9A 4I6VA 3S9IA 4ROPA 3VMPA 2OO0A 4D6CA 3VA8A 2VRJA 3M0LA 4D71A 2QUVA 2OKOA 3ITXA 5EKYA 2YXGA 2PC8A 2DT3A 4Q8MA 4HJWA 2X2YA 1GYNA 1OFRA 3FXGA 4IX0A 4KWUA 1IEQA 4PYSA 2PZNA 1A80A 4PEKA 4C6MA 1X39A 3MW7A 1SO3A 2PWGA 5DY2A 3TJ4A 1VBHA 3VAVA 1GJWA 1KFWA 3SCSA 2G50A 4JIHA 4H9XA 1VP5A 3ABSA 2FKPA 3RG6A 3FAWA 4UQDA 3BMVA 1A49A 2HISA 4ACZB 6REQB 5HAOA 2WC4A 4JTUA 1QK0A 3W4RA 2Z1BA 3HB9A 1CIUA 3LK6A 4TQTA 3VC5A 1OCBA 1OHLA 1O4UA 4IMGA 3R89A 5IXEA 3VZXA 3M0XA 3GVRA 3VOHA 3NSXA 2Q71A 1BEUA 2FYMA 1ISYA 4NJHA 4DO5A 2PDBA 2QDHA 4GNVA 4UTIA 4B2DD 4ZQPA 4ADSA 4ECLA 1RLCL 4PRWA 4D72A 3F5JA 4HOZA 1EDTA 4QG9A 4BF9A 1TZ9A 2WANA 3A3WA 4HA4A 4DBEA 1H7OA 1XFBA 3T2QA 2R6OA 4S3JA 1S2CA 1U30A 2WZHA 1Y5XA 1NEYA 2R1MA 1FFQA 1BG9A 2ALDA 1H4PA 3JZUA 1KTBA 4Q33A 1FOBA 1FUYA 5GQBA 4FF5A 1W8GA 3LENA 5BWFA 4IIEA 3CB3A 5LNUA 3IUHA 5LYRA 1VRXA 4U3AA 1IEIA 3GXFA 1AJZA 4L6HA 2WKJA 1O5RA 4NJGA 1JAEA 3KLKA 2FGZA 4KWSA 4UTFA 5JXQA 4B5UA 2VHLA 1VIZA 1V6TA 4ZE5A 1AQHA 3FJ4A 4IL0A 1UYQA 1QW8A 3XIMA 4EWJA 5KETA 1B3ZA 1DWAM 3PZVA 5T91A 5A8NA 3II1A 4GQ0A 2DGAA 3V3WA 4JEJA 3L67A 3GYEA 3TIMA 3BC9A 3SIZA 2YCLB 1IIHA 4GIAA 4H9ZA 2WLZA 5TF0A 5L9FA 2PDNA 3M47A 2O7SA 2XPKA 3PC0A 4NUWA 3LSCA 4PBFA 3W88A 3RPTA 5CEWA 4YL2A 1HN1A 1T5AA 2WOQA 3PUEA 4Q8PA 4XTIA 4F0SA 5H6HA 5HR7A 1GONA 1DJZA 3KBSA 3U2EA 3S0CA 3SIMA 2NV2A 4NZ1A 1Q66A 4HU4A 4Z0JA 1F4AA 4M8UA 5DCDA 4OU1A 4N2YA 1BFNA 3IAPA 1OYAA 1JEZA 2C16A 2YX0A 4MJ4A 2OCZA 2NQHA 2Z2BA 3DC0A 2OSXA 1KBIA 3KHJA 1WKEA 3WDQA 1W5QA 4ADUA 5BMWA 4MWAC 1Z42A 1TPFA 2PTWA 3O63A 3IGHX 1NFPA 2G41A 5PTDA 1VKFA 4MF4A 1K8XA 3SGZA 1YX1A 4OBRA 1CXKA 4O1DA 5H91A 1AQ0A 4I9JA 4ZXLA 2GSEA 3SUTA 4GA8A 3NPVA 4XB3A 2XIOA 5XIAA 2VZSA 2PDKA 3TTEA 1E0WA 4R9XA 3NQMA 1YKWA 2E5CA 2J4GA 1NWTA 1OIMA 4RDVA 2CKRA 1B9BA 4OV9A 2OLAA 4JGDA 4XSLA 2WMIA 4RK8A 4J5NA 4IISA 3GVQA 4AXKA 3N6QA 4CQCA 4MB5A 3KWSA 3CZLA 1OZMA 4H8HA 5K4XA 4BA0A 2VCCA 3UY8A 3N25A 1YQ2A 4JTIA 2OGJA 3WK3A 2VGBA 3KBVA 3LU2A 3NQVA 1VBUA 4JFSA 2ZX9A 2ZXDA 3ZR6A 1MWOA 4JKLA 4IMEA 2PD5A 1F3EA 1I2RA 3UERA 3BCDA 1OYBA 3N11A 5I79A 3UWYA 2F6UA 5I77A 5DT5A 1PKNA 3O6CA 1RPKA 4QE1A 3BV4A 1BXBA 2Q8LA 3HPAA 1JDFA 1HJVA 2G96A 5FF2A 1KC7A 4DWSC 2QEZA 4E6MA 1JR1A 2R1NA 3GVGA 4ZOCA 4NQ1A 4MUPA 4IP5A 5IOBA 1ICSA 2HE8A 1RY0A 1FDJA 2Y70A 5E9AA 1W5MA 3TYBA 3VD9A 3A3XA 3RO6A 4GUFA 4U5IA 1EJTC 1XH0A 3LBOA 4CCCA 5HJXA 2WCAA 3KRBA 2RDUA 3SEPA 1TPUA 3UBPC 1MQRA 2CXGA 3NQ8A 2ZXAA 1EIBA 2VDIA 4EPDC 3PWIA 4NAEA 4JAWA 5ENLA 3UP8A 1OGGA 1XWYA 2DT1A 4J1OA 1KR1A 4UQ9A 1PV8A 3S83A 4UTJA 3EMCA 4JL2A 4ICCX 1ZHAA 2HEJA 4J40A 4LVFA 1MDLA 1U1JA 3LX9A 2R9RA 1E9ZB 3L2MA 3ZOAA 2ISDA 4AZ7A 4HK7A 4DJFA 4KEVA 3VDGA 2CITA 5C7HA 2R14A 2OJPA 3PWAA 3DFPA 1NIUA 4YHEA 3PG8A 1DJWA 1H63A 1TREA 3CAQA 1QDSA 1RAKA 3P62A 2IKIA 1VQTA 1T8XA 4S2CA 2EPMX 1V0KA 2G97A 3W1NA 2CEQA 1LUCA 1E9LA 4HA3A 1B3XA 4GUJA 2OZ0A 2GVLA 4EXBA 4PZVA 4F79A 4H01A 2DV0A 4DWSB 2Q01A 7A3HA 2QJNA 3MPGA 1BYBA 4AY7A 2EG8A 2XU2A 4N6EA 1GHSA 4NXKA 1OC6A 1OJXA 1KV8A 3M5VA 2J6XA 5DEZA 1DHKA 4Y9AA 4GACA 3P5ZA 4X3ZA 4MADA 3ERPA 3KZPA 3MT1A 2E0PA 4O0QA 3AHYA 4KMQA 3AIRA 1LP6A 3S2LA 3GTNA 5AFDA 4UR7A 2EO7A 4LUJA 1OCQA 2Y62A 4R7WA 1DXFA 4A8IA 1Q6OA 2OOFA 1XIHA 3LQGA 3V35A 3EEGA 3GLCA 3EB2A 3AYRA 1FP8A 4IP4A 1Z89A 2PF8A 3K8LA 3TYAA 3WUGA 3RLGA 1E0XA 4GI9A 2BOFX 4JNMA 1QNQA 1O95A 7CGTA 3IVSA 4L1XA 5HNTA 5AYBA 1UR1A 1YYAA 3TX9A 3CMGA 2DZTA 3TXVA 3REQB 4XAYA 2TRSA 3HG2A 6ENLA 2PDMA 4E38A 4J3UA 4UXDA 2QT3A 2AGKA 4JR5A 2FDSA 3HM7A 4NVTA 3W3OA 3IK4A 1TB3A 1EJ7L 1MW1A 4YTRA 4H8VA 2NVCA 4G7EA 3QPZA 2RKXA 1KFKA 1VLWA 1J79A 3T6CA 4YN5A 1R3WA 1SJBA 1WXZA 3N2XA 1GOMA 3TP4A 2NX1A 1EXPA 1UD6A 4HPNA 1NVMA 3P82A 4RLIA 1W1PA 1RQHA 1W3TA 2DZPA 1A5AA 1OX4A 2OSYA 3AZSA 3QY6A 2G3JA 1GGOA 1DQXA 4JIIX 3WNKA 3G8EA 4EF9A 2AKMA 1H3GA 4IUGA 1NOUA 4N02A 3SQMA 3KZSA 3R0UA 4Y90A 2Z2AA 1K03A 4BFAA 5IDIA 4QE5A 2YCKX 4Y7EA 4Q7IA 1HVQA 4L6OA 3W27A 2XM2A 3B04A 3MSRA 5H1WA 2NZLA 4PH6A 4UMCA 2R91A 1H7WA 1WZMA 2YXXA 1WNOA 1IXPA 2GVGA 3VX1A 1CENA 3WSUA 4IICA 4S38A 4O10A 2FHCA 3FGCA 2JF7A 3RR1A 2JE8A 1I45A 3UWVA 5JH1A 4I3GA 4LY4A 1R2TA 4MUZA 3W73A 3NL6A 5GJPA 4ZEPA 1B4EA 4L80A 4W86A 3F7JA 5E9XA 1E4LA 5H8MA 2B7PA 5CLWA 3MBFA 3VGBA 1TA3B 1US0A 4WXZA 2FVKA 1Q4WA 1EOKA 1K8YA 3Q45A 1Q7ZA 3MWAA 2GUBA 4YNGA 2W79A 2HMCA 1P6WA 1EQPA 3S5YA 3CM4A 4Z08A 3RMJA 4AZ5A 1PKLA 1A5UA 5F2LA 4NI3A 1TV4A 2OEKA 3S1WA 1GYLA 4YJ5A 3A4WA 3T1GA 2CLEA 4MSSA 5HMSA 3CV1A 3GB6A 3VDBA 3SN1A 1NDVA 3P3BA 4FOJA 3TR2A 3A3HA 2HS8A 1CX9A 5DN1A 2QCEA 3WD2A 1JIBA 3DKJA 4O14A 2B0MA 3DHPA 4M3PA 4O57A 1TG7A 1Q3NA 3AHTA 1QMLA 3T2PA 3WJSA 3NQ6A 2BGQA 3GYCA 4DUOA 4R53A 1L6SA 1CXIA 4UNKA 2Z29A 3CAWA 2J7BA 2XDFA 3S9ZA 1GJUA 4MM1A 5D9OA 3QC0A 1EP3A 1QK2A 2ATSA 2WMJA 3B97A 4ICMA 3A13A 3GNOA 1TWWA 2NLIA 4LH8A 3A5VA 4GI8A 1XQLA 3A12A 1DPMA 3SY5A 2RH9A 1ZCCA 4W9TA 3EDJA 1NELA 1XLLA 4A21A 3VZYA 3LA4A 3S1VA 1MNZA 1KRMA 3K1DA 5TIMA 1J96A 3FJLA 3CHDA 2VFEA 1GQKA 4Z17A 2BOEX 2ZE3A 3FY1A 2PPGA 2QGHA 3AYVA 4M6VA 4TX6A 2ZRXA 1JGMA 1E1CB 1EP2A 3EOLA 2Y7DA 3SCUA 4JHMA 4LS1A 1L2QA 4ILSA 2OU4A 1UROA 1C3FA 4G6CA 4XAFA 2CESA 3M1ZA 3BXWA 5GNZA 2PWFA 1XUZA 3MC5A 3S8HA 2J7EA 1WA3A 2ISWA 4K2SA 3VIKA 4GC3A 2WNNA 4GX9A 3DG3A 3VX0A 4AWSA 3U8GA 4QEHA 4LAMA 3UW6A 3MBDA 3M64A 5KZ6A 3W23A 3A22A 3CEPA 4PCTA 4AMCA 1OEPA 1R3TA 3W7LA 2AQWA 2PDLA 3IUDA 3HQPA 4JPGA 3MHGA 3UG8A 2VOMA 1H61A 1GQLA 2QS8A 1M04A 3G0XA 3EOSA 3QV8A 4DF2A 4UFHA 3TWBA 1FWHC 1HIZA 4WHBA 4ZZ9A 1TTJA 4DAIA 1K6AA 6XIAA 1MEHA 1G7UA 5D32A 3CH9A 2BG5A 4BEQA 3L4XA 3R8RA 3W22A 3WLMA 3E2QA 5C7VA 4PMXA 3RUBL 2PWVA 1BYAA 4J2MA 3PR2A 3AYTA 1SO4A 4QHRA 3P80A 2PA6A 4OIFA 2VFFA 4WJXA 4PODA 4KF1A 1TQXA 3U4AA 1CEOA 3NPUA 3S5SA 5BMXA 3ITCA 4CD4A 4OKDA 1WKDA 4WR3A 1DIDA 5LA1A 2GQ3A 4Y8FA 4W93A 1E40A 4REQA 1H7RA 3BW4A 3S5NA 2PDUA 3WEZA 2VJXA 1KM5A 1R8LA 2OEJA 5ABFB 2Z26A 4FB7A 4CN6A 4EE9A 5D30A 3GDLA 2YW4A 4G7FA 5AOUA 1K9FA 4Q6XA 2XIIA 3JUGA 4K8EA 1TE1A 1F8MA 4ASTA 4Q32A 1E72M 3STGA 1DBTA 3EX1A 1O1HA 5FD0A 3F4CA 4DJFD 4PMQA 3WQ4A 5K7JA 3KLLA 5I3DA 4GVHA 3A5FA 4LFYA 9XIMA 2QCCA 4X61A 2EPNA 3SUWA 2X09A 4MZYA 4WY0F 1N55A 1UIPA 3NL2A 1HP4A 2PDGA 3WFZA 1CXLA 1OK4A 3I7SA 1UHVA 2MANA 2CLLA 3C2OA 4Y8EA 3VKAA 3CUJA 2C91A 4ZQMA 3RPDA 1S46A 1NFBA 1ML1A 3T4CA 1JYVA 4RPPA 2WVVB 4CCEA 1X97A 3GH4A 2CLIA 1T6MA 4D1IA 2W63A 2J8TA 5BZAA 4J2PA 4GJJA 4WJ8A 2QZRA 1ZPTA 2XN2A 5FF0A 2PDWA 1BVZA 3DKLA 3M0JA 3W1MA 1R9YA 1H51A 3PZNA 5GNYA 2C71A 5LHEA 3GU2A 4C1NB 1TIMA 3LTSA 3M7WA 2ZX5A 1ITUA 3TUUA 1MZRA 1QNRA 1B4KA 4CCDA 5LKYA 4YHGA 1EEXA 2ZYFA 1IEXA 4XZIA 4PN2A 4ZOBA 3H54A 4ATWA 3WK0A 4L9ZA 2X1UA 3C2EA 4GPNA 4M7TA 5G1MA 3VNZA 2R24A 3CHEA 3G6LA 4LS2A 3FEMA 4FXFA 4NT0A 1OYCA 3R8HA 5BXPA 2XVNA 4B15A 1VF8A 4KWOA 1REQA 3H2FA 2VC7A 2VR2A 5C2CA 2Z1KA 3HFYA 4NAFA 3UR8A 4GJ1A 2A3CA 1P0BA 4E3TA 7ODCA 2ZUMA 4JTEA 3AMKA 4TX8A 5BYWA 1KQYA 4ALDA 3ZT7A 2J78A 4KESA 1Z8AA 1LRNA 2GOUA 4M19A 2ZZ4A 1G1YA 1O7AA 1YTEA 2OG9A 5D9PA 1MZHA 1IZCA 4MJZA 3MQTA 4LPCA 3BQ5A 3OGVA 4A29A 2ZX8A 3T81A 1E55A 1F3XA 2ZX6A 5AVNA 3RU8X 3AIEA 2J62A 1FXQA 1KGWA 1VH7A 4EPBC 4XQ6A 3HQOA 1IT8A 2I5QA 4A3UA 2DZUA 8XIAA 2DW6A 1UR0A 5A6JA 2J9YA 3ARRA 4U2YA 5D2YA 4HCLA 2DZVA 1W3KA 2DT2A 4RW5A 3UCCA 4W4QA 4QROA 1W3IA 4DQWA 2QDEA 1E6PA 4PB5A 4D6HA 1CDGA 2CYGA 3N4FA 1XGEA 4ZOEA 1I6NA 3FEQA 1OFPA 1S2UA 3GTIA 2QR6A 4CNNA 4OWGA 2P76A 5CPMA 3FV9A 4EOUA 1CYGA 1RJPA 3MUY1 3OJGA 3TK7A 1TRIA 3WLHA 2TPSA 2Y61A 4G5DA 2W91A 2Y1HA 3AMCA 4Q8QA 3EKGA 4ONVA 1YMYA 4UCGA 1OFOA 3ABZA 1Q6DA 4GVFA 4XKYB 4LUYA 2QYGA 1QATA 3VKDA 3AIQA 3I68A 3XISA 1S3TC 5FSEC 3SCTA 5CG7A 2O9OA 1FHVA 3TTYA 2ZUWA 1JZ3A 5DLCA 5A6MA 2BP1A 4C6CA 3LUTA 3L68A 4NZ5A 1JUKA 2H9AB 3E38A 5CGTA 1R7OA 4F48A 3F03K 2E8ZA 1E5NA 1ELSA 4GNJA 5I02A 2WO5A 2J7HA 3VZZA 1POKA 8A3HA 3GVVA 4A3YA 4AIOA 4YXGA 3DGBA 1XLMA 1BLIA 4HTBA 3ZVIA 2Q09A 3VMOA 2QGYA 1LLZA 1S2VA 2OZ3A 3U2CA 4A6GA 1N8FA 4KT2A 1NF7A 2ZRUA 3CQJA 1XG3A 3GG0A 3C0JA 1PIGA 2VNCA 1GOWA 1KD0A 3G6MA 1KTNA 2GSHA 1ENUA 4UOQA 3U3HA 4L5ZA 3WDIA 5HJLA 1JDAA 2OWCA 4M1RA 4UTTA 2ZZ2A 3HG4A 5CGMA 1DE6A 2CZFA 4N0RA 3A9IA 3PBUA 2EBNA 1HJUA 1YPIA 2OB3A 3BAXA 1FCUA 1HUVA 3GU1A 1TJ0A 1V6UA 2HPIA 2WCGA 4P7RA 4E2BA 1E9YB 2WB5A 4HNNA 4L64A 1D3GA 1L2UA 5HULA 5CC7A 1DL3A 1GOXA 4AD3A 3TOYA 1A0DA 4Y6GA 4AYGA 4XBJA 2Y4SA 1X1NA 3PBYA 5FAGA 1X1OA 3UGRA 2PGFA 3OLGA 1D7KA 3GO2A 2UY2A 2A2IA 4JTAA 1SFLA 2CCRA 1W31A 2D24A 4H9VA 1ZAHA 2CLKA 4Q4RA 3W6YA 5CZTA 5XINA 3LCFA 3W71A 4G2DA 5I6SA 3H2MA 4XZBA 3T9PA 4E2DA 4JKMA 3GVWA 4LVGA 5AHIA 4CEUC 4YWSA 3PZUA 5CBIA 1EYEA 3PS7A 3CNYA 3UZZA 5I3GA 1P6BA 2XH7A 3PZIA 2A3AA 4D6JA 3DERA 3FKRA 2C3ZA 3VIFA 1G01A 1W3HA 4GZIA 3FHAA 4ZL1A 3BUVA 1TCMA 4GGHA 2D23A 1ZAIA 1V0MA 3CB8A 4LC8A 1S5WA 1N8IA 2SFPA 2H3DA 1OSEA 3TAOA 1GOKA 4CD5A 4BZYA 1WZAA 4LRSA 3USBA 3F4NA 3OG3A 6TIMA 1V08A 2HXUA 1HP5A 1D9EA 5C6MA 3SECA 1NJJA 4H8NA 3DFTA 4CNSA 3G1SA 4L4MA 4I9AA 3EX2A 1P5BA 3NSNA 4AD4A 4LNYA 5C9XA 3PF3A 4QG6A 1UD5A 1JYNA 1SZEA 1AZ2A 2GSJA 3H22A 3OHMB 1DIEA 1TPWA 2GJXB 2Q3RA 1XDLA 1HZYA 2O9TA 4IIHA 1EGMA 1RD6A 4HZ8A 4QS5A 3LHUA 3M41A 1HKWA 4S39A 3GNXA 4GYKA 3AO0A 4FOKA 3UXIA 3HF3A 2V5DA 3C8NA 5U7SA 4N7QA 4EP8C 1VYSX 1J0HA 1SU5A 2BHZA