4RDYA

Crystal structure of vmolac bound to 3-oxo-c10 ahl
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
312
Chain Sequence
VRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
molecule tags Hydrolase
molecule keywords Parathion hydrolase
total genus 124
structure length 312
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4rdyA00
4GX9A 4AQLA 1R9ZA 1NDYA 1IE7C 2HBVA 3E74A 4GK8A 1FKWA 4QRNA 3OVGA 3QY6A 1V79A 3UBPC 3WMLA 2EG6A 3F4CA 1ONXA 4C6MA 4KF1A 3FEQA 1RJQA 2HNHA 4UBPC 2QS8A 1EJSC 4LH8A 3LA4A 1FWJC 1R9XA 4DI8A 2R1PA 5G4HC 4Z42C 1M68A 1KRMA 2FFIA 4L9XA 4CEXC 1XGEA 3K5XA 2G3FA 5HMDA 2UZ9A 4C6FA 4ERGA 4IFKB 2HPIA 4H9YA 2WJEA 1V4YA 1POJA 4GOAA 4I6KA 4L6DA 4C6CA 4INFA 4NI8A 1HZYA 4IH3A 2Z7GA 3E0FA 1RJRA 3IARA 1EYWA 1PB0A 2XIOA 1FWCC 2R1KA 1EJTC 4IF2A 2YB1A 3F4DA 4V1YA 1J6OA 2O4QA 2YB4A 4J35A 2D2JA 2R1LA 3DC8A 4C6KA 1UBPC 1V51A 1JGMA 4F0LA 2Z28A 3IJ6A 3A3WA 3RYSA 3GRIA 4WHBA 2W9MA 3RHGA 2HBXA 2F6KA 3MSRA 1EF2A 4B3ZA 3IPWA 1A5OC 3URAA 2R1NA 3S4TA 1P6CA 4QS5A 4LAOA 4C6NA 4DZHA 4ZSTA 1UMLA 4E3TA 3T1GA 1RAKA 2YXOA 4BJHA 4XD5A 4D8LA 4QSFA 1GKRA 3A4JA 4V1XA 3WYZA 4HJWA 1EZ2A 4GBDA 3AU2A 3IGHX 3E2VA 2WM1A 1E9ZB 4R7WA 5A6TC 2Z27A 2OODA 4IGNA 3PNUA 2DVTA 2I9UA 3OOQA 4XAZA 2O4MA 4NG3A 3CJPA 3LSBA 2BGNE 1WXZA 4DO7A 2PLMA 3GU1A 3F2BA 4H00A 1ITQA 1WXYA 2PGRA 4DLFA 3RN6A 2GOKA 1M7JA 4LFYA 3FDKA 4RDWA 4EPKA 3F2CA 3MVIA 4XAGA 3QY7A 3PANA 4F0RA 1RK5A 3CAKA 4C5ZA 2R1MA 1PSCA 1P1MA 1NDZA 2QPXA 3D6NA 4C5YA 1NDVA 3LY0A 2FVKA 4RDYA 1A5LC 4ZSUA 3ID7A 4KEVA 4PBFA 1FWDC 3TN4A 2Q01A 3SO7A 2A3LA 4H9UA 3AU6A 4H9MA 4LALA 4IG2A 3MDUA 5HMEA 3NEHA 3F2DA 3B0YA 1FWAC 4OFCA 2DVXA 4J5NA 1UIOA 3MJMA 1EJVC 4C6EA 4C6JA 3IRSA 2Z26A 3R0DA 2AQVA 2QT3A 4EPEC 3GTHA 3IV8A 3T81A 3LGDA 3QY8A 1RA0A 4H9VA 4B90A 3OU8A 1YBQA 2Z2BA 4RZBA 1K6WA 4B92A 3OODA 3HTWA 1J79A 4C65A 2VHLA 2Z24A 3NQBA 4GY1A 4YIWA 5CH9A 4XAFA 1XRFA 4EPDC 2QVNA 2I5GA 2Q09A 1YIXA 4PCPA 3URQA 4G7EB 1V7AA 4LCRA 2HQAA 4DI9A 4RE0A 2AQOA 3K4WA 3OJGA 3EGJA 3GTIA 1KRAC 3SFWA 4KERA 4LAMA 1NDWA 1O5RA 3S2MA 4DNMA 3V7PA 4CNSA 1I0DA 3IACA 1QW7A 3PBMA 1K70A 1YNYA 3JZEA 4C6IA 4QTGA 1KCXA 1YRRA 4EPBC 4R88A 4IFOA 2OB3A 3S2NA 3FDGA 4CQCA 5FSEC 2OQLA 4KIRA 4HK7A 2VM8A 4C6BA 1S3TC 1A4MA 1ONWA 3LSCA 2VUNA 3TN6A 1FWEC 1RK6A 2PGFA 4F0SA 3K2GA 4IQJA 2E1WA 2OGJA 4ERAA 4DZIA 1A4LA 3HM7A 3DCPA 1M65A 3GU9A 2VC7A 4XD4A 4XAYA 5AKQA 4IGMA 1ZZMA 1FWFC 4KETA 4BKNA 2FTYA 1DPMA 2DVUA 3KM8A 2CZVA 4C6PA 4XD6A 4G2DA 4CNUA 3WZ0E 4CQBA 3MKVA 3LGGA 2BB0A 3EWCA 4HK6A 3MTWA 4AC7C 5E5CA 4TQTA 2ANUA 2Y1HA 2WJFA 4JOMA 5HMFA 4GZ7A 3GG7A 3GIPA 1A5KC 2OOFA 2Z29A 1FWIC 1EJUC 4KEUA 1QXLA 4RDZA 4C6DA 3ISIX 3GTFA 2ADAA 1VFLA 3T8LA 4H9XA 2P50A 4B91A 2WJDA 3ITCA 3O7UA 3UR5A 3E3HA 4GYFA 4PE8A 2PUZA 3MDWA 4DIAA 2UBPC 1RJPA 2EG7A 3MVTA 4H9ZA 3BE7A 2GZXA 4DYKA 3DUGA 3LU2A 4ERIA 4J2MA 2E25A 3C86A 2ZC1A 3E38A 4PBEA 4WGXA 1POKA 3UF9A 2EG8A 1I0BA 1FWHC 2GWGA 5LXXA 3PAOA 3TNBA 2PAJA 2HPMA 3GU2A 2Z00A 4GX8A 4I6VA 3EWDA 4HA0A 3ICJA 3G77A 3S2JA 4IFRA 1FWGC 1J5SA 3B0XA 1V77A 4EP8C 3A3XA 1K1DA 4DLMA 1KRCC 3S2LA 4ICMA 4IFKA 1YBQB 2Z4GA 2KAUC 3E0LA 2Z2AA 4LEFA 4LCQA 1UIPA 4PCNA 1P6BA 1PTAA 3N2CA 4H01A 4H9TA 2VC5A 4KQNA 4P5UA 4C60A 1RA5A 3O0FA 1O12A 3ORWA 4LANA 1BF6A 1FKXA 1YMYA 4LAKA 1XRTA 4GXWA 5FSDC 4G7EA 1KRBC 4HK5A 2FVMA 2IMRA 3GTXA 3QGKC 3GIQA 3TN3A 1ITUA 2GSEA 2GWNA 4BY3A 4MUPA 1GKPA 1EJWC 3LS9A 4R85A 3AUOA 3LNPA 1ADDA 4RDVA 3HPAA 3TN5A 4GY7A 2P53A 1J6PA 3OQEA 3PNZA 4C6QA 1R9YA 1FWBC 4M51A 2D2HA 4IG2B 4QROA 4KESA 4QS6A 2ICSA 4KEZA 1PO9A 2AMXA 4CNTA 4CEUC 4NP7A 2D2GA 3UR2A 1E9YB 3NURA 3CS2A 4C6OA 3RCMA 2RAGA 3URNA 4C6LA 1A5NC 4CQDA 4GY0A 3URBA 1A5MC 4UB9A 3B40A 2Z25A 3GUWA 3QGAC 4LCSA 3UPMA 1EJXC 4XD3A 1EJRC 3MPGA 1GKQA 2FTWA 4GC3A 1XWYA 1W1IE 4WVXA 1NFGA 2VR2A 2YZ5A
chains in the Genus database with same CATH superfamily
4IIDA 3G3MA 4PZVA 1WO2A 2A7PA 4S3DA 4XBSA 1MXSA 3KEHA 1VFTA 1MXDA 1ONXA 2NVAA 4O13A 1WYIA 4NU7A 4LS1A 3SY1A 3CV1A 3PULA 1TJRA 1V0KA 2YA2A 1XQLA 1H7RA 1B3OA 3CUIA 3IS4A 2XWEA 3TLQA 2ZCGA 3P14A 1XSJA 1ALDA 2R91A 5REQA 1R7AA 3VZZA 2Y5SA 1MW0A 4HA1A 3VGEA 3FNDA 1ZAHA 2XH7A 2O9PA 4RK8A 3WD1A 4ICCX 3KRBA 1TWDA 4C6CA 3LPPA 3UYIA 4US5D 4IMFA 4ZQCA 3DHDA 2JGQA 5ABTA 5CZSA 1AQ0A 4Q4RA 4IF2A 1O66A 1XHGA 2IPJA 5I3GA 2Y0FA 3UG4A 1LQ2A 4XZWA 1N2VA 4UFHA 3QKEA 2ZRUA 1W5PA 3BTNA 5JH1A 1F4HA 2BOFX 1WDPA 1MUMA 3M47A 3CIXA 3IPWA 4LRSA 5BW6A 3RLGA 4QE5A 3RF9A 4QS5A 3WQVA 1UMLA 3WLOA 2CCRA 1Z42A 4I7VA 3R8HA 3PVFA 2V82A 1XXXA 2JEQA 3AU2A 1SR0A 1OINA 2DZUA 3VDBA 5A6TC 1Q7QA 3S1VA 3TC6A 1S46A 3OOQA 5AYYA 3CJPA 5FACA 4HP5A 3PZVA 2JKEA 2QUUA 3VNLA 5DF0A 5E70A 2RGMA 5AN7A 1DV7A 1XI3A 4LRTA 1EC8A 2CU0A 3MKCA 1TTQA 1GQKA 1JZ7A 1OG6A 1DXIA 4JFVA 1H5YA 7CGTA 2FVKA 4RDYA 4DJED 1E72M 3BCJA 3DHFA 3P7YA 4F2UA 4IXHA 5F2GA 1XGZA 3E0VA 4G1NA 5CC6A 3A4XA 3TQKA 4P8WA 1GVEA 1JFHA 1L6FA 2FYMA 2AQVA 1CXKA 4B90A 1AVAA 1H1YA 3CYVA 2P10A 2ZA3A 3W73A 1IXOA 2PI6A 3KCLA 4AF0B 4GY1A 1QHOA 3G22A 3NL5A 2RDTA 3W76A 1E6ZA 4LX4A 5BXPA 5DEZA 1WKFA 2TODA 3KHJA 4PULA 4MB4A 3QH2A 4CKQA 3MO7A 4LAMA 1BVWA 1G5AA 3CTTA 1QHPA 5H8PA 2ASHA 4EPBC 5KZMA 2XZ7A 3TKFA 4WXZA 4RXGA 2E68A 3NQ2A 1O94A 3AMDA 3CASA 3P0XA 1ZP4A 4LC8A 1RK6A 3KRSA 3Q45A 3A24A 3KLKA 5CZJA 2VMFA 2SFPA 3QJAA 2C1HA 1TVNA 3CUXA 3FAWA 3VIIA 1U5HA 1A4LA 4L65A 1ADOA 2XVLA 3TR9A 4WJ8A 3HGJA 2DZVA 4CNUA 3H21A 1NU5A 3CV7A 3XIMA 4ORIA 3AHXA 3WNLA 3GXPA 2FDSA 2BY2A 1XLAA 2QW5A 2BXZA 2E9MA 1L6GA 3SCTA 3ZQ9A 3GIPA 3LTSA 5HQEA 5H2ZA 5HMSA 3A9IA 3RU8X 1AW2A 5LGXA 1X6LA 4ZQPA 3TAOA 4TR9A 2D0FA 2HK0A 4ZA0A 4WKAA 3FKRA 5LGZA 3HPFA 3UPBA 3W22A 3C86A 5MF5A 3BW4A 2X40A 1LJYA 5LXXA 3Q65A 3EA2A 5FL0A 3VMNA 2FKPA 2WZIA 4ONVA 5BCAA 4S3GA 3QR0A 1VBHA 3NA8A 5DMMA 4KCVA 2PURA 4I3GA 3BQ5A 3S2LA 1YBQB 2VZTA 3WK0A 3E0LA 2I5IA 3T2OA 1EHNA 2ON3A 4NZJA 1TFVA 2FIQA 3S6TA 2DW6A 2YL5A 2H90A 1QNOA 1WZMA 4C60A 3NGFA 1R30A 3C2FA 4OUEA 1EUNA 5L9FA 1A5BA 1MUCA 5GNXA 4B5NA 3Q37A 5FOOA 2ZUNA 1I60A 3EDJA 4DJFD 2E77A 1S3HA 3CT7A 3LNPA 5CJMA 3GDLA 1M7PA 1HJWA 4QQUA 4MJ4A 2BG5A 1RV8A 5EKYA 2V5JA 5GJPA 1TQXA 2VFIA 2UY5A 3OVQA 4QROA 3ABOA 4E8DA 5CZ0A 1P4CA 1XYAA 2VEIA 2D2GA 2ZWZA 3UZWA 1IIHA 2RAGA 2PF8A 1AJZA 1R86A 1XLJA 3BG5A 5LNSA 5C70A 1A5MC 2V68A 3GUWA 1J18A 5F4SA 4DRSA 2JQXA 3CHFA 4HGXA 4AZHA 4J3SA 5H6HA 5I24A 2WHKA 3PZ9A 4HPHA 1NEYA 4ML9A 4NYUA 2QPUA 4MIMA 5CAKA 1FKWA 1OC5A 1QOPA 3POCA 2G3IA 1JQVA 3TH6A 3DFPA 1V3HA 3W6LA 2YGYA 3UFYA 4E6MA 1AUSL 3LA4A 1JQXA 4ZQRA 2NV1A 3V0TA 4M3PA 3MMTA 3TMQA 4AMCA 1MEHA 4I5RA 4B5WA 2G3FA 4M1RA 8TIMA 4C6FA 1E71M 1OCNA 2FB2A 4TVUA 1GVIA 1MFUA 5M3WA 2ZRXA 2E8ZA 4UTIA 4PB5A 3QYQA 3WD3A 3PZIA 3EDDA 2OYMA 3PTDA 2J47A 1VRXA 1GVSA 3ZJ8A 4UOJA 5I0DA 1J6OA 4J35A 4C6KA 4HNOA 2X09A 2WMKA 2DW7A 1KLYA 2JIWA 1C7TA 2HBXA 4P61A 3UXKA 1V3IA 2WKGA 1PWLA 1VHCA 1UBSA 4JFWA 3URAA 4IUOA 4DZHA 3QV6A 4AZBA 4IPPA 3G1DA 4ZE4A 4Y7EA 1CXFA 3TYEA 4BJHA 1R6WA 2XH4A 1GCYA 4O1AA 4NZ1A 2B7QA 4IJBA 5K3VA 4Q8VA 4REQA 4WDWA 2QCDA 5AOUA 1E9ZB 3IJ7A 2GVGA 1SW0A 3M0JA 1ZB5A 3BDKA 2ZUTA 4AD3A 1GK8A 4CLMA 4Q8OA 3SCQA 1W1YA 1WKYA 1E4MM 1H51A 2PWHA 3F2BA 1XRSA 3UW6A 1EPXA 2ZRZA 4Y2WA 1MFVA 3KDNA 2X2GA 4FAMA 4DLFA 1ZAJA 3AIBA 1R2TA 3H2NA 3P80A 1CYGA 1DVJA 1IQ8A 2X1TA 5HINA 2DZWA 3DHPA 1AK5A 2ZXAA 2ZZ1A 3PUGA 4IX2A 4UTWA 2FJKA 3VOJA 4QG9A 3BAJA 3MANA 1UJQA 4LWWA 4JR5A 1JDDA 1NDZA 3LPGA 5GJNA 4D6JA 2W92A 3LY0A 8CGTA 4QGCA 4PMXA 2NX1A 4DJEA 4DF0A 4V27A 1W54A 3UJFA 2GDVA 4K39A 3S46A 1NJJA 1ME9A 3KP0A 3EMZA 3DI1A 1S2UA 1FWAC 3WF0A 3OG3A 4HOXA 3WJXA 2JKPA 3O0KA 3SRFA 1SZEA 2XYLA 3VKKA 2OXNA 1V6TA 4TX9A 2W27A 1YXCA 3PFRA 2GSJA 3D0CA 4H9VA 1NVMA 1JZ4A 2Z2BA 1UOKA 1RCXB 4QDMA 2ZWYA 3NQBA 3WIJA 1U1UA 1XRFA 1F3XA 3A3HA 3CZKA 4JIEA 3WBAA 4JFTA 1UWRA 4DM1A 3LENA 1R5YA 3EOEA 2HQAA 3B9OA 2NQ9A 3R10A 2QCEA 3S1XA 3OJGA 3EGJA 3LM7A 4YVVA 1TRDA 4I5UA 4M1BA 1E70M 4U3AA 4KWOA 4QTGA 4DWDA 4G56A 1Z48A 1DTUA 3BAYA 3CZGA 5D30A 3TVAA 1IYXA 2YCLA 2WCAA 5XIMA 4LGXA 4F0SA 4N9EA 3G6LA 2ISSA 2Y7FA 1XJBA 3GNDA 2QEZA 4DZIA 4H7CA 5LYRA 3N04A 3R0UA 4WDTA 3WH8A 2DVUA 4F48A 1OIFA 4C7GA 3H23A 2QJHA 4OQVA 1H49A 1SFTA 3GWQA 2EGZA 3WJZA 3GC5A 2BGQA 2GJLA 1V03A 3ATZA 4AWUA 3F5LA 5IBXC 3OEXA 3NZGA 4FX6M 4Q7BA 4O57A 3BC9A 3GX9A 5E93A 3MI6A 4TV5A 3OO2A 1SPQA 4N9DA 2BVYA 3KZSA 3Q4DA 4B91A 3R1ZA 5E9XA 1L8NA 1RHCA 1JYXA 1KO0A 4WQ6A 4MNMA 3MDWA 4LOCA 3AI0A 1WZAA 3P5ZA 1VFUA 3RXZA 1DJGA 3DUGA 3INPA 1JZ3A 4WGXA 1Q8AA 4ADTA 4YYFA 1UZHA 6CGTA 3S42A 2PWUA 1D9EA 4YCOA 2X16A 4DAIA 3G1SA 2CBJA 5C9ZA 3WJYA 5IRPA 3GY1A 4M5PA 3UQNA 1FWGC 1V77A 1EGZA 2YDRA 1BTMA 3CEPA 1UCWA 1Q7MA 3F5KA 3T08A 6ENLA 1OB0A 5BOFA 3MUCA 3HN3A 1FX6A 3RITA 4LCQA 4W7WA 1OF6A 1NFPA 5I79A 4EK7A 1EOMA 3QV7A 3SN1A 2WQPA 2YBUA 3N2CA 3DBNA 4YTRA 1KCZA 3GZAA 4LANA 4PL1A 5CXPA 3ARZA 1TWWA 3H8AA 1KRBC 3DDMA 1T99A 4E0CA 4RNHA 2Q3RA 3C8FA 3XISA 3BV7A 3T7VA 2BLEA 6REQB 1AQMA 1FFRA 4HN8A 5C7VA 1VF8A 1K9DA 3HG3A 3PUOA 1EBHA 4MZYA 2YDSA 1IXQA 3WEMA 3VIMA 4BF5A 3N3TA 4G5DA 2DT3A 3AMLA 3TWBA 3KDOA 3OVRA 3JR2A 1GOMA 3VOFA 4PTDA 2CBUA 3EWZA 3ARVA 3V36A 1HKWA 1K03A 4QNWA 3VFLA 3N9KA 1P48A 1KXHA 2JKAA 3TYAA 3BW2A 1SJAA 3ITLA 5J5DA 3ZVHA 4MWAA 3SCWA 2R82A 1XC4A 3O6YX 3WK1A 2VI0A 3H2EA 2XISA 3L4VA 2ZXDA 4CU6A 1IZKA 3KS5A 3NCOA 2I57A 3BWWA 1VR6A 6REQA 1LLOA 3UGRA 3GDRA 5CZTA 1GZJA 3TA9A 3N12A 2QJJA 1A5UA 1EZWA 4UBPC 3AIQA 3QZEA 4A3RA 3BXWA 3QFWA 1TZ9A 1FWJC 3AYTA 3WQEA 1J0HA 1RH9A 1X8CA 2P8BA 4Q4PA 3LCHA 2BV9A 4CUCA 4RX0A 1QI5A 1IR1A 3BV4A 3M0IA 2F61A 4NRRA 4M80A 1EP3A 1KA9F 4FZIA 3NAVA 5DRCA 5D02A 3I68A 4Z0JA 1XLBA 1JCJA 2ZE0A 3E0FA 3XINA 2Y8VA 2V2HA 4LS2A 3ZWSA 3TC7A 3KZPA 4I9TA 4PUNA 1WUEA 2F8QA 1KLZA 3WBXA 3RLVA 4Q8MA 4HSHA 4C7FA 4JKKA 3EYPA 4HU3A 2BHYA 1G4PA 3AYSA 4AG0A 3ZLHA 1PXGA 1M7XA 4ZSTA 2WAGA 4IMCA 2WNNA 1ZCOA 4M6UA 2YXOA 3AISA 5EMLA 3CQIA 3ONBA 4XD5A 2Y2WA 1X39A 1EZ2A 1WCGA 3PC0A 1EDQA 2Z27A 1VEOA 2QMJA 5HA7A 3WD4A 2VX5A 3OIXA 4D6GA 3ERPA 2PLMA 1EJ7L 2X30A 3M0XA 4J3WA 4E2VA 3P60A 5LKYA 4HNUA 2ZX8A 5FD0A 1AW5A 2TRSA 2CFFA 4PMRA 5ABFA 2A0NA 4A6GA 4HNTA 4NVTA 3L0KA 4RZ5A 3ARWA 2FJUB 2NQLA 1V93A 1VCVA 1DJYA 4WSJA 4LNCA 3AIVA 1L9WA 4QNEA 1W2PA 5HMEA 3B0YA 3L2MA 5HQMA 1H1NA 5C2GA 4UCGA 1BQCA 3RM9A 3KRUA 5I23A 4LV4A 3R58A 2Z26A 3THQA 3APTA 3LRLA 1N55A 3GXIA 4XBJA 1OIMA 4D1IA 3AS2A 3QY8A 4N9CA 5DY2A 2GLKA 2Z24A 3RO6A 7TAAA 4Y9AA 3PR2A 1F6YA 1BVZA 1LWIA 1SW3A 1ZBCA 1F2JA 3W2NA 5HWMA 3RFAA 2I7GA 3VC6A 3AS1A 1C3FA 1JXJA 3QQ0A 4A4AA 6A3HA 4IIFA 3IACA 1ZHAA 2F84A 2CHOA 1LT7A 4OBRA 1UZ4A 3CUHA 3V75A 4KGLA 4MVAA 3O2LA 5FSEC 3CV2A 4EAMA 3ARQA 1UUMA 1WDDA 5TF0A 5E0FA 3BOXA 3NQGA 4LY4A 3C5QA 1V0MA 3OGRA 3VDCA 4DO6A 5BU6A 2RDUA 1YPXA 3N14A 5E09A 4ERAA 1J96A 5XIAA 1Q13A 4LUTA 3C3UA 1S5NA 3QHOA 3REQB 2ISDA 1AH3A 3TOYA 2A2IA 4GABA 4AD2A 4EE9A 2OZ0A 4JTCA 4TQTA 1X97A 5BROA 4GHRA 1B5TA 3GG7A 2B4GA 3TSBA 3EOOA 1M01A 2VR5A 1K7FA 4PEKA 1US2A 1UASA 2ZRVA 4O18A 3BICA 3UR5A 2ZX5A 3L4TA 2WVTA 3VOHA 1H1ZA 1XLFA 3QZ6A 3RX4A 3HIJA 3LBCA 3LRKA 2EG7A 3BE7A 4K8HA 5C9WA 3LU2A 2CLEA 1MRQA 2V3FA 1QATA 4J2MA 2ZC1A 1L2QA 3CHCA 1D7KA 3HO8A 2FZBA 1TPDA 1J0YA 3CQKA 2PAJA 3UG3A 6TIMA 2FHCA 2I5QA 1DE6A 2PFHA 5EMMA 1E51A 4D1JA 4FNPA 2OVLA 2X1IA 4FXSA 1SZGA 4FLRA 1RY8A 4BZYA 5I3FA 1XKYA 4K7YA 4GUGA 2C14A 4NZFA 4L1WA 2VZSA 1HJQA 4JTAA 4NJIA 5IDZA 4IJRA 3KL5A 4JTEA 1W5QA 3EXTA 4FIQA 3TZNA 3ZIZA 2DY3A 4O8RA 4PN2A 5I07A 1EH9A 4GQQA 4QJ1A 2ACRA 3IIPA 4QJ3B 3O0FA 1G9HA 2EHHA 2C0HA 4ZTXA 2G0WA 4NJKA 2IQ0A 5D8WA 4GXWA 1T40A 2CBVA 3OVPA 4NRSA 3OTRA 2GSEA 4BY3A 3L4YA 4KCTA 3VUSA 2WMFA 3SCUA 1EJWC 3I6RA 4US6A 4GFSA 3W7NA 1ME8A 2VUYA 1EO7A 2V5BA 4HMCA 1EC7A 4A3YA 2XIMA 5G2WA 1FWBC 1MZHA 4J1OA 4M51A 3IJDA 4JTSA 1MEIA 3WDPP 3IVUA 2ATSA 5BMXA 5D33A 1DIOA 3NFUA 2CKSA 3GXMA 2WOQA 3QR3A 1QASA 3RCMA 4A2SA 4A8IA 5E1QA 3AUJA 1YXDA 2VDGA 4ZQMA 3URBA 4MB1A 2ZOXA 2Z25A 3N25A 1B90A 4PGLA 4Z2HA 4TTGA 4CN1A 3VD4A 3U7BA 4KCUA 1BQGA 2IKIA 3RRXA 1PEZA 1OX6A 5JBEA 1QPRA 3OBEA 1AD1A 3TLLA 2E9LA 4E3VA 3THDA 5HR7A 3V0SA 2C18A 3HA1A 2A1YA 4HZ7A 4O1DA 1OT1A 3ZOAA 5MHBA 3GHUA 3BARA 1V79A 2XM2A 1VRDA 4QLKA 2XUCA 1AFSA 3ATYA 4RPPA 5KEZA 1PKMA 1KBBA 4KRTA 3IIXA 3BMVA 2QZRA 4O15A 2R6OA 1KRMA 4BI6A 4N4QA 3FIGA 7REQB 3JVAA 3RR4A 5M17A 3CAVA 2OO0A 3RM8A 4W8BA 3AXHA 4GOAA 5BZAA 1ECEA 4MLRA 1UQZA 3ZWTA 2IKHA 2Y7DA 5SWUA 4YCPA 3BPWA 4LUSA 3TP4A 4TV6A 1EJTC 3A23A 3GZ3A 2EKCA 4U5KA 4DJDC 1IXNA 1BXCA 3F4DA 3U7VA 3HPSA 4XIAA 1LYXA 1Q8JA 2YBVA 4R9XA 1X7IA 4XG1A 6XIAA 3CLWA 1FP9A 2OU4A 3LLXA 2NUYA 2QV5A 1JDEA 4HIBA 2YIHA 4E3TA 3MCNA 4H1ZA 3IGHX 5CC3A 2OODA 5A8OA 2FMNA 1GQLA 2YZRA 1US3A 4J3VA 3NQ6A 2PDPA 4NG3A 2HWGA 2J7EA 1VFHA 3GU1A 3P74A 4JQ1A 3ZMRA 1OSEA 1V0NA 5EB8A 3GHTA 1M7JA 2BP1A 2Z1VA 2D73A 2VC6A 5BNKA 3NQAA 1FWWA 1S2AA 1RK5A 1BGAA 3UA3A 4N2YA 4NJGA 2XDFA 1WP6A 3A4WA 3RMJA 2QV4A 4P7OA 4WOZA 4H6RA 5E9AA 2ISWA 2JE8A 4AHOA 4QX4A 1C93A 3E96A 5C9RA 1UB3A 4ZSUA 4JEQA 1R0MA 1H60A 4GYPA 2J4GA 3U0HA 2X8RA 3NEHA 1V8EA 3EMQA 2XFFA 1XH2A 3L5AA 4BHYA 3WENA 2DVXA 2OJPA 2JF6A 1QVBA 1OCQA 5T9CE 3GNXA 3ABSA 2DUZA 1Y7VA 3L4ZA 1K6WA 1TPC1 3W29A 5GVJA 4ROQA 4YIWA 3GQYA 2W6RA 1F7BA 3LCWA 1VBJA 4G7EB 4GH1A 1XW8A 4O8AA 2XN0A 2XTKA 3H4GA 3F4NA 2W5FA 4HMNA 5LSMA 5AC7A 4A8LA 1SJDA 5A2CA 4PUDA 2OX4A 2DU2A 3H2CA 1YNYA 3WG6A 4Q8QA 3OPSA 1VHNA 1CB2A 2NW0A 2J78A 4PR4A 3P84A 5XINA 5CLTA 2DSUA 1YHTA 1TREA 1EGMA 2EPOA 3K1DA 3JS3A 2CEQA 1MUWA 4CCZA 2R94A 2Y85A 4UCFA 4ZOAA 1DQWA 1MQRA 2OGJA 5EYWA 2ZXQA 2VR4A 1K6AA 1PS9A 4X0NA 1PV8A 2DFAA 1I8JA 2Z1KA 1OZMA 3H2AA 2W91A 3WZ0E 3UWYA 4MDOA 4LBRA 4ZFMA 2PD9A 1BSLA 2ZICA 1HGWA 5F7UA 2ANUA 2O56A 2Q8XA 3RAOA 3MT1A 3YPIA 1FWIC 1CNVA 1GG0A 5I03A 2Z0IA 2VNCA 4H9XA 1QOXA 1QTWA 2GVEA 1FHDA 3F03K 4GYFA 2RHGA 3C0QA 4RZ4A 4QE1A 1F8MA 4DWSB 3B8VA 1S1RA 3EWBX 4ERIA 2E25A 3MBDA 2X7VA 3BG3A 1EB3A 1TB3A 5B80A 3ARSA 3EOSA 3W4RA 3LM3A 3FOKA 4JYDA 1Q6QA 1PL9A 2WKLA 3ICJA 1KXQA 3GYCA 4D6EA 4UR9A 4P7RA 3RGTA 4RZ6A 3OHMB 4TOQA 4MOZA 1ICPA 3DECA 1D3HA 1DQXA 3AZRA 4O19A 3CWNA 1S2TA 4GA8A 1RVKA 5ECUA 1F74A 4UUIA 3IIZA 4Q6XA 1DL3A 3GXFA 3MP3A 3I6TA 4P5UA 1K9TA 5BXSA 4RCXA 3HGOA 1WDQA 1YADA 4XO7A 3QMRA 5HWNA 1A3WA 2VELA 1ISXA 3EZ4A 4IJCA 3LK6A 3RDKA 4S3KA 1B3XA 3AIEA 4TIMA 2G41A 3MZ2A 2JIEA 2VWSA 4M24A 4JQ3A 2PP3A 3ZR5A 3HPAA 4UTKA 5EMYA 4Q22A 4C6QA 4U4MA 4XZ9A 1TIMA 4HU4A 3N9RA 3UVAA 1VEMA 1P0BA 1KM2A 2J8GA 1RZMA 1Q5MA 2P5NA 3NZQA 2X0SA 5AYIA 1KM6A 4PMYA 1U5VA 4B5UA 1E1CB 1KBIA 4R7JA 4YLWA 3GH5A 4M6QA 3WJWA 4LPCA 1HQTA 4MKSA 4DB7A 3DFHA 3LUTA 3OLDA 1KWKA 3NZRA 2O7QA 2PDHA 3LHYA 4AQLA 2AL2B 1VD6A 2GQ8A 5I3JA 3B4UA 2HBVA 1XLCA 1IHIA 4QRNA 3OVGA 5B7YA 4C6MA 4LB3A 4KF1A 4DM2A 3BLKA 4MY8A 3IUHA 1W6TA 2QS8A 3L66A 3PTKA 4Q4QA 2G3NA 2DUXA 1M53A 3WQGA 3WLSA 1M68A 4QITA 3UJSA 2DZPA 3K5XA 2BVDA 3C52A 2Z2UA 1GQIA 2DUAA 4PTVA 1W8SA 1GVQA 1VFSA 4JTLA 1AH4A 1PX4A 1UWTA 3H7UA 4GQ0A 1MWOA 1PX3A 3N13A 4HHMA 3EB2A 2D2JA 1UMYA 1VBRA 4YL2A 4X61A 3GG1A 1KFLA 4O11A 1HJXA 3WH6A 5FKYA 1KD0A 4DXXA 4D8ZA 3SCOA 2W66A 2XPKA 3AIUA 4GUHA 1K8XA 1XIJA 1FFQA 2JK2A 2Y24A 1CDGA 2GYIA 4DEFA 3ITYA 3WELA 1SZFA 3UWUA 2YL6A 1EC9A 1XLMA 3QOKA 3FSUA 3EXRA 1NTHA 3V3WA 1DXFA 4LUIA 1A3XA 2C13A 5BRQA 3VE7A 1BEUA 4CU8A 1YYAA 4E8CA 4RE2A 3TTYA 2DZAA 4NXKA 2VEMA 1VZWA 2NVCA 1HXJA 1J2WA 1ZBKA 3S5NA 1MW3A 1B3YA 3BLIA 1G4EA 2J25A 1IXPA 4PMVA 3PG8A 5C8BB 5DT5A 4B5SA 4JNYA 3AMKA 3FVDA 4WX2A 2J66A 3GXNA 4PBFA 5CC7A 4N42A 4HPGA 4D6HA 1X96A 3SGUA 3VDHA 1FXPA 1OG0A 2P88A 3UPWA 5LHEA 4LBUA 2WBKA 2FMOA 3NZ1A 3LOTA 3IAPA 3OZYA 1DWGM 3E1F1 3BAXA 2D69A 4PCFA 2E6AA 2NXHA 5I3IA 1IEWA 1RCQA 3T9PA 1W1TA 4B92A 1Q3NA 3HTWA 4HPNA 4C65A 2BX7A 3GB6A 5A8GA 3WMBA 3QMSA 3ALFA 1LG1A 1NIUA 4AZGA 3PZGA 4P8UA 4HNLA 1SW7A 4W86A 3UJEA 5CBIA 1QO5A 1XISA 2CBIA 5FF2A 3NXLA 4W7UA 3GTIA 3SFKA 4AZ5A 2L5HA 4YXGA 1O5RA 5EU9A 4DUXA 3H54A 1Q85A 1K70A 1ZRQA 2E0PA 2Z6JA 4YNGA 4B15A 3GM8A 2C0AA 4HK7A 1G01A 3G18A 2TYSA 4TX8A 4O0QA 2CZFA 4ZO8A 4YVPA 1K8CA 3EX3A 5KITA 2WZHA 3WQ5A 3BGGA 3VIHA 1LL7A 4N7QA 2Q8LA 4DZAA 1UPPA 2D22A 4YU1A 3GG8A 5HOSA 5D05A 4N02A 4NASA 5ENLA 4J3UA 1JZ8A 2YW3A 2VWTA 2CZVA 2NXIA 4AEEA 1BYCA 5LIWX 5T91A 2VGIA 3G1RA 3PWGA 4IOTA 3C2OA 3VABA 2A7RA 4V33A 2PPGA 4CQBA 3UR7A 1YDOA 1UZDA 2FQIA 3HGRA 3MTWA 4GPNA 3CZ8A 2QDDA 1W3JA 1LLWA 4JOMA 5HMFA 4HOZA 2HVMA 3N9SA 4DBEA 1L0PA 3NQDA 3WLNA 4YS1A 2GJXB 3T8QA 3LYEA 1DP0A 1XIIA 4OOZA 1EXBA 1T7LA 1W91A 3EOLA 4YPJA 5LXEA 1TJPA 1GQJA 3P8JA 3LRMA 1VB9A 3MV01 2I16A 1P0NA 4ZOCA 3PSVA 3S9ZA 1TPB1 3UWEA 2FTPA 2PRMA 2GFTA 4ORMA 2PLJA 4B4FA 3CUGA 2XIQA 3JW7A 4DYKA 4JTGA 2YL8A 1MDLA 4GZIA 4D9PA 4ZENA 3PK7A 1EYEA 3R8RA 4ZO9A 1U1HA 3N3MA 1LUCB 2GPTA 2EQDA 1TV3A 3G77A 1QUMA 3KW3A 3OHIA 2PWVA 1PJ9A 3UERA 3A3XA 2TSYA 1V5XA 3MYOA 1KRCC 4IM4A 3PBYA 4DHGA 3WBYA 1TQJA 1Q4NX 1UH2A 4JL2A 1Z8AA 3T40A 4PFHA 5EMUA 1DIEA 1U22A 1AL7A 2H6RA 4K1GA 2Y62A 3P5YA 2QMKA 1O12A 3QW3A 3CAQA 1Y5WA 2HSAA 3HG5A 1XICA 2DIEA 3AMCA 3RR1A 3RMEA 1UR9A 2YCIX 5CLWA 4ZMGA 1EHAA 4UQDA 3TAKA 1TZZA 5DT7A 1RALA 4ACZB 4AWEA 1AODA 3AHYA 2J6XA 5AC5A 1PBGA 4JAWA 2HISA 4X0VA 2PEVA 4I8DA 2C1GA 2DDXA 2D2HA 3WD0A 4DN1A 1NM9A 5HBFA 1ZGDA 4MADA 2WSPA 4CNTA 3ZR4A 5D9PA 4TVCA 4HHLA 3UR2A 5IOBA 3O63A 1ICQA 5A6SA 2PBGA 3ZT5A 4HA4A 3LI1A 3AXMA 3GDBA 3N11A 1GKQA 2D23A 2E7FA 4QJ5B 1MW1A 4QSHA 1AQHA 3TTQA 5DMLA 2YZ5A 2O92A 3GVWA 1VFMA 3S2CA 3VGBA 4GX9A 4JTIA 1B1YA 1IE7C 1H62A 1LBLA 2ISVA 4K68A 3F4CA 4O52A 1GEHA 4GIYA 4LNYA 4NAEB 3NL6A 1QJWA 2R1PA 1JI2A 2WHLA 1FBAA 2FGBA 3IIOA 3TYDA 4QDPA 5CPOA 3QLDA 3DKJA 3O6DA 4OBSA 4X22A 4IL0A 3I3EA 4OV9A 3CQ0A 2Z1SA 1G7VA 2A3CA 3N2BA 3I7RA 4UMAA 4FSAA 1IIGA 4K8EA 1J12A 4V1YA 1NH6A 1T0OA 3SCNA 5I2UA 4MLJA 3LN3A 4YJ5A 1JGMA 4CNNA 3IJ6A 2PSNA 3QSTA 2ZIDA 2H3BA 4MFEA 3N2TA 3VNJA 2WMIA 1E1EA 2ZRWA 2QAFA 4MWAB 2CLPA 2QULA 3FA4A 3CWOX 3WYZA 4JKLA 3H12A 3LPOA 1OC7A 3QPYA 2PTXA 2NWSA 3ZT7A 1DJXA 3VD9A 5G4WA 3LSBA 3T6CA 5HUPA 2BGNE 2Y7GA 5KZDA 5EBUA 2ZX6A 1J0ZA 4JHOA 3VYLA 4HN4A 3RM4A 2H8ZA 4I9MA 3FDKA 4JTKA 1DBTA 4ZXLA 3T05A 3QY7A 3TTOA 4O1BA 1XCWA 4YTTA 1AD4A 1OCJA 1ISZA 5IFPA 4LUYA 4FALA 5ABEA 3ZJKA 1M9HA 3UZZA 4HJFA 1DORA 2WO5A 3WNOA 3TROA 2QCNA 5ABHA 2Z1WA 3SO7A 2XSAA 3WBEA 4GVGA 1Y8BA 2A5HA 3G8RA 2PGEA 3CZJA 4OFCA 1BWLA 1VS1A 4MJZA 3O16A 4UTTA 4LU0A 3MZNA 3V5CA 3WLMA 3DERA 1REQB 4EPEC 4PODA 1EF3A 2YDAA 4HU0A 1YBQA 3MSGA 4K2SA 4CU7A 2E28A 3NDZA 1DE5A 3N2XA 4G1KA 4B5VA 5LNWA 1EA9C 4PUUA 2BVTA 3L5MA 4QEHA 4XZMX 4AD5A 4XX6A 1E9LA 2QCCA 4D6DA 1Z44A 1MVYA 1V7AA 1GVYA 5A2BA 2GGEA 4PRTA 3DOPA 1R8LA 2VTFA 3SRKA 4IMGA 2VZOA 1KRAC 3WK2A 3QFEA 1G1YA 1W5MA 2X1RA 2PWGA 1CXLA 5F1UA 1KR1A 1YPIA 3PBMA 2OSWA 2CXEA 4E4UA 1RUSA 1HGYA 1O4UA 1HN1A 1P0KA 3FDGA 1XD0A 3DAQA 5A8PA 4CQCA 2RFGA 3W00A 4BCEA 2YCEA 3SIMA 4XZLX 9CGTA 1R87A 2DEPA 3SGZA 3WL1A 3G1HA 3HQOA 1E43A 5CSUA 3R2GA 4MGGA 3HM7A 1P6WA 3DCPA 3NOYA 4GH3A 1UD8A 1G7UA 2Y8KA 2JGYA 1MYRA 3BGJA 5CSYA 3W85A 2FGLA 4B3LA 4KIEA 1AMKA 1R3WA 3G6MA 1LROA 4GNJA 5LIYX 2BNJA 3TQ0A 1XH1A 3NPVA 4JN7A 6TAAA 4NJJA 4KEUA 2WSQA 1GQNA 4HCLA 1F61A 1PHWA 4HU8A 5GQBA 1OHLA 5FCZA 4S1FA 3O7UA 6XIMA 4GZEA 3MP5A 5EMJA 2DT2A 4AZCA 1DJIA 4H19A 1QAPA 3B06A 3CHDA 1JGIA 2XU2A 1TA3B 1POKA 2VC9A 2FGZA 3TR2A 2HVOA 2HXTA 3PAOA 1DWAM 3O6CA 2OELA 1FCVA 1QHZA 3VOIA 2YA1A 2UV8G 3VKAA 4E2BA 1XDLA 5FEXA 3S2JA 8RUCA 3VO0A 3LMYA 3NYZA 1V3JA 3BLOA 2EEXA 4KFPA 1OT2A 3DFYA 2DJLA 4H3DA 2WCSA 4AF0A 3PBGA 4JZ5A 3MUAA 3GDTA 4IFKA 4L4OA 1SUXA 4QISA 3UEQA 4JY9A 1OZQA 2G96A 1SZNA 3SUTA 4JTHA 3T78A 4F9JA 4H9TA 2H9AB 3SUWA 1BF6A 2VEPA 2NSOA 1VAHA 1VQTA 4PTXA 1S5TA 3MUIA 4I9JA 3RPMA 1QK2A 4FF5A 1I2NA 1JDFA 1I75A 3FS2A 2BXVA 1CXIA 3LS9A 2NWRA 1ADDA 3SCVA 3WLTA 1CZ1A 2IPWA 4IMDA 5M1TA 4A8RA 1TMHA 4HSNA 2PODA 3GTNA 4O14A 1A0CA 2WXDM 1ZNNA 1WE5A 4JPGA 3WDJA 3MV11 1NOWA 1SQ7A 3GR8A 5D04C 1B3ZA 1ISYA 4A35A 1YKWA 2AQWA 3ITOA 3UXDA 3G1XA 1H0IA 1FUYA 3THUA 4F0KA 1UZ1A 3GXTA 2POZA 2V5LA 2V3EA 3ANUA 1RR2A 3H55A 2QGHA 3A22A 3GC2A 3EWYA 3R6IA 2CZEA 1E0UA 4L6HA 3HB9A 2QLYA 2WK2A 4R53A 5H91A 1Z69A 2WC3A 3WDRA 2E09A 3DENA 2FDMA 2PRHA 2RGLA 1E9IA 3CV6A 1OFOA 1D8CA 4WVXA 4PUJA 3H24A 3HV9A 4QJ4B 4RJEA 1BXNA 1MNSA 3PSWA 4PFMA 3I7QA 2AL1A 4EXBA 1A53A 2DSWA 3CUZA 3GAYA 1W3KA 2F6UA 3UBPC 1UA3A 3BOFA 5D37A 3FSTA 1XDJA 2IS7A 1KCLA 3NQEA 1RJQA 1GJUA 1S5WA 2BXYA 2D20A 1HVQA 4GIEA 1BAGA 3C4UA 4Q6JA 2OWCA 2CPUA 4ADUA 2Y4SA 1B4EA 2FFIA 4L9XA 2HNEA 1WBHA 4YN5A 5REQB 1AW1A 1LUCA 2A85A 3RRAA 4KWSA 1GZ1A 4A2RA 1JCTA 3P62A 8XIMA 1D7FA 1PWMA 4JNZA 4H9YA 2VCCA 3B03A 1V4YA 3WQ4A 2FPVA 2P0OA 2GUBA 4NAFB 4AWTA 5FESA 1C7SA 3RX2A 1H3GA 4PA8A 2OQHA 3BAIA 1O5QA 3BANA 4FNSA 2ALDA 1JUBA 2GJPA 2J77A 5A6BA 3PF3A 1PDYA 3NOEA 5CBJA 1OADA 4MTVA 4O0ZA 3WLPA 3IEBA 3OYXA 4NI3A 3A3WA 3RYSA 3GRIA 4U10A 3B8IA 3LEPA 4QHRA 4W4QA 1E4IA 3LTYA 1KFBA 4B3ZA 1H0GA 3IIVA 2GVJA 2ZZ2A 3K4AA 3II1A 2FVLA 1TV5A 3E2VA 4GGBA 1LOSA 4HYRA 1XG4A 2BDQA 4BS0A 3UWWA 1E73M 5I09A 1WXZA 4DBDA 4LT9A 2D0GA 2Q3OA 2Y63A 3EA3A 1WXYA 5BMWA 4ALDA 3NDOA 4LAZA 4MY9A 4JNMA 3CH0A 1CLVA 2HK1A 3GVQA 3PANA 3CUJA 4BF9A 3KE0A 1GGOA 3WUFA 2ZTKA 1W9UA 2Y5JA 4BF7A 1NDVA 2CKRA 1S2VA 1CENA 3SSJA 4W84A 4AY1A 4GIAA 2A3LA 4H9UA 5CGQA 4IG2A 1I1XA 4RXFA 1UIOA 3BJTA 4C6EA 3IRSA 3NVTA 2XFYA 2IQDA 1NWSA 1MQQA 1EGVA 4N9BA 4KFOA 5A6LA 1JF6A 3FX4A 1CEOA 4XAFA 1HL8A 3IJ9A 4U33A 2XFWA 2OT0A 3T0BA 5D38A 4WUIA 4LCRA 4DI9A 1MNZA 4JTRA 2EJ1A 4XVEA 1PCKA 2CZ5A 4S3JA 3I3DA 1I0DA 2XJ7A 5A6JA 3W74A 4S3AA 1N82A 3S2NA 4JCMA 3MW7A 4B16A 4ML4A 2PDCA 2INFA 1M7OA 2ODOA 2WWDA 3ARRA 2VM8A 2YOCA 1CPUA 5EL1A 4JICA 2PGFA 2Z6IA 3KOWA 3SQMA 3LQGA 4RPQA 1Y5XA 1RLCL 2XHYA 4IUGA 1CCWB 1NOFA 1IF2A 4QAWA 4XSMA 2VC7A 3GKFA 5AKQA 1YDYA 3SY8A 1SO3A 3QW4B 2C7FA 3BGAA 1F5ZA 1VFFA 2Q8ZA 3ABXA 4ZFCA 4IHCA 5DX7A 1PZ2A 1UUQA 1W3NA 3GVRA 3LGGA 3R12A 1F9CA 3EMCA 4L5ZA 5HNNA 4AC7C 4GXMA 3WQOA 3TJXA 3HBLA 3GVVA 4M29A 1T5AA 4NNBA 2OOFA 3UCQA 3BVJA 3QZAA 3QV9A 4XISA 4DWSD 2XVPA 3FXGA 2CESA 3UETA 3ISIX 3GTFA 4MY1A 3ITCA 1XX1A 3KWSA 1X1ZA 2UWFA 2PUZA 4KWVA 1S39A 2V5CA 3AROA 4H9ZA 1XLKA 3NIYA 3UF9A 3VOGA 3IVTA 4MF4A 1CIUA 2VVNA 1GOQA 3E2RA 3M07A 2G3JA 2HS8A 1TWZA 3S1GA 1EDGA 4GIRA 4M6PA 3BMWA 1KBLA 1F05A 2VDIA 4JTDA 2OKTA 1I9CB 3AXXA 4DQWA 2WNZA 4HVXA 3CHEA 4OZOA 3S0CA 3W83A 3D47A 2VFDA 2NQ5A 1XQKA 2OZ3A 1PTAA 3W7PA 5CAHA 1VH7A 4KQNA 4E5TA 2XH0A 1F76A 1EX5A 4Q4SA 4KWUA 5FAJA 4NZ5A 3CB8A 3PUEA 5FSDC 2O9OA 3TW9A 3QTPA 3HPZA 3C56A 1C92A 3GIQA 3VNYA 4HZMA 1VCGA 3SSZA 1CW2A 4DO5A 4XZHA 5CBBA 3SJ3A 3QGVA 3DBPA 2G50A 1JXKA 4GY7A 1J6PA 3BLLA 4U2YA 3E5BA 4M82A 3ABQA 4ATDA 4CD6A 2DGAA 1OEPA 2EBNA 2Q6ZA 1CB7B 2J7DA 1FCQA 4FNTA 3WH9A 4ES4A 1JZ5A 2FZ9A 3SUUA 3TYCA 2FLIA 3CZEA 5J5RA 4GY0A 4NUWA 4KEMA 2VD8A 3U57A 3MYPA 1BFNA 1LQAA 3UPMA 5AVHA 4PMDA 3S83A 3TK7A 5A6AA 3SR7A 3ARYA 1HKIA 2ACQA 2TMDA 2WC7A 1QPOA 4Y9MA 3M64A 4LAOA 3UA4A 4X9YA 3WDHA 1ZJHA 4QE4A 3AHTA 4JS3A 1D3GA 3SBFA 2E5CA 2W62A 4B9ZA 1GJPA 3R89A 1OWQA 2W61A 1RCOB 5C71A 4Q8TA 1VP5A 1S2WA 1XSKA 3BG9A 3I7SA 3W1UA 2X2YA 1TJ0A 1VGAA 4P7QA 4LEQA 3BJSA 4Y9PA 4CEXC 9RUBA 3C3NA 4AVNA 3W1RA 2FZ8A 3EEZA 5AC6A 5G1MA 5K4XA 2GQ3A 4INFA 2CHRA 3H2MA 3LXCA 2OZ8A 3AJXA 2Q71A 3KOZA 1RJRA 4WJXA 3VNKA 2NUWA 1EUAA 3EA1A 2OLSA 4XZIA 3KL0A 2YB1A 4AC1X 1OJXA 2VX7A 2MANA 5A6BD 1XYLA 4E2OA 3CUFA 3VD3A 3WUBA 4HZ6A 2HVNA 3BJFA 2PCQA 1T6MA 1R7OA 4H6KA 1KFJA 1BYDA 3CK5A 3AAMA 2X1UA 3VKBA 4DJFC 5I02A 4PMNA 2BHUA 4BQ5A 5KETA 2PTZA 3GR7A 4LS0A 1B54A 3V5OA 4Z1DA 1E3XA 1E40A 1XINA 2R14A 2OWXA 1BRLB 2DJXA 3ZZ1A 1Q6LA 1WPCA 4IP5A 1FCBA 4WD0A 4GBDA 2WJZA 4R27A 2O7SA 1E56A 1WZKA 3IRDA 4LF2A 2ALRA 3TXZA 3PNUA 3S47A 4DYEA 4GE8A 5EGRA 4K8GA 2A21A 1QDSA 4FOUA 1WDRA 2DV0A 2PGRA 4WKHA 1LRQA 5C9XA 4LVFA 3VXGA 1YXYA 3GLCA 3HGSA 1ISVA 3F2CA 3M0LA 1BKSA 3EKGA 1R38A 4IIEA 4R34A 2QPXA 4Q33A 1GHRA 3PM6A 3UY7A 2VD9A 1I2RA 3E0WA 5K4ZA 1UROA 2A3AA 4LALA 4UTFA 1SJBA 3MDUA 3SRHA 2YPIA 3HG2A 3RILA 1RPKA 2ZVIA 3T81A 1JYNA 4MPKA 1RA0A 4HHPA 5I6SA 2PU1A 3FKKA 3NPWA 2BWGA 1E1FA 4L56A 5TD4A 1SYTA 1TMQA 1ZU8A 3KVLA 3PPCA 3UJ2A 4KT2A 2P0IA 1K8ZA 1KBJA 3W1PA 1IR2A 3VX1A 5J8LA 5IXEA 1FXQA 1XIFA 3EWUA 3KVKA 4HHHA 7XIMA 1KCXA 2ZZ6A 1A5CA 1AQFA 1JRCA 2ZADA 4DJDD 1W3IA 4IIBA 1T96A 1IEXA 1XH0A 1B4KA 4KIRA 2PDBA 3KBJA 4Q8WA 2GJNA 2FHBA 3IK2A 1FDJA 1S1PA 3TN6A 1FWEC 2C71A 4Z08A 4CQAA 3NO3A 1UWUA 4MWAC 4M0XA 4AIBA 2CLFA 3EWWA 2WKJA 4HMEA 4HNVA 1DHPA 4ZL1A 2D2OA 3FJNA 3DYPA 2NLIA 4BA0A 1XP3A 4ACYA 3MSDA 1D2KA 3FA5A 3OGVA 3LZ3A 4DBWA 5E5CA 3RPTA 2V5KA 2WJFA 2Y1HA 4ACZA 4LUTB 1ZFJA 3USZA 2Z29A 3V1HA 3A6OA 4P7LA 1UWAA 2WNWA 1HKVA 4W7VA 5CPNA 3A12A 4E2DA 4J2PA 3E3HA 3OW1A 3N6QA 1A49A 4K3ZA 3BOLA 3L21A 2XIJA 5HXMA 1JUKA 2GL5A 3ZYZA 4O53A 4GKLA 4PBEA 1W17A 2QUVA 1AZ1A 2GWGA 4E8GA 3G0SA 3L2LA 4MWAE 1REQA 1EWEA 2Z00A 1RBAA 2CC0A 1LBFA 4AHQA 1BD0A 3N2OA 3K8LA 4OGZA 3B0XA 5FJIA 3TTEA 2VCAA 3W81A 4H2CA 3QYSA 2J8TA 1AZ2A 4ZB5A 1S2CA 4IPLA 1U33A 1KFWA 4CVUA 3QBUA 4XZNX 2PDGA 4K38A 1P6BA 3LX9A 1WA3A 3QPZA 4TX6A 3PJTA 1H2JA 1FKXA 1R85A 4HPJA 1YMYA 4LAKA 2FVMA 2G97A 3TFXA 3TN3A 1XD1A 2F9RA 4IMEA 5D9MA 5M2FX 3N17A 3R11A 3IGSA 1D8WA 3OLEA 5BWFA 3B97A 1OY0A 4D72A 4JIQA 5JIWA 4HNCA 1MW2A 2QXWA 4B3KA 4UTLA 3NSNA 4H8HA 1VBUA 3WBWA 2QHAA 1Q2SA 4HYWA 1YTDA 1ONEA 3R8GA 3CPRA 1W1PA 4IG2B 3G3DA 2RKXA 2O55A 2OQYA 4RNFA 4H4IA 3WF1A 2CYGA 2AMXA 2VCBA 4CEUC 1JRBA 5DCDA 4B4HA 3NURA 3CS2A 3B8SA 1WDWA 2OLHA 1DIKA 3TUUA 1JCXA 4UB9A 4LCSA 4X60A 3W7OA 4LTSA 2FTWA 1HW6A 1GOKA 1JD9A 2YFNA 3S1UA 3LCFA 3SEPA 1A5AA 1W8GA 2OFJA 3L67A 4K6AA 4UFLA 1C8QA 1O1HA 4I7UA 1N7KA 3VFCA 1A50A 4AX6A 3R94A 1KM0A 3P8IA 2INZA 3WMSA 5E0KA 1LRNA 3THCA 3H6OA 3MCOA 4MJMA 2EPHA 3WMLA 1ZUAX 3VMPA 1JL8A 3CL8A 4A3UA 1OFAA 3P2VA 3AMGA 1VC4A 4LH8A 4V2XA 1BVNP 3VKJA 3AWOA 1QPNA 3OBKA 3IVSA 1CGWA 3KBVA 2CHNA 5FEWA 1FTXA 4LW7A 4ROPA 4RW3A 3CNYA 5M03A 1OFDA 1B0IA 3PZNA 2EPMX 3NJ3A 4A22A 2EPKX 4CD5A 1UWIA 3DU0A 3B9NA 1UA7A 1UD5A 3W53A 2JALA 4JGDA 5A3HA 4OUIA 4Y6GA 2XIOA 1YTEA 3THAA 4W85A 3CXOA 1LG2A 1LOQA 4JX6A 1BWKA 5DBUA 4F0LA 4AYGA 1WV2A 3L9CA 3TSMA 3C0SA 5MKGB 3RHGA 3I6EA 4S3FA 4XKYB 3S4TA 1P6CA 3LPFA 4WRHA 4ILSA 4I9AA 4NT0A 1JAKA 2DP3A 1JFXA 1WKEA 3F5JA 4C1NB 3M4HA 1J2BA 3TJLA 1V3MA 3OLGA 3IJLA 4M19A 4X2RA 4JFSA 4PEEA 4IISA 4IQDA 2D0HA 3TIMA 4BI5A 1EPVA 2RUSA 5TNVA 2V69A 1XIDA 1MI3A 4H00A 2VFFA 3SIZA 3EXSA 4LFYA 4XSLA 1UH3A 3DFTA 2IQTA 5IHRA 1I2PA 5A6KA 3GKAA 1UR2A 1QCWA 2F2KA 1BTCA 4DJEC 3H26A 4NIRA 1KM5A 3O6AA 3HG4A 4FB7A 1EEXA 5AY7A 3NM3A 5BYWA 3P6LA 1TMLA 3PJWA 5AHNA 4J28A 3SUSA 1FWDC 4J40A 3DI0A 1EKOA 4XBKA 2ZQ0A 3TQPA 3WNKA 3UXAA 1VPXA 4MAZA 3LNMA 4GBUA 3BSMA 2I1OA 2DZBA 5K9DA 3LERA 1PIIA 5C5YA 3NPXA 1L6WA 3OG2A 4F2TA 3GDKA 4PUEA 2G3MA 1J79A 2A6LA 2QUMA 1P7TB 5HPOA 5JMUA 2NT1A 1M3UA 1CGVA 2Q09A 4MMWA 3LGEA 1YIXA 2EPLX 1GEQA 1W1ZA 3QPEA 5JQ9A 1PYMA 2V63A 2OZTA 5DCEA 3TONA 3OGSA 1E0XA 4QEEA 1GTHA 2J7HA 4IWWA 4NNAA 3QKZA 2C6QA 3S5SA 2QIIA 4UOQA 1KQZA 4BWLC 3D5HA 2J7CA 3N1AA 2EXOA 1E4LA 1XIGA 4LQ1A 1GVFA 4GG9A 3J7HA 4E4PA 5TBOA 3CU2A 5U4NA 1U2YA 1MZRA 3VMOA 2WPGA 2VUNA 3A47A 3DG7A 3K2GA 3VIPA 3WQ6A 3CIVA 1LP6A 1B2YA 5D32A 2NQJA 4EX4A 2PU0A 2WLZA 3ES8A 3HJZA 3SECA 3DGRA 4KETA 3QVQA 3S9YA 2QCHA 4R9OA 4GCXA 1CWYA 3SN0A 4OU1A 2XZ9A 3ZVIA 3C61A 2YDQA 3AXKA 2PDYA 1ODUA 4IT1A 3ZSTA 1WAWA 2C79A 2J6VA 3B3DA 3DIPA 3W37A 1C8XA 3ES7A 1O68A 1KGUA 4PC8A 3L0NA 4TXEA 4GISA 2HTMA 4IQLA 1UKSA 2XSBA 4GZ7A 4JN8A 3UWVA 3V16A 1EA0A 1XPGA 1W5OA 4P7NA 3W2JA 3GFZA 2WZEA 1AJ2A 3F1QA 3UT0A 3GR4A 1X7FA 4Z1BA 1DJQA 3NQ8A 3T55A 3S3GA 3UJRA 4BEQA 4JIIX 1ZBVA 4DIAA 2UBPC 3UWQA 1T8QA 3FFSA 3W88A 1JDAA 1BLIA 1I0BA 3KOXA 2JEPA 4AD1A 5G2IA 4JBRA 1JUEA 5DXYA 2QUNA 3P67A 3L4XA 1VCFA 2V38A 3G1FA 4UTWC 4GC4A 4FXJA 4WGHA 2E5BA 2JFEX 3QN3A 4Z1AA 4PYSA 5CPSA 3N18A 3NNTA 3REQA 5HDRA 3CPUA 2E40A 4Z2KA 3E02A 1ZENA 4MFDA 3WN6A 4H01A 2HROA 3AXIA 2OWWA 3ORWA 4IIHA 4DELA 5DELA 2WZMA 3E49A 3ALGA 4JHZA 1K02A 4ADSA 3RO8A 3SZ8A 4HK5A 4XKMA 1KTNA 1FH9A 1W32A 3ZVHB 3KBMA 2TAAA 5HNTA 4U28A 3CLMA 4O1EA 5D2VA 3ZM8A 3HZ3A 1YQ2A 2CITA 3RPDA 1DJWA 1NWUA 2J8FA 3U6WA 2BBFA 2H3DA 1TR9A 2V0TA 1OYCA 3F4WA 5KSWA 2NSXA 2WBGA 3PB0A 2CIPA 1A0DA 2PTYA 3W25A 4US5A 4HYVA 3EKLA 3GFXA 1Q65A 3T44A 1X6NA 1KC7A 4M7SA 1EJXC 5H8MA 1FWRA 1VYRA 3NL3A 4GC3A 2GJRA 5I7GA 3VNMA 1AG1O 4GQRA 1UUOA 1R9ZA 3DYOA 1NDYA 2IKGA 6PTDA 2GQAA 4C1NA 1Q4WA 4UIOA 1A80A 4F9DA 4Q8PA 1VYSX 2NVDA 3FEQA 4EF8A 4Q8NA 1E3ZA 1YX1A 4F66A 4RR4A 3UWZA 3WF2A 2PD5A 2QDHA 2VZVA 3KCOA 4J27A 1FDYA 4UZSA 2Y6ZA 4PB3A 2PDMA 4HT3A 3E6EA 3AC0A 5HMDA 2V8ZA 3UZ5A 3MKKA 3GFYA 4L1XA 3FXYA 3NPUA 2IPFA 3FHAA 4L6DA 5A69A 3TMLA 4HOWA 4AW7A 4AIUA 1IWAA 3N2MA 3IARA 5EFFA 5CSRA 1NFBA 1ONRA 3KXQA 1SO4A 3STPA 3TTSA 3GNNA 1RVGA 4IXXA 3BURA 4R33A 1M04A 3EX4A 4AVOA 4L9ZA 2AKMA 1RD6A 1TV8A 1A5OC 4KWWA 2R1NA 3H2FA 2NQHA 4JQAA 4XTIA 1R3YA 4IX0A 1XYFA 4W89A 4KKXA 3CL7A 3OIHA 3CMFA 4V1XA 4HJWA 4F40A 1PUDA 3VOCA 2XVKA 4YTUA 2WANA 2ZE3A 4R3UA 1CX9A 1TPH1 4A29A 5D2XA 1KV8A 1CXEA 1I45A 4QIUA 1UR4A 1S5MA 4NZ4A 4CCCA 1JCMP 1XYMA 2PTDA 4GQGA 4MZ8A 4EPKA 3FYYA 2G4JA 1V6WA 1GNXA 1SZRA 2E5DA 3EPMA 3NEVA 3CAKA 2XIIA 2VURA 3MMDA 4O1CA 3D3AA 3NQ7A 2R1MA 4GWEA 1PSCA 4HD5A 1M1BA 1LF1A 3D6NA 4W88A 4EWND 1P5BA 2B7OA 5A1AA 3D3FA 4NJHA 1YPFA 1JYWA 2DT0A 1JCLA 1IEIA 3CGTA 3F2DA 3IJ8A 1M6JA 3S5OA 3SI9A 2VGFA 3SJNA 3CH9A 1VENA 4C6JA 1NOUA 4RNJA 3UD6A 3COTA 2IUZA 2INEA 1J8VA 2GGJA 1KKRA 2CXGA 2YFOA 4NXSA 3TCSA 1JCYA 1W9BM 3KHDA 1PVNA 1RBLA 5EPDA 3CYJA 5IM51 4CD7A 1XS2A 1KKOA 1I2OA 2BODX 5C54A 2B7PA 4ZR8A 2F38A 4JD4A 3VNZA 1GVRA 1QU4A 4FF7A 2QKFA 4C91A 1G69A 4Y9OA 4BK9A 2PDXA 3H4XA 4UFIA 1TWSA 5E0CA 1H7WA 3ZJ7A 3PAJA 5CQ1A 1A4MA 1KQYA 3N4FA 1R47A 1T41A 3KOYA 2PMQA 2GUYA 2R24A 4CQ9A 4HPXA 4IQJA 4KFNA 3L7RA 1XL9A 1ZJBA 1B3WA 3H2OA 3IJQA 4ATLA 1M65A 2PC8A 4NY2A 4QAIA 4XD4A 3IK4A 2R9RA 4GUFA 1MRAA 3W70A 4JFUA 4LAUA 1K8YA 3O07A 3R43A 4WY0F 4AZ7A 3VD5A 4EXAA 3NO1A 3W82A 1ISWA 3T09A 1KGXA 4OT7A 4Y96A 4FP1A 4J9JA 5CJNA 3SURA 1A5KC 4NQ1A 3VZYA 3G1AA 4FNQA 4RDZA 5BXTA 5CPQA 2ZRYA 4PUKA 1GYNA 1UG6A 2ADAA 3CL6A 1VFLA 5HNUA 2PP1A 2WJDA 3G1VA 2BY0A 2QF8A 3BK0A 3ANVA 3BLEA 1B30A 1JJKA 4JDYA 2FPTA 1IZCA 1LBMA 3LCLA 2AOSA 3WFLA 2NQZA 1TPUA 5D9NA 4GX8A 3W24A 4Z0SA 3W28A 1AMYA 4EKJA 1J5SA 3CTLA 1HO4A 1MMFA 1GOWA 4MNKA 3K8MA 2VRJA 3LCIA 3VM5A 4DLMA 4N6EA 1FA2A 1ZP3A 4ICMA 1H50A 5D03A 1RPXA 2Z4GA 4A05A 3TFCA 2KAUC 2DIKA 2Z2AA 4E38A 1TV7A 1MO0A 2GVYA 2ZBTA 1R3VA 1X38A 2VFHA 4Q7NA 1RA5A 4UTTC 2VFGA 1KWGA 4KH2A 3UXIA 3PUDA 4JCLA 3W7MA 4K37A 3GTXA 3Q94A 3M41A 4IGSA 1Q6CA 4DVOA 2XGZA 3K4DA 1LQ0A 3AHVA 3RX3A 3AUOA 1XRVA 5HUOA 3QV8A 3VE9A 4MPQA 3W7GA 1AA1B 2GUUA 3W1LA 3W7EA 4G8TA 2YLLA 2P53A 5KZEA 3IV3A 1VPYA 5DRIA 2P3ZA 4L7ZA 4XAPA 3ZJ6A 5T9BG 4URIA 2H9AA 1JPMA 1Q6FA 3M44A 4AEFA 1RBOB 3NO5A 2GOUA 3WKZA 3IJIA 3NVDA 2J7BA 4WSHA 3NQVA 1FHUA 4K7VA 4WK9A 4F8XA 5DQPA 2X05A 1OQFA 4AIEA 2J7FA 1CTNA 1PPIA 5CGTA 1GOXA 1JNDA 1E6SM 1XDMA 3NXFA 4XK2A 2XGIA 4W5ZA 1DKWA 1SMAA 1RP9A 3AJ7A 3MMUA 4AIOA 1U5JA 1ZCCA 3W7LA 3A9BA 3G24A 1TR1A 4IGHA 5J04A 4B2DA 3GDMA 3AWNA 2QCGA 2ZZ3A 1JPDX 4GXPA 3CO8A 3LXBA 3LB0A 3WX7A 1M41A 1QNRA 2YR1A 4FXFA 3PHAA 4U5IA 4TVDA 3R7MA 1Q66A 2V30A 3MHFA 3ARXA 3P82A 3BCDA 3EPNA 1H4PA 3WEOA 3VINA 3H70A 2QIWA 3TC3A 3NG3A 4IL2A 1XBZA 5IDIA 2PF0A 1FWSA 3EX1A 3WQCA 2VFEA 4X3ZA 3U4FA 3EX6A 1KM1A 3LCXA 4LYRA 1HZYA 2AAAA 2POTA 3Q67A 4H83A 3MBFA 2WPBA 3S6OA 2I17A 3MO4A 4UMBA 4I8YA 1XV8A 4WF7A 4UNIA 3B9DA 5ABFB 5DLCA 5EBAA 2ZC8A 1V3KA 4JTQA 3VAVA 2F6KA 3MSRA 4MKNA 4NZ3A 5FEPA 1LLZA 3WLLA 1EL3A 1UW9A 2KX9A 4W87A 1F6PA 2BFGA 4MNJA 4AHPA 3LHVA 4DUVA 5E6ZA 4L80A 1UD4A 3E2SA 5K2ZA 3FHQA 1I6NA 2JBMA 3ZSSA 2WM1A 2DVTA 3N6HA 3GNRA 1ZSXA 7ENLA 3SM0A 1EX1A 3UNDA 4ZB2A 2DORA 1Q45A 4KMQA 4GVIA 4GNVA 1RP8A 5LZLA 2YBTA 3QM3A 3TEVA 3PZUA 4MJ2A 5FF4A 2GOKA 3AHZA 4LYKA 3R25A 1YLVA 1PKNA 3L65A 1R3QA 4EACA 2YLAA 4OVXA 4C1KA 2WHMA 2X1SA 4F79A 1L6YA 4ICNA 5EMKA 2B81A 5GNZA 1P1XA 4KEVA 1YTKA 2Q01A 3T4CA 2BGSA 1TPEA 5CPMA 1XLHA 4H9MA 2WWCA 5LA0A 3O1NA 5AZ1A 3LLDA 2HXUA 3SB0A 4L4LA 4WKFA 1FVPA 1TG7A 4LJ3A 3MJMA 3UNTA 4ZO6A 4UFMA 4ENLA 3IV8A 3AFBA 3LGDA 5GJMA 4RLIA 3W6YA 4NHVA 2PC4A 6ALDA 1SO6A 5HPCA 1UR3M 1W1A1 2ZVRA 1DYSA 3TW7A 3L5LA 3SUVA 3W7KA 1YNQA 4JIRA 3UGVA 4RE0A 5F2LA 2QJMA 3E2QA 2IW0A 4JX5A 4NX0A 4UQEA 3VDGA 5DMNA 1ESWA 3JZEA 1XUZA 3TWAA 5AECA 5T8GA 3I10A 4MYXA 3LZ5A 4JXCA 4G7FA 4KCWA 3B9AA 4XKYA 4LVBA 4LYQA 1ONWA 1N8WA 3LSCA 4O54A 1HG3A 2XH2A 4UMCA 2CLHA 4AISA 4Z1YA 4PBGA 4EWJA 1E15A 3EPOA 3KFTA 1VLIA 5I3KA 3W2KA 3G0XA 3LCGA 4XAYA 3PZMA 1B9BA 1BG4A 2W67A 1NP2A 1PZ0A 4HB7A 1EIBA 4GI4A 3G8EA 4U3CA 1VLWA 3PPHA 4ZZ9A 1Q6GA 2XM1A 3WQWA 3VA8A 1KBKA 2UY3A 1QNVA 2F7FA 4AX7A 1EJUC 4UC5A 3OLIA 3ECQA 2O9RA 2VRQA 3EEGA 4CVWA 4QBXA 1WKDA 4UTUA 3VM7A 1NQKA 3DFSA 1CBGA 3FK4A 3W1MA 1JDCA 3DKLA 3MVTA 2WYSA 4Q32A 1PCWA 1XIEA 4BEUA 2WV8A 3E38A 4AUBA 5FF0A 1J4EA 3DHUA 1V6VA 3KRZA 3LQLA 4FX8A 3GU2A 3GBEA 3AYRA 2AGTA 5U7SA 2J24A 3EAUA 1H61A 1H7NA 4BR1A 1KV5A 4BQ3A 5ABGA 2WMGA 1R3SA 5GNYA 3WLIA 1TV4A 2VEKA 4Q4KA 1WAUA 4AXNA 2G8ZA 4KGJA 3VIGA 3TV8A 1G0CA 2QQ6A 3W7HA 1KR0A 1W5NA 3W7IA 2HV5A 2Y7EA 1VJSA 3T2PA 1SGJA 1V6YA 1C9DA 5F4XA 2LLEA 2ZZ4A 4G7EA 4JTUA 2WVSA 7A3HA 5FF7A 1C29A 3NTYA 4MUPA 3N15A 2GDUA 2WSRA 1OFEA 3TYUA 2C15A 4RDVA 2OSYA 2YJQA 1TELA 3OQEA 1GONA 4F4RA 5DY3A 1TRIA 1R9YA 3LG3A 4QG6A 1M03A 2WMIB 1JF5A 1XF0A 2ICSA 1KFKA 1PO9A 2XFRA 4U31A 3T42A 1XM3A 3P3BA 3WH7A 1E9YB 1QPKA 1UHVA 4X9SA 8A3HA 1XBYA 3ONCA 1HL2A 4CQDA 1JEZA 1D3CA 1OABA 2XIBA 4FR1A 1S38A 4GVFA 1TJ2A 1HUVA 3O05A 1TPWA 1QWKA 5IHSA 5MKGA 3C2RA 2DSKA 5A2AA 2OR2A 9XIMA 1K9EA 3MC5A 4Q8UA 4NL1A 2ESCA 4J3XA 4WZHA 4LXFA 4PL2A 3QC0A 4MWAD 1C9WA 1ZJIA 1FHVA 3LBMA 1X1OA 4D6CA 3DFQA 4UWMA 5FI8A 3QY6A 4PSRA 1SSGA 2EG6A 4UR8A 3VGFA 3OZMA 2DH3A 3CB3A 5C2CA 5AC8A 3CEUA 3GW3A 3IANA 1G67A 3W27A 4Q7IA 3W23A 5G4HC 3WLHA 1Q2RA 2AL2A 1PKYA 1XGEA 3EB3A 5I3DA 4EOUA 4FOJA 4UXDA 2FPYA 4HZ8A 2E8YA 1BWVA 3E12A 4PUMA 5BOOA 4IFKB 1OGBA 2CLMA 4Z17A 1XUUA 4I6KA 5CZKA 1KXTA 1E5JA 5LIXX 4GI9A 1FH7A 2DT1A 2Z7GA 4PTWA 1XLEA 3STCA 4YHEA 2R1KA 4IZGA 1WB0A 3T0DA 2YB4A 5HAOA 3S5YA 2R1LA 3GD6A 2Y89A 3R0KA 4FLSA 2OO6A 9XIAA 1ZL1A 1DJHA 3PZOA 1HNYA 3M0YA 1JZ2A 3FY1A 4S2CA 4OJYA 1KM3A 3O06A 3S8HA 1ZS2A 2NV9A 1UH4A 3HFTA 3GG0A 3ZO9A 1GKRA 4IQEA 2VEGA 1V7YA 4RV3A 3HMJG 2NX9A 4R7WA 4Q4MA 4GFIA 4UZUA 3B0UX 4G6CA 1YDNA 4WY0A 4AAJA 3MUY1 2RH9A 4DO7A 4AYSA 2A7NA 2BTMA 3A64A 1TE6A 4A21A 1ITQA 5FEZA 4NILA 4D6FA 4H8UA 5G4EA 4PTMA 1ZALA 4UQAA 2CLIA 3MVIA 2WZTA 4F0RA 3PJUA 1THFD 5G1TA 3U9IA 1W0MA 4M8UA 5CEWA 3WFAA 5JUVA 1C8VA 2OTDA 1K4GA 3QHMA 3KTXA 2G5WA 3N19B 3VVGA 1AL8A 4FX7A 3BSHA 2TPSA 2PZNA 3M5VA 4X63A 2HE5A 3FYPA 2ZXBA 3W01A 2NXGA 3U5YA 1Z3NA 1EJVC 1BSIA 1WQ5A 3R0DA 3B05A 4W8AA 3CMJA 2QVHA 3SY5A 1L2UA 3C0LA 3PWAA 1YEYA 4JQ2A 3L68A 2EKGA 4GJ1A 1K77A 1P0DA 2MUCA 1ICSA 4JIPA 2ZTJA 4EPDC 4UQCA 3ITVA 2J9ZA 2OEKA 4PCPA 1HKJA 4BQ4A 1X8FA 3EDKA 3K4WA 3EOUA 2J27A 3QOMA 3LHTA 3GXDA 4KERA 3KVJA 1FCUA 2GJXA 3APYA 3Q58A 4Z2IA 2CWNA 3V7PA 4DYJA 3L2IA 2PA6A 3UCCA 1X1NA 3Q2DA 5RUBA 2ZDRA 1E6RA 2OX1A 1HF6A 5I78A 3PZQA 4YWSA 4GMEA 1XLDA 3WLRA 3N4EA 3U5UA 3USBA 4MG4A 4JTJA 2D3LA 3BAWA 2WVUA 2OKOA 4FEZA 3TYBA 4YYCA 4AD4A 3MWCA 1XLGA 4JN6A 2E1WA 5LA1A 2PRLA 3PJXA 5DO8A 3ZS4A 1GHSA 4Z2JA 2UY2A 1RQBA 4TTUA 2FTYA 2WM0A 3RUBL 3NDYA 3U4AA 4XD6A 1T8XA 2G4FA 4A3HA 4XB3A 4DWSC 4FI4A 3MA8A 1DWFM 1H7XA 1W2VA 3PY2A 1MXGA 3S1WA 3WD2A 4O4WA 3HQNA 3H4WA 3ITGA 1G94A 3IUIA 3T8LA 4JDBA 3VGHA 1VIZA 4Q3MA 3GBDA 1EFZA 3GH7A 4WOQA 3VPLA 5AHMA 2C3ZA 2F6XA 1F73A 2PDFA 1NF7A 4UTJA 1QRQA 3K1GA 2ISFA 1G4TA 4EIVA 2KZHA 3T4WA 5LA2A 1HP4A 3EWDA 4CNPA 1XG3A 4IFRA 4A8NA 5FJOA 3PBVA 4G9PA 4K1WA 4EP8C 1V02E 5G1YA 3MU7A 3DG6A 1QI0A 1PAMA 1Q6DA 4D6IA 4FK9A 5JBFA 1Z7AA 4CGTA 1OM0A 4GJIA 3ZXWA 4QXIA 4NAEA 3MY9A 1OD0A 1E6XM 2GDQA 2AAMA 1IGWA 3RLHA 1PIGA 3T2QA 3TSDA 2D1ZA 1FP8A 4JQ4A 1KTCA 4FLQA 4YHGA 2E67A 4DPQA 2X0HA 4UR7A 1HKKA 2BY3A 3STFA 1O5KA 1EP1A 1ENUA 3ZR6A 2XVGA 4UNKA 1E55A 5LNVA 4TU1A 3WCZA 5BWAA 3UR8A 4WJEA 1UR0A 4QS6A 5AYXA 3K46A 4EAYA 3PBUA 2PWEA 4B9YA 3WNPA 1NF0A 2ONEA 3LV6A 1DJNA 2A3HA 1MSSA 4C6OA 5AVNA 5G2HA 1W1B1 2FZMA 4FNUA 1SU5A 3BLPX 3R79A 4H8VA 1XC6A 2VOTA 5CC5A 1JI1A 4D2JA 2OOGA 4YVXA 4GUJA 3QC3A 4XD3A 4ATWA 3BQ6A 3M46A 1ITXA 1WBJA 4MUZA 4MZ1A 2VENA 3O9NA 1K7EA 4HTYA 5HWJA 2VGBA 3M5XA 1FWNA 3KTSA 7REQA 1E0TA 2DQWA 1EWDA 1NAL1 1ML1A 4YWIA 4YTSA 3EX2A 1XSIA 1WOBA 4S39A 1TYGA 4NYYA 4FXRA 4CCEA 4GK8A 1CGXA 2WHJA 2GVLA 1LT8A 3W07A 3O3RA 4H6EA 1XLIA 4DF2A 5KTLA 1KCKA 2HNHA 1FDZA 2FH6A 2VX4A 5FF3A 3KAOA 1OYAA 2QCFA 4C7DA 3RIKA 3M5YA 3WDQA 3NSXA 2BHZA 3GNOA 4O4VA 1DWIM 5JVLA 5KINA 3LLFA 5HATA 2WNQA 2UZ9A 2HS6A 5L6UA 1L8PA 2XN1A 4S3CA 3FGCA 2VRKA 4HKPA 1POJA 1PDZA 4IH3A 2GK1B 4IP7A 2YCLB 4AFYA 1RLDA 1PHQA 5G5IA 1U30A 1PB0A 3H7VA 2W4XA 4Y8EA 4PCSA 2QF7A 2WB5A 2B7NA 2O4QA 3QXBA 1SFLA 3CZLA 3HMCA 2E1DA 1DEDA 4MSSA 3GE7A 1V51A 5FIPA 4PUWA 1TIWA 2Z28A 4L9YA 2C1IA 4WHBA 3U2CA 1NQ6A 2W9MA 4OOUA 2XSXA 1EF2A 4JEJA 4ASTA 3CQJA 3GSMA 1YDVA 3MI2A 1SSDA 4PSPA 2WW5A 3A4JA 3M9YA 4W93A 4XZBA 4R5EA 5EFDA 3ZLFA 3VUPA 4IMAA 4F0HA 3AS3A 2VP8A 1XIBA 2YCKX 1E1CA 1Z89A 4GRSA 1VKFA 4IPNB 4GZJA 1Q6OA 3JRKA 3WQFA 1FRBA 1CGTA 3TZFA 5PTDA 5D4YA 3HQ1A 2VZUA 4MKVA 1W3LA 3EKZA 3W84A 2RJHA 3U2OA 3C6CA 5DN1A 2XVNA 3HQPA 1OFQA 1SM9A 4KRUA 3AIRA 4FIRA 3V1PA 3KLLA 1V6XA 4ZGYA 1NELA 4C1LA 3VD7A 5AZ0A 4AVFA 1SJCA 2J7GA 3DH7A 4HA3A 1E6NA 3W0KA 1VPQA 3BSGA 4QCFA 1QI3A 5BU9A 2ZUUA 1GTEA 4GO8A 1W3TA 4RZBA 2QUTA 3OODA 2BS9A 2VHLA 2QCLA 2WC4A 5CH9A 1HJSA 3NSMA 4NAFA 2NV2A 4POCA 4DZ5A 1H7OA 5FJRA 5DBTA 3PZTA 3W1NA 3WMCA 2BOEX 3BL3A 5AHIA 3S2MA 4DNMA 1NDWA 4XWUA 3RJXA 4CNSA 3MB9A 1QW7A 4LYPA 1L6SA 1RSCA 1Y5VA 2ZX9A 1YRRA 3GC4A 1MDRA 3KVMA 4IPJA 2J9YA 3GNPA 5A8MA 1V6UA 3K30A 3B8DA 4UFKA 5CKSA 3MJYA 4C6BA 3FN9A 1WXJA 2FB3A 2OG9A 4F0MA 3W26A 4JHMA 1CGUA 3M6YA 3C2EA 3M6DA 3M43A 4GQBA 5FA5A 2V5DA 2DSVA 2OMAA 3EBVA 2RDWA 3KTCA 2I56A 1WOAA 4IGMA 1Q7ZA 1FWFC 1R3TA 4LUJA 4I5XA 1R3RA 4DJDA 4XUGA 2E6DA 1B3VA 3W38A 2XN2A 5HJYA 2J75A 1GPFA 1XGDA 3W2UA 1H41A 5F4WA 3FEMA 2GGIA 3MQTA 2OCZA 2BB0A 3M5ZA 1ZQ5A 2F2HA 3ITTA 1BYAA 1NP0A 3HURA 2OGYA 2V2CA 4RE3A 2ZZ7A 1OK4A 1UD6A 2HCVA 5LIUX 4GLEA 2J74A 4PRWA 4E4FA 5B7ZA 3I65A 4Z2GA 4LV9A 1EOKA 1Y0EA 4GYJA 4OHQA 4AB4A 2WLYA 1JVNA 2REQA 3W7QA 2ZFAA 3M7WA 3RNDA 1DWJM 3QR1A 3NQCA 1VJIA 2X0YA 4H8NA 3JZUA 1A3HA 1XBVA 4KRZA 5JIPA 1KGWA 3N29A 3W1XA 1IV8A 2B0MA 1NSJA 3L12A 2JF7A 4EANA 3WL0A 4HA0A 3D46A 2V3GA 1LOLA 1UKTA 4OE7A 4AU0A 2FZDA 2FHFA 2ACSA 4AH7A 3UG8A 3CWHA 3V18A 1TTIA 5JU6A 3UZYA 2ZUMA 1LORA 3W87A 1K9FA 5HULA 1HTIA 2PE4A 1UIPA 1GOIA 1J9YA 3OZOA 3LTPA 5I5RA 3H53A 4RNIA 3B8WA 3BW3A 1TKKA 2HZGA 4RV8A 4I7WA 4DO4A 5BRPA 3TJ4A 1W3HA 4Z1CA 1J0KA 3PB2A 2X42A 4FO4A 2V81A 4TUFA 3VKCA 2VGGA 3C0JA 2BY1A 3WY1A 2HRWA 1VEPA 3W2LA 3GYEA 4GYKA 3BZJA 1Z32X 4ZXOA 4GKTA 3QSRA 3TNOA 4O50A 1XYCA 4Y90A 4HSOA 2FFCA 1NWRA 4KPLA 4LC6A 3H7RA 2ZA2A 3VIKA 1TUFA 5CG0A 5HR6A 1QOQA 1TPFA 3UU0A 3KS6A 2VOMA 2QCMA 3OA3A 2DH2A 4S23A 4NP7A 4GYPC 5KMYA 1XKJA 4HQVA 1LCOA 1OGGA 1GPWA 3VKDA 3EDFA 3B40A 3KBSA 3QGAC 1XCXA 4ZE5A 2C19A 3I4KA 1PX8A 1SMDA 3MPGA 2EJAA 4LUSB 3B0VC 2GGHA 5A95A 1TX0A 3SDOA 3OA5A 1QWGA 1TJ1A 1NFGA 1PKLA 1TWIA 4ZQNA 2PWFA 1WX0A 5CPLA 5C55A 2DPEA 3L4WA 4HCDA 3V35A 4KW2A 3W7CA 4AZIA 1CECA 2ZDSA 3ARPA 1SR9A 2EAWA 1DJZA 4WCJA 2V67A 3MHUA 2Y5EA 2BOGX 3PS7A 3HV8A 4PMJA 5FL1A 1KFEA 4JTTA 2YW4A 3NWRA 1UD3A 1DXEA 3LI0A 1R9XA 4GVHA 4R7OA 3WLJA 3FV9A 4WY0B 4OBTA 3GAKA 1UC4A 1UOZA 3TQVA 4EF9A 3L4UA 3PN8A 4NSBA 3U3HA 4BQ2A 1GW1A 4DBUA 1NY1A 2VEFA 2HPIA 1GUVA 2G37A 4XQ6A 1W37A 1UKOA 2V6AA 5D8ZA 3LHWA 4NI8A 2DZSA 4PMQA 2VYOA 2QR6A 1FH8A 4BFAA 7TIMA 3TU9A 3ARTA 4M81A 3UZXA 1QR7A 3U2EA 5A6MA 5HANA 3R4IA 1EP2A 3VZXA 7ODCA 1LM1A 2WSYA 1GOOA 4JKMA 4D71A 4GACA 1DHKA 1IGSA 4WLCA 1IT0A 1IEQA 5F2MA 3HFYA 4NF7A 3SAZA 2Y61A 3IGUA 1O5XA 2DSZA 3K8KA 1HO1A 1RAKA 4QSFA 3AIWA 3JUGA 1JNEA 3QQWA 3A21A 1UYQA 3A5VA 4GUIA 4RW5A 4Q4OA 4FLOA 2C91A 5C9UA 2C16A 1V02A 4DY1A 2CETA 1E5NA 2GQ9A 1O1ZA 3IWPA 3S6DA 2YYUA 1XLLA 2EPNA 4XVDA 4PCTA 2J62A 4S3EA 4Y8FA 1EIXA 4B2DD 4RDWA 1JZ6A 1NARA 4ZCWA 2PTWA 1QW8A 1P1MA 2WSKA 1J0IA 2PGWA 1SFSA 5AHEA 3RJYA 5LNUA 4V15A 5T26A 3GK0A 1Q6EA 3AU6A 1IT8A 3MS8A 1IWPA 1YW1A 3B8UA 1JR1A 3FGCB 3W1TA 1VJZA 3VTRA 3E9AA 1R2RA 2QT3A 1YE4A 4TMCA 3UVIA 4DF1A 1ZAIA 4GI6A 2IPGA 2CWXA 2QVNA 3WJSA 3M7SA 4DX3A 3DFNA 2VL4A 2AQOA 2RDXA 1EEPA 3TA6A 1J93A 3G5EA 5K7JA 1QK0A 3OQ8A 3B8TA 4LF1A 4C6IA 3DC0A 5TIMA 3BLDA 4IFOA 2OB3A 2PDNA 2OSXA 2OQLA 1DWHM 5K9XA 1S3TC 3WQPA 1Q63A 4H41A 3SN4A 5JBDA 4ZQOA 1FQ0A 3GHSA 4PB4A 1N8IA 3WLQA 2YL9A 3CM4A 4P8VA 1HT6A 3CPGA 2ZUWA 5BRBA 5CPTA 5FJJA 1ECQA 3UCDA 1EO5A 3GU9A 3TCEA 4NKCA 1ZZMA 2QYGA 4BKNA 4LBSA 4C6PA 2ZA1A 1OF8A 4V28A 1J01A 4LSBA 3S5ZA 3QEZA 1VYPX 1LWHA 3EWCA 3DXIA 5LHFA 3M0KA 4QG8A 3VIJA