4RE0A

Crystal structure of vmolac in p622 space group
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
313
Chain Sequence
MVRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parathion hydrolase
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
molecule tags Hydrolase
total genus 118
structure length 313
sequence length 314
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4re0A00
2WJFA 1J6OA 4LANA 2Z28A 2GZXA 2GWNA 4LAMA 4CQCA 1POJA 1M68A 2FTYA 3GTXA 4GYFA 4PBEA 2Z4GA 4H9TA 3K2GA 2D2GA 4KESA 4KEVA 2RAGA 2VC7A 4QROA 2ADAA 2W9MA 4P5UA 1A5NC 1YBQB 2Z2AA 2OB3A 2O4MA 3URAA 3IRSA 1K1DA 4NI8A 3OOQA 4KIRA 4ZSTA 3ISIX 1R9YA 4OFCA 2HQAA 1ITUA 2R1MA 4C6FA 1GKRA 4PCPA 4LAKA 4XAFA 3B40A 4C60A 2FTWA 1NDWA 2BB0A 5G4HC 2P50A 1POKA 5FSEC 1UIOA 4H9UA 1RJRA 3LA4A 3DC8A 4YIWA 2PAJA 2AQVA 4J2MA 2PGRA 4UBPC 4IGMA 4JOMA 1P1MA 4EPBC 3MVIA 1W1IE 3A3XA 4RDYA 4LAOA 3S2MA 4XD4A 4RDZA 2CZVA 3ID7A 1QW7A 4G2DA 1KCXA 1P6BA 3D6NA 4RDVA 4C6KA 1EF2A 4HA0A 3LNPA 2Q01A 2AQOA 4C65A 1PTAA 3HTWA 1E9YB 1V51A 3JZEA 4H01A 4C5YA 4C6OA 1KRMA 3LS9A 1EJTC 4HK5A 4F0SA 4H9ZA 1EJWC 4LCQA 3R0DA 4LH8A 3IJ6A 4GZ7A 5HMDA 4XD5A 4C6MA 4TQTA 4GY0A 4XAZA 3UBPC 5AKQA 2Z29A 4IG2A 2FVKA 3PBMA 1YMYA 1KRAC 1V79A 4H9YA 3F2CA 3URBA 2R1NA 4C5ZA 5HMFA 3IARA 3QY8A 2Z24A 4IGNA 2QVNA 2EG6A 2HBVA 4E3TA 2ZC1A 4NP7A 3E0FA 1ITQA 1WXZA 4D8LA 3IACA 1FWBC 3WMLA 2YZ5A 2HBXA 3T8LA 3IGHX 1UBPC 4XD6A 4CNTA 1XGEA 3OVGA 4DIAA 1O12A 3EWCA 3FEQA 2EG8A 4C6DA 4B90A 3FDKA 3N2CA 2QS8A 1A5KC 4V1YA 3GG7A 1I0BA 4R7WA 3E2VA 1XRFA 3QY7A 4KF1A 4WVXA 4J35A 3LSCA 4IFKA 4KEUA 4QSFA 2GWGA 2P53A 2BGNE 4NG3A 1KRCC 1FWJC 3GU9A 4RZBA 1V4YA 1JGMA 4DI8A 3CAKA 3GIQA 4XAGA 4HK6A 2OQLA 1EZ2A 3PNUA 4BJHA 4PBFA 2DVXA 4LFYA 4LEFA 3LU2A 3GUWA 3OJGA 4IFOA 4IH3A 1R9ZA 4R88A 4HJWA 2E1WA 3GU1A 4C6PA 3F4DA 1GKPA 1A4LA 3NQBA 1QXLA 1VFLA 1FWHC 4QTGA 3E3HA 4LALA 4GY1A 3S2JA 1ZZMA 1UMLA 4CEXC 1NDYA 2OGJA 4I6KA 3GU2A 4RE0A 2VM8A 1PO9A 1FKXA 3AU6A 1A5MC 4IG2B 4DYKA 3CS2A 4EPEC 1A5OC 2Z26A 4R85A 4C6BA 3RYSA 1YBQA 2YB4A 2HPIA 3URQA 3SFWA 3S2NA 1WXYA 4C6LA 4IFRA 3F2BA 4H00A 4B3ZA 4B92A 4EP8C 4KEZA 3K4WA 4C6QA 4CNSA 4EPKA 2PLMA 2R1KA 5LXXA 3MSRA 3V7PA 4CNUA 4ERAA 2R1PA 5CH9A 1NDVA 3TN3A 4IQJA 2O4QA 4G7EA 1PB0A 1R9XA 1HZYA 2Z25A 3MJMA 2WJEA 1YRRA 3A3WA 1GKQA 1FWAC 3TN5A 3F2DA 2Z7GA 3TN4A 3IV8A 4C6CA 4XAYA 4GX9A 1K6WA 1P6CA 3GTHA 4QS5A 3UR2A 4ERGA 3MDUA 4GC3A 2UBPC 2PGFA 4AC7C 4DO7A 3LGGA 4QS6A 4INFA 1M65A 1FWCC 3NURA 3AU2A 2YB1A 4C6JA 4Z42C 1ADDA 3OU8A 5FSDC 2FVMA 2HNHA 4WGXA 2QPXA 3SO7A 3E0LA 1I0DA 4MUPA 2G3FA 3WZ0E 2E25A 1FWDC 3PAOA 4DLMA 1NDZA 2Z2BA 3FDGA 4BKNA 3WYZA 3F4CA 4DZHA 3RN6A 4DLFA 3MTWA 1K70A 2GSEA 1V7AA 4GY7A 2VHLA 2FFIA 3ICJA 3QGAC 4XD3A 3LGDA 4RDWA 3MDWA 5A6TC 3OQEA 1IE7C 1A4MA 3DCPA 4EPDC 2ICSA 2I5GA 4IF2A 4LCRA 4QRNA 1J5SA 3TNBA 1EJRC 1UIPA 2DVUA 1FWEC 1RK5A 4ERIA 4KERA 1FWFC 3O7UA 1RJPA 2WM1A 3UR5A 1BF6A 2GOKA 2AMXA 3HM7A 4DZIA 3LY0A 3ORWA 4F0LA 4J5NA 4GX8A 4KQNA 4LCSA 3GRIA 2I9UA 4BY3A 2VC5A 4H9XA 2VUNA 2ANUA 4GBDA 3DUGA 1J79A 1KRBC 3PANA 4H9VA 3E38A 4DI9A 4PE8A 1EJUC 4F0RA 1FWIC 2D2JA 4G7EB 1YIXA 1RA5A 3BE7A 4C6IA 4CQDA 1RA0A 2YXOA 3MPGA 1RAKA 1J6PA 3T81A 2WJDA 4CEUC 3CJPA 2HPMA 3URNA 2Q09A 1EYWA 3OODA 2EG7A 3QY6A 1S3TC 3E74A 4WHBA 3GIPA 5E5CA 1DPMA 1RK6A 3RHGA 4GOAA 3B0YA 2PUZA 4M51A 4ICMA 3AUOA 3PNZA 4PCNA 4UB9A 1NFGA 3G77A 2A3LA 2QT3A 3EGJA 4C6EA 2VR2A 3O0FA 2D2HA 1EJXC 3ITCA 1PSCA 3QGKC 4L9XA 4I6VA 3UF9A 2Y1HA 3TN6A 1E9ZB 1FKWA 3IPWA 4IFKB 1EJVC 1EJSC 2UZ9A 3S4TA 3K5XA 4ZSUA 2Z00A 3T1GA 3MKVA 2KAUC 2OOFA 4B91A 3RCMA 4DNMA 3GTFA 3EWDA 3C86A 4AQLA 4C6NA 3HPAA 3B0XA 3UPMA 1ONXA 1M7JA 2DVTA 2R1LA 4L6DA 4CQBA 3MVTA 4H9MA 1YNYA 3KM8A 1ONWA 1XWYA 2IMRA 2Z27A 3NEHA 4KETA 4GK8A 3LSBA 1V77A 4HK7A 2F6KA 1FWGC 3A4JA 3S2LA 4V1XA 4GXWA 2XIOA 1RJQA 2OODA 5HMEA 1O5RA 1XRTA 1A5LC 3GTIA
chains in the Genus database with same CATH superfamily
4Q8NA 1JYWA 1REQA 2X7VA 4LYKA 3BUVA 3MV11 1DYSA 2NQZA 3POHA 1POJA 1F3WA 3APTA 2ZX8A 2FTYA 3TR9A 4H9TA 3IV3A 1U30A 1O6IA 1S2UA 1LQAA 1U5VA 3BW4A 4QSHA 1X7IA 1C92A 2Z2AA 1JD9A 7TIMA 1LLZA 5MF5A 2Y7EA 2XFRA 4J27A 4BS0A 1LWIA 5B7YA 4RUBA 4FOKA 5AECA 1NY1A 1IR1A 1OM0A 1SW7A 3K4AA 3WCZA 3ENLA 3QHMA 3O6DA 1FVPA 3W1TA 3NQDA 1TV5A 3QXBA 1A3HA 3UT0A 3W6MA 2HE5A 1ZAJA 2CFFA 2LLEA 3GG0A 3QHOA 2PP3A 5D03A 4XV0A 1A5CA 3IIOA 1XRVA 1YPIA 3PBUA 4S2CA 2WVVA 1JCMP 1WUEA 1JPMA 1KW1A 4C65A 3QFWA 2C8NA 1PTAA 3CLMA 3T0TA 4H01A 1I9CB 1AL8A 1JUEA 3VKDA 1LQ2A 1MFVA 1PWLA 4AZ6A 5HQEA 3AXMA 1UJPA 2PA6A 3UXLA 3ZT5A 5LHEA 3GX9A 4DWSD 4AY8A 4PMNA 5FJJA 7ENLA 2QMKA 4DBWA 3MWAA 3A64A 3O6YX 3OP2A 4J1OA 4PUEA 5AVHA 3PZOA 4KKXA 4N9BA 1VRXA 4Q4KA 3WQ4A 3WNLA 5KZDA 2XN1A 6REQB 2V82A 4FIQA 2EG6A 2YX0A 4E3TA 4KRUA 4ATWA 3AIEA 4P8WA 4LV9A 2Y6ZA 4GVFA 4IPIA 4LC6A 4HSNA 4AZBA 3T8LA 3B8WA 2MNRA 3TW9A 4CNTA 1GVIA 4WIWA 3E49A 1BRLB 1A5KC 4JHZA 1EGMA 1KBKA 2OWCA 3LSCA 1ME7A 3A47A 1JZ4A 4QDMA 5TAOA 3EMQA 1DWHM 1GOMA 2VZTA 1A3WA 1BPLB 5HQLA 2RJGA 1E0XA 1VENA 1L9WA 1WE5A 3TTYA 1OVDA 3N25A 4UFIA 1AMYA 2BY1A 3ONBA 3PWGA 5A6BA 3F4DA 1GKPA 3FVDA 2UY3A 1HKJA 4ZL1A 4W7UA 5AFDA 1GZ1A 3W53A 3GE7A 3VFCA 5F2IA 3VIHA 3AS1A 3OZMA 4C6BA 1F07A 4JY8A 5IHRA 4O8AA 2HPIA 1YNPA 4UOJA 3VNJA 4B4FA 3K4WA 1RQHA 5CGMA 1KLYA 1OF6A 5CPLA 3B05A 3K46A 1UWQA 3IANA 4A8NA 4ERAA 5A8MA 4E0CA 4OV4A 4IQJA 1U1JA 4WSHA 3T09A 2P76A 5HWNA 3TAOA 3OBEA 1NFBA 3ARYA 1UR8A 3F2DA 5BRPA 3OYZA 2A0NA 4DJFC 4YHGA 2OU4A 1QI3A 1D2KA 3ALFA 3UWEA 1PXGA 5FCZA 3WQCA 3DG3A 1UUOA 3N1AA 4X2RA 1BKHA 3NOYA 3W22A 2FDSA 5G5IA 5HJYA 1WOAA 2ZXQA 4WEVX 3RRAA 5BYWA 3A24A 3FYOA 4PCTA 1HKVA 5F7UA 4AD1A 3ELFA 5H8PA 1V0NA 3WQPA 3L4ZA 1IZJA 4DZHA 3LD5A 1QOPA 1FHUA 3H2AA 2VHLA 3ICJA 2ZZ1A 5A6TC 1JI1A 1B3XA 3UQNA 1ZCCA 1W1ZA 1NFPA 2YXGA 3IRDA 5LYRA 1X6NA 4EPDC 3WF3A 2ODOA 4AZGA 4UFKA 4TXEA 3KUMA 4AHOA 4GUGA 4IGSA 4AC1X 2NT1A 1DEDA 1GQIA 1W9PA 4CD8A 1SJCA 3IWPA 1DJHA 3PUOA 3B06A 3GRIA 2AGKA 4JEJA 2VUNA 2ESCA 5LIUX 4HNTA 2ZKMX 3PVFA 3CEPA 3STGA 5CC3A 3HQOA 3VXGA 4OQVA 3OVPA 2XVKA 5I3FA 2PWDA 3KRSA 1WKDA 1K4GA 1XDJA 2CLFA 4B5TA 1JULA 4JTLA 3QPYA 2QJIA 3S6TA 1PHWA 4J3WA 4XUGA 5LA2A 4MTVA 2W6RA 4AZ7A 1WYIA 4QJ4B 4QQ3A 4LXFA 2ZTJA 1LCOA 3VNDA 4XISA 4L4OA 4C6EA 1AJ0A 3LXAA 2HK0A 5EU9A 1THFD 3PG8A 1VYPX 2OKOA 4JIPA 4H6KA 3QQ0A 5FAJA 3V35A 3NQEA 1KBBA 5BU9A 4DNMA 1OGBA 2BVDA 4W9TA 1JPHA 2FH6A 4HIBA 1ZENA 3SY8A 5BXTA 3GXMA 4L6DA 1Q6FA 2R1LA 2ISSA 2YDRA 1FCVA 2B4GA 3NM3A 3AQUA 4QE1A 2J7GA 4AD5A 1FWTA 3NTYA 4TVDA 1AW1A 4EXBA 2WVSA 4AD4A 3M43A 2Z28A 4JFSA 5T91A 1XLFA 1RD5A 4GVHA 2WSRA 4IWWA 2P5NA 3L4YA 3VNMA 3BGGA 4MFDA 4H7ZA 3EWZA 2JF7A 4KEVA 4E2OA 2JKPA 4CNPA 3RGTA 1UQZA 1BVNP 1YQ2A 3URAA 4HU8A 4CNNA 2PDYA 4ROPA 4I3GA 3MUXA 3NFUA 2ZZ5A 4QQUA 3W84A 1O5XA 3UJRA 3VO0A 4I7VA 4H8HA 1MEHA 3A3HA 3MI2A 1RZMA 1IF2A 4AX6A 4YIWA 3VKAA 3N14A 4RXGA 4PCFA 5SWUA 1MI3A 4EPBC 2Q02A 1AMKA 2BSLA 3CMJA 2GK1B 1TTJA 4FS9A 4JFTA 3EA1A 4OGZA 3E5BA 4IP7A 5GVJA 1GONA 3UZ5A 4UTTA 3ID7A 4LSBA 4QCEA 2X1SA 1GQJA 2X0HA 1EF2A 1J0YA 1AODA 3L67A 5DMNA 3CQHA 4OV9A 1O95A 3R7MA 4DJED 3S46A 4D1IA 4L5ZA 5EA9A 2ZTKA 3EEZA 4QM1A 3HG5A 3H2CA 1XSKA 1QNPA 3VILA 3ZR6A 1EJWC 3AWNA 2IXVA 2BXZA 3UERA 2NT0A 2DT2A 2GUYA 1PE1A 5BOFA 4ACYA 1TVLA 2ALDA 1FWWA 1WDSA 1CGTA 2EKCA 3PZTA 4Q32A 1MQRA 3KP1A 4RXFA 4Q8MA 3LXCA 4POCA 4JTUA 2IQ0A 3WQGA 4WLCA 3W7MA 4Z1BA 3QY8A 2Z24A 2QUTA 1B4KA 1F4AA 3WIJA 3T44A 2JIWA 1QU4A 3AICA 3CMFA 4G56A 3MUCA 3KWSA 3E0FA 3SIZA 1W9DM 1E56A 1MDLA 1NP0A 3WMLA 1O66A 3H22A 4AVNA 4O1BA 4UCGA 5FOOA 3SECA 1UD4A 5LIKX 1ZALA 4Y7EA 4WZHA 5HNTA 1P0DA 2RKXA 2ZE0A 1CXIA 3MP5A 1C7SA 4ML4A 3GKAA 4HPXA 4LVFA 2QQ6A 1N8FA 4AIBA 4NG3A 2WLYA 4HHLA 3ARRA 3AHTA 3SGGA 1KCZA 2SFPA 2J7HA 3W4RA 2HSAA 2ZCGA 5DFAA 3FLUA 1TWSA 5I78A 3FVMA 8TIMA 2ZUVA 3C0JA 5CPNA 1ODUA 2WMIA 3PZIA 3DIPA 4DAFA 1BWVA 4S3JA 4L1XA 4R88A 4HJWA 2X1RA 1QRQA 1XKYA 1I45A 3B0UX 5A6BD 5TF0A 3VOIA 1QXLA 4ACZB 1MWOA 5EY5A 2IKIA 1AW2A 4QGCA 1TPUA 2A85A 2OEKA 1RLDA 4E4UA 1HIZA 1DKWA 4CU7A 1WKEA 4UTLA 3VZYA 4V27A 3WD2A 3OVQA 3SY5A 3AZSA 3IUIA 3MUZ1 3BVJA 3RYSA 4MYAA 3U8GA 3W07A 4K7VA 4E8CA 2QV4A 2GGEA 4GINA 2J78A 5ABFB 2DUXA 4GJ1A 4EPKA 4O8RA 3NA8A 4R9OA 3HFYA 2RDWA 2QDGA 3GBEA 4L6HA 3IUHA 4NAFA 3MI3A 5C2XA 5IRPA 5HWMA 3MJYA 1FCUA 2ZRUA 1HZYA 3GHTA 4CCZA 4YVPA 2PWVA 1XIHA 2GJXB 4PUNA 2CHOA 2GUUA 1OCNA 2E4TA 2OYLA 3IV8A 3N15A 4EK7A 3R43A 1XIIA 5MHBA 1H50A 4CQ9A 4GC4A 3AU2A 4NJKA 3OU8A 3GNPA 1M7PA 4CU8A 3G6MA 2ZDSA 4HSHA 2BX7A 3OBAA 3I6EA 3MUY1 4DPPA 5T8GA 5FEXA 1JDEA 3EWBX 5B7ZA 2IKGA 3F03K 1X1OA 2X7WA 4KCTA 1DQUA 2GSEA 5KZ6A 3GS6A 4GXPA 1KWGA 2PDQA 4P7QA 3VFLA 4LU0A 4XG1A 5A2BA 5EFDA 4Q8UA 3TLLA 1IEWA 1XP3A 2NQ9A 1KXQA 2H6RA 3ANVA 3BLKA 3DYOA 1QR7A 3W0KA 3RCYA 3LLDA 1DIDA 3NPVA 3N6QA 3MBDA 2GOUA 1J18A 2Z1SA 3W9ZA 3B8DA 1KM6A 3AIRA 4JDBA 4UXDA 1QJWA 4XZ9A 3MO7A 2QCDB 4WXZA 2QUVA 3PJUA 4OWGA 3P5ZA 2FLIA 4PMOA 3KVMA 1L2UA 2BDQA 4QEEA 6A3HA 1S1PA 4GISA 1NWTA 1AFSA 1LDCA 4J3SA 3GC4A 3LLFA 1EJUC 3T7VA 3KLKA 2ZRWA 2I9EA 5AOUA 4JN6A 4AVOA 4OT7A 4PB3A 1O5KA 2WW5A 4Q8TA 3WLHA 2JF6A 3SRDA 4H1ZA 1CEOA 4N4QA 3QY6A 4H6RA 4MNLA 1TWWA 1TV7A 2ACRA 3BSHA 1GOKA 3RHGA 3NEVA 2VX4A 1BXCA 2WC7A 4ZOAA 3AUOA 4ZB5A 2GVLA 3M1ZA 2QUUA 3SGUA 4US6A 3GDRA 2PDHA 3W7GA 3TONA 2PLJA 3CB8A 5KSWA 2ZUSA 3GNXA 4I6VA 1E9ZB 4QJ3B 4IFKB 1EJVC 1FX6A 2EAWA 3LZ5A 3NO5A 1BQGA 3W1PA 2OOFA 1UOKA 3RCMA 4M6VA 1TE1A 3ARPA 4R9XA 3I6TA 3TTSA 3PUDA 1UR9A 1JGIA 1CYGA 3QRHA 3M07A 4J4KA 2DQWA 1E15A 4DPQA 1QOQA 4GK8A 4HHMA 1L6YA 2IPGA 3N2BA 4PSPA 1T40A 3M0YA 1FWRA 1TIMA 3NZGA 2ZXAA 2GUBA 4BQ4A 4LANA 2ZXBA 3MMWA 5D05A 3MW7A 4KWOA 1CGXA 5ABTA 4PH6A 3NSXA 4LPCA 3VIKA 2EPLX 2G96A 4XSMA 3W7DA 4KGJA 1XLHA 3PPFA 3TSDA 4UCFA 3OGSA 4IUOA 1VH7A 3PB0A 4D6HA 3OOQA 4KIRA 5HUOA 2BXYA 2YDSA 4D6CA 3UWQA 3K1DA 4C60A 4FLQA 5DMLA 3HG2A 2CBJA 1ZHAA 3SDOA 5HMSA 2WVTA 2XPKA 2AQVA 3IGUA 5M03A 5GJNA 5CXPA 3P0XA 5BWFA 1VIWA 3LLXA 1WKYA 3RU8X 1P0BA 1K8ZA 1XIGA 3N3MA 3UWUA 2YYTA 1SGJA 3LQGA 4FNUA 4UR7A 1XSIA 2AL1A 3O1NA 4NSBA 1F61A 2PTXA 1F3XA 1UQYA 3FA4A 4P7NA 4MADA 1K7EA 3C61A 2DDXA 5U4NA 2ZOXA 4JEQA 4ZFCA 2CW6A 2Z1XA 1V8EA 1E73M 2ASHA 4FMVA 4PRRA 2FJUB 4QFUA 3RMEA 4TQTA 3TH6A 2H90A 4A8LA 2B31A 5D4YA 4B9YA 2GQ8A 2WOQA 3R12A 4GZIA 1HUVA 2NWRA 4Q4MA 5I0DA 3VGBA 3LX9A 5JH2A 1UD2A 3VM5A 3QV7A 5GNYA 2B7PA 2C0HA 4IL2A 4F66A 4URIA 4JY9A 1AZ1A 1XC6A 1KD0A 3H24A 1QVBA 3IGHX 2I7GA 4XD6A 1JF5A 3KOXA 1O12A 3NSNA 4QDWA 3RITA 3WBWA 4WOZA 3MP4A 3UW6A 5IM51 3C2VA 3TVAA 4O52A 3TJXA 1XBVA 2XU2A 1KKRA 2W67A 3L68A 4R7WA 2QW5A 2VEKA 4S3CA 3GYEA 3SSZA 2I17A 1FHDA 5GNXA 5CLWA 5C54A 2C3ZA 2WMJA 2W92A 4S2BA 1H5VA 5AVNA 4UUIA 4FNPA 4MJMA 4BJHA 3LCFA 3UR8A 3H4XA 3OJGA 2PZ0A 5M17A 2XSAA 3RCNA 2WZTA 3SJ3A 5FJPA 1P4CA 5DRCA 3FY1A 1WZLA 3EKZA 3SM0A 2Y4SA 3T0DA 4CCDA 1W56A 3AS0A 4CD7A 1K6AA 3KW3A 3ZWSA 1UZ1A 1QI2A 4XVDA 4QAIA 1V3JA 4NIRA 1YPXA 4DO4A 2V2DA 2VI0A 3ITVA 2V3EA 1A5OC 1F9CA 2PZNA 4YWIA 2INFA 3NQCA 3NUKA 4Q7NA 1UYQA 4TX6A 3C52A 4TTGA 1ME8A 2X1IA 4HYWA 1FDJA 5AHNA 2FPVA 4C6LA 2FTPA 4EP8C 3F1QA 1QAPA 5D2TA 4C6QA 2RJHA 3BJSA 4D6DA 5HXMA 4HN4A 2HVMA 1NOUA 5AYIA 1YXCA 1E4IA 1V3IA 1ZBVA 2FB3A 3MU7A 4K7YA 2ZADA 1M9HA 4IGHA 1X96A 1YNQA 2PGFA 1TO3A 1OGSA 3EWYA 1VPYA 3LCHA 1IHIA 4F9DA 3LPOA 3CUJA 5D9NA 4ZQCA 3LMYA 1NF0A 3L0KA 4E2VA 3AJ7A 1QWGA 2ZYFA 2YB1A 2YCLB 2Y61A 2FZBA 3LB0A 3QMSA 1YDOA 4RW5A 3AYRA 3MUAA 3WDHA 4DLMA 3E2RA 3CH0A 2Z2BA 3R58A 1C29A 1KFKA 3BSMA 1XC4A 3FSTA 5FD0A 1XUZA 3QGAC 3UA3A 1QCWA 1SJDA 1DBTA 3GLCA 5BU6A 5HATA 4KFOA 3KP0A 4O1EA 4JGDA 3TJLA 1J5SA 2HTMA 4IQDA 5L9FA 3H12A 1TZ9A 1XLEA 4GUFA 1JPIA 4LB3A 3WH9A 2C7FA 1V6VA 1BXNA 3WD1A 1DIEA 3C0QA 3CB3A 4MDPA 1Z42A 4PMYA 4W93A 2I9UA 4NHVA 1DHKA 3NM1A 4LRTA 1DXEA 4E38A 4HTBA 5JH1A 1TMHA 2B0MA 3QTPA 3KS6A 4DYEA 1XLGA 3WJZA 3BSGA 3U57A 2J88A 1LRTA 3VINA 1M6JA 3HGOA 1Q6QA 1PZ2A 3RUBL 3ARVA 1NP2A 5JBDA 5CKSA 4X0NA 3BANA 4DELA 3E74A 4PL1A 3CUFA 1C7TA 1LOLA 1YADA 1DJWA 1QPOA 3F5KA 2QAFA 3WDIA 4PUJA 2OQHA 5CG0A 3ARZA 2W79A 3K8MA 4BWLC 2OKTA 3OA5A 4ZBCA 3U4FA 1Q8AA 2GK1A 4IMEA 3LHWA 4AB4A 3TJ4A 4PZVA 2O9TA 2QCEA 5D04C 1UPPA 4AQLA 2E3ZA 1W37A 3TZFA 3GG1A 1S2VA 1W5MA 2H9AA 2QF7A 1W9VA 3CUGA 3FNDA 1E3XA 2P8CA 3E9AA 3ZVIA 1MNZA 4XKYB 1BSIA 1WDRA 4KETA 4UTWC 1JYVA 3ITGA 2QPUA 4DBEA 2F6KA 5JIWA 4F48A 3AMDA 4HPNA 1A5LC 4HVXA 3DN5A 1H62A 1GTHA 3VAVA 3PC0A 4ZOEA 4ZCWA 1M68A 5I3DA 2X2GA 3FJLA 3T08A 3E0VA 1MEWA 4TV6A 5AHMA 4XZHA 2PF0A 4F4RA 2C1GA 2OB3A 1Z41A 3NO1A 2D2OA 3R0KA 3FEMA 3U2EA 1P0KA 3ISIX 1ZJBA 2EPMX 3KFTA 2G4JA 2X0SA 1ITUA 2FZMA 2F9RA 3WENA 1CDGA 4N9DA 3ZR5A 4DBDA 4JTHA 1POKA 2PEVA 2JBMA 2XWEA 2IS7A 2IKJA 2ABAA 4ZQOA 4LUTA 4DXXA 4J2MA 2PGRA 2WNWA 1QO5A 3KDOA 4KIEA 4W5ZA 1ODZA 1KKOA 3HMJG 1M03A 2F84A 3CZKA 1QW7A 2V2CA 3LCXA 3OQ8A 4V15A 2HISA 3S1GA 3Q58A 2ZIDA 1TX2A 2C79A 1TYGA 3WL1A 4ILSA 1ECEA 3RPDA 4A29A 4R7OA 2ZICA 4O0ZA 3W1QA 4ACZA 1SM9A 2BG5A 5C2CA 4YCOA 3LENA 4AMAA 4QG6A 3KZSA 4GI9A 2P10A 2OR2A 1DWAM 2VQUA 2VP8A 4U4MA 4AHPA 1GK8A 1W1A1 1XR2A 1A5BA 3L4XA 1ISYA 1HL8A 4IIFA 3TX9A 3ITTA 3W24A 3VD5A 1RY8A 4QE5A 3FA5A 2E6FA 2ZA3A 2PWEA 1MYRA 2Z1VA 3SQLA 1OX5A 1V3MA 4FPSA 4MB3A 1R3TA 4HNVA 3HJEA 1IWBA 2A7RA 3BOXA 3W2LA 2VZOA 1Q6DA 2GJXA 2Z1KA 1JQVA 4PSRA 7ODCA 4RV3A 1ZLPA 3VX1A 3QY7A 4JIIX 4J35A 5TBOA 4PEKA 4LC8A 3W2KA 3L65A 1PCKA 1GJUA 2QLYA 4RZBA 1QI0A 3CV2A 4RNHA 3KOWA 1JR1A 1SMDA 4IIHA 1B9ZA 3E2SA 3VD7A 1M5WA 2QJMA 3UCDA 2VZVA 5ABEA 1IXQA 1BG9A 1JF6A 5DXXA 3G1VA 4HZMA 3G6LA 4ZR8A 3UNDA 3A5VA 5HDRA 4F2BA 2DGAA 1VFLA 4BI5A 3FXGA 3VMPA 2XFFA 2BZNA 5I02A 1VFSA 3GH5A 1K9TA 4DVOA 4JIRA 2VMFA 1XGDA 2A7NA 3CS2A 2Z26A 5D38A 1GCYA 5I24A 4C1KA 4RNFA 5CJ5A 4N6FA 5E1QA 4S3AA 3W7CA 2Y5JA 4H00A 2X2YA 1SO4A 2VX6A 2JEQA 3P80A 1PWMA 1UWRA 2PP0A 3ABRA 3SCRA 5D2YA 1PB0A 4F9JA 2J62A 3WH5A 5I3HA 4D6IA 3WQ6A 5I3IA 3GVGA 3M16A 3RM9A 3TYDA 3FN9A 1VB9A 2PLKA 2C6QA 4TMCA 1IYXA 3VD9A 2G41A 1Z89A 4A22A 4AD0A 7PTDA 1VEPA 3A13A 3LGGA 1WCGA 1LOSA 4HYVA 2XJ7A 4C1NB 4Z42C 4US5A 1S2CA 3MCNA 1EQCA 3LRLA 2XISA 5A94A 3UNTA 2DSVA 3LHZA 1TZZA 3LERA 3QPEA 3G2GA 3F4VA 3O0KA 3KWXA 4X0VA 2HDJA 3BXWA 6TIMA 3MTWA 1SO5A 1SO3A 3L12A 3UXKA 3S9YA 1DVJA 3TYUA 2WHLA 1R3WA 2V8ZA 3CIVA 4K36A 2DSZA 2RDUA 2AQWA 3BAXA 3LUTA 3DBNA 3HG4A 5C55A 4HHPA 1EYEA 4HZ7A 2YLAA 1RCOB 4TVCA 3V3WA 4I5RA 1OYAA 4JIEA 4BEQA 3FCPA 3TNBA 5FEPA 1M7XA 3N29A 2F8QA 3QQ1A 3TIMA 4U28A 1EC7A 5F4WA 1W91A 3KTSA 2CZEA 4WUIA 2ZRYA 3M0ZA 3L21A 1OBAA 2WLZA 4XAPA 2VRJA 1G7VA 3B9AA 4H6EA 2OZTA 4G7EB 2D23A 4EWND 4MKVA 4CN1A 1FOBA 2Q8XA 1PTGA 2UY4A 1H1NA 4WDXA 1HKWA 2HK1A 5DANA 5JBFA 4J9JA 5A69A 4W4QA 2O9RA 2RH9A 2Q09A 3M41A 4JYDA 1XIBA 3GIPA 1TPB1 3QYSA 1Z32X 3G8EA 2PUZA 1QHZA 1AQMA 4AG0A 2A3LA 3NL2A 2Y89A 3RX3A 1DJGA 4MLRA 3W75A 1OSEA 2J25A 5I79A 3WMCA 5AHEA 1XYFA 4DAIA 3QGKC 3N2OA 5I03A 3KBJA 2CZ5A 4AVFA 2XWDA 3EYPA 3TA9A 5CBIA 2Z7KA 1IT8A 2OWXA 3G1AA 1GVOA 2ZQ0A 2PTWA 4YTUA 2FGBA 4Z1YA 1XWYA 3C2FA 4ZVJA 3LSBA 2CYGA 1QNQA 1E40A 2JGQA 4NY2A 4V1XA 5KETA 2XH4A 4OBTA 3I68A 3DU0A 1YDVA 4MAVA 3DEQA 2I1OA 1GW1A 1J6OA 4H8VA 5EBAA 2QJNA 3BWWA 1TB3A 4LT9A 1TRDA 4C7FA 2D2GA 3LOTA 4KESA 5LNWA 1JZ5A 4GI8A 3OIXA 4GYJA 3TJIA 1K8XA 1AH3A 2ZDRA 3PPCA 3VIGA 1FQ0A 4L1GA 3IRSA 3UWVA 4A8IA 4MVAA 4DJDA 4PMXA 3VNYA 3W37A 2CLIA 2CNCA 4Y2WA 4HOWA 3NNTA 4LAKA 4ZO6A 3B40A 2BB0A 4EAMA 3BMWA 3GY1A 1P6WA 3T78A 3WEOA 3D3FA 4RV8A 1IR2A 2PDBA 3WNNA 1JXJA 2OMAA 4D72A 3A3XA 3ARWA 1TPFA 3GZAA 2PE4A 1KQZA 4O13A 3ABXA 3BL3A 1P0EA 1SJAA 4QBXA 4PTVA 3CYJA 4NNBA 2Q01A 3WDQA 2YJQA 2A2IA 2WMGA 1O7AA 3Q67A 4DXVA 3JZEA 3M64A 2EPNA 1QNOA 1QPKA 4ZFMA 4IHCA 3DBPA 3W00A 4LH8A 4HBKA 1CENA 3EB2A 3EWUA 3ARXA 4DJFA 2I16A 3RPMA 1W5OA 2GQ3A 3VNZA 3M5XA 4UQCA 5FF4A 2G37A 4FAMA 3UBPC 3N9SA 4NZ5A 2AL2A 4O1AA 3COTA 1NSJA 5H91A 3GNOA 3P81A 3IIZA 3ZMRA 3SCWA 3B8UA 3LM7A 5IFPA 1MFUA 3BG5A 2VVSA 1E0TA 4CN4A 1UH4A 4KW2A 3VZXA 1BD0A 1T5AA 3W83A 1GVRA 2GVYA 3OVGA 4IT1A 5A95A 3UU0A 3RX4A 2QXWA 1GGOA 1PEZA 3CHFA 3N2CA 4QG8A 3NSMA 3APGA 3R8RA 3FFSA 3BLIA 3CT7A 3WD4A 1EP1A 2CLLA 2V81A 1KRCC 4XAGA 1EBHA 1SFSA 2NUWA 3WSUA 5K9DA 2YCLA 1Y5WA 3BC9A 1U22A 2V3FA 1MEIA 3STEA 1K9FA 3BLDA 3NQBA 1DJQA 5F2LA 3VDHA 2VEIA 3TQPA 4LALA 3ZXWA 4BR1A 3VKKA 3BCFA 1VD6A 4HZ8A 1RV8A 1DJXA 4N2YA 1LYXA 4NF7A 1CLVA 3KVLA 2HS8A 2B7OA 1DWJM 4H2CA 1O68A 3QTGA 3W88A 1I60A 4AX7A 4J2PA 4XZMX 1FFQA 7CGTA 1T7LA 4L56A 1CZ1A 3F2BA 3GC2A 3KEHA 5G1MA 4GVGA 4JL2A 2A1YA 3RJXA 2TPSA 5CC7A 4IX2A 2XHYA 1LBLA 1IT0A 3UXDA 4QJ1A 1OX4B 3MJMA 5C8BB 1EUAA 2NV1A 6ALDA 1WDPA 3TN5A 1XYLA 4UTIA 1MVYA 2GDQA 3GTHA 1R3RA 4ZB0A 4LVBA 4B4HA 1V6WA 3WFAA 3QYQA 5A6KA 3WBYA 1XFCA 3JUGA 4AC7C 3C0LA 1ISWA 1XLCA 1KR1A 1TRIA 2OX1A 1K9EA 4I9MA 2JIEA 1US0A 2TYSA 4US5D 4FALA 4AH7A 2P0IA 2PURA 1J0KA 3EAUA 3NYDA 3RN6A 3G5EA 1PS9A 1AL7A 2NX3A 1VJIA 1QNVA 5D02A 1G0CA 2GDVA 4ZTXA 4RZ5A 4DNHA 3LPGA 1W3KA 2PBGA 4MLJA 4ROQA 3DCPA 1XS2A 3NQAA 4PODA 3PSVA 4XKYA 1EJRC 4IISA 1S2AA 2VDIA 1TPH1 3GQYA 3I65A 3AHYA 3O7UA 3PZUA 1QASA 4Q6JA 3T0AA 2YPIA 4WJEA 3CZLA 1LJYA 1T8QA 1H49A 2TODA 2VUYA 1S5VA 5HJLA 4NYYA 4MKNA 3VKJA 1J4EA 3WJSA 4C91A 3G0SA 1AUSL 4IPJA 3OGRA 3HFTA 3APYA 4C6IA 1RA0A 2MANA 3G18A 1VEMA 1DJNA 2BMBA 1J6PA 1S5MA 2GJRA 2Z6IA 4CEUC 3WF0A 5AYXA 3WK1A 4GNJA 3CJPA 3M0HA 4MY1A 4A3UA 5DN1A 4DXKA 4J28A 1LT8A 3U2ZA 4NJIA 3W7OA 3W38A 2WZIA 3ARSA 2OYKA 3ANYA 4ZO9A 1PKMA 1ZNNA 3P7YA 1A5AA 1H7OA 1P7TA 3CO4A 4P7LA 5J04A 5I07A 2PD9A 4O4WA 3OG2A 3T6CA 3GZ3A 3BJTA 3VIIA 3BURA 4ZSUA 2PC8A 4PC8A 3FAWA 3L7RA 4E3VA 4H2HA 2E5DA 3KS5A 5FL1A 4JD4A 1TR1A 3LRMA 3MVTA 3PF3A 1JD7A 5CAHA 2IMRA 2VC9A 3GHSA 3ME3A 5GQBA 4FP1A 3RG6A 1EXBA 5LIWX 1NWRA 1KFBA 3S2LA 1H4PA 1GVQA 3H2NA 5HMEA 3KHJA 1BYCA 4OKDA 3UZZA 1B3YA 1T0OA 3MHUA 4QNWA 2WNQA 2PDNA 2PS2A 5AC6A 2J4GA 4DUXA 2C15A 2XH7A 1F6KA 2Y7GA 1B30A 3O15A 4UR8A 3R94A 3W81A 2CKRA 5FL0A 4W89A 2YCIX 1QPRA 3TC7A 3C3NA 3AMCA 2R1MA 3D46A 5C7VA 1EIXA 2YYUA 1TIWA 4JX6A 4Q8OA 4JQ3A 1Y7VA 1KBIA 2J6XA 1W5PA 4U5IA 3GR8A 3PJTA 2J8GA 4UQAA 2OEMA 4I5UA 4NAEB 1W1IE 3WDRA 4F3HA 4I5XA 4LAOA 3S2MA 1EPXA 4FK9A 4GCAA 4M1RA 3VDGA 2ABBA 4H6QA 4MHBA 4AZ5A 1KCXA 1JCTA 3SN0A 2FMNA 3VOFA 1QATA 4IMGA 1OWQA 5IBXA 5GNZA 1TWDA 3HTWA 5LXEA 2PSNA 3QLDA 3VIOA 1ZBCA 4O1CA 3H23A 2V0TA 3G1DA 4HK5A 4KT2A 1HP5A 3FKKA 3W1LA 4HMNA 3RR4A 3NXFA 2XGZA 4O17A 2H3DA 4XBKA 4DJFD 4RL3A 5C2GA 5AKQA 2YCKX 1IGWA 3W82A 4BQ5A 4H9YA 1ZFJA 4D8AA 2H8XA 1J2BA 1LWHA 2XH2A 3UR7A 3UWZA 1U83A 1W3NA 2HMCA 1PAMA 1YDYA 3D3AA 4UFLA 1RCXB 4S3BA 3FJ4A 3KCLA 3NJ3A 1M01A 4MSSA 5DBTA 1AG1O 1YEYA 1VFUA 3M47A 3IACA 4N9EA 3MB9A 2DT3A 4EX4A 1KWKA 1VEOA 1XGEA 5CPTA 3V5OA 1MSSA 1XH0A 3ZVHA 2FHCA 1TPDA 2ZZ3A 3E2VA 3AFBA 1R3VA 4I90A 2PLCA 4LYPA 2GWGA 3V0UA 1UROA 1FWJC 4JTRA 3KRBA 1H41A 2CLEA 2EPKX 3B4UA 4IMAA 3RIKA 4XZNX 3GG8A 1BTMA 4N4PA 3TTEA 3HJZA 2J24A 1ZBKA 1DE5A 3AO0A 4LFYA 3IJLA 4R27A 1FH7A 5EYWA 4QLLA 1YKWA 4DM1A 1R9ZA 3RLHA 1PVNA 4GA8A 5J8LA 2OGYA 4FR6A 4JCLA 4JXCA 2HWGA 4Z1DA 3VC6A 3E3HA 4X22A 1UMLA 2R6OA 3DFQA 3CWHA 2QNEA 3QMRA 5BWAA 4CLMA 4Z2LA 3GU2A 2VM8A 1PO9A 4MB1A 3CAVA 1E9IA 3DGBA 5CEWA 2OLAA 3NL6A 4CUCA 3A6OA 4C90A 1OF8A 3EX2A 3HG3A 3S83A 4N42A 4FX8A 3R1ZA 1MW2A 3N2TA 2G4FA 2ZUNA 1ME9A 3L4WA 4RW3A 5K4ZA 4M6PA 4S3FA 4HZ6A 5PTDA 1XBZA 2QEZA 3IAPA 3D5HA 3W74A 1DV7A 3PUEA 4V33A 4J7RA 2YBUA 2QIIA 3L23A 4G7EA 1V0LA 4OECA 3AI0A 4MAZA 5E6YA 2W61A 4XO6A 2WJEA 3O8AA 1FDZA 4LF1A 2D24A 5GJPA 2Z7GA 3LHUA 4IZGA 4FXRA 4GYPC 4LBUA 1OFDA 2FZNA 3G1SA 2NX1A 4FF7A 2QGHA 3HA1A 5T26A 3ZJ6A 3P6LA 5A6AA 3TW6A 1US3A 1PX4A 1ADDA 1J2WA 1I6NA 3NQ2A 3NQMA 3GVWA 1E71M 4FLRA 4AXNA 3G22A 1IWPA 1SW0A 2E8ZA 2JK2A 4M7TA 4YJ5A 1U33A 3PAOA 2ZX6A 3R79A 4QG9A 1US2A 3WUBA 2YBTA 3CPRA 1R86A 4BKNA 3HPSA 3DKLA 3HQPA 3VGGA 5CGTA 4RPPA 1LRQA 2GVJA 4KWVA 5KZMA 3KL3A 3BOLA 2Y88A 2HE8A 5EMMA 3B4YA 4K1WA 4AXKA 4QIUA 4JIQA 2I5GA 3S5NA 2NXIA 4QRNA 2OLHA 1UIPA 3MC5A 5I23A 4K68A 1TKKA 4WRHA 4NILA 1N55A 4K6AA 3WO8A 3W70A 1LL4A 4NL1A 4UTJA 3ARUA 3UPWA 3NPWA 4LAZA 2GOKA 1XFBA 3KBSA 1DTNA 2WSYA 3MHFA 3L2IA 2VC5A 3W1RA 1R85A 4LS0A 1KRBC 3CUZA 4AY7A 5AC7A 3FGCB 3W76A 3VU2A 1Z8AA 3E6EA 2D2JA 4E4PA 1QMLA 5CZTA 2FKPA 3P67A 3REQB 1RA5A 4PFHA 1FH9A 4FF5A 4NI3A 3ZLHA 1CWYA 2PDKA 1LZOA 3IJQA 2V5KA 1DXFA 2WCGA 2A3HA 3P82A 2NQJA 2CERA 3LXBA 3SCSA 3QV8A 4GD0A 3IJ8A 4FNRA 3S9ZA 5A8PA 1W9XA 3ERPA 1RK6A 1ADOA 3B0YA 3AYVA 5BRBA 4M80A 1ZAIA 3RJYA 4GI6A 3O0FA 3PP7A 2XVGA 3WFZA 3VOHA 3S2CA 3PWIA 1V02A 3C2OA 1PSCA 2WMHA 4GKTA 3LN3A 3G1XA 1XISA 5A6MA 3L5MA 3AHZA 2WAGA 1S5TA 1Q85A 4E2DA 4JQ2A 2C19A 1KCKA 3LPFA 4Q4OA 2W0UA 3NDYA 4GO9A 1KB3A 1ONEA 3U5YA 3PZNA 4FEZA 1XRTA 5FAGA 4IMDA 2ZWYA 1IZKA 1W0MA 2GWNA 1J93A 4D1JA 2NLIA 3H54A 4IICA 1EGVA 1LWJA 3TU9A 1F3TA 5I5RA 3DHDA 2NZLA 2XFYA 5D09A 1YBQB 3BV4A 5DT5A 1XLKA 2HV5A 1EHAA 5G4EA 4IIDA 3BLOA 3R2GA 4OFCA 1S3HA 3Q2DA 4PCPA 1UWIA 3AMKA 5BXRA 3OLGA 1AD4A 1NDWA 2Z1BA 3GYCA 2VTFA 3AHVA 3DC8A 3WJYA 2PTDA 3W73A 1PYFA 1J11A 4WX2A 1H0IA 4U31A 3MVIA 3N9RA 3PSWA 3F7JA 5MKGA 2DU2A 1C8XA 3N4EA 2O7SA 2PDLA 4IIGA 1F73A 1U2YA 4U3AA 1YHTA 3QR3A 3NL5A 2GGHA 3VIJA 3QZAA 3GHRA 1E9YB 3AZTA 1Q6GA 4PMJA 4UTHA 3MCOA 1UA3A 1E70M 4UTFA 3POCA 3KZPA 1BHGA 4Z1CA 1WP6A 1XG4A 1UZDA 3U9IA 4XAZA 4ADUA 4OUIA 3TYAA 4E6MA 1V79A 1RY0A 3QKZA 1QHOA 2W27A 1Q6LA 3W7JA 1GVEA 1X97A 4K8EA 4AHQA 1F6YA 4LRSA 5JQ9A 3V36A 3RLGA 5AHIA 2P3EA 1WXZA 1XL9A 1A3XA 4Q33A 1SU5A 4OBSA 1V3LA 1UBPC 4MY9A 4UNLA 2C91A 1XF0A 1G4PA 1D7KA 3RU6A 4YYFA 2XIJA 2QS8A 3CH9A 3GG7A 1I0BA 3WK0A 4EKJA 4LAUA 4KF1A 1TZ7A 3EA2A 1LOQA 4GJIA 4M82A 1QPQA 1HN1A 4HK6A 3ZS4A 3QKEA 3WLLA 3NQGA 3TFXA 2J7CA 2PI6A 3WLOA 1H7PA 2D1ZA 3O63A 4PYSA 4ZEPA 2WYSA 3OGVA 4D6EA 1VFHA 1OHLA 3XISA 3QSTA 4Z17A 2WKLA 1V7YA 4K39A 5M1TA 2G95A 3BK0A 4GHRA 3VPLA 1ZZMA 1Y65A 1NDYA 1JUKA 4I6KA 4GIEA 4CD6A 5FACA 3AU6A 4TIMA 5EMYA 4GYKA 3O2LA 1Q8JA 4AIOA 5E0FA 1TR9A 5DF0A 2YB4A 4M19A 1G6CA 3CZGA 1IV8A 3UJ2A 6ENLA 3HF3A 4PTDA 3UZJA 4KWUA 4B92A 3QOKA 4BWLA 1TTIA 3A21A 3IJDA 3T40A 1XYCA 4YLWA 1KBJA 3F4WA 1H63A 3GTNA 2ATMA 4O50A 1M1BA 3B03A 4O0QA 4CCEA 4D8ZA 3STPA 4NUWA 4RR4A 1LROA 1BVWA 1MMFA 1IEQA 4Z0SA 3VNLA 3VIMA 1K6WA 3UR2A 3QM3A 3P61A 4UTWA 1C90A 4RX0A 1MZHA 4MOZA 1ZL1A 4RK8A 4B9ZA 3KBVA 5HBFA 1L8PA 3EDDA 1ZRQA 1DIKA 4Q3MA 5FSDC 1X38A 4IPNB 5F1VA 1ZJHA 3BG9A 2CEQA 3ZO9A 3WLRA 1SZGA 2HJPA 5C70A 3WYZA 1SW3A 2PDPA 3AXXA 3T4CA 4Z1AA 1UD6A 2C18A 4XD3A 4TO8A 3EX3A 2BGSA 3EEGA 2YGYA 3P93A 3B8VA 1PUDA 4ML9A 3BARA 3AYTA 1QNRA 1XPGA 4JYFA 4IMCA 5CSYA 5B80A 4IIBA 3TXVA 1UR1A 1V5XA 1X8FA 4PULA 7A3HA 3UJEA 1K03A 5DBUA 1E4LA 1HKKA 3N11A 3PWAA 4N6EA 4H9XA 1HJUA 1BKSA 2DJXA 4ONVA 3Q45A 3E38A 1EF3A 3W7LA 2NSOA 2UY2A 1GVFA 3MI6A 2ZVIA 3TNOA 3WLTA 3NWRA 1BWKA 1B54A 3II1A 3MHGA 3JU2A 1B4EA 5E6ZA 3WF4A 1PJ9A 3R8GA 3GB6A 3BAIA 5IHSA 3GH7A 2OCZA 4DJEA 2C1HA 4M51A 4PCNA 4NU7A 4S23A 2HCVA 2W63A 3V1PA 2CWXA 5FJTA 4MUZA 4Z2GA 4JYEA 1SR0A 3GR7A 1B3WA 4NAEA 2ACSA 4XQ6A 2D3NA 1WKFA 1U5JA 1J96A 4WOQA 1V0KA 2Z00A 4AWTA 1XIFA 3E12A 3AOFA 3WLNA 3EX4A 3EWDA 3UG8A 3DKJA 2DP3A 4FX7A 1VC4A 1CT5A 5LA1A 1AZ2A 1ZPTA 1BGGA 2ZX9A 3SN1A 1XYMA 1R3SA 5HINA 1GEHA 2GGIA 1QTWA 1EDQA 2PTZA 2OYMA 2GGJA 2W5FA 3AROA 2FJKA 3DFOA 1P5BA 4HNUA 4GXWA 3S47A 5I09A 1TSIA 3TOPA 3MSYA 4I8YA 2VEPA 2CBUA 3LM3A 1JNEA 1EHNA 4REQA 4MYXA 1SPQA 3SRHA 3KHDA 3AUJA 3LQLA 2Z6JA 1HNYA 4O10A 3DHUA 3UWWA 3HMCA 1EJ7L 3T05A 2L5HA 1L8NA 4ADSA 3SJNA 3MS8A 1GOIA 1R9YA 9RUBA 2HQAA 1LUCB 3KRZA 3DDMA 4PUUA 5E0CA 4AUBA 4O18A 3AIUA 1XLDA 4GO8A 1DORA 2IQTA 3C0SA 1RJRA 1J01A 1MRQA 1KFLA 2EJAA 2AKMA 2AAMA 1E0WA 3ATYA 3UZWA 1PDZA 1UWTA 1OZQA 4I7UA 3D6NA 3M5ZA 3LNPA 1HQTA 2AQOA 4OU1A 5FKYA 1EJTC 2WCAA 3OEXA 3MWCA 2F7FA 4LS1A 4GZ7A 4PEEA 3I7QA 1XCWA 1J0JA 3SCNA 3TSMA 1TJ2A 3GDMA 1FA2A 3LRKA 3NPUA 3TAKA 5D33A 4OIFA 2RGLA 1SJBA 1VCGA 2RHGA 3LEPA 3KVJA 3TYEA 1KRAC 5AYYA 3KTXA 1B5TA 1VJZA 2PDGA 5FF2A 4C5ZA 1SFLA 5HMFA 3IARA 3FKRA 4YU1A 3BGJA 2X1UA 3ITOA 4PN2A 2OSXA 3N4AA 1ITQA 4AIUA 4L61A 1TCDA 4OVXA 1TE6A 2VX7A 3N19B 1R3QA 1FXPA 1TPVA 3N2XA 1AA1B 2QV5A 1EOKA 2BOGX 2YR1A 1PDYA 3FS2A 3KBMA 4YTQA 1ZP3A 5CJMA 3DFHA 4QE4A 3ZOAA 4JAWA 2DVXA 1VBRA 4WKFA 2NW0A 1TV2A 4GIAA 3W2MA 5EL1A 4Q8QA 3UESA 3S6DA 2D0FA 1QO2A 4GCXA 4E8GA 4ZO8A 3OG3A 3QHNA 3S2JA 1W17A 4XO7A 4L7ZA 3CHCA 3WH7A 3GNNA 2QR6A 3WEMA 3SCUA 2INZA 2XIQA 4NKCA 1SZEA 4DB7A 4IFRA 2Q3RA 1M53A 4KS0A 4Q22A 1PKYA 1UZ4A 2XZ9A 1SZRA 2XSXA 4HN8A 2PTYA 3OZYA 4A21A 3SURA 1OFAA 2DORA 3H2OA 4ZXOA 3FGCA 1Q66A 1REQB 3OB8A 3M0JA 4ZQPA 2FH8A 1G94A 3REQA 5EMLA 3T2QA 2DPEA 3EDEA 4P2VA 3TN4A 4MNJA 2R14A 4C6CA 1AVAA 1R5YA 4QS5A 2JEPA 4GC3A 1OFPA 1VPXA 3V5CA 4Z2KA 2P8BA 4DO7A 4MWAC 4UQEA 1XIJA 2PDJA 3TTQA 1Q13A 1FWCC 3NURA 1ML1A 2NQ5A 2CLOA 1AQFA 3SGZA 3PZMA 1EOMA 3S42A 1I1WA 1FP8A 1KFEA 1GJWA 1NAL1 2X09A 3FDGA 3LYEA 1T41A 2YKKA 5G1YA 1UWUA 2QCCA 3O16A 4JTTA 3SCTA 3NR0A 4AD3A 4YNGA 5BRQA 4H7VA 1KXHA 3K4DA 1KFWA 2TMDA 1CB7B 2DIJA 4LCRA 4OE7A 2WVVB 4MFEA 3AXIA 2WZMA 4HMCA 4S3KA 3L9CA 1H2JA 5FF7A 1JXKA 3F5LA 3B3DA 3GC5A 5REQB 1JDCA 1CXFA 1R2RA 4UC5A 2NSXA 4S3DA 3ORWA 2EF9A 1XUUA 4F0LA 3VE7A 2RGMA 2DZPA 1XINA 2ANUA 3DUGA 3S8HA 4E2BA 3CMGA 2V6AA 3L5AA 3O6CA 4F0RA 2INEA 1NOFA 2FGZA 5C5YA 2CESA 3BE7A 3ZQ9A 1LP6A 3MPGA 3W7KA 2WJDA 1OG6A 5HAOA 1Q4NX 1H7RA 3BLPX 4JZ5A 4B5NA 2E1DA 1F5ZA 1S3TC 4UWMA 2XVPA 4RNIA 4W5UA 3BLFA 1M3UA 1PL9A 1PIGA 1Z48A 3W87A 4W7VA 3M0MA 4UB9A 1UPMB 1RD6A 1IT7A 3EGJA 4FXSA 1Z69A 4XZLX 4JFWA 3B8IA 1Q7MA 2OT0A 3CZJA 2D3LA 3AIWA 1FKWA 1K8YA 1S39A 1E5JA 1EJSC 2VJXA 3T1GA 2KAUC 1OIFA 1X1ZA 3ALGA 1B0IA 3H70A 1R7AA 1JFHA 3UPMA 4YN5A 1M7JA 1F8IA 2E68A 3PTMA 3TROA 2WCSA 5E70A 4H3DA 2ISDA 4NJGA 1VBGA 1TJ0A 1J5TA 1EB3A 3HGSA 3LBMA 5F4XA 3TE9A 2VEGA 2OELA 2WJFA 2OXNA 2QF8A 1RLCL 1KXTA 3TCEA 5AZ0A 1J8VA 2Z4GA 2RAGA 4OHQA 2ADAA 3M6YA 4P5UA 1A5NC 3ZJ7A 3ZJ8A 3M4HA 1C91A 2XIIA 5JIPA 1NU5A 3MT1A 4ZSTA 4O16A 3QVQA 4YTTA 2WZHA 3UXAA 1E6ZA 1GKRA 3RF9A 1CW2A 1NWUA 3GDLA 3GVRA 4EAYA 5HPCA 2FTWA 4M5PA 2ZUUA 4KGLA 3DI0A 1JEZA 3V75A 1Y5XA 3UP8A 4FZIA 2VFIA 3NO3A 4S3GA 1TVPA 1QNSA 3I3DA 2RFGA 2OOGA 4YPJA 2QAPA 1OQFA 4JNMA 5XIAA 4FB7A 3S3GA 3ZZ1A 1E0VA 3M44A 4W8BA 1ZTVA 3HN3A 2P1FA 2Y8UA 4HA4A 4E4FA 1EX5A 4YHEA 1MUCA 4W84A 1XXXA 3QF0A 3CUHA 1ECQA 5XINA 3AHXA 4YYCA 2X42A 3L4VA 1CXKA 3THAA 4M1BA 2G3IA 2PWUA 4PCSA 4A3QA 3LTSA 2FPYA 3NDOA 5HMDA 1OCJA 3DESA 1PPIA 3WUFA 1W3IA 5CPSA 4W86A 2E9BA 3IS4A 3W71A 3URBA 2V69A 4HCDA 4LY4A 5H2ZA 4UTMA 1OFRA 3H4GA 4LX4A 4GXMA 2DZAA 1JDFA 1QOXA 3NGFA 1HL2A 1ZP4A 3S5OA 4WQ6A 2ZC1A 5I3GA 1OD8A 3CIWA 1VRDA 3MP3A 5HNUA 1LTDA 4CVUA 1B3OA 4MJZA 1N82A 5LIXX 1BVZA 1L6SA 4WJ8A 2E28A 1F6PA 1SQ7A 1IZCA 2I5IA 1Q3NA 1V03A 4GACA 1S2WA 1XRFA 2FZ9A 2Q71A 2VDHA 1E1EA 3WNMA 1UKTA 4WVXA 3IJIA 4TUFA 3ITYA 1RUSA 3CAKA 3GIQA 4DEFA 2B7QA 3AALA 3KLLA 3KBWA 3W7RA 3ATZA 1W2VA 1DIOA 2A79A 3KVKA 1Q7ZA 2YFNA 3RMJA 4C6PA 3M0IA 4I9JA 2GJNA 4HSOA 5DRIA 5DELA 3CL6A 1UOZA 1G9HA 4LUSB 4GGBA 1GJPA 2Y24A 3B04A 3AMLA 4AZCB 3UCCA 3BW2A 4JHMA 1XQLA 3TYBA 4FLOA 1OEPA 3TDFA 5CBJA 1OT2A 2UWFA 2V9DA 1YYAA 3LPPA 3ANUA 1XH2A 2R1KA 3P8IA 1T6MA 2J7FA 3A9IA 2X05A 3TN3A 3H6OA 3QC0A 1WUFA 1G69A 1UCWA 3SUTA 2Z25A 1JYNA 3PFMA 3PB2A 1KNWA 3TC6A 4PUWA 1A49A 4JBRA 3CWNA 4YTRA 4QAWA 4B3KA 1P6CA 4U5KA 2DZVA 2QCNA 2PWGA 3CC1A 4PMRA 1AH4A 4W7WA 3ZWTA 4N7QA 4QITA 3GNDA 1OJXA 1M65A 3I4KA 4XUYA 1Q7QA 3QJAA 2DUZA 4F0KA 2QGYA 3EDKA 1JRBA 2QPXA 3SO7A 4C1LA 5DX7A 4ENLA 1RVGA 2PGEA 3M7WA 1GTEA 4UFHA 3WJWA 3NZPA 1NVMA 3F4CA 1OFBA 1LBFA 1QT1A 2ZX7A 2FFIA 1PKLA 2HZGA 2BLEA 4WJXA 4LF2A 3UG3A 1OFOA 1A4MA 1A50A 3O07A 1E6PA 4JTCA 1W1B1 3OW1A 2YZRA 6REQA 4LYRA 4IF2A 1ISVA 3PN8A 1FWEC 1RBLA 1UP3A 3BCJA 3UR5A 1OX6A 5A6SA 1W1TA 1KXVA 1PYMA 3THDA 2X41A 3MA8A 3MV01 4LCSA 1SMAA 1L6FA 4G9PA 2BP1A 5AC8A 1WDWA 3W23A 3WK3A 1HF6A 4FNQA 1E6RA 5CSSA 1BRLA 4F0HA 1NEYA 2DH2A 3UJSA 1B57A 1XGZA 4X60A 4N02A 3MY9A 2CBVA 3VUSA 2YL6A 1W3JA 3GW0A 1LUCA 3WLSA 4XIAA 3USZA 3L0NA 2D20A 1QFEA 1BF2A 4LTSA 1VCVA 1HL9A 2TSYA 1TPWA 3HQ1A 2CKSA 5CZKA 1TWZA 2VGBA 4R5EA 4EIVA 2C1IA 2ZZ7A 1XDMA 3G3DA 1XBXA 2Y5SA 3SN4A 4HNCA 4ATDA 2HVNA 4WDUA 1EEXA 4JKLA 1CCWB 3WNOA 5A8QA 1DP0A 1R8LA 3GW3A 4M29A 3PZ9A 3UF9A 2HVOA 4BQ2A 1Y0EA 4PB5A 1I2NA 4M24A 1XLLA 2BVTA 4WF7A 1VHNA 3EWWA 1SFJA 5AYZA 2WMIB 4YMZA 2Z27A 3U48A 4MKSA 3TTOA 2Y5EA 4KCVA 1GQLA 2QCMA 4ZE4A 2ALRA 2XIOA 1XD1A 4UOZA 3GSMA 4QLJA 2B81A 3AC0A 3TLQA 4G7FA 3H55A 4TX9A 1ESWA 4F79A 6CGTA 1XSJA 1Y8BA 2QUMA 4JN8A 1S46A 5I00A 3G1YA 5FJUA 3GXDA 2VC7A 4B2DA 1PTDA 2O4MA 4MDOA 1JCNA 4NI8A 2ZZ4A 5M2FX 1E4MM 1GOQA 3UG4A 2Z1WA 3JVAA 3PTKA 3DFPA 3W1NA 2YA2A 4QHRA 4H9UA 3LA4A 1D9EA 3W1MA 5IDZA 3OZPA 1GOXA 1OG0A 1W8GA 2G97A 3FW6A 1EXPA 4B5WA 4IGMA 4O1DA 2X0YA 3OLIA 4B5UA 3TKFA 4L4LA 3UXIA 1JCXA 4WKAA 3S6OA 1YTDA 1W9BM 1MNSA 5JVLA 3H7RA 5I6SA 2R82A 1DHPA 3VABA 3TW7A 4G2DA 4LUJA 5FF3A 3QSRA 3TZNA 4DF2A 1C8QA 1ZJAA 3HPZA 4HP5A 1V51A 4FLSA 1F05A 4FX6M 2GQ9A 2DSUA 3CTTA 1QBAA 4GH3A 3UFYA 4H9ZA 4MM1A 3C2YA 3VX0A 4GYPA 1SSGA 3VD3A 2BHYA 4Y90A 4AEOA 4UQDA 1J0HA 1PCWA 3HQNA 1YMYA 1ZCOA 4O1FA 2VT0A 1H7WA 4TX8A 3LCGA 5A8OA 2V5DA 3G24A 3B97A 1XRSA 2DV0A 4WSJA 1GG1A 3SSJA 3EB3A 1G4TA 2NV2A 3UPBA 3QMTA 3WUGA 1BG4A 2WQDA 1BTCA 4IP4A 2DZXA 1VQTA 4KPLA 3FDKA 1B2YA 5DLCA 4GZEA 1V6TA 2FPTA 3RPTA 1HO4A 4JTGA 1Z6KA 3NQVA 4DO6A 1EA9C 1UB3A 4GABA 3DG6A 2QJGA 1TELA 4H83A 4QSFA 2BGNE 5LNRA 1JGMA 2FQIA 3CTLA 4G5DA 4UTUA 4X61A 1HX0A 4PB4A 5E9AA 3WUEA 5FEZA 3NG3A 4Q4RA 1FRBA 2VURA 4Y9MA 1JZ8A 3V4BA 3GU1A 5A2CA 2X16A 3CLWA 4QTGA 1EBGA 1EH9A 4GY1A 3QW4B 1I75A 4PUDA 2BVYA 1U1UA 4LBSA 1Z9AA 3SEPA 1RBAA 3BOFA 3IGXA 3T4WA 2FGLA 4MWAB 3WEZA 1Y5VA 3XINA 2BVWA 1F4HA 3T0BA 3BLLA 1VCFA 4PMVA 5TD4A 1HGWA 3WD0A 9XIMA 1GW9A 4BHYA 1UWAA 3S2NA 5REQA 3CUIA 4R53A 5CZSA 4Y96A 4CNSA 5LNUA 4EF9A 2YCEA 1C93A 4AWEA 1MXGA 2XTKA 1JG9A 1AW5A 5D8ZA 3KOFA 2MUCA 2WHJA 4JTEA 5E0KA 3GM8A 1DWFM 1GKQA 5AYBA 1JZ2A 1KR0A 2CPUA 4R34A 4MWAE 1YTEA 1AD1A 1I8JA 1MUWA 1O94A 2R9RA 1V6YA 2PDMA 3WBEA 4QS6A 1Q45A 3OYXA 3ZYZA 4B5SA 4HGXA 1NQKA 4FSAA 3FK4A 1EC8A 1R2SA 3GIYA 2V30A 4O53A 3R0UA 3STFA 1KM5A 1T99A 5I7GA 1KTBA 4XZBA 3V5FA 1KM2A 2VZUA 3GXFA 4J3TA 3AMGA 2HXTA 1UD8A 3WNKA 2VFHA 2QCLA 2O56A 3AIVA 4Y9NA 1XI3A 4B3LA 3U2OA 3KCJA 1XQKA 2E7FA 4NRSA 4LV4A 1WV2A 1RK5A 3B8TA 2OTDA 4ERIA 5A3HA 2ZVRA 1V6UA 3W3OA 1FWFC 3BO9A 4LEQA 4OOZA 4IPPA 1C9DA 1BQCA 2DT0A 3VYLA 4YS1A 1VFMA 2Y70A 4DJDC 2XFWA 3LMZA 2AMXA 4K8GA 1OY0A 4GX8A 3W2UA 1QK0A 3TP4A 3ZIZA 2WJZA 3PTQA 5EBUA 1BYDA 3N18A 3PANA 1Q6OA 4KWWA 3E1F1 1O60A 4Y9PA 3W7PA 5JXQA 4GQ0A 2Y8KA 1HXJA 2G0WA 3WLPA 4I8DA 3EA3A 1TTQA 3WL0A 3W6LA 4GH1A 3E02A 2YW4A 3TWBA 4NZCA 5ECUA 1OABA 4AMCA 1M04A 2BBFA 1ICPA 2DIKA 3B0PA 3GAKA 3THQA 2VR2A 3VDAA 1XD0A 1EJXC 3MZNA 1LF1A 1EC9A 2GJPA 5J5DA 1JVNA 1QWKA 3A5FA 2UY5A 3QV6A 5DCDA 4FOUA 3N6JA 3IIVA 4IP5A 3NZRA 1I2OA 4NXKA 4H9MA 4LBRA 4BEUA 4CGTA 4NASA 1Z3NA 3IIXA 1VF8A 2QYGA 2WXDM 4MB4A 5ABFA 2P88A 4DRSA 3M0VA 1E6NA 1VLIA 3EOEA 3D47A 3A23A 2XN2A 1F3EA 3RO6A 2CXEA 2RDXA 1O5RA 4S39A 1X98A 1H60A 1FH8A 4QJ5B 2GZXA 2GLKA 4RKAA 3VOGA 3QZEA 4A8RA 4IJCA 3MSGA 3W7EA 2W9MA 4JICA 2FFCA 1IQ8A 3VMNA 4B2DD 3EOLA 5K4XA 1PIFA 4IJBA 2VZSA 1MZRA 2VRQA 1EKOA 2PDXA 4C7GA 2WWCA 3LBCA 1WDQA 1IXPA 1EPVA 3TWAA 3C8NA 1GOOA 4YTSA 1NJJA 1IEVA 3NYZA 4Y9AA 3GK0A 1E0UA 5LIYX 3W25A 1ITXA 4AFYA 3S1XA 2TRSA 4UMAA 3FOKA 3IAQA 4W87A 1XM3A 3T0CA 3DENA 2W3ZA 2PAJA 4YVVA 1W31A 4JOMA 5C9RA 3PTDA 3D0CA 3LCWA 1EA0A 3EPNA 4UR9A 2V5BA 1JZ6A 4RDZA 5EPDA 2CZVA 2EQDA 5KITA 1Q5MA 5HPOA 4RZ4A 4OBRA 4HCLA 2BNJA 3CO8A 1M41A 2DIEA 4HA0A 4P7OA 3N6HA 4NZ1A 3VD4A 3W7NA 1C9WA 1GYNA 5EMUA 2BODX 5I3KA 5K2ZA 3SIMA 2ACQA 2QCDA 3N12A 4BA0A 4LUSA 3TC3A 3DXIA 3N9KA 5D2XA 1J10A 1P48A 5JBEA 3LHTA 4AZCA 2Z29A 3VGFA 3GHUA 1UH2A 1SUXA 1D3HA 2E0PA 8RUCA 4ZO7A 2EHHA 3MUIA 3PZVA 2R8WA 4PR4A 3H2FA 1RVKA 3BDKA 3QN3A 1TREA 1TQXA 3AZRA 3WQDA 3FYYA 4L65A 4NVTA 3BQ6A 4RE4A 3TYZA 1TG7A 2YBVA 3TQVA 4GQRA 3R8HA 3UGRA 3GXNA 3VM7A 2W66A 4F40A 4Z2HA 5I06A 1JAKA 2O9PA 1OB0A 2DW6A 1AK5A 4C6DA 3I7RA 4B90A 3K1GA 3C8FA 3DI1A 5LZLA 2VCCA 4DWDA 3N2MA 3ONCA 4IFKA 3TOYA 2OLSA 3N13A 3DAQA 3W2NA 4DI8A 3RX2A 2GDUA 4Q6XA 3T2PA 2DZBA 3QFEA 4IPLA 2WMFA 2EGZA 3GUWA 1SZFA 2VELA 1PX3A 4HPJA 3KXQA 2HROA 4PMDA 5M3WA 4HNNA 3WH8A 5C7HA 5ABHA 1G1YA 1YPFA 3NQFA 3IVSA 2BHUA 4Y8EA 1BEUA 1KCLA 4U2YA 1UR0A 3DZ1A 4G6CA 1NF7A 1WB0A 2PFHA 2XM2A 4GUIA 3C4UA 2CC0A 5KZEA 4DYKA 4XK2A 1UH3A 3ZM8A 1S5WA 2H9AB 3MSDA 1UR2A 1LM1A 1PZ0A 3G8RA 1WXYA 1LLWA 2VEFA 3HO8A 4NX5A 2PLMA 2J9ZA 3LBOA 1GYLA 3V7PA 2O55A 5CSRA 3CT2A 1C8YA 1E9LA 4ZB2A 1GPWA 4IL0A 2ZRXA 1CGVA 5A1AA 4HPHA 4TU1A 3ABSA 1TCMA 1HP4A 1W3TA 5D9MA 1LL7A 3M7SA 5CQ1A 4KH2A 4JS3A 4DZ5A 2H3BA 4C6JA 3INPA 1KM3A 1R2TA 1IIHA 3SY1A 4CCCA 3WQ8A 5DEZA 1D3CA 1TV3A 3NGJA 5L6UA 1H09A 1RR2A 2E6YA 4FXJA 4Q8VA 5AC4A 1WA3A 1HGYA 4LUTB 3KRUA 3TEVA 3UWYA 4J3UA 4HD5A 5AZ1A 1UW9A 3LGDA 3QEZA 3OQEA 3PJWA 1QK2A 3PAJA 2YOCA 3NQ6A 5G2WA 5AB3A 1MQPA 5HK4A 3SI9A 1J9YA 1XLAA 4GFIA 3P8JA 3UGVA 4NZJA 1L0PA 4ZGYA 1NARA 3NVTA 3DG7A 3OBKA 3UJFA 4DM2A 2NVAA 1RJPA 2GQAA 1GEQA 1R0MA 1R38A 1J12A 1XICA 3LY0A 2VFGA 3S5YA 2ISWA 2VL4A 4J5NA 1JZ7A 2CLHA 4XSLA 3UETA 3LZ3A 3TYCA 4N9CA 2EJ1A 4HU3A 5TQLA 1A0DA 5JU6A 1YIXA 1DWGM 3LI1A 3OTRA 2AOSA 4WD0A 5EMKA 1TJRA 4PTNA 3Q37A 3IK2A 3HBLA 5IXEA 4YL2A 3T07A 4W85A 2ATSA 3EZ4A 2HPMA 3EPMA 2EKGA 3OODA 4KEMA 4AZHA 4WHBA 1RBOB 4PFMA 1E5NA 5CPQA 2G50A 3RK8A 4GOAA 5XIMA 5IBXC 1B31A 3WQEA 2BY3A 1RP9A 5TIMA 3U7VA 2QMJA 4L9YA 3ZSSA 3UY7A 3R4IA 4K38A 5JMUA 3M9YA 2XUCA 2F38A 4M3PA 5C0QA 4L9XA 4YCPA 5AC5A 4X9SA 3IPWA 8XIMA 2UZ9A 1ELSA 4BF9A 5C9UA 4JCMA 4B91A 5D2VA 3VVGA 2WPGA 2Y7FA 3T9PA 2J47A 5FA5A 4CQBA 2JKAA 1ZBWA 1E72M 3EDJA 1YNYA 1ONWA 1LLOA 3NEHA 4IMFA 1H7XA 5FI8A 3S5SA 4LB4A 1MW0A 2D73A 3FX4A 5LNVA 4HNLA 2R94A 1DXIA 3LK6A 3ARTA 3DGRA 3MZ2A 1RJQA 3A4AA 4JTAA 1D8WA 2AGTA 4FI4A 1I2QA 4UMBA 3GDBA 3LDVA 3VKCA 3PBGA 2QUNA 1FDYA 3B9DA 4YWSA 2XVLA 2E6AA 3K2GA 1E6SM 2J8TA 3HPXA 2YIHA 1UWSA 3E2QA 4M7SA 1T96A 3W85A 1UKOA 3T42A 2E77A 3LGEA 2CBIA 2J7DA 2FDMA 3KBNA 1SVDA 5H1WA 1Q4WA 2OX4A 1V3HA 3SAZA 3WLIA 1WZAA 1O1HA 2A3AA 1ZS2A 3FYPA 3VUPA 4HKPA 4P61A 1I2PA 3OPSA 3E96A 3EXTA 3NZQA 3GFZA 3TK7A 2E5BA 2DFAA 3ZLFA 2PCQA 2VFFA 3CL7A 1WQ5A 1GHSA 5K3VA 2DSWA 1G4EA 4UZUA 5FJIA 1MW1A 4NZ3A 4WDTA 4LNCA 3UG5A 3CU2A 2PC4A 3U3HA 4AISA 4X2PA 3RILA 4GG9A 4RDVA 4C6KA 2J8FA 4XB3A 4XZIA 3K13A 2PRHA 2IPFA 1KO0A 3AWOA 4NT0A 1NQ6A 3HZ3A 1EP3A 2F61A 2WK2A 1OK6A 3NQ7A 3LS9A 3MMDA 4F0SA 4RE2A 1XIMA 3CM4A 3VZZA 4XX6A 4GQGA 1RH9A 2D69A 2XH0A 4GGHA 5TNVA 3BMXA 4MWAA 1UD3A 3CEUA 4IOTA 2FVKA 5ECVA 4Q4QA 1FUYA 1PKNA 4AWSA 1JUBA 4QDPA 1CBGA 3SADA 1UR4A 1ZY9A 5IOBA 5BCAA 4ZE5A 4LUYA 3CQIA 2PP1A 1W54A 2BOFX 1KBLA 3GVQA 1TV4A 1H61A 2QKFA 5BZAA 3BZJA 4GLEA 4D8LA 2VD9A 5LKYA 4DX3A 4I7WA 2BASA 4TMBA 4GIRA 4NZ4A 1OYBA 2YDAA 4AD2A 4D71A 1C3FA 2A3CA 2NWSA 2NV9A 5ABGA 1HJVA 1YXYA 3H21A 2PDFA 1Q65A 3KDNA 2XZ7A 3ZR4A 3I6RA 4JTDA 4Q7IA 4FO4A 4QX4A 2ZUMA 3BAJA 3G1HA 1MQQA 5F4SA 1EZ2A 5CAKA 2ZRVA 4U33A 4WKHA 4IFOA 3VOJA 3WLQA 1J0IA 2E1WA 1VBHA 1EGZA 2QJHA 1WAWA 2ZZ6A 1MXSA 1E1CB 4RPQA 4H04A 3L5LA 2YXXA 2V68A 2J9XA 4AEEA 3RLUA 1OK4A 3WLJA 3N73A 4B5VA 3IVUA 1A53A 3R25A 1EDTA 3MANA 3CV1A 4RE0A 1WZKA 4JQ1A 1WNOA 4WSKA 3AS2A 4HHHA 3I10A 3SCPA 1FWNA 4LY8A 1BAGA 2C71A 3BAYA 1GHRA 2WB5A 1W2PA 4EXQA 3V0TA 3WELA 3SRFA 3C2RA 3Q94A 3SUSA 4GIYA 3W86A 3PFRA 3JW7A 1TJPA 1GORA 1UMYA 1S38A 5CH9A 1F74A 1UHVA 4DF1A 4HNOA 6XIMA 3FAXA 1F7BA 1R9XA 1YRRA 3CQ0A 1N2VA 4EXAA 4OZOA 4MNKA 2DT1A 4B15A 1A47A 3IEBA 2J9YA 1VYSX 4DWSC 1TFVA 4MMWA 5A6JA 2CZDA 1YW1A 3FHQA 1DOSA 2OSWA 1X39A 3FA3A 3SCQA 2QCFA 1BLIA 3UYCA 3NCOA 2FVMA 1L6WA 2OZ8A 2HNHA 5C9XA 4ALDA 3E0LA 3EX1A 1H0GA 2E40A 3WZ0E 4JIHA 4X9YA 4DBUA 4I9TA 2I5QA 2VXNA 3K8KA 2C16A 3TCSA 1DQXA 3DFSA 4HCHA 5KMYA 5CGQA 1JI2A 4O12A 4O14A 3VCNA 4WCJA 1DJYA 3W6YA 3QC3A 2ICSA 3VIPA 4M56A 1K77A 3WH6A 4KERA 3L2LA 4J3VA 1TA3B 3DYMA 1K7XA 4LS2A 2ZX5A 1KV8A 3XIMA 1W5QA 3CQJA 1OC5A 4KQNA 1UR3M 3BPWA 2I56A 2A3BA 4IQEA 1X8CA 5HNRA 4H9VA 4XBSA 4PE8A 3EB4A 2HXUA 2AL2B 2A6LA 1UZHA 4IQLA 3O05A 2FB2A 1KGUA 4PTMA 4GJJA 4JTSA 9CGTA 5DY2A 1GPFA 4S1FA 5E93A 3KOYA 1EO5A 2V63A 4FIRA 2X30A 5HR6A 4ZOCA 2POZA 3P60A 3R11A 5CG7A 2BWGA 2DQXA 4FNSA 2WC3A 1S5NA 3N17A 2KX9A 3ITCA 3GAYA 1J0ZA 4IXHA 4JL1A 3UA4A 2PRLA 1QDSA 3MKVA 4IM4A 2ZUTA 1XYZA 1W8SA 3O06A 3F5JA 3PG9A 4DBSA 1ONXA 3KE0A 3M5YA 1K7FA 2CETA 2NXHA 1PZ1A 2WNNA 3L2MA 2YSWA 1DJIA 3ABZA 2FHFA 1B90A 4HA3A 2DY3A 3N04A 2EEXA 3ES7A 4BQ3A 1V77A 4ICCX 2VFEA 2O9OA 2ZRZA 1GYMA 4JHOA 2VOMA 2ZUWA 3KTCA 3RDKA 4Q8PA 3WKZA 3GTIA 1MW3A 3CXOA 4PA8A 2A21A 3M5VA 2VD8A 3DERA 1VFTA 1A5SA 1FHVA 4LAMA 4CQCA 3TQKA 1CLKA 3BJFA 3I7SA 3GTXA 3U2CA 2OSYA 4XZWA 3A4WA 2ZA1A 2Y7DA 3GFXA 4JNYA 3SUUA 2YL5A 2OG9A 3L0GA 3TV8A 1JZ3A 3WBAA 4K1GA 1R3YA 1P43A 2WQPA 4C6FA 2HS6A 4C1NA 3H2MA 5G4HC 1CNVA 5FSEC 3F4NA 3RAOA 2VGIA 1BYAA 5G2IA 5BXSA 4UBPC 1Z7AA 1KA9F 3CGTA 3PR2A 2OO0A 3WDJA 5A5WA 1UKQA 4MNMA 4WY0F 3CHEA 5FJRA 4PRTA 1QW9A 3LCLA 5BMWA 1E3ZA 1A5UA 1WPCA 3BG3A 1WBJA 4RE3A 1H3GA 3AS3A 1R47A 2WV8A 4C5YA 2YLLA 1Q6RA 3GKFA 4ATLA 4GUHA 4L6OA 2IPWA 4Y9OA 1VBUA 1UP2A 2VYOA 4IJRA 3UD6A 4FR1A 3G1RA 4QISA 3WX7A 2VWSA 3DHPA 3CZEA 4BCEA 1X6LA 1RXOB 4MWAD 5E09A 4JTJA 3B9EA 3B0VC 2R1NA 1FY6A 2E5CA 3BV7A 1W3LA 1BFNA 1B3ZA 4KBXA 4PBGA 4GBUA 4JKKA 4JKMA 1F76A 3LNMA 5K9XA 1FWBC 2CWNA 3KCOA 1HFBA 1OYCA 2H8ZA 2Y8VA 3VA8A 2BGQA 3W28A 1NTHA 4R33A 5HA7A 3V18A 3THUA 3V0SA 1K9DA 1JYXA 2EG8A 4HQVA 4DF0A 1FFRA 4V1YA 2YA1A 5CSUA 1NM9A 5LA0A 2G3JA 1QBBA 3GU9A 3P84A 5G1TA 1RALA 6XIAA 2XVNA 4LNYA 1KTNA 4PBFA 1ISXA 3STCA 2YW3A 1IWAA 5DCBA 4NYUA 1UD5A 3WMSA 3I3BA 5BMXA 1P7TB 4ICNA 4U10A 1XHGA 5ENLA 5F2MA 4AYSA 2A5HA 1VYRA 3IJ9A 1CECA 3C3UA 1F2JA 3VOCA 4NZFA 1NWSA 3MBFA 7REQB 1GT8A 2VCBA 1A80A 4G1NA 1DQWA 1DWIM 1FWSA 4MF4A 2V38A 3C2EA 1V93A 2QCHA 1U5HA 1KTCA 5LXXA 1E51A 5D9PA 2XN0A 4DJEC 1VBJA 2O4QA 1ZJIA 4QNEA 3PK7A 5I3JA 1ALDA 2E6DA 2FMOA 5RUBA 2BTMA 1UKPA 2J66A 1QUMA 3DC0A 2I14A 2PD5A 2VWTA 4A4AA 2UBPC 1FHLA 3U0HA 1JRCA 1I1XA 4O57A 5I2UA 2NUXA 2NUYA 1SO6A 5DMYA 1GQKA 1RSCA 3LV6A 3LHYA 1R6WA 3WNPA 3WLKX 3WQVA 2JE8A 1I0DA 4MUPA 4O28A 2E25A 1VZWA 5FEWA 2FZ8A 2JKEA 3OVRA 4NNAA 3CQKA 3T2OA 1CTNA 4LW7A 1K70A 1VP5A 1V7AA 1V6XA 2ZZ2A 4GY7A 3THCA 1ICQA 4RDWA 3MDWA 5G4WA 4Q4PA 3P62A 3OLEA 3ES8A 3EWXA 3MKCA 4I9AA 3I4EA 1WOBA 4L9ZA 4P8XA 4A3RA 5DMMA 1ZU8A 4IX0A 5C71A 1XCFA 3JS3A 2PF8A 1E55A 2QDDA 3L66A 1HW6A 4AWUA 1G67A 4GZJA 1XLMA 1VFFA 2DZUA 4F0MA 1FWIC 2XIMA 2R24A 1YDNA 1HJQA 1EDGA 5J5RA 4C7DA 1IGSA 1TUFA 4UQ9A 5KTLA 2ISFA 1PZ3A 3T81A 2WPBA 4D2JA 2ACUA 2PWFA 4AEFA 2CU0A 3VI2A 1B9BA 3LCIA 1LQ0A 4GNKB 4HMDA 2A6NA 4P7RA 4AW7A 1RCQA 3UYIA 2VGGA 3W29A 2TAAA 4LOCA 5HULA 4XBJA 1CI1A 4NXSA 5E5CA 2X8RA 4J3ZA 4RNJA 1QW8A 3WK2A 4UNIA 2PDWA 4ZZ9A 3U7BA 4GQQA 3SFKA 3ZVHB 2WHMA 2EO7A 1WZMA 3FSUA 4DQWA 3TN6A 1KM4A 3S4TA 1ZQ5A 3CL8A 3C86A 4HYRA 4C6NA 3HPAA 3R13A 3B0XA 1JCJA 1QHPA 2J13A 3TUUA 3HURA 5IDIA 5EFFA 2RDTA 3I3EA 4MZ8A 1L2QA 3EMZA 5LGZA 2W62A 4WY0B 3A4JA 2O7QA 3WQWA 3P3BA 1XIEA 4S3EA 1S1RA 2VENA 4FXFA 2WKJA 1OX4A 3PZGA 2YCJA 1B3VA 3GDTA 2XG9A 4PBEA 2QVHA 5CLTA 5H8MA 2UV8G 3RM4A 4H8NA 3FHAA 3W26A 2VR4A 4KFNA 4QLKA 4HOZA 3NVDA 4X63A 4M6QA 2JALA 4ZA0A 3HGJA 1OT1A 4GPNA 3K8LA 1LG2A 2GPTA 4Q4SA 4J3XA 3QQWA 1FCQA 2DW7A 3WD3A 1H51A 3KL5A 4XAFA 4KRTA 1OC6A 1R7OA 1TV8A 2WWDA 1RP8A 3GVVA 4JR5A 2P50A 2VO5A 4PTXA 1UIOA 3W7QA 1KGWA 2Y85A 3OO2A 2HRWA 3RFAA 1Z44A 1ZB5A 3WLMA 1P1MA 2ONEA 1OCQA 1UA7A 5BOEA 5CCZA 2YFOA 3EXRA 4L64A 4RDYA 5D30A 3L4UA 6PTDA 4XD4A 1KV5A 4M0XA 2F2HA 2V3DA 1WX0A 2QZRA 2WSQA 3TR2A 4YVXA 2CITA 4CD4A 4JTIA 1N7KA 2OVLA 4DO5A 4NRRA 3KAOA 4A2SA 3H26A 1E1CA 3PULA 3RRXA 1A0CA 1EEPA 4TR9A 1K3UA 1OC7A 5HWJA 3N3TA 3SCVA 1ADSA 4LCQA 3EBVA 3IJ6A 1AJZA 2OEJA 5D2WA 3RM8A 2PRMA 2X1TA 3CAQA 1EUNA 1R46A 5C9ZA 1H1ZA 1GG0A 1GWJA 4OTKA 5DQPA 1CPUA 2OQYA 4A05A 4MJ4A 1TQJA 2J27A 4EWJA 3RXZA 4V28A 3SBFA 4IGNA 1HTIA 3W1AA 2WZEA 3PZQA 3K30A 1JDAA 2QVNA 4BF5A 2HBVA 4EVZA 2ON3A 2DSKA 2DH3A 4MZ1A 3WJXA 4Y8FA 5D8WA 5HJXA 8CGTA 3CASA 4HPGA 2D0GA 4JDYA 2YL8A 1SR9A 5BXPA 2J77A 3TSBA 2QULA 4QEHA 3V16A 3HV9A 4FHAA 3P74A 2VNCA 1ZUAX 5CPMA 4CN6A 3EKLA 5HNNA 4MGGA 3MKKA 4QCFA 3UEQA 2WVUA 4UMCA 1GNXA 3A12A 3M0KA 4GWEA 3EOSA 1JDDA 5LSMA 3DFNA 3KL0A 1EFZA 8XIAA 4LEFA 3LU2A 3N34A 1VPQA 3GFYA 4GE8A 2REQB 3T55A 5CBBA 3NIYA 3RLVA 3ARQA 3BGAA 3MYOA 2QPSA 3H7UA 4B16A 3NL3A 1A4LA 1XX1A 4BZYA 1OZMA 3SW6A 3NPXA 1LORA 4RCXA 5D9OA 4CEXC 2NQHA 4H4IA 4DWSB 2IXUA 2PU0A 2O92A 3M46A 2G3MA 2P0OA 1A5MC 4IG2B 1XW8A 2WO5A 3VGHA 1EX1A 4M81A 1FCBA 1H7NA 2ISVA 1ONRA 1TA3A 1FXQA 3AJXA 3IJ7A 4ZXLA 2NXGA 4G8TA 3RNDA 4DHGA 3S0CA 3KX6A 2F2KA 4UTTC 2QDHA 3OA3A 6TAAA 3MSRA 1V0MA 2PMQA 1YLVA 1GQNA 2AKZA 4AF0B 4PUKA 5A2AA 3HGRA 1ISZA 4MPQA 1V02E 3SR7A 2Q6ZA 1H1YA 4OUEA 5C9WA 2D22A 2VFDA 4XAYA 3CHDA 7TAAA 4GVIA 2W4XA 4W8AA 3FJNA 1K02A 2JFEX 5EGRA