4RE0A

Crystal structure of vmolac in p622 space group
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
313
Chain Sequence
b'MVRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parathion hydrolase
molecule tags Hydrolase
source organism Vulcanisaeta moutnovskia
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
total genus 118
structure length 313
sequence length 314
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4re0A00
1VFLA 1WXZA 2FVKA 2Z2BA 3LU2A 4GOAA 2OB3A 1FWIC 1V77A 1KRCC 1RK6A 5E5CA 4ICMA 2QPXA 4P5UA 4B3ZA 3DUGA 1BF6A 4LANA 2Z29A 4CNUA 4XD6A 4EP8C 1K70A 2RAGA 4GK8A 3SO7A 2BGNE 4QROA 3DC8A 4XD5A 4CNSA 1FWFC 3NQBA 2ANUA 3TNBA 2GZXA 3URNA 4INFA 4XD4A 4LAMA 4YIWA 2GWNA 5LXXA 1QXLA 3QGAC 2ICSA 4HK6A 5AKQA 1GKRA 2D2GA 1YMYA 3K5XA 4C6IA 3E3HA 5A6TC 2Z28A 4H9UA 3CS2A 4GY7A 2HPMA 4B90A 1YRRA 5HMFA 2UZ9A 3MSRA 4E3TA 4KEVA 5FSEC 4GXWA 1NDVA 4PE8A 1RJRA 4H9ZA 3LGGA 4CEUC 4UBPC 1XRFA 1RJQA 3LSBA 2Z2AA 3OOQA 4R7WA 4V1XA 1ONXA 1P1MA 2HPIA 1UMLA 4PBFA 1NFGA 1GKPA 4NG3A 1P6BA 1RK5A 3FDGA 3GU1A 4QS6A 4KEZA 4C65A 4IG2B 3A3XA 1HZYA 3E0LA 3JZEA 2FTWA 4HK7A 4L6DA 1DPMA 1WXYA 1NDWA 4LAKA 4R85A 1I0DA 2ZC1A 1KRAC 1POKA 4KESA 5HMDA 4KERA 2R1MA 3E38A 2YB1A 1RA5A 4PCNA 4RE0A 3GUWA 2AQOA 1O12A 1V79A 4XAFA 4D8LA 1PO9A 2PLMA 3ID7A 3S2JA 4IF2A 4ZSTA 1EJSC 3TN3A 4C6DA 4RDWA 4EPKA 3IARA 3EGJA 1M65A 1YIXA 2OODA 3IJ6A 2YXOA 4J2MA 3RCMA 4ZSUA 2FTYA 4PCPA 1R9ZA 4H9VA 4C6NA 1O5RA 4GYFA 2VM8A 4C6OA 3D6NA 4LFYA 3LY0A 2O4MA 3MKVA 2QS8A 1EJUC 4DZHA 4ERAA 3PAOA 1V4YA 4KIRA 4C5ZA 4LCQA 2UBPC 1ITQA 3B0YA 1UIPA 4L9XA 4LEFA 1EJVC 4R88A 4DLMA 3LNPA 4NP7A 3T1GA 3MJMA 2DVUA 2OOFA 3A3WA 4J5NA 4C6FA 3QGKC 3G77A 3URAA 4V1YA 2Z00A 3OU8A 2EG6A 3HTWA 1EJXC 3AU6A 1FWCC 3MDUA 3OQEA 3R0DA 2WM1A 4WHBA 4IFKA 4NI8A 1FKXA 4IGNA 4JOMA 4PBEA 4C6LA 3UR2A 4B91A 3RYSA 3E0FA 4IG2A 3WMLA 4QTGA 3AU2A 1EZ2A 4C6JA 4F0LA 1A5MC 3BE7A 1K6WA 3N2CA 1RAKA 2GWGA 3OVGA 1YNYA 2Y1HA 4IQJA 4BY3A 4LCRA 2HBVA 4C6MA 3O7UA 4GX9A 4H9TA 2XIOA 2EG8A 1GKQA 2I9UA 1FWGC 3T81A 4EPBC 4BJHA 4HA0A 1ZZMA 1XRTA 3IACA 3S4TA 3URQA 2R1NA 4GY1A 1XWYA 1M7JA 2F6KA 1JGMA 1EF2A 4QS5A 3T8LA 3PNZA 1PTAA 3ICJA 1PSCA 4I6VA 4WGXA 1UBPC 2FFIA 3ORWA 2IMRA 4GC3A 4QSFA 4CNTA 1K1DA 3B0XA 1W1IE 4BKNA 2WJFA 3NEHA 2DVXA 4AQLA 3WZ0E 2Z26A 1YBQB 3TN5A 2G3FA 2HNHA 1R9YA 2FVMA 3LGDA 4GY0A 1J79A 1EJWC 2OGJA 2KAUC 4J35A 3GTIA 3URBA 3LSCA 2BB0A 3CAKA 1KRMA 3B40A 1IE7C 3MDWA 4OFCA 2Q01A 4QRNA 4EPDC 2VR2A 2VC7A 4C6EA 4M51A 3A4JA 4I6KA 4CQBA 3K4WA 2R1KA 3AUOA 4RDZA 1KCXA 1RA0A 1E9YB 1KRBC 1UIOA 5FSDC 3QY7A 4H9MA 4H01A 2VHLA 1A5KC 4KQNA 4C6BA 1RJPA 4CQCA 3ISIX 4DNMA 4HJWA 3IGHX 4HK5A 3F4CA 2VUNA 2AMXA 3SFWA 2PGFA 2A3LA 2WJDA 3EWCA 2Z4GA 3TN6A 5G4HC 3HM7A 3OJGA 3IRSA 4LH8A 4G7EB 1V7AA 2QVNA 2D2JA 1A4LA 1NDYA 4ERGA 1YBQA 2PAJA 2Z25A 4XAYA 3GTHA 4DZIA 3FDKA 3MTWA 2Q09A 3V7PA 3K2GA 2R1LA 2OQLA 3GIPA 3E74A 3UF9A 4DO7A 2W9MA 4Z42C 4G2DA 2P50A 2E25A 1I0BA 1EYWA 4EPEC 3UPMA 3UBPC 1E9ZB 3GRIA 3GU9A 3QY8A 1J5SA 4KETA 4RZBA 4DI8A 3GG7A 3HPAA 1EJRC 2QT3A 3PBMA 1POJA 1S3TC 4IH3A 3O0FA 4C60A 1FWEC 4XD3A 2I5GA 3E2VA 4H9XA 3RN6A 4IFRA 4B92A 3MVTA 4C6CA 4WVXA 4IGMA 4KEUA 3C86A 3MPGA 2HBXA 3F2BA 2E1WA 1FKWA 2PUZA 1FWJC 4F0SA 3KM8A 2PGRA 3S2LA 1FWAC 1FWDC 4C6QA 3WYZA 1A4MA 4XAGA 4GX8A 4MUPA 4IFKB 4GBDA 2Z27A 1M68A 3IPWA 1A5NC 3ITCA 2GSEA 3F2DA 4LALA 3DCPA 3S2MA 3F2CA 1ITUA 3F4DA 3S2NA 3TN4A 2CZVA 4UB9A 4G7EA 2ADAA 4CEXC 1PB0A 4LCSA 2HQAA 4XAZA 4H00A 2VC5A 2D2HA 4TQTA 1ONWA 1XGEA 2WJEA 3LS9A 3FEQA 1FWHC 1QW7A 4H9YA 1A5LC 1EJTC 4LAOA 3CJPA 3QY6A 4RDYA 5CH9A 3PNUA 4F0RA 4DLFA 1V51A 4KF1A 4DIAA 4C5YA 2Z24A 3GTXA 2AQVA 4AC7C 4RDVA 4DYKA 2Z7GA 3GIQA 3EWDA 1P6CA 4IFOA 1J6PA 3IV8A 4GZ7A 4C6KA 2GOKA 3NURA 3PANA 2DVTA 4C6PA 4ERIA 5HMEA 3GU2A 1ADDA 1R9XA 4DI9A 4CQDA 2YZ5A 2P53A 3LA4A 2YB4A 3UR5A 3GTFA 1J6OA 3OODA 2R1PA 3RHGA 2O4QA 1FWBC 2EG7A 3MVIA 1NDZA 1A5OC
chains in the Genus database with same CATH superfamily
4OBTA 1MUMA 3N1AA 1JUEA 3WBYA 1FWIC 2FVLA 3WLOA 2VC6A 3UA4A 2QCNA 5FIPA 4MLJA 3DUGA 7XIMA 1BWVA 3UYCA 4CCEA 3AIRA 5CJMA 2EJ1A 2E6FA 2O55A 3W7KA 3H4XA 1VZWA 3POCA 1OGGA 3BWWA 3E02A 2QJNA 2XIQA 3WD3A 4NT0A 4AB4A 2VX5A 1JDAA 4IQEA 1GEQA 3E49A 3S9IA 5C9XA 5D2WA 4J3XA 2V5DA 3MSRA 5FSEC 4GXWA 2DH3A 3O16A 1RJQA 4UNKA 2BY3A 4OBRA 3GNNA 5AYXA 4XSLA 2RGMA 4HNLA 4AWSA 1UB3A 3ZVHA 1EP1A 1XIHA 5L6UA 3N3TA 1PHQA 1OINA 4RXGA 2F38A 4L6DA 3LTSA 2XH0A 1ODZA 5HK4A 1G1YA 1THFD 1P0DA 1Z6KA 2YXGA 1W3NA 2IXVA 4MNLA 5LNUA 1C8VA 4E2VA 1XP3A 5D8ZA 1N55A 2JFEX 5DCBA 2ABBA 4JL1A 3CL6A 4D8LA 1BWKA 1V0LA 3HMJG 1Q7ZA 3HG4A 3RO8A 3SURA 5FJTA 3A24A 4C6DA 1UD8A 2OTDA 3ECQA 1UZ4A 4IICA 5G2WA 3TXZA 3KBMA 3RIKA 3M16A 4K38A 3NL2A 3WLJA 3RUBL 4GUHA 1TPH1 1LRQA 3KRUA 1MDRA 3ITGA 4WSJA 5H2ZA 1F76A 4GJJA 4C5ZA 1X7IA 1ENUA 2X40A 3TC7A 2EPLX 1CLXA 3LB0A 3QGVA 2GUYA 3RNDA 3KCJA 2X16A 2WMIA 2DZVA 3IJ9A 3KLKA 1ICPA 2OSXA 1UR4A 2ZRWA 3WSUA 5GJNA 2BV9A 3KBVA 3WLMA 3LLXA 3WLNA 5G4EA 3MDUA 5HR6A 1VD6A 2BP1A 5DLCA 3BMWA 4OJYA 4Z1DA 3TYUA 4YJ5A 4W85A 3WEMA 1B54A 4E6MA 3HOJA 4I9MA 3T08A 2H3DA 2HDJA 3RYSA 4K39A 2G3NA 3HURA 4ZXOA 3DFPA 4EXQA 1QI2A 1KFKA 2WSYA 4F0LA 4XZNX 3KP0A 4KRZA 4D6CA 1LQAA 3UT0A 4V15A 1VFSA 1GYMA 2NXIA 1JG9A 3AYVA 3O7UA 5D37A 4W7UA 2AOSA 2RFGA 3MYPA 4H9TA 3K1DA 4O13A 1LWHA 1XS2A 5CAKA 1SJAA 2CERA 1E0XA 4P7QA 3B9NA 4N2YA 3S5OA 3BLEA 3T8LA 5JIWA 1VJIA 5HXMA 1XKJA 4GC3A 3EKLA 2E6AA 3WMSA 4D1IA 1D7FA 2CLLA 4OZOA 4YL2A 1BVWA 4EXBA 4Z17A 4AZHA 3RLGA 3B9AA 1O1ZA 4J35A 1EGZA 2BB0A 1T6MA 5IM51 1KBBA 3N4EA 2XN1A 4JNYA 2PSNA 4HA1A 3VGFA 4Y2WA 4HCLA 3S5ZA 1E6RA 3RILA 1A5CA 4DUVA 2ZCGA 1HQTA 3DFYA 4JX6A 4MB5A 1XC6A 4MNMA 1V3LA 1UZDA 3ZMRA 4IPNB 3AAMA 1RSCA 3BSGA 2DSZA 4F9JA 4YNGA 1AH4A 3DG3A 3QHMA 1CXIA 3OQ8A 2J6XA 2CKRA 4UTTA 3DBPA 4H7CA 1SJDA 4DO7A 1XCWA 3DX5A 5EFFA 2ZVRA 2G97A 4MVAA 4L1WA 4HTBA 1EYWA 2CPUA 1C7SA 1TR1A 2CU0A 2DQWA 4LUTB 2I14A 4DI8A 4FAMA 4ZTXA 1N8IA 1PE1A 3INPA 1E1FA 2XIIA 4H3DA 1V6WA 3THCA 4XD3A 2BOFX 3QN3A 3TQPA 2OCZA 2XIBA 1SR9A 4JTTA 4XWUA 3ZJ7A 1YLVA 2ZX7A 2Q8ZA 3G0SA 4IP5A 5JVLA 4A6GA 1BQGA 3MCOA 4NJIA 2OEJA 1PTGA 4NXKA 1BSLA 6XIMA 2ISVA 3LXAA 3DECA 4O1DA 2E4TA 4GQQA 1XQLA 2X2GA 1PJ9A 4HCDA 3W2MA 1GW9A 1YXDA 3G0XA 3F2CA 4JXCA 2GJRA 4JTSA 1TG7A 4IPLA 4DBSA 1XM3A 3UNTA 3L0KA 1PB0A 4IQLA 4KWOA 3THDA 1HKJA 4KS0A 5HINA 1EJTC 2ZDSA 3WKZA 1YPXA 1E72M 3I3DA 2BHZA 4ML9A 4B4FA 3VDCA 2GJNA 3WDHA 2IW0A 2PF0A 4JTRA 3AHTA 4GYKA 4RDVA 3GHRA 1JDEA 1WQ5A 1S39A 4PMYA 1LOQA 2BVWA 1YXYA 1S5VA 2ZYFA 4PFHA 4WR3A 3P62A 1ODUA 2B7PA 4MLRA 2E7FA 1IEQA 3MO4A 1VBRA 3GTFA 4B5WA 3T55A 4CU7A 2WCGA 3GC4A 4B3ZA 2PLJA 1WXZA 3W24A 3CYJA 5ENLA 4A29A 4MNKA 4ZOAA 2WSRA 2GQ8A 1S2VA 3P93A 1WZKA 1VJZA 1SMAA 2VZSA 4AF0B 3ARUA 5I07A 3TNBA 3U6WA 2GQAA 1PKMA 3R5EA 4XSMA 3EA3A 3GXIA 2D0FA 1S2TA 4HVXA 2YDRA 3BGJA 3G5EA 3DKJA 3JVAA 5DANA 1GKRA 1DXEA 1CXKA 1X6NA 5HQMA 1LWIA 3B97A 1UASA 2DY3A 1QI0A 5U7SA 2CHOA 4HU0A 3C2YA 1ISYA 1SFLA 3KOZA 3AYSA 2TSYA 4B90A 5CC3A 4ILSA 1RJRA 4ACYA 3UCDA 1Y5WA 2PDXA 3Q4DA 1U83A 1BGAA 1JAKA 2CLPA 2W62A 3B9OA 2D69A 1CXEA 4YTUA 4KEZA 3DN5A 1KXQA 4BWLA 1TA3A 4XZLX 4OUEA 5REQB 4PMOA 3UGRA 4WQ6A 2E6YA 3Q45A 4UFKA 2WC4A 2CC0A 1IWBA 2ZC1A 1KRAC 4A8RA 4F66A 1A5BA 3WEOA 1OCBA 1OWQA 4GI6A 4RE0A 1BXBA 3GUWA 5K9CA 3LPOA 1B90A 1O12A 1O95A 1O94A 4UOJA 1PO9A 3PZOA 1HFBA 2RDUA 4W9TA 1P43A 1CNVA 4EPKA 3QOKA 3WF4A 3ARZA 4US5D 2ISDA 4YWIA 2D20A 2YIHA 2VRKA 4IMGA 4CCDA 5FJJA 2WHKA 4E38A 3PP7A 3TK7A 3CO8A 3O2LA 3DFQA 4NAEB 5TNVA 4LNYA 3QLLA 4CGTA 3L5MA 1I6NA 4HA3A 2E9MA 1V4YA 1LROA 5EGRA 3EB3A 1JXKA 4JICA 3EXSA 3LNPA 2DVUA 4GH1A 1UA3A 2JIEA 3MYOA 1MNSA 2DH2A 3VDAA 1XL9A 4ZEPA 4GXPA 1XLLA 3U5UA 3MBFA 1SSGA 4MNJA 4AD0A 5FJUA 2DZAA 1TO3A 1W5PA 1HJVA 2ZZ1A 3W1NA 1OFEA 1Q3NA 4F0MA 4MY8A 2ZDRA 3N6QA 3C5QA 1AODA 4C6LA 4P7LA 4I8YA 3UR2A 1T41A 4U33A 3I4EA 3GZ3A 2HXUA 4Q4PA 3STEA 2PFHA 3CU2A 4C1KA 2QCDA 2PDWA 3W1RA 3UPBA 2NUXA 4GUGA 3AHXA 5F2MA 3CZLA 2CLIA 3CUHA 1F61A 3PF3A 1G9HA 1JYXA 2QZRA 1FWGC 2Y8VA 3T09A 1FY6A 3PM6A 4DVOA 1S2WA 3S4TA 1LLWA 4OTKA 1HN1A 3FJ4A 3UXIA 4MZ8A 2ZUWA 4TVDA 4K8EA 4QS5A 1WZLA 2QEZA 2DUXA 3RPMA 3LERA 4LUSA 3L5AA 2DU2A 5I24A 4FZIA 3MP3A 4PODA 5FJOA 2CBUA 3EB2A 3TTYA 4N9DA 2V30A 1EWDA 2VEGA 1UUOA 3WDJA 3W7EA 3VNIA 2AL2B 2QUNA 4AQLA 4X2PA 3G18A 3GHTA 2FGBA 1K77A 4IPJA 2FVMA 4E8DA 1CXFA 4JYFA 2V68A 2OGJA 1RD5A 2OJPA 2WKJA 1J96A 4HD5A 4QP0A 1AZ2A 1H1ZA 1E15A 1R7OA 4JQAA 4C1LA 1GYLA 4KQNA 3HQNA 5CKSA 2BDQA 2GJLA 3ITTA 4LX4A 5I3JA 2YPIA 1EDGA 4LY8A 5A8MA 4O12A 5LNWA 2XFRA 2PGFA 5B80A 5DMYA 3PUOA 3TE9A 4GBUA 3KOXA 5HUOA 3CLMA 1WOBA 3LOTA 3EPOA 3W1XA 2PDNA 1GQIA 1XLIA 4Y90A 2EPNA 1UH4A 1T40A 4QG8A 3FSTA 4A2SA 2WZTA 3V7PA 1HJQA 2Y89A 3E2SA 1Y5XA 3RLUA 4IUOA 5BOOA 3O6DA 3NWRA 4I9TA 4RZBA 1TJ0A 3KTSA 3LHUA 3UJSA 2DSKA 2J7GA 3F4NA 1GJUA 3U8GA 2IXUA 4WUIA 5I3DA 2EJAA 2XN0A 3MPGA 4I5UA 4UWMA 1RQBA 5HA7A 3VE9A 1MUCA 5EMKA 3WBWA 3TYBA 2P88A 4DAFA 3KVKA 4RLIA 1TCDA 4MUPA 3CK5A 5ABGA 1FWWA 3B3DA 4XZ9A 2XDFA 1B5TA 2I17A 3CH9A 4CD7A 2EF9A 4H8NA 5IHSA 3ITCA 5G5IA 3VIHA 2CITA 3KVMA 2BLEA 3H4GA 3EKGA 1VEMA 2ONEA 3V75A 4TU1A 3I6EA 3SUUA 1LZOA 1F5ZA 4N0RA 3LTPA 3T4CA 1IWAA 3H26A 4DO5A 2WWCA 3FGCA 1RUSA 4PN2A 1GQLA 4F8XA 1B3OA 2G3JA 1TFVA 4K36A 1C29A 3NYDA 5A1AA 1P4CA 4C5YA 2E6DA 2QUMA 4PUKA 3BUVA 5LIYX 5FJRA 1H0IA 1XD1A 3B8DA 4JNZA 2CIPA 4IISA 1RCXB 5HMEA 5DBUA 2ESCA 4IMAA 1FWBC 1MXGA 1MVYA 1CT5A 3P3BA 2Q6ZA 2BWGA 1A5OC 4ECLA 3PBWA 1WAUA 5IHRA 3H55A 1PKYA 1KRCC 3T05A 3A5FA 2YBUA 4P5UA 4ZZ9A 3UERA 5BCAA 2E67A 4GCXA 4PUWA 4C7DA 3NQBA 1SM9A 4D6JA 3WD4A 2HK1A 3NPUA 1I2OA 1US2A 3VIIA 1JYVA 2QDGA 3AC0A 3EDFA 3ZO9A 3MSYA 2YJQA 2OELA 4LV4A 3NQ8A 4HK6A 4Q8VA 3D0CA 1OX6A 3K5XA 3N12A 1X6UA 2W67A 5CSYA 1W1VA 1PUDA 3W7OA 5ECUA 3V36A 4P7OA 4UBPC 3G1YA 1JPKA 4S3DA 2WVVB 4ZCWA 4V27A 5K4ZA 3LBCA 4CUCA 2YDSA 2YXXA 1K9DA 1JCXA 1V8EA 4D2JA 5T26A 4J3SA 2VZVA 3DERA 3ARWA 3VI2A 3LENA 5J5DA 4YYCA 2DPEA 3OVRA 4YVXA 1IXOA 3PSVA 1PDYA 2QJMA 2J9YA 4HPJA 3DFOA 1S5TA 3M5ZA 3M1ZA 1RD6A 2DW6A 4YS1A 1A3XA 3U2CA 3UJFA 1QMLA 2CBIA 5AOUA 4ASTA 5C7VA 3I68A 4RZ6A 2INFA 2I9EA 1LQ0A 3JW7A 3IIPA 1GTHA 2ACQA 3C0JA 1GQKA 5JBDA 4N7QA 3UESA 2A1YA 3AHVA 2IPWA 3IIXA 3OHIA 1XYBA 5EMJA 2ZUSA 2OG9A 3HQPA 3W87A 3LCLA 3RM4A 1J0KA 1FH7A 2WMJA 1NM9A 4BF7A 5CAHA 3GG0A 4OECA 4W8BA 1WDSA 3A3WA 2ZUTA 4I7VA 3UPWA 1D7KA 1EGMA 1C9DA 3EDKA 4LT9A 2A3AA 5JMUA 1KFBA 2XH4A 3NUKA 3PPHA 3W02A 3HO8A 3LXBA 3SRKA 4IGNA 3C3UA 1CB7B 4WRHA 4KMQA 3FVDA 2J9ZA 4TTUA 3LUTA 2GK1B 5M2FX 4C6JA 5EMYA 3V5CA 1X97A 3C56A 1PL9A 3NO3A 4DWSA 1U5HA 2GGEA 4QDPA 5AC5A 2PZNA 3DZ1A 3EWZA 2PWEA 4UQAA 4REQA 3EZ4A 1HJWA 4HZMA 4GJIA 3WK3A 3AMDA 5LSMA 2GFTA 3URQA 1QI3A 1JGMA 1UPPA 2KX9A 3L23A 3BGGA 1XC4A 3D3AA 1H11A 1PTAA 2VFGA 4AXKA 2WOQA 2VD9A 3CIXA 1UOZA 4IIBA 1KM4A 1GOMA 3AS1A 5LNVA 5C2XA 1WPCA 1R3QA 1W1IE 4LRSA 5DN1A 2PDGA 1QDSA 4IIEA 1GORA 1V3HA 2G3FA 3SCSA 3BH4A 4PTNA 1QUMA 5TAOA 5FD0A 3VE7A 2AL2A 1E6QM 3GFZA 3GXFA 3MDWA 1WKFA 1F2JA 2G5WA 2ZX5A 3NZPA 1LM1A 3QMTA 3VXGA 2FPVA 3T6CA 5AHNA 2PEVA 3KVJA 1RA0A 3YPIA 4YTRA 3AMLA 4H9MA 4LF1A 4URIA 2YL9A 1XIFA 3PZGA 1Q2RA 1XQKA 1TIWA 3TTOA 1ZP3A 4A3UA 5G4HC 3AHYA 3S9YA 4N6EA 3ZWSA 3BAJA 2QCEA 3CO4A 4G7EB 5AHEA 4DO4A 4WXZA 2CETA 5D33A 2NQ9A 2YFOA 3GW0A 4DZ5A 6PTDA 3EX1A 3RCYA 3OEXA 1NWTA 1UJPA 1HX0A 4GG9A 2YDAA 3JZUA 3TX9A 2RJHA 5BROA 4KCVA 3N13A 2R6OA 1BYDA 3M41A 1G0CA 3MCNA 2ZIDA 1EQCA 3QY8A 1W1TA 3AYRA 3GHSA 4XBKA 3H2AA 3GVQA 1XBYA 1ZUAX 3C2EA 1XYFA 4DJEC 2PCQA 1R2TA 2I7GA 1ITCA 3EAUA 3PK7A 3VOIA 2IKJA 3EA2A 2WC3A 5C9WA 3UXAA 4NJJA 2PUZA 3WDQA 3NR0A 2CLFA 1W5QA 3N9RA 1AW5A 3T9PA 4E8GA 2POZA 3UWEA 3A4WA 2DZSA 4MJZA 4ZL1A 1E4LA 3THUA 2CFFA 2YDQA 5FCZA 5T9BG 3S1XA 3NPXA 4PULA 1SGJA 2ZTJA 2V2DA 2TPSA 2C0AA 3PZMA 4H6KA 4JTCA 4W89A 5TQLA 5KTLA 2D2OA 1IYXA 3W7CA 3IEBA 4G7EA 2ADAA 1R3YA 1R30A 4POCA 3PZ9A 1V02A 1XCFA 5AECA 4EKJA 4PCFA 1U5JA 2NUWA 4ENLA 5I02A 3FEQA 1UWUA 3KL0A 4H8HA 2VVSA 4OV4A 1JR1A 3QRHA 3GM8A 4DIAA 5AHFA 3U3HA 4WX2A 5DMLA 3VNLA 3S8HA 3OA5A 4AVNA 4DUOA 1KR1A 1RXOB 1OYAA 1PDZA 3GU2A 3M0VA 1TMLA 4B9YA 5XINA 3VX0A 3ZJKA 2GLKA 3MSDA 1IEWA 4KWVA 4FA3A 3MVIA 1JQXA 4LYPA 1BRLA 3MWCA 2A7NA 4A8IA 1J10A 3HG5A 2PZ0A 5E5CA 3UZ5A 4DWSC 1DQUA 1KM2A 3C3NA 4RUBA 4QCEA 1HKVA 3KBSA 2P0OA 4UNLA 1C91A 3IUIA 3AICA 4YXGA 4HB7A 3V18A 4HHPA 1KD0A 2XH2A 3SI9A 2VTFA 5JBEA 3GKFA 3U7VA 1MO0A 3AYTA 1QXLA 5LA0A 1XW8A 4L64A 1HJSA 1UH2A 1XV8A 3W1UA 5KZEA 4OQVA 3IGXA 3O9NA 3IWPA 5IFTA 1O6IA 1E9LA 3QXBA 2E28A 1BEUA 5DX7A 4ZFCA 1OVDA 1XSKA 2PD9A 2P5NA 1H51A 3OOQA 5DT5A 3TMLA 1UUQA 2OU4A 1JNEA 2V5LA 4O17A 1G69A 1K9EA 2NQHA 3KHJA 4QS6A 2EAWA 1FCUA 1ZQ5A 3TWAA 3CTLA 4UTTC 2XTKA 2WBGA 3QW3A 4UFIA 4O16A 4XB3A 3OG3A 4KGJA 2YL8A 3NQDA 4AZCA 4DQWA 4ML4A 3C61A 3ZLHA 4LBRA 3W2NA 3QQWA 4GACA 5LIXX 4KBXA 4NZ5A 3HQOA 2XFYA 2X42A 3NJ3A 3RDKA 2FGZA 2VEPA 4C90A 2PWDA 3VKJA 4PA8A 5BU6A 1OFBA 3N73A 4Q7IA 3C0LA 2H9AB 2OQHA 2J13A 2D0HA 3FAXA 3KFTA 3TJXA 1T0OA 2OR2A 3UU0A 2QDDA 5LNRA 5AYZA 5K7JA 2F2KA 4ADSA 4LCQA 1NP0A 1JZ3A 2AGKA 3BCFA 1UIPA 7A3HA 1HJXA 4O18A 5B7ZA 1IGSA 3MCMA 3TSMA 4NP7A 5DXXA 1C9WA 1CECA 2WW5A 3SN0A 3PZIA 1CBGA 4U31A 2ZRVA 4C6FA 3E1F1 4FLOA 3G77A 3URAA 2XFWA 4H4IA 4XG1A 2B7NA 4WDUA 4NJKA 2DSUA 3U4FA 1EJXC 4OOUA 5E93A 4M8UA 3OQEA 1FP8A 1HKWA 3W7MA 4JPGA 3HV9A 3NGFA 2LLEA 1I75A 4EACA 2EO7A 3L4UA 4MYAA 5A8NA 3E0FA 3CWNA 5BRQA 3WN6A 3QPZA 3MV11 1IGWA 4CNNA 3MP5A 4K8GA 1B3WA 4AEFA 5I23A 3K30A 4F48A 2HVOA 3NYZA 2PTDA 1RHCA 2NLIA 1E40A 1YE4A 4AHQA 4JCMA 3IUDA 3FA3A 1TKKA 3QSRA 4IXXA 4JX4A 4ZR8A 1CDGA 4HA0A 4RL3A 4TX8A 4LUTA 1VGAA 2V38A 3DESA 4CQ9A 4RKAA 3NQ2A 3W28A 4AUBA 4A3QA 4U3CA 1KWKA 3PNZA 3S2CA 5T9CE 3B0PA 3V4BA 1Q4NX 2Z2UA 4NIRA 3WH7A 3BQ6A 2YLLA 1F8IA 2UY3A 1WDRA 4MGGA 3W23A 4B16A 2FH8A 3R25A 4LVFA 2OQYA 2QIIA 1LBFA 2R94A 3ATZA 4ZQPA 1LJYA 4XKMA 3MO7A 4FXFA 4UMBA 1I8JA 4HU4A 4E4FA 4IOTA 2GVYA 5D09A 4RZ5A 5JH1A 4R34A 1DJQA 3UFYA 3WFLA 2IKHA 2G4JA 3OJGA 1KKOA 1NWSA 1UHVA 3I3BA 4O1FA 5CXPA 1A4LA 3W9ZA 2Z25A 3QMSA 2DIKA 3V0UA 2GVEA 1YNQA 2QVHA 2CXEA 3K2GA 3UF9A 3U2ZA 2W9MA 2WVVA 1VENA 1H61A 3QPEA 1SFTA 1XIJA 1I0BA 3KW3A 3UPMA 1TE6A 1J5SA 5HR7A 4AY1A 1E6XM 2Y4SA 4L1XA 5IDIA 2XWDA 3P80A 3BZGA 4K7VA 1NOFA 3SCPA 4B92A 3OGVA 1H5YA 4KWUA 4O11A 1M41A 5EB8A 4BQ2A 2WQPA 3KRZA 4LXFA 1A0DA 1FDYA 3VIGA 4RNIA 1QJWA 2Z1VA 2JQXA 1OT2A 5B7YA 4B2DA 4JN6A 1W0MA 3BXWA 3NNTA 4XBSA 2PU0A 4MTVA 4UR7A 3DIPA 5FKYA 3HJZA 3PJWA 1DJXA 1MYRA 1E73M 2VXNA 2RKXA 3WJWA 3FYOA 4LQ1A 1Q8JA 3UWZA 3ZIZA 5A94A 1VHNA 4DY1A 1UROA 4A21A 3HGOA 4O1BA 1H7WA 4A8NA 2VC5A 2WMIB 2QMKA 2D2HA 4L4MA 3FJLA 4QFUA 3LS9A 4AZBA 3OO2A 5CLWA 4GUFA 3M0HA 1XG3A 5HULA 5HNUA 3EMQA 2JE8A 3M5XA 1M5WA 4CU6A 1AL7A 4BZYA 4DLFA 5HAOA 1V51A 4KF1A 3STCA 4GZEA 4DBUA 2CLKA 1DBTA 1UWRA 4ORIA 5LA1A 2ZTKA 1P6CA 4IFOA 5BOEA 3VK5A 3P82A 4Z1YA 3QV9A 3CV1A 1OFQA 5D2TA 1Q6RA 4ZXLA 1FWNA 3C0SA 1QPQA 3WF2A 1A50A 4QNEA 2BFGA 5E09A 2PURA 1L8PA 1Q7QA 3NZ1A 2PE4A 2A3CA 2V3GA 3TSDA 1VEOA 4QE4A 4YTSA 3CUZA 3W82A 3ZJ8A 4B2DD 3UEQA 3GDRA 3UWWA 4ZQCA 1CIUA 1VF8A 4IQDA 4F0KA 4GK8A 4HZ7A 5CC5A 2FZDA 4FI4A 2FGLA 1CLKA 3V35A 3Q37A 3NDOA 1KKRA 4INFA 4RV3A 5LXXA 3SUWA 5DEZA 3NL5A 2JBMA 2WAGA 1GONA 3R6IA 5BXTA 3VGGA 4QJ3B 4X9SA 1VFTA 1QPOA 3E3HA 4HN4A 5A6TC 3KLLA 5F2GA 4IMDA 1UP2A 1EYEA 3NG3A 1NFPA 1JZ7A 4UTJA 4S3AA 3SN4A 1C92A 3DI0A 3UWUA 1VYRA 3MUAA 1RLCL 3QH2A 4QQUA 4WSHA 4YHGA 4FO4A 3LSBA 1RY8A 2W4XA 1GVIA 4UFHA 1R46A 1TSIA 1KFWA 4HMEA 1NFGA 4TIMA 1D8CA 3S83A 2VEFA 2CESA 4UCFA 4MPKA 4RE4A 3GU1A 4C65A 1XIIA 1I0DA 1S38A 1HIZA 1W91A 4WJEA 4NAEA 4GNVA 1TPB1 3SCRA 3PTMA 1JFHA 2I16A 3ARXA 4DM1A 1DKWA 4JIHA 2A3HA 5I77A 1ME7A 4JTJA 2PLMA 1NH6A 2PDUA 4QAIA 2BXYA 2VR4A 4ZSTA 2QCGA 4BF5A 4GQBA 3TXVA 1I60A 1DQXA 4HZ6A 3RR4A 2E9BA 3GXNA 5JH2A 1OFOA 4PFMA 4ZSUA 3U57A 4CNOA 2C18A 4PR4A 1A5SA 2X1RA 2PS2A 4WSKA 2IKIA 5FEXA 2BNJA 3WD1A 4NAFB 3W7RA 1K4HA 4DZHA 2SFPA 4KIRA 1XGZA 4O28A 5F2IA 1FWRA 1ELSA 5FOOA 1IZJA 4AVOA 3UCCA 2WLYA 4R88A 4C1NB 3R10A 2DZUA 5BRBA 2NZLA 1E70M 4UQEA 4J5NA 2X05A 4Q22A 1IF2A 4LYRA 3R89A 3NQVA 3HFTA 1ZJAA 2VOMA 3CUGA 1GZJA 4L61A 5CPMA 3HPZA 4V28A 1F05A 3HTWA 4LYQA 2EPKX 2EPHA 2Q3RA 1MQQA 3E6EA 4NQ1A 3QMRA 2QJGA 2CBVA 5AZ0A 1VJSA 1WBHA 3N2TA 1XYMA 4KRTA 4IG2A 1ZJHA 4EAYA 5CC7A 3MI2A 5CSUA 4M6VA 1MI3A 4R53A 3ZR6A 2HBVA 4YU1A 4QEEA 4M0XA 1GOXA 3AALA 7ODCA 2H3BA 3GAKA 3KVLA 4J27A 1M7JA 5EPDA 3ANYA 1TB3A 2VGGA 3NFUA 5CZJA 4W88A 3G1AA 5DO8A 3EXRA 4Z1AA 2WMHA 3FAWA 3R7MA 2QGHA 3UGVA 1H41A 4MWAD 5CG0A 5IFPA 1JPHA 3U7BA 1YBQB 1OCJA 4MUZA 1UD6A 3MUIA 3F1QA 4EF9A 2RDTA 4LF2A 2C1IA 4AD4A 2NVCA 1PPIA 2ATSA 1EWEA 4M3PA 1KCXA 1UD3A 2OT1A 4GVGA 3VOFA 1UIOA 2XN2A 4KCWA 4HP5A 4B5SA 1AMYA 1GVEA 1OCNA 2VHLA 3UCQA 5AYIA 1TX0A 2DP3A 5AHLA 3FKRA 1YADA 3CHEA 2NVAA 3VFCA 1DJIA 2BOGX 2V5CA 3EWCA 1UKSA 3BTNA 5JUVA 3R43A 2PTZA 2YL5A 2NX9A 2ZXAA 1UWAA 4IL2A 2FHFA 2W79A 1EA0A 1FVPA 1W9PA 3KWXA 3FDKA 3PZTA 2OQLA 4C7FA 2Y7GA 1EF3A 5G4WA 2FLIA 4DJFA 2XJ7A 2DIEA 3CT2A 1FX6A 3M44A 2FZ8A 3QEZA 2VO5A 1OG6A 2PWGA 1A3WA 2QT3A 1POJA 4W84A 5DY2A 4IH3A 4Q7NA 3W6LA 4RE3A 3C2VA 1F3WA 5T91A 4QE5A 4WVXA 2PWVA 1H7OA 3QFEA 3ZSSA 2VURA 3G6MA 1EX1A 5H8PA 3RITA 3SY5A 4JIPA 3MHUA 2BGSA 3AXKA 1V6YA 3QZAA 3ANUA 3RLHA 1E6SM 4F79A 1BTMA 1I2QA 1E1EA 3ARRA 4LALA 3UZXA 1HVQA 1O66A 3QQ1A 3S2NA 1E5NA 3IGSA 2J7CA 2J9XA 4AWEA 4FNRA 5EMUA 4NL1A 4KRUA 2WPBA 4LCSA 2D1ZA 2FZ9A 3AWOA 2FDSA 2BY2A 4JIIX 4U4MA 1TV3A 1AVAA 4F0RA 2XGBA 3IJQA 2NT1A 3MI3A 4AHOA 2AQVA 2GVJA 4J28A 4AH7A 3GIQA 4UTFA 3T40A 1UG6A 3HGRA 3NIYA 1XH0A 4C6KA 3TIMA 1JCYA 2A85A 4F2UA 1GEHA 4DRSA 3H7VA 2VMFA 3LA4A 3FHQA 3EMCA 2R1PA 3LLFA 4Y8EA 1WAWA 4ZFMA 5BWAA 4EOUA 2E8ZA 1XIMA 3LV5A 3QPYA 4MY9A 3VOHA 2MANA 3FK4A 3KTCA 1LUCB 3NSXA 2PDYA 4DBDA 4ICCX 3IIVA 1B31A 3LZ3A 1W5MA 5AVNA 1A5AA 1FCQA 3M43A 1IWPA 3WJZA 3A23A 5DELA 4CNUA 4LC8A 5REQA 1CI1A 4IPPA 2ANUA 3M0IA 3MC5A 4XX6A 3NQMA 4MF4A 2HMCA 3WQPA 1U1JA 3RU8X 1IT7A 3P7YA 1FA2A 3BV7A 3NTYA 4PUMA 3RPTA 2YW4A 1HT6A 3MZ2A 4C6IA 2UZ9A 4DUXA 4DB7A 1TIMA 1VRDA 4TX6A 4AZ5A 4CEUC 4S3EA 1QWGA 4O57A 5K4XA 3TDFA 1KGUA 4QJ4B 2OZ3A 4IWWA 1IEXA 1UC4A 4Y96A 4LW7A 3O6YX 5A69A 2Y8KA 3DGBA 4BI5A 2G95A 4UNIA 3T7VA 2VOTA 5HMDA 4BEQA 4MJ4A 4KEMA 4M82A 4XV0A 4Q6JA 3ZT7A 3T2QA 2X1SA 1TREA 4CD8A 4CD5A 1CTNA 3WY1A 3UG4A 2QIWA 1XDMA 3EYPA 1KBKA 3G1SA 1CGVA 3TOPA 3BZJA 1L9WA 3OP2A 3EWWA 4IXHA 1Q6DA 2FTYA 2V3EA 2WC7A 3A4XA 1CGTA 1U33A 4LEQA 3LY0A 1EOMA 1UJQA 5CBJA 1UBSA 4A3YA 1QFEA 4HPNA 1EZWA 1ITQA 4PMUA 1SFSA 4LEFA 3IUHA 5K2ZA 1NF0A 4Z0JA 1E51A 3N2XA 4AIOA 4XVDA 3QGKC 4DX3A 3AMGA 1JF5A 4JQ4A 2Z6IA 4PTXA 3LI1A 3ANVA 3FEMA 1W3HA 3CGTA 3MS8A 4N9EA 1R3SA 3CWHA 2NV1A 4M6PA 1YW1A 3FN9A 1ZSXA 3ITXA 4XISA 4L7ZA 3II1A 3BQ5A 2CYGA 1YDOA 1JAEA 1SO4A 1I2RA 4PMQA 2QHAA 2YKKA 3POHA 4LVBA 3TH6A 4O4WA 4BY3A 3VDGA 3PS7A 1AJZA 4XIMA 2PI6A 2PDIA 5HWJA 5D9MA 3HIJA 4PMZA 2ZOXA 3T81A 2E09A 4GRSA 4L80A 2DJXA 4WLCA 3E96A 5EKYA 1XWYA 4DBWA 1HW6A 1V0NA 1YE6A 5E9AA 2C1GA 3NQFA 1WE5A 2XM2A 2VCBA 1H09A 2Y70A 5BYWA 1SU5A 1MEHA 4UZSA 6CGTA 3DHPA 2J7EA 1G5AA 3CQKA 2E0PA 3PSWA 3WZ0E 2HWGA 3R8HA 3TYZA 1Q6GA 1IZKA 1V03A 1AA1B 1R9YA 3LGDA 3F5KA 2INZA 3UVAA 2BOEX 3GAYA 4QRNA 2VR2A 4TUFA 4S39A 4I6KA 1J0JA 4K1GA 2XIMA 2O92A 3LNMA 1UYQA 4H01A 3TC3A 1VCGA 1EOKA 4FX8A 3A12A 5CLTA 4JIQA 3WUEA 3P14A 2PAJA 1VIWA 1XIBA 5E6YA 2D0GA 3K1GA 1WP6A 5C8BB 2J47A 2PDQA 4JN8A 1EO5A 3GIPA 3CHCA 4ZQNA 3S46A 1Q63A 3HPXA 3E9AA 4ROQA 1OSEA 2QDHA 4FIRA 4QBXA 2FYMA 3PTQA 4RNJA 5I6SA 1J2WA 3U9IA 4XTDA 4GNKB 5I7GA 2P8BA 3DXIA 3LG3A 4J1OA 1LCOA 4IGMA 4KEUA 3NCOA 3PN8A 3VC5A 5HDRA 3F2BA 2VGIA 1DJYA 4F0SA 2J66A 4FMVA 3VD5A 1ME9A 2ZX8A 4H1ZA 2HXTA 5HATA 3QLDA 5CGTA 3O0KA 4GWEA 4IFKB 1HL8A 1ESWA 4N02A 8TIMA 3HGSA 3LMYA 2C6QA 3F2DA 1V6TA 2NWSA 2UY2A 3DCPA 4MWAB 1MW2A 4O15A 4FNSA 2B7QA 2D22A 2J62A 2I5QA 2ZZ5A 1W1A1 1QW9A 3LQLA 2HE5A 3TCSA 1AJ2A 4IMEA 3O6AA 5BW6A 4HPXA 1QNOA 1MXDA 4PSPA 4P8VA 1KCZA 3EOSA 3CTTA 1W9XA 3M07A 3OHMB 2F6XA 4L65A 3W88A 4V2XA 4PH6A 3GTXA 1BSIA 3RAOA 3MT1A 3VU2A 4PUNA 3NQAA 4GQGA 1B9BA 1JI2A 3W1LA 1UZ1A 3WNOA 4CLMA 1J4EA 1MW3A 3H2NA 2UY5A 5ABFB 3LTYA 2ZA2A 4JX5A 3S1UA 4ATDA 1IXNA 2GJXB 3ENLA 3U5YA 3VGDA 5K9XA 1J6OA 3O07A 3SADA 4FXSA 1BAGA 1BG9A 2QPSA 3L4YA 3MANA 3M64A 5G2HA 3FCPA 1BF6A 2BODX 2ZKMX 4AD1A 2CLMA 4M81A 5CC6A 3QZEA 1VFFA 2QCDB 3R79A 4AF0A 1HXJA 3LCIA 5CJ5A 3IJIA 4S38A 4H9UA 4AD2A 1OX4A 2QDEA 4KGLA 3BL3A 4ZVJA 1YRRA 2FH6A 3W83A 2BXVA 1FXQA 5CPTA 1XLEA 1TCMA 4S3CA 3RX2A 4DAIA 2VX4A 2Z2AA 4XZHA 5DMNA 5A6KA 4L4PA 2X0YA 1UMLA 3NO1A 5LNSA 3TAKA 7REQA 1VQTA 4QG9A 2FPTA 4IG2B 4LB4A 5F7UA 2QV5A 1ZU8A 3I7RA 3L68A 4R85A 3UWVA 3BW2A 1JI1A 2A3BA 4YLWA 1ICQA 3NM1A 3M6DA 4HQVA 5FL1A 3LEPA 1X1OA 2AQOA 3W7DA 3IANA 3SGUA 4PTDA 3N19B 4FX7A 4F2TA 1W3LA 4RDWA 3A9BA 1TPC1 1UR1A 1QHOA 4JEJA 1P6WA 1M7PA 4CCCA 1Z9AA 1TPWA 4L4LA 1MXSA 1JDDA 3NVTA 1TWDA 4D6FA 3WELA 3GBDA 2VWSA 2Y85A 4Z2LA 2QS8A 2ACSA 1BVNP 3KOYA 4U5KA 3FXYA 2JGQA 3CHDA 4DXVA 5XIAA 1PYMA 3BOFA 3TUUA 3RM9A 2GSJA 5KITA 2YCLA 4L6OA 3CV2A 4JTGA 1UA7A 1AK5A 1GZGA 1EGVA 4NYUA 1SW3A 2NT0A 1LBLA 3GR8A 3SY1A 1AQ0A 3LM7A 4IFKA 4JQ3A 1XDLA 3BCDA 4PCSA 5CGQA 3ZR5A 2DIJA 1EFZA 1RALA 2VFFA 4QTGA 1KGXA 1MFVA 1A5MC 3ITVA 2PCEA 4WIWA 1QNRA 1RAKA 3C52A 4UCGA 8CGTA 1KM6A 1XJBA 1OFAA 5J5RA 3QM3A 1UR3M 4Y7EA 3WLRA 3VCCA 3WH8A 4UTMA 4WEVX 3LRMA 5C54A 1QCWA 2C7FA 1ISZA 1E55A 3AS0A 2IPGA 4HT3A 1NOWA 3BAXA 1MSSA 5ECVA 5DCEA 4JTAA 3MBDA 3L66A 4OIFA 2E5CA 5TF0A 3AIBA 2BASA 1F6PA 3QTPA 2VELA 2VGBA 2Z26A 4J3ZA 3LCFA 1PWLA 3N17A 3MZNA 3M4HA 1DWFM 3K46A 1VBHA 2GGGA 4R33A 3TTQA 1ITXA 4Q4KA 4AD3A 1IE7C 4EPDC 4YCPA 4JTKA 4M51A 1E9YB 4S3FA 3FSUA 5TIMA 2BTMA 3VINA 2YSWA 2WJDA 2Z4GA 2WANA 4TR9A 1XF0A 3WNKA 5BZAA 4OU1A 1QT1A 3IVTA 5EY5A 1KXHA 2Y5JA 2QAPA 1H4PA 1NDYA 1WDQA 2YCIX 4LU0A 4ZQOA 4XAYA 3CH0A 3GK0A 5FAJA 1B3ZA 1JCNA 4BWLC 4CNPA 3E2RA 2DGAA 5H91A 4J2PA 4Z42C 3MU7A 1FXPA 1VLIA 2AL1A 4A3RA 3P8JA 2WHLA 1JCJA 1E9ZB 3TWBA 1WA3A 1A0EA 1DJGA 5EMLA 3GG7A 3AS3A 3FXGA 2A4AA 3TCEA 1HUVA 2VJXA 1XBZA 2NLYA 3BOXA 4U10A 1R86A 3GXMA 2R91A 3KCOA 3KM8A 1B3VA 3IS4A 1XINA 3G1XA 1CYGA 2DQXA 3XINA 3VYLA 1WZMA 3L65A 4S1FA 2FZMA 2C15A 3H12A 1OEPA 2OO6A 1J0IA 5AC4A 1GWJA 4HNNA 3SBFA 1H3GA 1KBIA 4ZE5A 1E1CB 1OFDA 2Y62A 2B4GA 1F3XA 2C19A 1S5WA 3UJEA 2AKMA 3IV3A 3HA1A 2NQ5A 1EUAA 4CEXC 5FA5A 3EDDA 3KZSA 4XAZA 1LWJA 2HQAA 4CN1A 1C90A 1XGDA 4JKMA 1YDVA 4ROPA 1R3VA 2TMDA 2WJEA 1F07A 3GX9A 2O56A 1CZ1A 4NX0A 2O9RA 3KL5A 3L4VA 4ICNA 3LV6A 4LVGA 4Q4MA 4GGBA 5KEZA 2NXHA 4OT7A 1PVNA 2WJZA 1YYAA 2RGLA 2YOCA 4Z2GA 4FIQA 4NRSA 1HVXA 2Y7DA 3EWDA 1V3JA 3W2LA 3W71A 4U3AA 4BK9A 4RW3A 2GOKA 3LPGA 3LCGA 2BXZA 1MNZA 4ZQMA 1F4HA 3SQMA 4LV9A 2NUYA 4ZO6A 2ZZ6A 1KM1A 4HMNA 1DXFA 2NVDA 4Q7BA 4HNUA 1FDZA 3WQEA 1AH0A 3QV7A 4UXDA 2GUBA 4FB7A 2AAAA 5CJNA 2FHBA 1O60A 1LLOA 3LYEA 1M7XA 1PKNA 4W87A 5DCDA 2Z29A 3C6CA 2RAGA 1J0ZA 3UXKA 3VGBA 3THAA 1Q5MA 3STGA 2DT0A 3GNDA 4PCTA 3L0NA 8XIAA 2GWNA 5EFDA 3V16A 3W07A 5I78A 4W8LA 3NL6A 4AU0A 3QFWA 2W6RA 2Z28A 1W3JA 4MWAC 1LUCA 1X1NA 4KEVA 3ZM8A 4WGHA 2Q8LA 3WD0A 1TZ9A 5H8UA 2WVTA 1VCVA 1HNYA 3B04A 4M29A 2ISWA 2VQUA 1P1MA 1A53A 4PBFA 3VIOA 3EX4A 2PB1A 4GZJA 1G01A 1UOKA 4NI3A 5D32A 1RK5A 2Y7EA 4F3HA 2TRSA 4Y9AA 1WXYA 2X0HA 2C71A 5GPRA 6A3HA 3N25A 2F61A 2V0TA 1KXVA 2OOGA 1POKA 3IK4A 1ZTVA 5M3WA 2QKFA 2DSWA 4OE7A 1OIFA 3MJYA 1QBBA 1PKLA 3A9IA 4W93A 4GIRA 3MKKA 2VRJA 2L5HA 3TA6A 2WHJA 3UWYA 4BI7A 5DRCA 2PRMA 1QNVA 3AXXA 5C0QA 3THQA 1DE5A 2OODA 3IJ6A 1DXIA 1Z44A 1R9ZA 3S1VA 2W61A 2QW5A 4LBSA 1UUMA 3OVQA 1Q45A 4MHBA 4R9OA 1US3A 5BRPA 3SFKA 3AFBA 4WCJA 3GC2A 4FK9A 2OGYA 4PRRA 3VC6A 2VNCA 1E56A 5GJMA 4BA0A 5U4NA 3TQ0A 5HQEA 3L5LA 1YTKA 4PTVA 3QV8A 4YTQA 1K9FA 4TMBA 2BGQA 2Y2WA 3W26A 4HU8A 4MIMA 5KZMA 3BLPX 4PEEA 1UC5A 1SZEA 3OLGA 1VPQA 1VRXA 3LCHA 1W5OA 4HYRA 3TJIA 3ZR4A 5F4XA 3V3WA 1BLIA 1TMQA 4BF9A 1S2CA 4Q4OA 1ZBWA 4CCZA 3WLIA 5GQBA 4JS3A 1UMYA 1WNOA 3WMLA 1XIGA 3AU2A 2ZC8A 6ALDA 3WLKX 3CQHA 5D2VA 3WNPA 5M03A 3MHFA 1K3UA 1PS9A 3KOFA 1QK2A 1V08A 3OVGA 2Y1HA 1O7AA 2WWDA 3PFRA 4CN4A 4PB4A 4C6MA 1REQB 7TAAA 1P1XA 3VNYA 4G56A 2ZWZA 1VPYA 1KFCA 3CV7A 4MZ1A 4ACZA 2WM0A 3SCVA 1RY0A 5BXRA 1HKMA 3GHUA 1BYBA 2V5KA 3WQ4A 2BVDA 1WKYA 5CZSA 3N4FA 1SO5A 4KWWA 3UA3A 1FTXA 4CNTA 4HCHA 2DVXA 3EPMA 3ES8A 5FEWA 5A6LA 3ALGA 1BF2A 2PBOA 2GJPA 2YA2A 3LXCA 4GUIA 4RPQA 3WJSA 4OOZA 4FF5A 4ONVA 1OT1A 2A5HA 2O0TA 4P7RA 3VIFA 3GTIA 3BGAA 1TPUA 4JQ1A 5E6ZA 4Q4QA 3DKLA 1HKKA 2GL5A 3GVRA 2WNNA 4H19A 1K4GA 3PVFA 1OF6A 3L12A 3QY7A 4EX4A 1SO3A 1TQJA 2J8FA 3VFLA 2QLYA 2VZUA 4H7ZA 4ACZB 4HK5A 3M5YA 4ZMGA 3F4CA 2VUNA 2EEXA 2XVPA 3SFWA 2QAFA 3AXMA 1WKEA 2HE8A 2W91A 3P5YA 4AZ6A 3P60A 3EWXA 3HZ3A 3M7SA 1V7AA 1OZQA 1W3KA 1EDQA 3WBEA 4AC1X 4JY9A 4QDMA 7TIMA 1KA9F 1OYBA 3E12A 3MTWA 2OEMA 5FAGA 3UYIA 1OY0A 3OPSA 3VD4A 1HKIA 1JDCA 1KGWA 1U22A 1ZBKA 3SN1A 5HPOA 4MADA 2R24A 3W74A 2YCJA 4UQBA 5D2YA 5GNXA 4KW2A 3OBEA 2XVLA 3C86A 2QCMA 1EC7A 3U0HA 3FA4A 2IQ0A 4HN8A 3ABSA 1Q6QA 3WUFA 1WDWA 4P8UA 1E6NA 2WCSA 2VUYA 4PUJA 2AQWA 3OLIA 4EXAA 3GC5A 2HNEA 1BWLA 2Z27A 3SY8A 4Q8PA 1LL7A 1LOSA 1TPDA 5EU9A 1NVMA 3S2MA 1TUXA 1J11A 3LD5A 1TJRA 3WDPP 1PYFA 5C71A 1DL3A 2WNQA 4LYKA 3W1PA 3IAPA 4TQTA 5FEPA 1A5UA 1CPUA 3RM8A 2Y63A 1K6AA 1RR2A 1VBGA 4S2BA 4DWSD 2R14A 1UKPA 2NQLA 2B81A 2JEPA 2G4FA 2FZBA 2Z24A 1OYCA 5CZ0A 3I10A 4AC7C 4DYKA 4AZGA 1NAL1 4IIDA 1DJZA 4Y9MA 1YDNA 3BC9A 3VIJA 3W4RA 3WLSA 2YGYA 3VOJA 1ADDA 3ZVHB 2ZXQA 2ALRA 2VFIA 2BVTA 4AG0A 4M7TA 1XX1A 1SSDA 4IGHA 3K8KA 4HNOA 2I56A 1TPVA 3NZRA 1NOUA 3PPFA 5KINA 4RR4A 1RPXA 5JIPA 3EXTA 1V77A 3OYZA 4XZWA 2QPXA 1G4TA 3TTEA 3LMZA 1C3FA 2ZICA 1Q6CA 1GHRA 1LDCA 3GVGA 3PWGA 5FF2A 1L6YA 1R3WA 2OX4A 3BLFA 2GZXA 3PZVA 3GNOA 2W66A 4GISA 1EPVA 3H8AA 3NSMA 5LIWX 3AIWA 3G0UA 1GGOA 1VBUA 2ODOA 3GDKA 3LRKA 2CHNA 3HQ1A 4KWSA 1OC6A 1YPIA 1QO2A 1A49A 3BJFA 1TV7A 2JF6A 2BHYA 3UW6A 1AQMA 1C93A 1NDVA 4PE8A 1IQ8A 4PB5A 4JGDA 1XRFA 3N29A 4K3ZA 3AWNA 1ONXA 3KHDA 2WB5A 1TELA 3ABZA 3FA5A 3MV01 4H6EA 3FDGA 3JZEA 3AMKA 3VDHA 2C16A 4ZE4A 4H2HA 2PDJA 1ZPTA 3WENA 3WF0A 2Q3OA 2XSBA 3SQLA 3AHZA 3VM7A 3L2MA 6REQB 3FFSA 1V79A 2OVLA 3U48A 5HWMA 4O54A 3MW7A 1YX1A 1E4NA 4IF2A 2WO5A 5IOBA 3QHNA 2RHGA 3IARA 5JQ9A 4QSHA 3PFMA 1GCYA 2Q02A 1UWTA 2FJUB 3FW6A 3RCMA 5AVHA 5BXPA 3O63A 1EEPA 4C6NA 3UP8A 1BXCA 1XCXA 4GYFA 2Z0IA 4DWSB 3DYOA 4LFYA 4TTGA 1NP2A 1Q13A 3S3GA 3ZOAA 1LF1A 3OIXA 5KETA 1FH8A 3C8NA 1F3EA 3VZYA 3S6OA 2NX1A 4QG6A 4LGXA 3KUMA 3WQDA 3LRLA 3CUXA 2QUVA 2ZRUA 3L9CA 2B0MA 3UY7A 4JTFA 1SQ7A 1W17A 3GXDA 4V1YA 2WVSA 2VZOA 3TR2A 3KS5A 1ISXA 1MW1A 1ADOA 1BQCA 1Z3NA 3IJ8A 3SJ3A 3AU6A 3OZMA 1F8MA 1IR2A 1JXJA 4IGSA 1TWWA 2WM1A 1PCKA 1TZZA 1W6TA 4XK2A 3NGJA 5BU9A 1R2SA 5C7HA 4MFDA 3RXZA 4W5ZA 3G1VA 1MQRA 4W7VA 1O5QA 3KE0A 1XLGA 1C8YA 1SW7A 3V0TA 1S3HA 2JKPA 2RDWA 3ZZ1A 3WNNA 1Q85A 4IQJA 3GVVA 3WLPA 3COTA 4EPBC 3TSBA 3WNLA 5BMXA 3TNOA 3KP1A 3ITYA 4E0CA 2O9OA 1J01A 4D1JA 2YCEA 2B31A 1YXCA 4M6UA 4D6HA 4M7SA 3ORWA 4JIRA 1VP5A 2WZIA 3QQ0A 4IP4A 2C14A 4AWUA 4P61A 5I5RA 3VKBA 4I3GA 1FWTA 4WK9A 1TTPA 2INEA 5CBIA 3PBYA 2OPJA 4B3LA 1ISVA 1I9CB 1EBHA 3UG5A 3EB4A 3ES7A 8A3HA 3B40A 1EH9A 3ZLFA 2VC7A 3A4JA 2O9PA 3VM5A 2YA0A 1XHGA 3BICA 1KNWA 1KQZA 2W0UA 4UR8A 1JNDA 3HGJA 2FIQA 3ISIX 4FLRA 3UG8A 2E3ZA 2E77A 3CAQA 3FNDA 2PD5A 4PEKA 3WCZA 1YBQA 4TX9A 1GPFA 2JKAA 3USBA 3OG2A 4GUJA 3ONCA 4HMDA 1JL8A 1SR0A 4G2DA 4EPEC 4LNCA 2QPUA 2J24A 3VD3A 4DXXA 4JHOA 2G37A 1VFMA 3O0FA 2I5GA 4KT2A 3PWAA 3SJNA 2A7PA 2P0IA 3PZQA 5CPQA 3HB9A 5CEWA 2Z1SA 2ASHA 2DV0A 4KFNA 3EX2A 1AD1A 1E6ZA 1FWAC 2GDUA 5CG7A 5FESA 2PU1A 2ZXDA 4A8LA 3AJXA 4GBDA 3PTKA 1L2QA 4LS1A 2GSEA 2PODA 3FYYA 2UWFA 4GKTA 2VWTA 1W9BM 2OXNA 2NSOA 4CQAA 4H8UA 4GO9A 1UR9A 3GNRA 1JRBA 1R0MA 4CU8A 1OC7A 3G1HA 3T8QA 3CEPA 4E8CA 2OWWA 2QQ6A 1ZAIA 1A5LC 1XBVA 1WKDA 3A47A 3MP4A 5CZTA 5IBXC 3LQGA 4M80A 3V1PA 1SJCA 1B4EA 1H1YA 4YTTA 1Y7VA 2AAMA 3PULA 4HNTA 5RUBA 2HV5A 1QATA 1JUBA 5HNNA 3IV8A 4DHGA 3PANA 4DN1A 3IVUA 1KLZA 3KXQA 1H2JA 3OVPA 4O1CA 3PB2A 1WZAA 4XBJA 4PTMA 3IJLA 5F2LA 4NXSA 1Q6EA 3T2OA 2VFEA 4LSBA 4B3KA 4IJCA 3CB8A 4HNVA 3EWBX 2J4GA 1J18A 1W1B1 3S1WA 4H8VA 4TXEA 4YYFA 3GH7A 3CMFA 4XD6A 4EP8C 1JUKA 2BGNE 3ABXA 1X98A 2C91A 1ZS2A 4X9YA 2YZRA 4ZO7A 4YIWA 2C13A 3TZFA 3TTSA 1QPNA 3VKCA 3CWOX 2HISA 1WUEA 5SWUA 4GJ1A 1O4UA 4GY7A 1E71M 4ZB0A 2YBTA 3E5BA 1TQXA 3M0KA 4D6IA 4WD0A 4JTUA 3M0LA 4Q6XA 3GR4A 2GQ9A 3NQ6A 2JGYA 4JL2A 4GLEA 1V93A 5FF3A 5HWNA 3B8UA 4G1KA 2FTPA 2HVNA 1RVKA 1JZ8A 3A5VA 3FHAA 3GFXA 4QIUA 5LYRA 2ZZ3A 3OZOA 3VOCA 3DC0A 1D3HA 2PTYA 3H2MA 3H2CA 3C2FA 3M0JA 2IPJA 3W84A 2BHUA 4NNBA 3L7RA 4KERA 3E38A 2YB1A 4OV9A 3RMEA 3UZWA 3R12A 4XAFA 1B1YA 1ZL1A 2XISA 1GVQA 1JYNA 1H63A 1KFEA 2WMGA 4TVCA 4B5UA 3NQ7A 1N2VA 2P3EA 1PCWA 3HBLA 2ON3A 1M65A 3W3OA 2WNWA 1EIBA 5D38A 2V82A 3P67A 3RU6A 4O50A 3CZ8A 2HZGA 4QX4A 4H9VA 1JFXA 3T0CA 4L4OA 4DEFA 3BW3A 4DO6A 2VDIA 3D6NA 2PP0A 3VTRA 3BAWA 3WF3A 2AGTA 3U2OA 4N6FA 4MB1A 4L9XA 1XDJA 1WO2A 1EJVC 4QISA 3GDBA 3NZQA 2W92A 3MJMA 3REQA 3VIPA 2P76A 1SVDA 2GYIA 3ZVIA 3GE7A 3IGUA 2DEPA 4PL2A 4GQ0A 4IM4A 2J88A 2OZ8A 3AISA 3BSHA 4A4AA 3HN3A 3OU8A 4EF8A 2ZX6A 4R9XA 3DEQA 1YQ2A 1OFPA 2H90A 2X09A 5DRIA 3DFTA 3TW9A 3MQTA 5HNRA 2J25A 3R0DA 4A22A 4NI8A 1FKXA 1SUXA 3N9KA 3G8RA 3RLVA 1RP8A 2Y6ZA 2ZFAA 1FFRA 3S47A 3T0DA 2EXOA 2HS6A 1E0VA 4GIAA 3DBNA 4JTDA 1W1ZA 1D9EA 3PJTA 1GKQA 2V2HA 3C0QA 4O0KA 3OBAA 2NSXA 4PZVA 1OX4B 5I3KA 1W5NA 2FMOA 1F3TA 1I2NA 4MZYA 1IIGA 4MYXA 1OF8A 3RRAA 3ICJA 1PSCA 1XSJA 2G8ZA 4WOZA 1N8FA 1XLBA 4F0HA 1G6CA 1QVBA 1R7AA 1K1DA 2ZQ0A 4ZOEA 2D3NA 4BKNA 2RH9A 3TN5A 2VGFA 3GBEA 3R0UA 3WL0A 1RBAA 1XLCA 1J79A 1QO5A 1J12A 3XIMA 2KAUC 1JZ5A 2GDQA 1QOXA 2DJLA 2X1TA 3CAKA 4OFCA 5IXEA 3K4WA 8XIMA 2OWCA 4DJFD 1EKOA 2WMKA 3B9EA 1JIBA 4O8AA 4HMCA 4KH2A 4G1NA 1B3XA 2CCRA 1W37A 1BKHA 2ZZ2A 3EEGA 3TMQA 1HO4A 3OA3A 4JHMA 3Q67A 3W7QA 4JKLA 1R38A 5I3GA 1MFUA 2UV8G 2W27A 1UCWA 3MY9A 1W2PA 1EX5A 3E74A 2REQA 1G4EA 3U4AA 4RZ4A 2GVLA 2OKOA 3CLWA 4I5XA 1TVLA 3BSMA 3GU9A 5A6BA 1J9YA 3R8GA 2POTA 2V5BA 4FX6M 5G2IA 3T78A 4DJEA 4L9YA 1S3TC 2J77A 3WUBA 3UZZA 1VS1A 1RVGA 4EWND 4MWAA 3EPNA 5FEZA 4QM1A 3OYXA 1OK6A 3UXLA 1B30A 2O7SA 1CCWB 3KOWA 4Z2HA 2A6LA 3ELFA 2ATMA 4LTSA 1JGIA 2GK1A 4WY0B 4UZUA 1X96A 4WY0F 1DTUA 2YL6A 4GX8A 3HPFA 1ZCOA 1BYCA 5HPCA 1V02E 4NX5A 1HG3A 3KBJA 4J3TA 5AHMA 1OD8A 4XZMX 1KXTA 2DORA 3B8SA 4PC8A 1OZMA 1IR1A 4JR5A 4UB9A 1TPEA 1VLWA 1IEIA 3KRBA 5DF0A 2PTWA 4HHHA 2PPGA 2HCVA 1G4PA 1ONWA 3VNKA 5J04A 3R8RA 5I00A 5I06A 2QMJA 4Z1BA 5F4SA 4HPGA 1S2AA 1SYTA 4H9YA 3QY6A 1U30A 2BVYA 4GABA 2VX6A 4DJDD 3SCUA 4GVHA 4HJFA 1LG2A 1NFBA 4JD4A 3GFYA 5F1UA 1BHGA 1WUFA 3H21A 3FY1A 2OFJA 1ALDA 4GZ7A 1DIEA 3NURA 5D03A 3IIZA 4UC5A 5C2GA 2B7OA 2OLSA 2OX1A 5D4YA 3G1RA 4UTWA 2O4QA 4IT1A 2AKZA 3W27A 2Z2BA 3LU2A 1ZENA 1UR0A 4A2RA 2F84A 4FR6A 3NSNA 1MMFA 2VEIA 1RK6A 4BEUA 4B15A 3W1MA 2CHRA 3ITLA 4LANA 4M1BA 5A5WA 3HF3A 3SUVA 2G3MA 2QR6A 1IIHA 4X61A 5A6SA 3DG7A 3APTA 3PZUA 1FWFC 4O1AA 4UQCA 4QEHA 1TTIA 4B9ZA 2J8GA 5AKQA 3LDVA 3B4YA 4JDBA 4DUWA 3F03K 1FCVA 2YW3A 4M6QA 4NY2A 1Q65A 1PHWA 1VB9A 3EBVA 2JK2A 1YKWA 1H50A 4XO7A 1RV8A 1MEWA 4HOWA 1PTDA 2PDCA 1YTEA 2QXWA 5JXQA 1GVOA 1GKPA 2W63A 3H7RA 2HEJA 3IIOA 2HJPA 4LAZA 5KSWA 1DPMA 1NDWA 1SZFA 3ZT6A 4LAKA 4E2BA 3V5FA 3O15A 1UQYA 1R5YA 2P1FA 5LHEA 4AHPA 3QR3A 1O1HA 4BR1A 3N14A 2VL4A 2RUSA 3TQVA 2O9TA 3CZGA 4XIAA 3S2JA 2C3ZA 3VIMA 1A47A 4HZ8A 1W3TA 5E70A 3I7SA 3WG6A 4P7NA 3EGJA 1F9CA 1R3RA 2VT0A 3AO0A 3FS2A 5LGXA 3SZ8A 2HRWA 3FLUA 4EAMA 1VIZA 3F7JA 2Y24A 1I45A 4LVAA 2YFNA 3N9SA 3MA8A 1N7KA 4K1WA 3VNMA 2XIJA 1VHCA 3VOGA 3LCXA 5C9UA 3ZXWA 4FEZA 2J8TA 1MW0A 1E4MM 4FP1A 2QGYA 3B9DA 2PRLA 3NQEA 2F7FA 3K4DA 4B5TA 1AW1A 2A21A 2DZTA 4NZJA 2Z00A 3GYEA 3WMCA 4J9JA 1J0HA 4Q8UA 4AEOA 3GB6A 4H6RA 1KCKA 3N2BA 3WNMA 4LOCA 4O10A 3CPUA 3W0KA 5CSSA 3ATYA 1HGWA 1PAMA 1HL9A 4JOMA 1XG4A 4GQRA 1L6FA 1Z48A 1EL3A 1PZ1A 1I1XA 1OX5A 4ZB2A 1JJKA 5FF0A 2RJGA 1ZAHA 2XZ7A 3BE7A 3W81A 1KTCA 1E9IA 3WQ5A 1QPRA 2GWGA 4PBGA 1S2UA 2E5DA 3P6LA 2JF7A 1TRIA 2PLCA 5EMMA 3AOFA 4GX9A 1JULA 1IEVA 2ZRZA 2FHCA 4BJHA 4YPJA 1XRSA 1XUZA 1ZZMA 3LBOA 3UY8A 3WIJA 2H8XA 1TTQA 2F6KA 4BHYA 3IAQA 3KZPA 5C6MA 4I6VA 3CL8A 3TV8A 3GDTA 2VCCA 3VMPA 3RFAA 1NY1A 4FALA 4A35A 1AG1O 2ZUVA 5G1MA 2WJFA 4OHQA 4HYVA 4H41A 2ZUMA 1AQFA 1C8XA 1QRQA 4AIBA 5LKYA 2X7WA 3HJEA 4Q8QA 2A2IA 2X7VA 1BRLB 3UETA 2XM1A 2EBNA 3CYVA 4PUEA 3NA8A 3TONA 3BLDA 3BG9A 3C4UA 2C0HA 5IRPA 2BS9A 4L1GA 2XGIA 1VH7A 2QCFA 2QUTA 2NXGA 2VEMA 3QC0A 2QVNA 2EGZA 4ERGA 3TR9A 1J0YA 1HL2A 3GDLA 4FS9A 3F5JA 1SFJA 4GNJA 1HP4A 4LUJA 4TVUA 3TP4A 1W1YA 2R9RA 3EEZA 2E25A 1VCFA 2WZMA 1JZ6A 4R7OA 2XFFA 4HKPA 3WL1A 4ZTYA 4BI6A 3GRIA 2NX3A 1GOKA 3NXFA 3RO6A 2PP3A 1YEYA 1KM0A 3SCQA 1UR2A 3G3DA 3NVDA 3F4VA 2ZXBA 3CQIA 4I7UA 4FF7A 1MUWA 2PC4A 2PDLA 5TD4A 1B3YA 3N4AA 4C6CA 3W2JA 4LBUA 3H24A 3LHZA 4PSRA 3TAOA 3APYA 3BG3A 1DYSA 3S2LA 5LGZA 5C5YA 5E1QA 4IX2A 4NUWA 4P2VA 3XISA 3H70A 3CV6A 1UH3A 1JRCA 1E3ZA 1LL6A 1S46A 4V33A 3W53A 4EE9A 5MKGA 4Q8WA 4PL1A 1TVNA 4KFPA 1ICSA 4H04A 2EHHA 1UD4A 2VKZG 1R8LA 3EX3A 2ACUA 3W76A 7ENLA 2C1HA 4X60A 1VFUA 4ATWA 1UQZA 1B2YA 3NQCA 5CPLA 1FOBA 3KWSA 2GVGA 3GYCA 3WF1A 4EWJA 1FWHC 3TW6A 5C55A 1NU5A 3H53A 4DPQA 4D8ZA 1VC4A 3BVJA 1S5NA 4IMFA 1MZRA 3PC0A 3SB0A 1NEYA 1OBAA 3QZ6A 1ML1A 1JZ2A 1WB0A 2JKEA 3NEVA 4D72A 2WZEA 1LQ2A 3QJAA 4ATLA 3AUJA 2WPGA 1RLDA 1E43A 2DT1A 4ZOCA 4PMDA 5IBXA 3TLLA 3W75A 4X3ZA 4DI9A 4GYPA 4CQDA 3GIYA 1KFLA 3R58A 2HVMA 2W5FA 3OODA 3CT7A 3RHGA 2V6AA 4XKYB 1ADSA 4N42A 3QW4B 2Z1XA 1EHAA 1DIDA 4JFVA 1R3TA 1LYXA 1OHLA 2FVKA 4GOAA 4AZCB 1T5AA 3DOPA 4DPPA 5A6JA 1CB2A 2WXDM 3HG3A 1DHKA 5CSRA 2FMNA 4X0NA 3URNA 4XD4A 4JTIA 4TOQA 4Q32A 3SSJA 2EKCA 4QNWA 1XSIA 3QGAC 4NSBA 3DI1A 2QV4A 3KDNA 2D2GA 3ARTA 3UZYA 1GG1A 4DM2A 1QU4A 5D2XA 4GC4A 1QHPA 3VNJA 4JIEA 4GPNA 1M6JA 2QCHA 2MNRA 4OWGA 5D02A 1NQ6A 1Z32X 4JY8A 1GQNA 3EWYA 4AY8A 2C79A 2PC8A 4FOKA 4NG3A 4L9ZA 1P6BA 2ALDA 3LHYA 4X2RA 3WLQA 3A3XA 1IXQA 2CZ5A 4HK7A 2ZRXA 3PJXA 1LRTA 3N6JA 3W7PA 1LL4A 2WSQA 1E0TA 4KESA 1XD0A 4NZ4A 3VA8A 4QLJA 2CKSA 1XFCA 1JD9A 1SO6A 1QW8A 3M6YA 1Z42A 4UTIA 3USZA 1JCLA 2BBFA 3B05A 3SCWA 1ZJBA 4Z08A 1D3GA 4H6QA 3ID7A 1HO1A 3QYSA 1E3XA 1BTCA 5M5DA 1K8ZA 1YIXA 3FVMA 1L6GA 4ES4A 2P3ZA 2VQTA 4JHZA 2Y5EA 2ZZ7A 2YLAA 2VM8A 1W9DM 3AJ7A 4H83A 2A3EA 5MKGB 4ZBCA 3RF9A 4ERAA 3KCLA 1OD0A 3PAOA 1XYCA 3VDBA 1OGSA 4LUIA 1QPKA 2ZBTA 1KCLA 4LWWA 3VILA 5AYYA 1QTWA 1GHSA 3Q65A 1BYAA 1RPKA 1F74A 4XVEA 4QXIA 3BLLA 2VFHA 2VDHA 2E9LA 3PY2A 5LA2A 4AAJA 2YBVA 3G22A 2YA1A 3ZYZA 5ABEA 1PX3A 1M03A 1OM0A 3VIKA 2CLOA 4PBEA 4FNQA 3GS6A 1AJ0A 4HOZA 4B91A 2WZHA 3R11A 1FBAA 4J3WA 1KC7A 4WF7A 1BG4A 1GUVA 2PGEA 2V67A 3SECA 4NAFA 4W86A 3N2OA 4JTQA 4JYDA 3RCNA 3QKEA 3SGGA 3WLLA 4LCRA 4E2OA 1GTEA 5D8WA 1YDYA 2ZVIA 2OSYA 4AFYA 4X0VA 1PBGA 5CPSA 1YPFA 4IZGA 3L4ZA 4EK7A 2XGZA 3TYEA 5LIKX 1DWJM 1Y0EA 3CUFA 4FNPA 3VMNA 1K7FA 3IVSA 1K7EA 3ABRA 4WGXA 1KTBA 1XXXA 1IT0A 1TWZA 4D6EA 4P8XA 4UQ9A 2Y88A 1J2BA 3NEHA 5E0KA 3BAYA 3OW1A 4Q4SA 3P61A 2FFCA 4MY1A 3M0XA 2ZA1A 2G41A 3LX9A 4C6EA 5A2CA 3SCNA 3HMCA 1BFNA 2V8ZA 2ABAA 5FSDC 3ZS4A 3H22A 4FXRA 3VUPA 1US0A 3M46A 3ZJ6A 3A6OA 3M0YA 3NQGA 1ZALA 1ONRA 3IGHX 5FL0A 1UWIA 3OB8A 4GCAA 3L21A 2A3LA 4NF7A 3IRSA 1ZBVA 3NM3A 4QCFA 4B5NA 1W1PA 2CLEA 3GTHA 1CX9A 3WUGA 1KV5A 2R1LA 3RX4A 1KW1A 1ME8A 3QR0A 1DWGM 1SPQA 3A22A 1N8WA 3VPLA 1XKYA 1K8XA 3I7QA 3RPDA 1VFOA 2GPTA 3GNXA 3FGCB 3QR1A 1FRBA 2QJHA 2PDBA 1EPXA 1W56A 1XLFA 4LS2A 2Q8XA 4KETA 4GZIA 3PHAA 4F4RA 3V5OA 8RUCA 5I03A 4BQ5A 3FIGA 3M47A 1R85A 3DFSA 4UTUA 3GWQA 4ZGYA 3F4WA 5I79A 3SCTA 4MSSA 3Q94A 2E1WA 1K7XA 1VYSX 1XR2A 1V6UA 1VYPX 3GG1A 1TJ1A 2KZHA 1A4MA 3DYPA 4XAGA 2NQZA 3LK6A 3LI0A 3WQ6A 2BMBA 4WZHA 1DV7A 1DWHM 1M68A 3FV9A 3D47A 3GQYA 4RE2A 4DBEA 4NU7A 4DZAA 1CEOA 4HSNA 3TQKA 3F4DA 4LPCA 1P7TB 3HV8A 4UR9A 4GVFA 3NPWA 3B03A 1P0KA 2YCLB 4X63A 5BNKA 2GSHA 1TV8A 2V2CA 3B8VA 5DT7A 1W31A 2E8YA 3IJDA 3CXOA 3MMDA 3P74A 3VKKA 4UIOA 2DDXA 2WNZA 5A8GA 3G8EA 1F6KA 2VENA 1H7XA 3QYQA 4HOXA 3PNUA 4HGXA 4B5XA 1YNPA 6ENLA 3CL7A 1V6VA 2XPKA 5I3HA 4BFAA 4S3KA 3MI6A 1WBJA 4PMJA 1R47A 2Z7GA 3P84A 4CVUA 3NDYA 1XICA 2GQ3A 4Z1CA 2DVTA 1KM5A 1MWOA 4GE8A 4UTLA 1ZP4A 2CWXA 5KZDA 2PWUA 2X0SA 1V3KA 2QULA 4NJHA 3O8AA 2CLHA 4JFSA 4K2SA 1E1CA 4J3UA 3UG3A 1K9TA 1FQ0A 2TYSA 1RZMA 4LVDA 5HJXA 2VZTA 2A6NA 3CMJA 3ZQ9A 5A6BD 3D3FA 5HOSA 5M17A 5K9DA 1TA3B 1K70A 3SO7A 5HUPA 3H2EA 4XD5A 4CNSA 4PYSA 3O6CA 1X8FA 1VBJA 4RNFA 4FPSA 4D9PA 3R0KA 2OEKA 4ZOBA 1GVSA 2YX0A 2AMGA 2ICSA 4XAPA 1UR8A 4AXNA 1AH3A 1G7UA 3A3HA 3CS2A 1OC5A 3S42A 2E1DA 1ZJIA 3QKZA 2ZUNA 2CXGA 4GGHA 2OYMA 3B4UA 2PTXA 3SQSA 1E0UA 3LGGA 2GGJA 2VC9A 1O5KA 2Z1WA 7PTDA 1RH9A 4V1XA 1FWSA 3VAVA 4U5IA 3B8IA 5C2CA 3I65A 1XIDA 2GGHA 3G2GA 5AHIA 2VDGA 4KIEA 3E0LA 2FTWA 1EDTA 1KTNA 2QUUA 3PUGA 3AIUA 5I2UA 2G3IA 4NKCA 3GSMA 3NO5A 1TE1A 3L67A 3I6RA 4GIYA 4ADTA 4MM1A 4NILA 4E5TA 3LPFA 1RA5A 5GJPA 3JS3A 5AYBA 5KMYA 2DFAA 3UVIA 4NYYA 3OZYA 4MFEA 2BSLA 1V0MA 4NVTA 4JKKA 9CGTA 2PP1A 3REQB 2QF8A 1K02A 3E5PA 1UZHA 2FDMA 3M9YA 3R4IA 1XLKA 4I90A 4QR6A 3PR2A 4PCPA 2DW7A 1ZNNA 4M5PA 3QVQA 1G94A 4O53A 2V69A 1LP6A 1LT8A 1GQJA 2O4MA 3MKVA 2Z1BA 3IRDA 3DAQA 2O7QA 3DFHA 4K68A 1OADA 5H1WA 2OKTA 4O0QA 2R82A 1H5VA 4DELA 5A3HA 2XSXA 3FKKA 4IHCA 5AC8A 2F2HA 3AI0A 4MJ2A 1OGBA 2OOFA 1J8VA 2PWFA 2XSAA 2ZZ4A 1SZGA 1WYIA 4GHRA 4BCEA 3GTNA 4J4KA 4Y8FA 3CBWA 1EJ7L 3P0WA 1GPWA 1PIFA 1Z8AA 2CZDA 3BANA 1AD4A 4HBKA 2DZBA 3GDMA 4I8DA 3AIQA 3O06A 3ONBA 5DXYA 1TYGA 2YYUA 1CXLA 3W1AA 5BXSA 1DE6A 3ARQA 4MAVA 3WLHA 3VCNA 1EZ2A 3MWAA 3DHDA 1K6WA 3N2CA 4E3VA 2JEQA 1G7VA 3QV6A 1PX8A 4EVZA 4Z2KA 2V63A 2ZUUA 2XIOA 3P81A 1JPDX 5D9NA 4UFJA 3STPA 1E5JA 3SSZA 1CGYA 3STFA 3OTRA 1QI4A 2IKGA 3NOYA 4Y9OA 4O4VA 3Q2DA 3CIVA 4GY1A 3RJXA 1UPMB 1OFRA 3T4WA 4U28A 2FB2A 3A4AA 1PEZA 1UBPC 1V5XA 1MEIA 4A05A 3C2RA 2GUUA 2GJXA 3UZJA 5D30A 5CQ1A 3N3MA 3BOLA 3WLTA 1GNXA 3AZRA 1X6LA 1U1HA 2J78A 5C9RA 3UJRA 3SGZA 5HMSA 1CGXA 3S5NA 1DVJA 2HS8A 2J7DA 3GG8A 1QHZA 1L6SA 1XPGA 3LLDA 4HNCA 2BY0A 4GXMA 3C2OA 4CVWA 4MKSA 1A5KC 4XUGA 4WOQA 2J74A 2J75A 3EOEA 4ZENA 4MKNA 5EA9A 3AIEA 1GJPA 3TZNA 3NZGA 4ORMA 1EC9A 3P2VA 1Y65A 1M04A 4MG4A 4WDWA 1QNQA 3LHVA 4FHAA 4RX0A 2R8WA 3NPVA 2Q09A 1BD0A 1LOLA 4DJDA 3BARA 3M7WA 4KCTA 1DP0A 3GD6A 3TVAA 3DHFA 1WDDA 1VAHA 3W25A 2DUAA 4CKQA 1CGWA 1H0GA 2TODA 1EB3A 5JU6A 4PRWA 1FWEC 1H1NA 1EXPA 1CW2A 1F7BA 4IFRA 3WO8A 4FNUA 2HSAA 3DU0A 1XUUA 3CZJA 5HANA 3HG2A 3TW7A 1M1BA 4YWSA 4FNTA 2FPYA 4L6HA 2HTMA 2PBGA 3VCRA 4OVXA 4S2CA 1FUYA 2WVUA 3ERPA 5I3IA 1OABA 1ZB5A 4C91A 5A6AA 2CWNA 4G9PA 2H6RA 1ITUA 4G8TA 1XIEA 4AX7A 5GVJA 4N4PA 5A2BA 4H00A 3PWIA 5ABFA 4LAUA 1JCTA 1DWAM 4U2YA 4R5EA 4WDXA 4NRRA 3ALFA 3WH5A 3WK0A 5EL1A 4P8WA 2VEKA 4LAOA 2WLZA 3WQ8A 1W2VA 3S0CA 3CPGA 1TWSA 5HJYA 1TRDA 1S5MA 1Z89A 4NZCA 1GYNA 1QAPA 4GYJA 5IDZA 5J8LA 1DJHA 5GNZA 3GY1A 3RR1A 3UXDA 3S6TA 4ERIA 1XFBA 1CGUA 1I4NA 3W6YA 1I2PA 1ECEA 3NL3A 4G5DA 1FH9A 1GZ1A 4OBSA 2FKPA 5CGMA 4GO8A 2J6VA 3VD7A 4FSAA 5DQPA 3T2PA 1H62A 1MRQA 4PRTA 4DXKA 1OIMA 1XI3A 2EQDA 4ICMA 5BMWA 3TJLA 1A0CA 2J79A 4O14A 4AIUA 3TKFA 3S5YA 2EKGA 4JTHA 1R6WA 1KM3A 2Y5SA 5LXEA 1EEXA 3VX1A 3WK1A 1UD2A 3DGRA 4GINA 2EPOA 4LAMA 1KV8A 3A21A 4OUIA 3W7IA 7REQB 3G24A 4YCOA 3I3EA 1TV5A 1J93A 3P8IA 2XWEA 1YMYA 1IT8A 3W7NA 4FXJA 4J7RA 1D2KA 1CLVA 2MUCA 2I5IA 1PIIA 5PTDA 1WOAA 3TFXA 4E3TA 3RG6A 4WKAA 3AIVA 3TEVA 4Y9PA 1PWMA 4R7WA 4QQ3A 2I57A 2HPIA 5F1VA 3JU2A 3PBUA 4O0ZA 4ZB5A 3S5SA 4AMAA 5DBTA 4F9DA 1JF6A 2PDMA 3E0VA 5DFAA 1O5XA 1EP2A 3W7HA 2WMFA 4PMNA 3VZZA 2CW6A 2VR5A 1JEZA 2WSPA 2WSKA 3K4AA 3W70A 3DENA 1WX0A 4XO6A 4I9JA 3TC6A 3L0GA 4MKVA 3SRFA 4XUYA 4DYEA 2BZNA 4W7WA 3WQFA 3CAVA 1Q6OA 2E68A 1EJSC 1B57A 1L6WA 3H2FA 4UQDA 4FLQA 1PZ3A 1AL8A 4MWAE 3BCJA 3N04A 1B9ZA 1F4AA 3H6OA 1EA9C 1UP0A 5AY7A 3OIHA 3PPCA 3OLEA 1OK4A 4AYGA 3LZ5A 1EJUC 2F6UA 1Z69A 3DYMA 2VYOA 3R13A 2UBPC 2QNEA 1AQHA 1BGGA 4LJ3A 1NARA 4IJBA 2X2YA 4WY0A 1ISWA 1ZRQA 1O68A 2FJKA 1ZHAA 2WCAA 4DLMA 3B8WA 1RQEA 3N6HA 5E9XA 1RCQA 3AXHA 2JALA 5I09A 5DY3A 1VEPA 4QGCA 1MDLA 2X1IA 2EG6A 6REQA 1JPMA 1TTJA 2GDVA 4PUDA 3N2MA 4IIHA 4MAZA 2IS7A 2IQTA 3EOOA 2VFDA 3TROA 3ZFHA 3CPRA 2J7BA 4O1EA 3RGTA 1V3MA 2J7HA 4K37A 4NZFA 1F73A 1BXNA 3FJNA 4DWDA 2X8RA 4DF0A 1GT8A 4WKFA 3RX3A 4Y6GA 3D5HA 4RW5A 1D8WA 2DUZA 4XTIA 2R1NA 3RMJA 1RBLA 2DSVA 3DH7A 2IQDA 1MRAA 4Q3MA 4Z0SA 4GYPC 2XVKA 4NHVA 4UOQA 1FCBA 1P0EA 3I4KA 5A8OA 4GMEA 5M1TA 1C8QA 2OMAA 9XIMA 1CENA 1BKSA 1UD5A 3G3MA 4JTLA 3JR2A 4WKHA 3QC3A 4K8HA 2PA6A 1IZCA 1GOWA 2Q01A 3AQUA 2CBJA 3PPGA 2R1KA 3SDOA 1HP5A 4LUSB 4DYJA 2Y61A 2IPFA 3W73A 1M9HA 1W9UA 1RJPA 1RP9A 1EP3A 1DEDA 3SAZA 1PZ0A 3AS2A 1W3IA 2WBKA 4Q8NA 1Z41A 4QE1A 4LH8A 1NF7A 3E2QA 1MQPA 2OT0A 4JEQA 2WQDA 3SCOA 1AMKA 4D6DA 1OG0A 1YTDA 1BPLB 3L2LA 1JYWA 3KAOA 3VABA 1MZHA 1X8CA 3M5VA 4CD6A 3LBMA 4YVPA 3W38A 2VI0A