4RE0A

Crystal structure of vmolac in p622 space group
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
313
Chain Sequence
MVRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parathion hydrolase
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
molecule tags Hydrolase
total genus 118
structure length 313
sequence length 314
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4re0A00
3GIQA 3IACA 4LCQA 3TN5A 1ITQA 2VUNA 3PBMA 2PUZA 3B0YA 2DVXA 4XAFA 1FKXA 4LCSA 3GTXA 3IJ6A 3OQEA 1ADDA 3DUGA 1KRMA 3AUOA 3UPMA 2OOFA 1POKA 3GG7A 3S2LA 2QPXA 4ICMA 4F0LA 1UIPA 4UBPC 4CQDA 3QY6A 4DLMA 4IFKA 4H9MA 4DO7A 3C86A 1J6PA 2GSEA 2R1KA 1P6CA 4LFYA 4KEZA 4G2DA 4DLFA 2D2GA 5FSEC 4B92A 2OODA 4PBEA 1NDYA 4NG3A 4E3TA 3K5XA 4BKNA 4CEXC 4RDYA 4PBFA 4IH3A 4H9TA 3GU2A 1E9ZB 4M51A 4XD3A 2WJDA 4C6MA 1VFLA 3RCMA 1YBQB 4QS6A 5HMDA 5HMEA 2D2HA 3JZEA 2AQVA 4PCNA 3IPWA 4PE8A 1FWAC 1W1IE 4QRNA 4KERA 2HQAA 2YB4A 4KIRA 4DI9A 1J5SA 3HTWA 4C5YA 1FWJC 3DC8A 1GKQA 3QY8A 1QXLA 4R88A 4WVXA 4RDWA 4L9XA 1V79A 3PNUA 1EJXC 2Z29A 4GYFA 3ICJA 1PTAA 3RHGA 2QS8A 4INFA 2AMXA 2EG6A 2F6KA 3MSRA 4GX9A 4QSFA 4OFCA 3F2BA 3T81A 4DI8A 4G7EB 1E9YB 4B90A 4I6VA 2HPIA 4RDVA 3O0FA 1EJTC 1A5OC 2VM8A 2VC5A 2VR2A 3MDWA 4XAGA 3DCPA 1NFGA 4GXWA 1WXZA 2FTWA 5A6TC 4CNTA 3D6NA 4IG2A 2EG7A 4EPKA 3TN4A 2Z24A 1FWDC 1V4YA 3SO7A 1R9ZA 1J79A 3FEQA 1RK6A 4C6PA 4CEUC 1PSCA 4V1YA 4C6EA 4IFKB 3ITCA 3GU1A 4H9XA 1RAKA 4EPDC 3N2CA 1UIOA 2Z2BA 4ERIA 3GRIA 3GTHA 4H01A 3A3XA 1IE7C 2VHLA 4IGMA 1HZYA 4L6DA 2R1NA 4DZIA 3R0DA 1NDWA 2RAGA 3MPGA 1A5KC 4DZHA 1A5NC 1EJUC 1RJPA 3OU8A 3IRSA 4XD5A 4C5ZA 3LU2A 3UR2A 5CH9A 2DVUA 1EYWA 3SFWA 3F2DA 2Q09A 1YIXA 4RDZA 4CQBA 4JOMA 5AKQA 4AQLA 1RA0A 4KEUA 1FKWA 2A3LA 1A4MA 4CQCA 2R1LA 2PAJA 1XRTA 2AQOA 3S2NA 3PAOA 2YB1A 2P53A 4H9YA 3A3WA 3EWDA 2WJEA 4XAZA 2OGJA 3G77A 3MVTA 1RJRA 3FDKA 2YZ5A 4LAKA 2FVKA 3URQA 3LY0A 4GK8A 4RZBA 2WJFA 2HBXA 4IG2B 5E5CA 4C6DA 3RYSA 4QROA 1KRBC 1PB0A 1RA5A 1YNYA 4J35A 4IFOA 2GWNA 4HK6A 3PNZA 1FWHC 4LALA 3F2CA 3S4TA 4C6OA 2DVTA 1FWCC 4H9ZA 3F4CA 4EPBC 2Z4GA 2BB0A 2XIOA 3O7UA 4CNUA 2Y1HA 5HMFA 3F4DA 2VC7A 4LCRA 4ZSUA 3ORWA 1XWYA 3S2MA 1JGMA 2PGFA 4AC7C 3E3HA 4IQJA 4XD4A 4IF2A 3CS2A 4GOAA 2E1WA 1V7AA 3E2VA 3OODA 2WM1A 3LSCA 4KQNA 3AU2A 3E74A 3PANA 3IARA 2HBVA 4QS5A 1FWGC 1P6BA 3HM7A 4H00A 4WGXA 1ONWA 1XGEA 1FWIC 1EJSC 2IMRA 1R9XA 3OVGA 2W9MA 1KRAC 1J6OA 4J2MA 4C65A 3A4JA 4WHBA 4TQTA 2I5GA 5FSDC 3MTWA 3GU9A 4C6CA 3CAKA 3LGGA 4C6QA 1YRRA 3TN3A 1UMLA 2PLMA 3CJPA 4ERGA 2D2JA 3WZ0E 3LNPA 1V77A 2OB3A 3BE7A 3UR5A 4CNSA 4YIWA 3EWCA 3MJMA 4B91A 2QVNA 4QTGA 3LA4A 4BY3A 4J5NA 1A5LC 3WMLA 1I0DA 3IV8A 4GY0A 1A5MC 1RJQA 4KF1A 1FWEC 4HA0A 4G7EA 4GBDA 4V1XA 2O4QA 4D8LA 2ICSA 4GC3A 4HK5A 1KCXA 2FTYA 4Z42C 1ITUA 3IGHX 4GZ7A 1UBPC 3QY7A 2ZC1A 4ERAA 1NDZA 4DIAA 4H9VA 1FWBC 4C60A 3NURA 4EP8C 4LEFA 4C6NA 1FWFC 2HNHA 3GIPA 4IGNA 4LAOA 4H9UA 4B3ZA 3QGAC 4P5UA 3TNBA 4C6LA 4R7WA 2Z25A 4C6JA 2BGNE 3LSBA 3MDUA 3LS9A 1PO9A 2KAUC 2UZ9A 3OOQA 3NEHA 3LGDA 3S2JA 1WXYA 3ID7A 4XAYA 1QW7A 2Z7GA 2P50A 3AU6A 1YMYA 1V51A 1K70A 1POJA 3URNA 1M68A 1A4LA 3RN6A 3OJGA 5LXXA 2UBPC 4R85A 4KEVA 1O5RA 1M7JA 4EPEC 2GZXA 3WYZA 4HK7A 1BF6A 1EZ2A 4GY7A 3K4WA 3E0FA 2GOKA 4C6IA 2Z26A 1GKRA 4NI8A 4KESA 3B40A 3MKVA 3QGKC 4GX8A 2O4MA 4I6KA 3GTFA 4RE0A 1ZZMA 3E0LA 2ANUA 2G3FA 3FDGA 2Z00A 3HPAA 4HJWA 1K1DA 1K6WA 1S3TC 2CZVA 3NQBA 2GWGA 3URBA 4XD6A 2E25A 3TN6A 4F0SA 2HPMA 1R9YA 4LAMA 1GKPA 4C6BA 3ISIX 3EGJA 4C6KA 5G4HC 1EJVC 2Q01A 4IFRA 1YBQA 1M65A 2Z2AA 1ONXA 4ZSTA 4PCPA 2Z28A 1I0BA 3T8LA 1NDVA 1XRFA 2EG8A 2QT3A 4LH8A 2R1PA 3T1GA 3K2GA 4MUPA 3UF9A 1EF2A 3E38A 4C6FA 1KRCC 4DYKA 4GY1A 1DPMA 3KM8A 2PGRA 1O12A 3B0XA 1P1MA 2OQLA 2R1MA 4DNMA 3URAA 3UBPC 2Z27A 2YXOA 1EJRC 1EJWC 4UB9A 4KETA 2I9UA 3GTIA 3V7PA 3GUWA 3MVIA 4F0RA 2FVMA 4NP7A 1RK5A 4LANA 2FFIA 2ADAA 4BJHA
chains in the Genus database with same CATH superfamily
3UU0A 5DBTA 3K8LA 2DVXA 3SUSA 4V2XA 2OJPA 2QCCA 2DEPA 3IJ6A 5JQ9A 3OQEA 4YXGA 2J9YA 5GJMA 3O3RA 3K4AA 1UYQA 4TR9A 2OLHA 3L5AA 4ICMA 3SCOA 3Q65A 2BP1A 2E8ZA 1SVDA 5RUBA 4IFKA 4IZGA 4H9MA 4AMAA 1M9HA 2WWDA 2JGYA 2WHLA 4G2DA 4DLFA 2BGQA 2F6UA 1NDYA 5TIMA 1QBAA 1TJ2A 3VUPA 3WEMA 4NYUA 4IH3A 1OCQA 2Y8KA 2X1IA 3W85A 3KFTA 1VFLA 3RCMA 2CLIA 5HMDA 5HMEA 1W37A 4M8UA 4RV3A 3CMGA 1CXEA 5EU9A 1SZFA 3STCA 1ZBWA 4JTIA 4A35A 1EL3A 1OX6A 3MMTA 3UGRA 3FAXA 3GNNA 3VIKA 4M6QA 3AYTA 3PUOA 1WBJA 1SFTA 1WDWA 2RGLA 1I4NA 4RZ6A 5GNZA 4UTUA 3QLDA 2XYLA 3CGTA 4PTDA 3PJXA 2HPIA 3CWHA 1EP2A 4JICA 1OY0A 1G94A 4P7LA 2FTWA 3W70A 4HYWA 3ZMRA 1K8CA 1HKJA 1VFUA 3AS1A 1W3JA 3NZQA 4HD5A 3V1HA 3UVAA 1WE5A 1UZ4A 1V7YA 3EB2A 3RMJA 2DGAA 2ZE0A 1K9EA 1MXDA 2V3FA 2IQ0A 5HUPA 1UQYA 4PODA 5HK4A 2DH3A 3S5SA 3BGJA 3GTHA 3DYPA 1A0EA 4LJ3A 3G8EA 3W28A 1Z9AA 1NQ6A 3C3NA 3F4WA 3FA3A 4PTXA 1NDWA 4Q32A 4Q4KA 1ALDA 3DFNA 5HNUA 2G95A 2V69A 3BCDA 2VZTA 5I23A 5ABFA 3IUIA 4ENLA 3THQA 2X0HA 2DVUA 4IMEA 1FCQA 4NAFA 4CQBA 5CZKA 3AISA 3IK2A 1CW2A 3EBVA 4FAMA 2YYTA 4HOWA 1S38A 2WMHA 1EWEA 3NL2A 2P53A 4I5UA 5DMLA 4EACA 3DKLA 1JUBA 4O28A 3ZLFA 4GUGA 2HXUA 3F1QA 4J4KA 2ZUWA 2QDEA 1XP3A 4ZB0A 3FDKA 3UERA 3C2EA 3ZWSA 3MU7A 4RZBA 1BYCA 4HOZA 3RM9A 1TE6A 4HNVA 5JVLA 4PUUA 5A8QA 1LG1A 2PE4A 1KO0A 4L1WA 1XRVA 4GE8A 4Q8MA 4EWJA 1XUUA 4WQ6A 5H8MA 2VC7A 3PG8A 1EC9A 4DX3A 4IPIA 1JGMA 1JGIA 3PK7A 3LUTA 1XCXA 3ANUA 5ABHA 3W7GA 2WM1A 1TPC1 1MRAA 3PANA 1XLFA 2P8BA 1FX6A 1QOXA 1M04A 1KBIA 2NQ5A 3WD1A 4WJEA 1CIUA 1HTIA 5JH1A 3DEQA 4I7VA 4Q8OA 2Y2WA 3W27A 1WCGA 3A4JA 3R0KA 1PL9A 4UR7A 2DZBA 3AO0A 4GWEA 3AIWA 5LGXA 3WH6A 4FIRA 1XUZA 4UCGA 4ZQOA 2Z1XA 4C6QA 2Z1SA 3DXIA 4QG6A 3WZ0E 4QE4A 3WLPA 4OOZA 3WX7A 4PC8A 1W3NA 3TTOA 4MDPA 2WM0A 2XIBA 2XN2A 2ZRUA 3LBMA 3NO5A 2QCDA 1ZAIA 4UQAA 1K7XA 4AB4A 4D8LA 3EWZA 1PZ3A 1HF6A 2FZNA 3W6LA 1W5QA 1F2JA 4J2PA 1UH4A 3MHFA 4RXGA 3V5OA 1FWFC 3MCOA 3W88A 4S23A 1I2QA 1PYMA 3GYCA 1KLZA 3SCUA 3QGAC 5A6LA 4DF0A 3SGZA 3QRHA 4JTEA 2XJ7A 1F07A 3UZJA 2E28A 2EO7A 5LNWA 1RY0A 5E09A 4H4IA 3NEHA 4XZHA 5DRIA 3KCJA 5FF3A 2Z7GA 1T7LA 2QYGA 2XIQA 3PTMA 4JNZA 3EXRA 2C3ZA 4HHHA 4AG0A 3FSUA 4AY8A 1HW6A 1DIKA 5C71A 3QMTA 4QDWA 2INFA 3RK8A 2MUCA 2PZNA 3MYOA 1GKRA 4P8XA 1KTNA 1QHOA 3C61A 2PDWA 1JPMA 4DXVA 3NSXA 3VNMA 1AODA 3B03A 3C2YA 4RCXA 3QYSA 1OX4B 1QBBA 2QJJA 4JQ3A 3FJ6A 3JVAA 4JPGA 2XM2A 2V2DA 3O63A 3NR0A 2GWGA 5TNVA 4LAMA 3LM7A 1SR0A 4HYVA 2X2GA 4XZLX 4C6KA 2ISDA 4BS0A 3M9YA 1GVIA 4IFRA 4S3AA 1TR1A 2HSAA 4YLWA 4ZB5A 2E6DA 3FAWA 3ZVHB 1BXNA 2VR5A 1K9TA 4GCAA 4HHPA 5G1TA 1GOKA 3KBJA 2VQTA 3UJSA 4Z2JA 3H2NA 4Q33A 3VOIA 4LNYA 4DHGA 2GGHA 4Q4PA 3B0XA 1QW9A 2FGLA 2C0AA 4I5XA 3V35A 2B7NA 3S9IA 2VT0A 2WANA 3NL5A 2G97A 1Q63A 7TIMA 1I1XA 4FF7A 3VCCA 4D6IA 2MANA 1ITQA 1Y5WA 2ZUMA 3NM3A 3TAKA 2KZHA 1KM5A 1JRCA 2X1SA 1TREA 1E15A 3WF1A 1E73M 4KRUA 3TTYA 4MOZA 1OWQA 1JG9A 1VF8A 4C7DA 1QNRA 4F0LA 4JFVA 3WUBA 2QXWA 1IF2A 1UJPA 2E9BA 2G8ZA 3BMWA 3C86A 3L4YA 9CGTA 4AVOA 4B5WA 1QUMA 1O94A 2TMDA 1X6LA 2OYKA 2POZA 1Y8BA 3RLVA 1BD0A 4QAIA 1JCYA 3OZMA 2CW6A 2INEA 1JVNA 3AXMA 1ZSXA 1JZ7A 1LCOA 2WHJA 3AIQA 4TUFA 2QHAA 1VPXA 1OC6A 1CXIA 4LUIA 4FZIA 4U2YA 5DX7A 4OFCA 3WJXA 2B7QA 2QCNA 1CYGA 1W3IA 3H2AA 2VM8A 2QV5A 3NVDA 5G4WA 4K38A 3MDWA 3HF3A 4NX5A 3V0SA 3DCPA 1H1ZA 3AC0A 2GFTA 3QMSA 4M6PA 3W76A 4AZHA 3IUHA 5KTLA 4MPKA 1V4YA 4X22A 2P3EA 3RUBL 3TYEA 2DZWA 1O7AA 3WKZA 5C9WA 3POCA 4NSBA 4AH7A 3KZSA 3KE0A 1R2SA 1US3A 4B5SA 3A47A 4U10A 5DY2A 4L64A 1DEDA 3BGAA 4HP5A 1J4EA 4ECLA 2EPKX 3L0NA 4PUMA 4F2UA 3LDVA 3T44A 1R85A 3CB3A 4IP5A 1RJPA 4Y9AA 1KM1A 1Q2SA 4XO6A 2D2OA 3E6EA 4GD0A 2R91A 3LU2A 1UASA 4UFKA 2XVKA 2DY3A 2QULA 2AQOA 6PTDA 3UJFA 2VZVA 1BGGA 1V08A 4XAZA 4PH6A 4GXPA 3T9PA 1QWGA 3TYUA 2V3GA 1WXJA 1RPKA 3DBPA 1J11A 3WLRA 4C6DA 4L4LA 3RYSA 3VA8A 4WSHA 4IFOA 4FB7A 1JQVA 1XM3A 3ME3A 5AC4A 1V3MA 1Z42A 3AZSA 3CT7A 1PDZA 2XIOA 1V0KA 1A50A 5J5RA 1OT1A 3ABQA 2BHZA 1W1TA 4X9YA 3N6JA 1GZJA 1XLEA 3W1PA 5K2ZA 2NWSA 5HQLA 3QR3A 4DJFC 3E2VA 3LSCA 3U2OA 5C9RA 3IEBA 1EXBA 3IARA 2HISA 1YXCA 3ZZ1A 4Q8PA 3WQPA 2WBGA 3BAWA 4Q4MA 3NWRA 1Q13A 8CGTA 1OT2A 1J6OA 1R3VA 1IT0A 2ZUVA 2D3NA 4X0NA 3W7NA 1PZ0A 4TQTA 4AZCB 4IJRA 3TZFA 2VEFA 1NOUA 4H41A 1LL7A 1RQHA 3CL7A 4DUVA 1UR3M 2XVPA 2L5HA 2BS9A 1XYMA 2CZFA 1OX4A 3MW7A 3VKAA 1TMLA 1EWDA 1HP4A 3ARWA 1JCMP 5FEPA 4HA0A 5DT7A 4UWMA 2CCRA 1TV3A 5AHLA 2OZTA 3F4NA 4BK9A 5GPRA 4CVUA 1W31A 2XIJA 2NW0A 1NDZA 1FWBC 3BLFA 3PSWA 4I7UA 1J12A 1UD6A 2IQDA 4F48A 2P0IA 2D69A 2QLYA 1YX1A 2X40A 3L21A 3ZVHA 1NWRA 1GOXA 3VD9A 1RCQA 2QMKA 4R7WA 1NFPA 1DIDA 2CBVA 3B06A 3VOHA 1H7RA 2YLAA 1G6CA 4QBXA 1X6UA 4HCLA 2VR4A 5CKSA 3W1TA 1QI0A 2ISSA 4L9ZA 5C7HA 5FIPA 1K70A 3ZR6A 3NO1A 3PPCA 2I9EA 1XIIA 5CG7A 1XCWA 4O13A 2PDPA 3WYZA 1UBSA 1KBBA 3QOMA 3EX1A 1JDFA 4A22A 4LYKA 2WCAA 1SFJA 3IIVA 5JUVA 1DXFA 3W83A 4MWAC 2BVTA 3B40A 4QX4A 2JBMA 3MHUA 3TTQA 2XIMA 1YNQA 1QJWA 1X1NA 3BLOA 2NX9A 1RSCA 2E25A 3TN6A 4FNRA 4OU1A 3ISIX 4MADA 3W7LA 4Z2IA 1KD0A 2VRQA 4WDTA 3G1VA 1M65A 1Y7VA 4IICA 1AJ0A 4CU6A 1EA9C 1I8JA 2EG8A 1DL3A 5KITA 3UR7A 2ZTJA 1KR0A 4X60A 3K2GA 4MUPA 3K30A 4IPPA 6REQA 2YL5A 4S3DA 3W2JA 5LA2A 4FF5A 3EKZA 3WG6A 1BXCA 1JDDA 1KFLA 6ALDA 5FKYA 4ZEPA 2UY4A 2CWNA 2ZRVA 3NM1A 3N73A 1PJ9A 1B4EA 1EJWC 3RMEA 3QFWA 1IZKA 4LVDA 3KWSA 3MVIA 1DTUA 3SI9A 3TWBA 5BWFA 4FXJA 2G3JA 3RO6A 1KV8A 3ZM8A 1LLZA 1KB3A 1IWPA 3VFLA 2A4AA 2CZEA 2GVJA 3BAKA 3BW2A 1MQRA 4NNAA 1IXPA 4JHZA 1POKA 3TFXA 4FNUA 1FHLA 2OQYA 1HJQA 2JKEA 1TPEA 2AKZA 4MAVA 3V36A 2A3CA 3FA5A 3F7JA 2CXGA 2C19A 3SQLA 3UG3A 1GHSA 1PAMA 1KTBA 3QR1A 1OINA 1QVBA 3MP3A 3ARUA 5LIYX 1D8WA 2EGZA 4AEEA 4GA8A 2GJNA 1UKPA 4XD3A 3B05A 4Q4QA 4MVAA 3L5MA 1J5SA 1R5YA 2DW7A 3CLMA 3CEUA 1A47A 4ACYA 3BJSA 4AVFA 3W1UA 2HNEA 3QY8A 1QXLA 2YA1A 3VOGA 4KS0A 2O55A 1H62A 3G1HA 3QFEA 1E5JA 3G0UA 4IJCA 1EJXC 3DFTA 5FCZA 1C8YA 2EG6A 4Z2GA 1A49A 2VMFA 2CC0A 1E9YB 3L0KA 3W23A 3O0FA 4BQ5A 2GGEA 3IGUA 1EPXA 2BY3A 5LZLA 1WXZA 3M07A 1JIBA 4OBRA 2PF8A 4ZFCA 1JZ2A 1L0PA 1MFUA 1KNWA 1KCKA 4QNEA 1FWNA 1L6SA 1VBHA 3A4WA 3GKAA 3KHJA 3B9NA 4WJXA 4YTTA 1OCNA 3OYZA 4C6EA 3AJ7A 4XZIA 4JTRA 4OZOA 2ZZ4A 4LVFA 4L1XA 5TAOA 1PIFA 4CCZA 3FK4A 1M7PA 4RX0A 3N4FA 1KCZA 4NILA 3CHFA 4X61A 1FWRA 2JE8A 3EX2A 2PP1A 1H4PA 3GFZA 3ES7A 1R2RA 2Y70A 3E9AA 5D38A 4PL2A 1BSIA 4E8GA 3HMJG 1TTQA 4Q8QA 1TJPA 4RDZA 1EIXA 1E6RA 3N6QA 1F3EA 4NIRA 4AZCA 3N12A 3CQJA 3NO3A 2BHUA 5HJYA 1D7FA 3E2QA 4PMXA 3AWNA 4N2YA 4NKCA 3WL1A 3VNDA 2OX4A 2QCHA 4GJ1A 1U33A 3W1LA 2DIKA 4WXYA 5CPTA 4A05A 4EE9A 2ASHA 2GVYA 3QZEA 4LAUA 2BVDA 4AZBA 1OC5A 3A4AA 4LAKA 1TX0A 3DENA 4U3CA 4HNUA 1KBLA 3WH7A 1H1NA 1PB0A 2FHBA 1R3RA 1WDDA 1FWHC 2QQ6A 4QSHA 1Q7MA 2VP8A 1KXQA 1XH2A 4OWGA 5BRBA 3BDKA 5I03A 4TMBA 1S5TA 3MI2A 3GIYA 3Q67A 4LRTA 2VEKA 4N0RA 3SJNA 1QO5A 3IVSA 1W9VA 3M0JA 5A6AA 4BQ3A 2VX5A 3B9AA 4Z1CA 3AHZA 3H2EA 3QPEA 4YVPA 3DFHA 3MC5A 5FF7A 4FA3A 2B0MA 1EJSC 7ENLA 1GVEA 4OHQA 4YVXA 1R7OA 3WH8A 4JIPA 2MNRA 3W26A 2YBTA 3GXNA 5AYBA 3S5ZA 4GQ0A 3RXZA 2GVEA 4NNBA 1XSIA 3RITA 4F2TA 4KGLA 4WJ8A 3N11A 1RCOB 4H8VA 4H3DA 3ARTA 1H5VA 3T05A 4JS3A 1W9DM 4OUIA 2EJ1A 3WY1A 2DFAA 1V5XA 1GOIA 4GVFA 5LHEA 3LERA 4MZ8A 3P84A 4P8UA 4E3VA 4YTSA 1GVYA 1CI1A 1TWSA 1TZ9A 1US2A 3THDA 1WAWA 4FEZA 3UWZA 4TX8A 3MUZ1 1QRQA 2QDHA 1MQQA 1WOBA 3O9NA 5I79A 3U48A 4KCWA 3MDUA 2UZ9A 3T4CA 1K4HA 5ABTA 5I02A 4PUKA 5BOEA 3KL5A 3WQDA 4U2ZA 4HA3A 3OJGA 2VFIA 3C0LA 1LBLA 3R43A 3A23A 1C9WA 5C2XA 2DZSA 1Q65A 1GPWA 2R24A 3PJTA 3GH5A 1ICPA 4B4HA 4K7YA 1KV5A 3GG8A 3KBWA 3S1XA 1EF3A 1VENA 4B16A 4O12A 1SQ7A 2DIEA 3U4AA 3KTSA 3S5NA 2GOKA 1P5BA 2Z0IA 1A5CA 2VZSA 4L80A 2YA0A 2WO5A 3CM4A 2ZICA 5HR6A 2ZQ0A 2E9LA 1XLGA 3L2MA 4PB5A 3TYDA 1VC4A 3SQMA 3A4XA 1EO7A 3E5PA 2ATMA 3SY1A 3M46A 3PZGA 3H53A 5CPMA 2HE8A 3VNKA 1S2TA 3U0HA 1L8PA 1AW2A 4O15A 5KSWA 5CSUA 1I9CB 1GUVA 4QFUA 4MAZA 5CPQA 4Z0JA 1NF7A 2NXHA 4A3HA 2Z2AA 1WO2A 1ONXA 1NWSA 5REQB 3COTA 4ZSTA 3JZUA 3BOLA 1GJPA 2W4XA 3ABOA 3WNPA 4O18A 1FCBA 1EF2A 4MJMA 1UQZA 4UFMA 4KH2A 3M5ZA 3PPHA 4L61A 2PSNA 4M81A 2HVNA 1PXGA 3SCSA 3L2IA 4NZ3A 3M7SA 3CZEA 1PWLA 1HJXA 1QMLA 2PS2A 2YXOA 4EKJA 2WPGA 3VD3A 2ZTKA 3PAJA 1RK5A 1V6VA 3OP2A 1JXJA 3LPOA 2H8XA 6ENLA 1X8FA 4Y9OA 3NQ8A 4E6MA 1MUCA 2QEZA 3SRFA 2HXTA 3N29A 3TU9A 3DUGA 2UY2A 4KMQA 3USZA 3GVQA 3AJXA 1V6TA 4K6AA 1LQ2A 4O1BA 1TVPA 1DE5A 4DO7A 3H26A 1SO6A 1YQ2A 1CGYA 4LV9A 4AIOA 4UZUA 5IFPA 5D2VA 1OFDA 1DXIA 1TPWA 4R34A 3EPNA 5BXPA 4GXMA 3M6DA 2W27A 4QLLA 3LCXA 3WFZA 3M0HA 3F03K 4LTSA 1W1IE 1LRQA 4QRNA 1YPIA 2HQAA 2VGGA 2JF6A 3T7VA 2QUUA 2PRMA 4R5EA 1NP0A 4HMEA 1IIHA 2BNJA 3ZT5A 3GQYA 1PX4A 3SCTA 4UNKA 4KCTA 3T81A 5EFFA 5DEZA 2A3AA 3NIYA 3SCPA 2G0WA 1A5OC 3OHIA 1Q7ZA 4MTVA 4KWUA 5D8WA 3NA8A 1FWDC 4QE1A 3FGCA 1X96A 4GGBA 3BQ5A 1EYEA 1EX5A 2PEVA 2OWCA 3THCA 3ITTA 1YYAA 1XGDA 4NY2A 1TMHA 3RCNA 3UWEA 2QUMA 3WQ4A 1WDRA 4Z2HA 3KVJA 2ALDA 3I3DA 4Q4RA 1VBJA 4RNJA 4ZE5A 4DZIA 4S3EA 4H6QA 1HFBA 1TE1A 2YX0A 5MF5A 1H60A 4UMCA 1XIEA 4N42A 5CZJA 3N3TA 1E9LA 3N19B 2BLEA 1QI2A 2FZBA 5A8NA 4XWUA 2TSYA 3ZS4A 5EY5A 1LQ0A 1T6MA 1AH4A 1OYCA 3ABZA 3I6RA 4UMBA 8XIMA 4WLCA 1V3KA 1CGXA 4KFPA 5C9XA 5AN7A 2GVLA 3CIWA 4LNCA 3KZPA 1E0TA 1XLBA 4GPNA 4AZ7A 1QU4A 3PUGA 1R3WA 2FVKA 3GAKA 3BZJA 4TXEA 4ZCWA 3SUVA 3IAPA 4HK6A 4TX9A 4N9CA 3IJ9A 5EMKA 1XHGA 5JBDA 1XIJA 1Q4WA 3ECQA 5L6UA 5A2BA 4LXFA 1XJBA 4HMDA 3APYA 1FQ0A 3I7SA 1ZGDA 4JQ2A 3W9ZA 4DJDA 1SMAA 2YW3A 1C7SA 4ICNA 5AYZA 3W25A 1UD5A 1QW8A 1KFBA 3W82A 1XIFA 1SPQA 4EAYA 1ENUA 2V2HA 1UHVA 1HKIA 3ARPA 5IDIA 1R9XA 4YTUA 1KRAC 1O5KA 3SUUA 2OEKA 4LT9A 4EXBA 2A3BA 3ITLA 4D2JA 1C8VA 1YRRA 3AIUA 4PTVA 2XSBA 1UMLA 3DHFA 3V18A 1G5AA 4FP1A 1PKNA 4ERGA 4EX4A 2CIPA 3O06A 4M82A 3RPTA 4A8RA 4PMZA 3S1UA 1LRTA 3CHEA 1MW3A 1MUMA 2G3IA 1MDLA 4V1XA 3ITYA 3TFCA 1A0CA 2DP3A 1EC7A 4GC3A 2FTYA 1KM0A 3AMKA 1E6ZA 1PTDA 1EQPA 2J88A 3HA1A 4YU1A 1CB7B 4B9ZA 5A6MA 2HROA 4JIIX 1JXKA 3MKCA 4C6NA 1QHPA 5REQA 3VAVA 4JY8A 1A5AA 2O7SA 3BMVA 1UR9A 2NT0A 1EFZA 3RX2A 4LWWA 2A6NA 4UZSA 3VD5A 3MP5A 1H7WA 4OOUA 3E0WA 3WDRA 1NFBA 3E96A 3S6OA 2YKKA 3UYIA 4XAYA 1E6QM 3EA1A 2FZMA 2ZCGA 4PEEA 5A95A 1DTNA 1LZOA 1V51A 5EMUA 3LV6A 3LLDA 4ZXOA 2CLFA 1L2QA 1UWAA 4H8UA 1SSDA 3P93A 1EZ2A 1UWRA 3EMQA 5I3KA 2NV1A 1KGUA 1DJNA 2XZ7A 3W1QA 3CL8A 3E0FA 3CZGA 5EMYA 2JQXA 5A8MA 4HTBA 1Q4NX 3HQPA 4GBUA 3IGXA 5HJLA 3LBOA 3H2CA 1HL8A 4GJJA 3DGRA 1GVRA 4Y6GA 3WENA 1XL9A 2DT1A 4IMGA 3EKGA 4BEQA 1W3HA 2CLKA 1BLIA 4XD6A 1MXGA 4AZGA 4D1JA 2HTMA 3ITVA 1Q3NA 4W85A 3CV1A 2ZC8A 1A5UA 1T99A 5H1WA 1M6JA 1H41A 3QJAA 4UIOA 1OG6A 1S1RA 1ZRQA 4LB4A 1GZGA 4IMDA 3E38A 2E5CA 4G7FA 3CWOX 3TSBA 3SSJA 4JGDA 3AFBA 3EA3A 2R1MA 1KFWA 3NPVA 3QW4B 3C6CA 1HG3A 5F4WA 1W1VA 4V15A 4B5XA 3RCYA 3VX0A 4MFDA 2V0TA 5E70A 2E67A 1HJWA 4JTUA 2XG9A 2J25A 4I9JA 1OZMA 4MNLA 3GIQA 3IACA 4IUGA 3PBMA 5I77A 3B8DA 2PUZA 5BROA 3EWBX 3HBLA 1ADDA 5EA9A 5A8GA 3OVRA 1UC5A 3TW7A 4ES4A 3O6DA 2TODA 5I3HA 1XV8A 1UD8A 3QMRA 4DNHA 4FOJA 4DLMA 4F40A 2XFYA 1J93A 3PJWA 4B92A 4JCLA 2YXGA 3WLKX 2V9DA 2X16A 5HXMA 3B97A 3M0LA 2OG9A 4XO7A 2OLSA 2Z1KA 2YA2A 4GACA 4D6FA 2PDXA 3SCNA 1US0A 2CHNA 1EOMA 4W8BA 1MNZA 2H9AB 1FUYA 4DBEA 3VIJA 2PRLA 2BODX 4S3BA 1MUWA 2ODOA 3H7RA 3WF2A 1UP0A 1EDQA 1XYLA 3PNUA 5HMSA 3M41A 2GUBA 2OVLA 4W7UA 2QVHA 3I65A 3TC7A 3A64A 3W75A 2CU0A 5CSRA 1R3QA 1JD9A 4GXWA 1SFSA 1P0DA 3MSDA 3GVGA 3O05A 4S3GA 2PI6A 2ZX9A 3UWYA 4A3UA 2J78A 2PDLA 3WF4A 4O4WA 4LUSB 4KWVA 3OG2A 4UTHA 3EX3A 4RPPA 5AVNA 1Q66A 4IQEA 4HZMA 4AXNA 1UUOA 1K8XA 4QXIA 4P2VA 3DH7A 4YPJA 3CU2A 5I3JA 2V30A 3EOEA 4M0XA 2VFGA 1OF6A 1FHUA 2VFEA 4EF8A 2WQPA 1MYRA 5G4EA 3DECA 3SECA 2RAGA 2OT1A 4GFIA 3IWPA 5LKYA 5DANA 4Z17A 4PTMA 2C15A 1XD0A 3IAQA 3W2MA 3VDHA 5BU9A 3WNOA 5LGZA 1EYWA 1WZAA 4JYEA 3SSZA 1OBAA 3ARYA 2WNZA 4JQ1A 1GONA 5H91A 1YIXA 3H4WA 3KAOA 1Q6QA 3AZTA 3L0GA 3PBWA 2OZ3A 2WCGA 1UJQA 5EFDA 2ZIDA 1DQXA 4G8TA 1G0CA 3LRMA 3OTRA 1FH8A 3WJWA 4S38A 3ZT7A 1RHCA 4P7QA 4IL2A 3RGTA 2PTZA 4QP0A 3WJZA 2J7DA 3BCFA 2ON3A 2WMIB 3R11A 3SIMA 5DLCA 3SUTA 4A3RA 4GK8A 1UWSA 1J0IA 1JPHA 2WCSA 4DN1A 5M2FX 3W84A 1EUAA 1B4KA 3G0SA 5D03A 2P1FA 4IP7A 3S4TA 1K77A 3W2NA 2BB0A 3O7UA 1UW9A 3L4VA 2HE5A 2PF0A 2NLYA 3HO8A 4LCRA 4E2BA 4I90A 1WKFA 3GS6A 4MB4A 4D6GA 4NAEB 2YBUA 4F66A 2PPGA 3AYSA 4YHEA 3S6DA 2DV0A 5C2GA 2OT0A 1JFHA 2RFGA 2FTPA 2VQUA 5D2TA 1K8YA 2ZA3A 2EKGA 1E43A 3GO2A 1EJ7L 4MIMA 4EAMA 4H00A 1ONWA 5D9OA 4F4RA 4Q22A 3IS4A 3SDOA 1O1HA 4FOUA 5FA5A 5JBFA 4UFLA 4RXFA 2Y0FA 1VRDA 4J2MA 3G2GA 4Q8NA 4MKSA 3MANA 3OA3A 4NI3A 3LZ5A 4GG9A 3HOJA 3VIHA 2BWGA 3GFXA 4UTWA 4IIEA 2ZRYA 5A2CA 5CSSA 4V27A 1QK2A 1CENA 3W86A 2WZTA 2CLMA 1XDLA 4HT3A 4PMQA 4XVEA 1ADSA 3LRLA 2C1HA 3ZR5A 4JIEA 1RJQA 4G7EA 5C55A 2O4QA 3LQLA 5I06A 3E49A 4QQUA 1UP3A 4GABA 4C60A 4ZTXA 1W0MA 4JTAA 2DUZA 4W8AA 1AZ1A 2DUAA 3DKJA 2R82A 4ATLA 1THFD 3GHSA 4XIMA 3LN3A 2J4GA 5BW6A 4QEHA 4JQ4A 5HNRA 4NZFA 3R8HA 3W73A 1SJBA 5HNTA 2V5JA 1H11A 5PTDA 1IT8A 3GLCA 4R9XA 4XAPA 3KTCA 3Q37A 1A4LA 3KCLA 3FX4A 5DT5A 1BTCA 3VIIA 4S3FA 3VIOA 1XISA 4DO5A 2ZVRA 1U5JA 1VYSX 2O92A 1S39A 1Q85A 3G1YA 3R1ZA 1F7BA 3IIXA 4D1IA 3VM5A 3QLLA 4PB3A 3W4RA 3GVRA 3UWUA 3VMPA 3MKVA 4E38A 1TCMA 2TRSA 3HPZA 1JZ8A 1YDYA 4QG9A 3TSMA 1XXXA 2NWRA 3DFQA 2E40A 2HS6A 1GTEA 1G4SA 2HRWA 1HL2A 3EGJA 1J01A 1NQKA 3PN8A 4EXQA 1G4PA 3GYEA 1G69A 2E5BA 3SRHA 5AHIA 2ZXDA 3A9BA 3B4YA 2NUWA 4E8DA 1HVXA 2VC9A 4C6FA 4DYKA 4XVDA 3KM8A 5FAGA 5J04A 3PZVA 3PZUA 2JF7A 1OGGA 1P1MA 5JXQA 3LYEA 3LPGA 3KOXA 1WP6A 4FALA 3U7BA 1KW1A 3V7PA 3GR7A 1KBJA 1FWWA 3RU8X 1SM9A 4O1DA 1TV4A 5FJIA 5KINA 1ZENA 4Q8WA 3R8RA 3AYVA 1DWFM 2CETA 2VUNA 3NTYA 4ORIA 3ZR4A 4LUSA 3P81A 4BWLA 2BY2A 3INPA 1K6AA 1YHTA 4K8EA 2GVGA 3R0UA 1R8LA 3OGVA 4E0CA 4I9MA 5E9XA 4O0KA 3VIGA 1BPLB 3WL0A 3MHGA 4M1BA 4B15A 2Y7GA 3FCPA 4CLMA 2Y6ZA 1H51A 4NG3A 1QT1A 1VIZA 4HU3A 3NGJA 4UNLA 3Q58A 1KQZA 3GU2A 1MW0A 3H22A 5M17A 3B3DA 1F3WA 1UWQA 2Y8UA 1GTHA 4BZYA 3HTWA 3TXVA 4ZBCA 1VQTA 5KZDA 5HQEA 3GNDA 4GQQA 5M5DA 4UUIA 4A3QA 3B0UX 2RKXA 2E6YA 4HB7A 4AY7A 1B0IA 5DRCA 1OD0A 3DGBA 3A21A 3O07A 1QR7A 5D9NA 3F2BA 3KLKA 3AIVA 1DIEA 4D72A 3N14A 1R30A 4XAGA 3BAXA 2WK2A 4C1KA 2PDUA 3TIMA 1W9PA 4CNTA 1OYAA 2EG7A 1NH6A 3RNDA 2GGJA 1V93A 1R9ZA 1J79A 2HS8A 4I7WA 3CUJA 2E4TA 1JQXA 4JXCA 2CXEA 4XX6A 2Q3RA 1YPFA 3JW7A 3C2FA 1A80A 3Q94A 2J24A 3VIMA 3BQ6A 1VCGA 1UUMA 3DFSA 1WDQA 3A9IA 4NAEA 5IHRA 1W9XA 3B4UA 4HZ6A 4MY1A 5F2MA 3N25A 4H8NA 1WKYA 4GJIA 3GH4A 4CN1A 4FX8A 1YLVA 3VIPA 1EH9A 3A3HA 4NF7A 1U5HA 3R6IA 1ME8A 4IPNB 2P5NA 5CGTA 2XPKA 1IEVA 3M6YA 3O6AA 4HIBA 2DQXA 4ACZA 1J8VA 3HB9A 2ZZ3A 4WCJA 1F4AA 2GGIA 4JN7A 1ICSA 4W4QA 4WK9A 3W22A 3HG4A 4D6JA 1HXJA 3NQAA 4UTKA 4ZQNA 1KBKA 2ALRA 3VMNA 1S5NA 2DZXA 2Q71A 1DWGM 4B2DA 1C9DA 3U2EA 5CSYA 1E4NA 4I3GA 4WRHA 1KRBC 2PGWA 5CBIA 3OLIA 1D2KA 3M4HA 4AIUA 5I3FA 4FPSA 3MV11 4Q8UA 3S47A 1G4TA 3LHVA 3QSTA 2Q02A 1V3JA 1A3XA 2YFOA 1FDYA 3UT0A 3GVWA 3TOPA 3ORWA 3W1XA 3BLEA 2PGFA 2WNNA 2XN1A 3WFLA 4DJDC 1J0ZA 4LSBA 1LUCB 2OZ8A 4NJHA 1XYCA 1AMYA 4MPQA 4ZVJA 7REQA 2I1OA 4BA0A 3QV7A 1FY6A 1XYAA 4BQ2A 2UY5A 2WC4A 4O54A 2W9MA 1OFOA 4C7GA 3PHAA 3SB0A 1UKTA 1PVNA 3GU9A 3FFSA 4GRSA 5FOOA 4POCA 1UH3A 3CJPA 3T78A 2ABBA 4GNJA 4HVXA 3NOEA 4IIHA 4B91A 1X7FA 2QJMA 3BSMA 4O8RA 1FWEC 2DT3A 4GBDA 3DG3A 3GBDA 3ZIZA 1XRSA 4Z1AA 2TAAA 4FSAA 3OPSA 3T0BA 4H9VA 1AW5A 2PC8A 1W91A 5E6YA 4PA8A 3TEVA 4FS9A 3PFRA 1KA9F 3PWAA 5MHBA 5TD4A 3OOQA 3Q45A 3E0VA 5LIXX 3KW3A 2Z1BA 1JPKA 4DELA 1KGXA 1TZ7A 3PBVA 3F5KA 2TPSA 3VDAA 2J27A 2ZXAA 1MW1A 4N9EA 5DMMA 3AU6A 3PS7A 1H63A 1H2JA 3RN6A 3WQFA 4NU7A 1M7JA 1GORA 1S2CA 4XZBA 4HK7A 1IGWA 3L2LA 3LLXA 1O68A 1GVFA 2WB5A 1S5MA 1B30A 3RLGA 1JZ4A 4EANA 1Q8JA 3AAMA 4NQ1A 4AF0B 5G5IA 3ABRA 4R9OA 1HN1A 1W56A 2J62A 2O4MA 3ITOA 5A3HA 5AECA 4RE0A 4PUJA 4NZCA 2D22A 3U3HA 3WQ5A 1LWHA 3ZO9A 1UD3A 2Y7EA 1GJUA 4DRSA 2HPMA 3W3OA 4Z2KA 1FA2A 4NJKA 5DMNA 5F2IA 1LOLA 3BLKA 1LROA 1JYNA 2Q01A 3ARVA 2VWTA 2GSJA 1F5ZA 2XIIA 5SWUA 4HNNA 5E0CA 1CLVA 2WZMA 2QCLA 3APGA 3FS2A 3MB9A 3H4GA 3VVGA 4JBRA 4LVBA 3T1GA 4HPXA 4ZOAA 3CH0A 2ZOXA 2OKOA 1FBAA 2YW4A 4GH1A 2C13A 5KZEA 5AHMA 4HBKA 3GH7A 3P7YA 2ISFA 1EKOA 5MKGB 3EX6A 5FESA 4CD7A 3BVJA 1UR0A 2ZX8A 1ME9A 1VH7A 3SCRA 3AS0A 3KWXA 2RJGA 2DH2A 3TW9A 1UR1A 3VGFA 5BZAA 2O9OA 4ONVA 4LCSA 1B90A 3N2OA 2VDGA 3W71A 2QPXA 1ITCA 3PZ9A 2W62A 1E3XA 1TO3A 3KX6A 1NTHA 1WA3A 4DJFD 1EX1A 1FCVA 1K7FA 1Q7QA 1JPIA 1LYXA 5KETA 4RDYA 4PFMA 3LK6A 5C9ZA 2Z6JA 1E51A 3NEVA 5C0QA 4DBSA 1HGYA 2BX7A 2YXXA 1JYWA 1J10A 4PCNA 4JX5A 2AMGA 3H2OA 3CQHA 3VE7A 4KT2A 3C3UA 1XKYA 2X0SA 3RF9A 1RP8A 2C71A 2W63A 1VBRA 1V79A 4UOQA 3RHGA 2V5CA 3MSRA 3P6LA 1RLCL 3W7DA 1PHQA 2XGBA 1OFRA 2NQLA 4RDVA 3M0MA 3OLDA 5FJTA 1FXPA 1PZ1A 3W7PA 3V5CA 4PUEA 3D3FA 3TN4A 3L9CA 1E6PA 5T8GA 1X97A 2J8TA 3IGSA 5EL1A 4QLJA 3WLOA 1RK6A 1V6YA 2YSWA 2VWSA 4I9TA 4K36A 3UNDA 3BG9A 2OGYA 1XSJA 2P3ZA 1GOMA 4PUDA 4ML9A 4ADTA 5LHFA 1BQGA 3TKFA 3A3XA 2WVVB 2J8GA 3UWVA 5EMJA 4WEVX 1LUCA 4KFOA 1G1YA 1XIGA 1TIMA 1PKMA 2WKGA 3LTSA 3DIPA 5F7UA 1A5NC 1W17A 3UESA 1EJUC 2BY0A 3TSDA 1YW1A 1FH9A 1S2UA 3NJ3A 3QPYA 4AWEA 2RDTA 3NZPA 5CH9A 1O4UA 2UWFA 4O57A 2FMNA 4PSRA 3S9ZA 1BWVA 4LC6A 4MWAD 1BYDA 2FQIA 1A5SA 2HK1A 2PRHA 1JCNA 1P1XA 4AHPA 4MGGA 1BYBA 1XRTA 3S2NA 3PAOA 1ZJBA 1E4IA 1RD6A 3G6MA 2RH9A 2W66A 3N34A 4CQAA 1D9EA 3II1A 3OVQA 3WELA 3TUUA 3UWWA 3MVTA 1DIOA 1BEUA 4UMAA 5FI8A 2PBOA 3WDHA 2JKAA 3VDCA 2BVYA 4ZR8A 5H2ZA 5LIWX 2GWNA 2XINA 4GMEA 4YJ5A 5A6BD 3K8KA 4GIYA 4P7OA 2O9PA 1JF5A 2DVTA 1J18A 1LWJA 4Q6XA 3UJEA 5GQBA 4NVTA 3VZZA 4HSHA 4JL1A 2ZVIA 1WPCA 1DJWA 4LF1A 2DZVA 3U7VA 5FL1A 2EPMX 1GQNA 3AALA 3S2MA 1Q6FA 2PWUA 4RL3A 2IS7A 3T40A 3M1ZA 4ATWA 3ATZA 1DP0A 3OODA 1XICA 1WOAA 2ZRZA 5GNYA 3LG3A 4GKLA 2GOUA 3C5QA 2HBVA 3B8TA 1TV7A 4O0QA 4QEEA 2OOGA 5CBJA 2YGYA 4JD4A 3N2XA 2P10A 5JMUA 3MSYA 2H90A 3EOLA 1VFFA 4UTWC 3T07A 4E4PA 3B8IA 1KM3A 4PUNA 4AF0A 5CGMA 2YOCA 4RE2A 3BV7A 5DFAA 1SJCA 4WSKA 1XD1A 2QW5A 4Y8EA 4CNSA 1LDCA 5C54A 1Z32X 3GAYA 4ZODA 1YDVA 2BDQA 1I45A 1Z7AA 1PCWA 1DXEA 4US5D 1AJ2A 3AMGA 4GI4A 4MWAE 2XSXA 1KCXA 4HK5A 4Z42C 7A3HA 2IXUA 2ZC1A 3TLLA 4BI6A 5TBOA 3NURA 2HNHA 1TCDA 4R33A 2GQ8A 4R7JA 1EDGA 2F8QA 4WD0A 2NUXA 1RUSA 4LB3A 4C6JA 1FFRA 3UZWA 1XYZA 4YTQA 5T91A 1I60A 2I56A 3SURA 4H19A 5MKGA 1F73A 3VZYA 1W54A 3ZJ8A 4HNCA 2XZ9A 1B9BA 1FWTA 2BZNA 1RQBA 1LOSA 1BF6A 4QDMA 1VYRA 4KCUA 3QHOA 3CBWA 1LL4A 5TQLA 2Q8LA 4YN5A 1ZFJA 3LENA 4HPHA 2ONEA 1MZHA 3BW4A 5A6JA 3TJXA 3ZLGA 3AQUA 3HPXA 2PDMA 5AC5A 5AFDA 1W3LA 3TC6A 3QHNA 2ZBTA 2ANUA 2VENA 1PIGA 2QGHA 4PL1A 1VLWA 4TMCA 2AGTA 3HPAA 1KFEA 2Q6ZA 4UTTA 3TW6A 4PMNA 4GH3A 3TH6A 1LORA 1E1EA 3WF0A 5CAHA 2ZUNA 4BFAA 5HNNA 2VGBA 3UP8A 3A5FA 4C6BA 3VKJA 4TVUA 5GJPA 3ZYZA 1NDVA 4P8WA 1X38A 4A2SA 4F0MA 1XKJA 3UXDA 1KFKA 1MQPA 3UF9A 2PDFA 2FZ9A 4WXZA 2RDWA 1XQLA 3RR4A 3WH9A 1KRCC 5B80A 2F9RA 3WO8A 3BOFA 3GX9A 3KEHA 1ZQ5A 3UJ2A 3GB6A 2REQB 1QASA 4AFYA 4RNHA 4IIBA 3ZSSA 4XBSA 4Y9MA 3ZLHA 3OEXA 2PLKA 1EHAA 3C0SA 2WYSA 1WYIA 3ZOAA 5I00A 3BW3A 4LPCA 1MRQA 3BAJA 5D2YA 1P6WA 2VGFA 1S2AA 4I8YA 3P8IA 1GWJA 1J96A 4BWLC 3GTXA 1XC6A 2Y5SA 1KCLA 2XUCA 4AD2A 4IPLA 1QPQA 5FJJA 3EPMA 2I14A 2NQHA 2ZXBA 4JTJA 4UBPC 4CQDA 4HJFA 3AYRA 3QY6A 3NZ1A 4PGLA 4M7TA 3I3BA 4ZOBA 1P6CA 3VGDA 1JD7A 3VNYA 4BQ4A 2CLOA 4HGXA 4DWDA 4ZO8A 2WVVA 3QQ1A 1TSIA 3OLGA 4O1CA 1E9IA 4OT7A 5ECUA 3TTSA 4X0VA 3BG3A 1LWIA 2ESCA 3UXKA 3QTPA 2RUSA 2WJDA 3W00A 3V0UA 1GG0A 1UR8A 2JEQA 2WQDA 4KERA 2W67A 1CXHA 1OIMA 4DI9A 2I7GA 1TJRA 1CXKA 2Y8VA 4IT1A 5HBFA 4ZENA 1LF1A 1GKQA 1EGMA 1VFHA 3U8GA 3QW3A 1TPB1 2NT1A 1ICQA 1QOPA 3W01A 1W1PA 5HULA 4OQVA 3CZLA 4QJ5B 1QATA 2NUYA 2W92A 3HJEA 4AWSA 5LIKX 1V03A 1WAUA 2V67A 4GZJA 2V3EA 4G56A 4OE7A 2V8ZA 4GQGA 1W5OA 2E5DA 3R13A 1LP6A 1YXYA 3TP4A 1JCXA 2X0YA 2GK1B 4JTQA 3L65A 3HQ1A 4TU1A 4TVDA 5DY3A 4LBUA 1EPVA 1GEQA 1E1FA 1UR2A 4DZAA 1B57A 1QNVA 4CQ9A 1IZJA 3J7HA 1WKEA 1Z8AA 1HJUA 2CITA 5HWMA 4O1AA 5EGRA 1IE7C 3I4KA 4GYPA 3HURA 3R0DA 2D0GA 2X8RA 5J8LA 1TYGA 3NQEA 4LF2A 3TVAA 5I6SA 2DSVA 3OU8A 5D2WA 4O4VA 3FVDA 1TR9A 4DWSB 3UZXA 3RJYA 3SFWA 2Z1VA 8A3HA 3W7RA 4D71A 3WIJA 2LLEA 4X2RA 5E9AA 1XYBA 2A3LA 4FNSA 4JTLA 3TR9A 3TDFA 4H2HA 3GZ3A 1JAKA 1OFBA 4BR1A 3T0TA 3LQGA 4G6CA 4AZIA 1KXTA 3W37A 3PC0A 2ACQA 2GUUA 3DFPA 4IXXA 3USBA 4A8IA 4UTMA 4Q4OA 3ES8A 3GNRA 1BYAA 3AMLA 1UPPA 2XH4A 7PTDA 5A1AA 1AJZA 1YEYA 3H8AA 3LCLA 1IXOA 3VC6A 1JDEA 3W6MA 2Q8ZA 4IQJA 1E1CB 3VDGA 4IF2A 4DM2A 1MEIA 3KVKA 1WV2A 1VEOA 3PSVA 3CHDA 4LYQA 1AZ2A 3KRSA 3T4WA 3VK5A 1PPIA 5K7JA 3CZJA 4DJEA 1AL8A 2Y7FA 1ZHAA 3N13A 4L4MA 3OVGA 1VBGA 3GZAA 3B0PA 1UZ1A 3B04A 4XV0A 1M01A 4NXKA 5FSDC 3TQKA 5D30A 3PTDA 3CTTA 1W5MA 3WNLA 4EVZA 4P61A 5E93A 2D2JA 3LNPA 3IUDA 1DHPA 2FPYA 3P74A 1L6YA 3TONA 2PB1A 2C16A 4J5NA 3NCOA 3TQ0A 3WLSA 5ENLA 3HFTA 2Z1WA 1P0EA 2PTWA 3ZXWA 5DF0A 2SFPA 3KHDA 4RKAA 2CEQA 5M1TA 4ERAA 1M41A 3RRAA 2RHGA 3GIPA 5CC6A 3NXFA 1YTEA 3BC9A 5H8UA 3EX4A 2IKJA 5IBXA 4X2PA 5BCAA 3LSBA 3LS9A 1NIUA 2YFNA 3E2SA 4DZ5A 3HG3A 2W61A 3WQCA 4ZOCA 4RPQA 4TTUA 3NYDA 1G7UA 3B8SA 1IWAA 1QI3A 1GGOA 1VP5A 4MF4A 4XKMA 2ISWA 4HU4A 1O5RA 4EPEC 1L6WA 4MUZA 4GFSA 4E5TA 5CZSA 5DBUA 3R4IA 4J3TA 4HOXA 3P8JA 2ZZ1A 4YYCA 4C6IA 1BFNA 1ZCCA 3M64A 1YDOA 3R7MA 3WLIA 3GDTA 1GQIA 2B31A 4IQLA 2QV4A 3OIHA 3KL3A 3UG4A 4OV9A 3BSGA 3UPWA 4NRRA 3FDGA 4MYXA 2J7CA 3GKFA 5A94A 3NAVA 5FJRA 1Y0EA 5A5WA 1B5TA 1VD6A 2EBNA 5GVJA 3BAIA 1TPDA 1S3HA 1HO4A 2X7VA 1AQFA 1V3HA 1Z44A 1RZMA 3GE7A 4LH8A 4H7VA 5AC8A 4GZIA 3BLPX 4L65A 1V6XA 3C0QA 2FGZA 1F6KA 1I1WA 1G4EA 2ZA1A 1V02E 4J3SA 2YIHA 4EWND 3B9DA 4AX6A 2DUXA 1DJIA 3L4WA 2VVSA 2J6XA 1T8QA 3L4TA 4EK7A 1RLDA 3FV9A 4NP7A 4IMFA 3P5ZA 4UFJA 3TN5A 4MNKA 1IEIA 1ZNNA 2PTXA 2GK1A 3ALFA 1W5NA 1XLMA 3OZYA 2A7NA 2B7OA 3DU0A 2G50A 3HU7A 4JZ5A 2IKGA 3GG7A 3MUAA 4V33A 1OZQA 2NV2A 3O6CA 2GSEA 3S2CA 1XIBA 2WSQA 4DM1A 3CAVA 3GNOA 4CNPA 1YNPA 3W0KA 2XTKA 4YNGA 4H9TA 2CPUA 5F1VA 2P76A 2AAMA 2IPFA 2G5WA 1BVWA 4RZ5A 4JX4A 4KIRA 1EHNA 3BCJA 4C5YA 4KW2A 1IEWA 4DWSA 4XIAA 1KTCA 3EZ4A 1XIDA 3M5YA 4FLRA 4OGZA 5FEZA 3HGJA 4UNIA 4HZ7A 3RM8A 1FDJA 4PFHA 2QUTA 1H1YA 2QS8A 1YPXA 4K2SA 3TROA 3SY8A 3SIZA 3VILA 3W7JA 4IWWA 2EEXA 2IPJA 3CUGA 2C6QA 4NZJA 3CQKA 1TV5A 4RW5A 3WJSA 3CXOA 4L4OA 3TYCA 3W87A 5HOSA 4R7OA 4ADUA 4HPJA 2B81A 1D7KA 2Y62A 2NXIA 3O6YX 1WUEA 4GYJA 3WF3A 3W07A 3RX4A 5C2CA 1ELSA 1IZCA 4ZO9A 3TYZA 3STGA 1N8FA 4AMCA 2OR2A 3TCEA 3LCIA 4AU0A 2Z2BA 3R8GA 2OEMA 3W7IA 4AD3A 1E1CA 2EPHA 2ZA2A 3LOTA 3NQMA 2X1UA 4DZHA 3TOYA 1Q45A 4WUIA 4J40A 4NT0A 1FWSA 3SZ8A 3NGFA 1VCFA 3WQVA 4OECA 4D8AA 4MWAB 1UH2A 3V75A 3GD6A 4JFUA 1ZLPA 3MMUA 3VNLA 2OX1A 3JS3A 3XIMA 1ODZA 3BLLA 1OEPA 1RA0A 3AZRA 1SO5A 2ZZ6A 1W1A1 1I75A 3A13A 2YB1A 2XWEA 4D6CA 3VKBA 3A3WA 2DSUA 2A6LA 3G1XA 1WNOA 3I10A 2HZGA 1VBUA 3LTPA 4AXKA 1NP2A 1IXNA 2EPNA 2WJFA 1OQFA 1TRIA 3O2LA 4TX6A 4PN2A 1OCBA 5HAOA 3S1WA 2ZYFA 4F0KA 1JULA 2PA6A 1EGVA 2ZZ7A 1SO4A 3W02A 3L12A 5LXEA 3F2CA 1ZP3A 4HMCA 5DCBA 1XQKA 2Z4GA 4AISA 2PWFA 2FLIA 4GUFA 3F4DA 4DY1A 1RCXB 2CERA 3EWXA 1J0HA 4AC7C 4GOAA 1QNQA 1GHRA 4KQNA 5I0DA 3NQ2A 1TWDA 1N55A 3NQFA 3HM7A 2CESA 1GVSA 3G5EA 2BHYA 2J47A 3WK3A 2RDXA 1UZHA 4Z08A 1VJIA 2G96A 3W7QA 4BF5A 2IW0A 1XPYA 3WBYA 4LY8A 3L23A 3MTWA 2QUVA 3H24A 4TIMA 4NZ5A 2BGSA 3QV9A 5AZ0A 3VGGA 3RR1A 4IMAA 4WOQA 3LI0A 4YCOA 3LCHA 3BLDA 2XVLA 1F8MA 1XIHA 3GK0A 3WD2A 1FCUA 3ITGA 4V28A 4BY3A 1GG1A 3P61A 4GY0A 4M6VA 4C7FA 4CN6A 3R58A 1S1PA 1ITUA 3CNYA 2A2IA 2O9TA 2C1GA 3P2VA 5BYWA 3B8UA 3BJTA 1GW1A 4C1LA 1Q6DA 4DUWA 3LI1A 4ROPA 2BXVA 3NQ7A 2GJLA 4YCPA 1QFEA 2YCIX 3BGGA 5D8ZA 2WSYA 1J0YA 2C8NA 2QCFA 3D46A 3RIKA 2BGNE 2KAUC 1RY8A 3TYAA 2I57A 1Q5MA 5HPOA 1X6NA 4FNQA 4WIWA 4Y96A 1TJ1A 2P50A 3B8VA 3DI0A 4XUGA 1D8CA 4IISA 1B54A 2QJGA 1EUNA 4PMJA 1OD8A 4N02A 1H49A 3ARRA 4OVXA 3SY5A 1CGUA 3OBEA 1I2NA 4G9PA 4LYRA 1E55A 1PHWA 1H61A 3FOKA 3W7KA 1TG7A 4U5IA 4X9SA 4ROQA 2AGKA 4NI8A 2I16A 4GVIA 3W72A 4PRTA 4KRTA 1D3CA 3GBEA 3OZOA 1DWIM 2ZUSA 3TYBA 3N1AA 3UXAA 1PKLA 4IPJA 1JI2A 3GTFA 5D02A 4A8NA 2X1RA 1DYSA 2F61A 1OG0A 4UTTC 1Y5XA 1K1DA 2GDQA 4S3JA 1PWMA 4GI8A 1PTGA 3LNMA 1XI3A 2HK0A 2VGIA 3GXFA 4WKHA 1VYPX 2BOEX 1R0MA 3T0DA 5BOFA 4ZE4A 4HNTA 2VFHA 3T8LA 2D0HA 3CLWA 5JH2A 4O14A 1R87A 1VGAA 2FMOA 2FHCA 1IYXA 1LBMA 1KWKA 2R1PA 1U5VA 5FJPA 4Y9PA 1V0MA 4GY1A 2NSXA 1QPNA 1DOSA 3MS8A 3KCOA 4QQ3A 1U22A 2IQTA 4CNOA 3DX5A 2XU2A 1TFVA 3CUZA 4PR4A 2I9UA 4S3KA 1VEMA 3OVPA 2HWGA 5HUOA 4QITA 1KM4A 3B9OA 1E71M 2WNWA 3BSHA 1KRMA 4AD4A 7CGTA 4S1FA 1FTXA 1DV7A 1XGZA 3GSMA 2YYUA 1NWUA 4NASA 2CNCA 2R1KA 4NNCA 2UY3A 2D2GA 2OO6A 5FSEC 4J3VA 4Z2LA 3UETA 4H2CA 2TYSA 3K5XA 4WKFA 3EWWA 3GHUA 4CEXC 3UY7A 4W8LA 3CHCA 1AUSL 4AWUA 3VX1A 2G37A 1V0NA 4UFIA 3LZ3A 2OWWA 1R38A 3P80A 2VNCA 2VOTA 4QCEA 2WOQA 2HEJA 3GTNA 4AHOA 1TKKA 1XH0A 3PPFA 1FWJC 1ECQA 4R88A 4LV4A 1TPUA 3IRDA 4WVXA 4CD4A 1XC4A 4RDWA 3DN5A 1H5YA 4L9XA 4Y9NA 2F7FA 5CG0A 3G1FA 3IJ8A 3TLQA 3VNIA 5H6HA 1NARA 2F6KA 1TTJA 2QCDB 1CGTA 1BVZA 1EBHA 3C52A 4DI8A 2B7PA 3FA4A 2X30A 4CD5A 1HKKA 4C1NB 1JZ6A 3LMYA 5ABGA 5A6TC 1JZ5A 1RBAA 1QHZA 4LEQA 3FEQA 5G2IA 4TVCA 3OBAA 1Q6RA 2WVSA 3QHMA 3T6CA 2BY1A 4AIEA 2A21A 3N6HA 2QJIA 4L1GA 5G1YA 4ZZ9A 4GO9A 4ERIA 5EB8A 1YXDA 2ZZ5A 1E56A 3DDMA 4L6DA 2R1NA 4IOTA 4TOQA 3TQPA 4K39A 1C7TA 2VELA 5CZTA 1FRBA 3VYLA 3GHTA 3E2RA 3LHUA 4MYAA 4XD5A 4FX7A 3MYPA 3HPFA 3ABXA 3N4AA 3DG6A 3H70A 2FZ8A 3AWOA 3VOCA 3FLUA 1KFCA 1JUEA 2EPOA 1W8SA 2PAJA 3H7VA 1EIBA 3VOFA 3FEMA 3RO8A 2YR1A 2ABAA 3U9IA 3P82A 3WBXA 2ZE3A 4DXKA 2GPTA 3C2VA 4KBXA 4WSJA 2CYGA 4MB1A 4US5A 1ZP4A 1HT6A 1XLKA 5G2WA 4O17A 1MNSA 1RJRA 2YZ5A 2DZUA 2WBKA 3EYPA 4DVOA 1B2YA 4QROA 1PS9A 3CYJA 1OADA 2FHFA 2AQWA 3P60A 2WHKA 1I2RA 2VX6A 4C6OA 4HPGA 4EPBC 5CC3A 3MZ2A 5TF0A 1F76A 1ZPTA 3QR0A 4A21A 4A4AA 1C92A 2W3ZA 3FSTA 1TZZA 1DBTA 3H23A 2NVDA 4W87A 3PTQA 3QYQA 4NRSA 4NHVA 1XF0A 5JU6A 2CBJA 3CUHA 3PBYA 3JRKA 2E1WA 3G6LA 1JR1A 1RXOB 1LLOA 2EHHA 3IVUA 1NU5A 2WKLA 3P0XA 4JTHA 3LCWA 4DJEC 1XGEA 4GHRA 2IMRA 5HWNA 4JIQA 5B7ZA 4E4FA 5BWAA 3BK0A 4C65A 5IRPA 2OU4A 4LUYA 1ZJIA 2X41A 1DJGA 3I3EA 3BJFA 1UCWA 2WVTA 3TN3A 5F2GA 5C9UA 1O60A 4NZ1A 3SGUA 2NVAA 1XW8A 4GIRA 3NDOA 3ANYA 4AEOA 3BE7A 3BO9A 3VOJA 5A6KA 2QVNA 4MZYA 1TPH1 1A5LC 5HR7A 4NL1A 2YL9A 4KF1A 5AB3A 1OIFA 3CTLA 1DE6A 4IMCA 2ICSA 3ANVA 3XISA 4GUIA 2AOSA 1X98A 3U2CA 4DIAA 4R3UA 4N7QA 4ZO6A 5DXYA 5LNUA 1IR2A 4J3XA 1BHGA 3EXSA 3SW6A 2OEJA 5IBXC 3RU6A 4PCTA 1TB3A 3TNBA 4C6LA 1P0BA 3N4EA 4KWOA 2H3BA 5JIWA 4WR3A 3REQB 3AXXA 4D6EA 3LGDA 5XIAA 3FYYA 2VO5A 4JFTA 2XM1A 4LW7A 3N3MA 3URNA 1E0VA 3FYOA 1NVMA 3TA6A 1DJXA 1NJJA 4KEVA 2POTA 3UVIA 3V3WA 2D73A 3IJQA 3RILA 3A22A 2XFRA 4J7RA 6XIMA 4W86A 2GDVA 4ZQPA 1MVYA 2XH2A 3C2OA 3QKZA 2BFGA 3APTA 5AVHA 1DJYA 1UUQA 2NV9A 3QQWA 1XLJA 1UZDA 5I3DA 1G7VA 1K6WA 1O6IA 4MMWA 1CGWA 1K8ZA 3KRUA 4JNMA 2BOFX 3M47A 4LS1A 2P8CA 3QZ6A 4WX2A 4O16A 1VLIA 1W6TA 1DQWA 1N7KA 4JCMA 3MY9A 4GQRA 3EAUA 2DZPA 3NOYA 2KX9A 2CHOA 5F4XA 4DEFA 5AHEA 3PJUA 4LU0A 2DW6A 3CQIA 3VC5A 3MV01 1TV8A 3R5EA 2DZTA 1AVAA 1C91A 1YDNA 3CB8A 3NZGA 3LCFA 3QV6A 1O12A 5I3IA 3M5VA 2C0HA 5DXXA 3GTIA 1J0JA 1XFCA 3A5VA 3GG1A 3NPXA 4C1NA 3R25A 5C7VA 4E2DA 1XSKA 5F1UA 3L4ZA 1J9YA 2FVLA 2HMCA 2YBVA 3U4FA 3TV8A 3VABA 1JL8A 1NF0A 2Y89A 1F6YA 4L7ZA 3EEZA 3UPMA 4GNVA 4I9AA 1UIPA 2OSXA 3CEPA 1OC7A 4GVHA 4DJDD 2CLLA 3W1RA 4U3AA 4LFYA 1ZS2A 4RR4A 2QCGA 3NFUA 4UTJA 4AZ6A 5E0FA 2JGQA 7XIMA 1UWTA 4RJEA 2V38A 3EPOA 1E72M 1OJXA 4ZQCA 1E9ZB 4M51A 1ZBKA 1W5PA 1V6UA 4R27A 2V3DA 4PE8A 1Q6EA 2AQVA 2GUYA 4JFSA 3FHAA 3WQGA 4REQB 2DT0A 1AD1A 4GIEA 4DWSC 1PKYA 2NQ9A 3XINA 3ONCA 3MSGA 3CUIA 3NZRA 2XH7A 2OFJA 3VDBA 1CT5A 2PWHA 4QAWA 4UCFA 1SZRA 1CGVA 4PZVA 5I07A 4KFNA 4TV6A 4H04A 7ODCA 1Z3NA 4CKQA 3O0KA 4P7NA 3PZIA 2QAFA 2QJHA 2ZZ2A 2X42A 3BAYA 1GPFA 1EA0A 5BXSA 5I3GA 3GWQA 1SZEA 1UWIA 3W81A 1H7NA 4E2OA 3OZPA 3T08A 3EB4A 6XIAA 5E0KA 1XCFA 3EB3A 3F5LA 4QDPA 2PDKA 3N9KA 1GCYA 2WSRA 2F6XA 3GXTA 2O56A 1TTIA 3HG2A 1E4LA 1UIOA 1NWTA 4K8GA 1JEZA 3E02A 5K4ZA 3JU2A 1ZAJA 3MPGA 4IGHA 3IJDA 2YDQA 3IRSA 2E77A 4K7VA 1SU5A 3UR2A 1LT7A 5DN1A 4DB7A 3HGRA 4E8CA 1XLHA 3IK4A 2CBIA 2J7FA 3MWCA 1U1HA 1A4MA 4L5ZA 4CQCA 4ZQMA 5AYYA 3LX9A 5A69A 3UJRA 3I7RA 1ZAHA 3WUEA 3UW6A 2PTDA 5FJUA 1MMFA 1V02A 2EQDA 3TMQA 1SZNA 1HKWA 1RH9A 3WLJA 4JX6A 1FVPA 1RA5A 4U28A 3WD3A 3HMCA 3UPBA 3PNZA 3WLNA 6REQB 4L9YA 1L9WA 3M0XA 1TQJA 1LM1A 1VPQA 5FF4A 2E68A 5D33A 2YCKX 2VRJA 1OK6A 5HMFA 4E4UA 1QTWA 1IEQA 2XH0A 2E6FA 4UQDA 3IJLA 1YE4A 1XWYA 2VEIA 2ZRWA 3REQA 3SQSA 1WDSA 3E3HA 3CS2A 4M5PA 2OQHA 1ODUA 4F8XA 2PDJA 1QNSA 1UOKA 3H2FA 4N9BA 1FWIC 1IXQA 3BXWA 1FFQA 1T0OA 1F9CA 1W1ZA 1O5QA 4Q7BA 3D0CA 1LTDA 4J9JA 1RBLA 1L2UA 3BOXA 3NQGA 4CU8A 3LGGA 3M0YA 3MUXA 1X8CA 1KC7A 3A12A 1V77A 1WKDA 3EOUA 5CPOA 1E0WA 4HQVA 4YIWA 3EWCA 3AOFA 4Q8VA 4MB5A 5XIMA 4HU8A 2VJXA 1S2VA 5K9CA 5BRPA 4GZ7A 2J9ZA 1XLLA 3G1DA 1PZ2A 2XWDA 4AEFA 1VCVA 1P0KA 1TWWA 3GR4A 2DIJA 1ISVA 2NVCA 4F0HA 1OX5A 1TUXA 5K9XA 1V3IA 4B3ZA 2GDUA 2OKTA 2Y5JA 1H0GA 2Z25A 4DAIA 3LBCA 4XZ9A 3STFA 1GZ1A 1EGZA 3SCQA 4UTIA 3ID7A 1N82A 2VCBA 3ARQA 5KZMA 3U2ZA 1W2PA 5LXXA 3P5YA 4R85A 1EEXA 2VDHA 2YCJA 1M53A 1VZWA 2JK2A 2QZRA 4GY7A 2YJQA 1LJYA 4YWSA 3SRKA 5KEZA 2PODA 2VC6A 3IIZA 4M80A 3MT1A 4O8AA 3W6YA 2CFFA 1M1BA 4HHLA 2Q8XA 3SUWA 2ZX5A 4I6KA 2I17A 2RDUA 1L8NA 1VJZA 1ZZMA 4D9PA 2OSWA 1TA3B 2G3FA 1QNPA 2Z00A 3L4UA 4HJWA 4YWIA 3H7UA 2CKRA 3MI6A 3S3GA 3UNTA 4W9TA 5ABEA 1R9YA 4AAJA 1EC8A 5T26A 2QF7A 4F9DA 5G4HC 4R53A 3U5UA 1AK5A 2ZWYA 1RBOB 4OBSA 3C4UA 4REQA 4YL2A 4AD5A 2QT3A 3V4BA 1U2YA 4RLIA 1NSJA 1F4HA 3K46A 1GVQA 4KGJA 1DPMA 4ZQRA 4PEKA 2E9MA 3LCGA 2OQLA 3WLTA 5HPCA 1UPMB 4DNMA 4CVWA 3UBPC 3HJZA 3WBAA 3RM4A 4WF7A 4YHGA 1DQUA 3GUWA 3HV9A 4FHAA 4OBTA 4U5KA 1VAHA 1MDRA 4LANA 4W84A 4DF1A 3SEPA 2UV8G 4BJHA 3STPA 3S42A 4B9YA 3B0YA 3W1MA 4XAFA 4B5VA 3N2BA 3AUOA 3TJ4A 3BLIA 1JAEA 3B0VC 3MMDA 2P88A 3S2LA 1CWYA 4QNWA 5BOOA 1J6PA 3WK1A 2HVOA 3PR2A 2XSAA 4FR1A 3FJNA 1XDJA 4PMDA 2OODA 4PBEA 4CCEA 5L9FA 3AMCA 4UQ9A 4BKNA 2NSOA 2VD8A 4U4MA 4LY4A 3S6TA 1QWKA 4FMVA 1KKOA 4IJBA 2PFHA 1F8IA 3TE9A 1CDGA 5AYIA 5I24A 5CGQA 4DPPA 3A6OA 1BKHA 5GNXA 4Y90A 2I5IA 1K7EA 2RJHA 1M7OA 3VO0A 1S2WA 3ICJA 4OIFA 3DESA 4U31A 1VEPA 3C8FA 4GX9A 1ONRA 1CX9A 2E7FA 1AW1A 3WD0A 1SW0A 5K3VA 1ZJHA 3TQVA 3FJ4A 3M44A 5KZ6A 2QIIA 2V5LA 4MJ2A 4AVNA 1GOQA 1SJDA 3DBNA 3D6NA 1ME7A 4DYJA 4EPKA 2Z24A 1IT7A 3H54A 3L66A 4JYFA 2VDIA 1GVOA 4MKNA 5IHSA 4HU0A 2ACRA 4O10A 4L56A 3LHTA 1PSCA 3WNKA 3EMZA 1EP1A 2YDSA 2CLEA 3H55A 3WQWA 3MBFA 1GNXA 4MNMA 1BQCA 1VRXA 2FYMA 3TTEA 1XPGA 2QCEA 2FZDA 4OKDA 2J9XA 3OBKA 5BXTA 4FI4A 3W1AA 3EDEA 5C5YA 4MB3A 3FKKA 4WY0B 1S5VA 5LNVA 4WDWA 4DO4A 1GQJA 2W6RA 1OYBA 1AL7A 1CEOA 2PMQA 3GDLA 4HNLA 1UROA 4C5ZA 1W9UA 3UR8A 3ZJKA 3BURA 2GLKA 1HP5A 2E0PA 4UR8A 4PRWA 1HX0A 4OJYA 1NAL1 4JOMA 3GC2A 4GVGA 2BASA 2CLHA 1B3OA 3POHA 1ISXA 1KGWA 1HJSA 1VFTA 4MY9A 3R79A 2V6AA 3M16A 4JNYA 1SR9A 4D8ZA 1X1OA 1ZB5A 3CL6A 1DVJA 3WNMA 1MWOA 3MJYA 4I8DA 3WNNA 3NVTA 1YNYA 2YCLB 1JJKA 3PB2A 1KKRA 3AI0A 3I6TA 3KOZA 4B5TA 2R8WA 3HQOA 4GKTA 3BICA 3SRDA 3KL0A 4GISA 4LVGA 4WDXA 4KWWA 2E6AA 2AL1A 3RLUA 2AL2B 4GQBA 3RG6A 4ZMGA 4BCEA 4MJ4A 3G3DA 1JRBA 1IWBA 4XZMX 4K3ZA 8TIMA 1WZKA 2DORA 3LHZA 3E74A 3QV8A 3LB0A 3WCZA 2PGEA 2VZUA 1FWGC 1EBGA 3W1NA 2VL4A 2A79A 4QM1A 1A3WA 4CD6A 3VU2A 1J0KA 3LTYA 3MKKA 5BMWA 2H9AA 3CAKA 4U33A 1R46A 3QPZA 2ZUTA 3CZKA 3M5XA 1FHDA 3P67A 3VUSA 1XINA 1N8WA 3UG8A 1SFLA 3MJMA 2PC4A 1TA3A 1BKSA 2G4JA 1HJVA 2DSZA 3RLHA 3MWAA 3GR8A 3AHYA 3AIEA 3R12A 3QY7A 4G1KA 2WZIA 4H6KA 3I68A 4ORMA 4HCHA 4GUJA 3V0TA 4LEFA 4Q6JA 2J66A 3OQ8A 3NQ6A 4H9UA 3CT2A 2GL5A 3W7CA 2FH6A 2XDFA 4M19A 5CCZA 1Q2RA 3LPFA 4D6DA 1P48A 3AXKA 1G9HA 1FDZA 3PBGA 3S2JA 1YE6A 1WXYA 2J77A 1QW7A 3AIRA 2ISVA 3G24A 2VX7A 1YMYA 2XHYA 2PLCA 3KLLA 4Y7EA 3PF3A 3FGCB 3LEPA 3KOWA 1W32A 4LS0A 4YVVA 4GCXA 4DUXA 3UFYA 4FNPA 2A1YA 3H6OA 1QI4A 1SW3A 3MZNA 3RPMA 3UZ5A 4QHRA 1X7IA 4Z0SA 2W91A 4GX8A 1CCWB 1U30A 3PULA 3NYZA 1Z69A 4GNKB 1O1ZA 3CZ8A 4GGHA 4LUJA 2QDGA 2FJUB 4K1WA 1OFAA 3OYXA 4ZFMA 4NJGA 3GXMA 5AC6A 2GQ9A 3EWUA 5BXRA 1GT8A 3WK2A 3WDIA 4MKVA 4IX0A 1W1YA 4LYPA 2DDXA 2WMIA 3DHUA 3R89A 3VMOA 4DAFA 4IX2A 1SYTA 3WFAA 1A0DA 1CPUA 3ARSA 3UXIA 5FEXA 3K1DA 3MO4A 5IFTA 2X2YA 3TJIA 1ZU8A 1TWIA 4XISA 3T8QA 1JNEA 1XS2A 1KFJA 1H3GA 2WJZA 3VD7A 1UKQA 5M3WA 4N4PA 3PZQA 1H09A 3VKDA 4J3WA 3KBVA 5C8BB 4B2DD 3FW6A 2CKSA 1AMKA 3ZVIA 4PRRA 5ECVA 2PWVA 3TC3A 3SBFA 5KMYA 2DSKA 4N6EA 5DQPA 1OSEA 3MMWA 1JCLA 1ZL1A 4LBRA 3SCWA 2OCZA 1XBXA 1K03A 3OB8A 1EQCA 1IEXA 3S83A 1SMDA 1KM2A 2HJPA 2OOFA 1PV8A 2CZ5A 3CPUA 3RRXA 3T42A 1JYVA 2VYOA 1UD2A 4ZO7A 1U1JA 2EXOA 4GO8A 5CPSA 3WQOA 4JHOA 4GIAA 3WUFA 5HDRA 4FK9A 5A6SA 1XG4A 1E6SM 5E6ZA 1XLCA 3N2TA 3MBDA 2NX3A 3NG3A 5D32A 1TIWA 1VIWA 4PBFA 3SN4A 3THUA 3NSMA 2WLZA 4WY0A 4CCCA 4IIGA 4XB3A 1B3YA 5K4XA 1ZJAA 1GJWA 4D6HA 4M24A 3CAWA 1XLIA 1IGSA 2QGYA 1J5TA 4J3ZA 4LGXA 1XYFA 2A7RA 1PTAA 4INFA 5AOUA 5HJXA 3GXIA 3LPPA 4FLSA 3KRZA 4M3PA 1LBFA 4O0ZA 3I6EA 1CTNA 8XIAA 4KKXA 3QZAA 4F2BA 1R7AA 5FD0A 4BI7A 2QJNA 2OELA 1WQ5A 1RV8A 1C8XA 1SZGA 1HKMA 4XKYB 2YCLA 3SO7A 3VCNA 4Q4SA 3S5YA 1JDCA 3IV3A 3R10A 4FLQA 1LL6A 1HVQA 1Z48A 2PZ0A 3VXGA 2JEPA 1JF6A 3WLMA 4PUWA 1QDSA 2AL2A 3EEGA 3KUMA 1I6NA 1T5AA 3KS5A 1CXLA 1HL9A 3ARZA 1FH7A 2ZKMX 3L68A 4HCDA 3SFKA 2BV9A 3UG5A 3EA2A 3T2OA 1DORA 2NQZA 4GC4A 1V6WA 1W3TA 4QJ1A 1GQLA 2D24A 2PCQA 5CPLA 5A2AA 2PD5A 4JDYA 4PMYA 2C7FA 3CMJA 4CD8A 5EBAA 1FKWA 4RUBA 1F3TA 2Q3OA 3WLQA 3NDYA 3PUEA 4S39A 3W24A 3Q2DA 5CXPA 1CNVA 4UQCA 4Y2WA 3KBSA 3QVQA 5LIUX 4JHMA 1JPDX 1E5NA 3G77A 4MLJA 3VFCA 4IL0A 3JR2A 4JKKA 4OV4A 3T0CA 1W1B1 1BVNP 2OZ0A 5E5CA 1V3LA 4A29A 5CBBA 5FL0A 6TIMA 3U6WA 3AXIA 3OO2A 4QJ3B 3GM8A 1EOKA 2HCVA 1UB3A 4NXSA 2GQAA 1QPRA 1NELA 3TCSA 2PU0A 4BEUA 4LALA 4RNFA 3S1VA 2WMGA 1GOOA 2FJKA 3FNDA 4CNUA 4DBDA 1DJHA 3SM0A 3QQ0A 1BSLA 4ZSUA 5M03A 1B31A 2FPVA 2YL6A 2PDBA 3RAOA 2FB3A 3KRBA 4XTDA 1GW9A 3PFMA 3V5FA 1E40A 1GOWA 3GY1A 1P0NA 1JNDA 2I5QA 5EKYA 3SAZA 1GQKA 3RDKA 4QJ4B 4QS5A 3G1SA 3U57A 1AH0A 3ABSA 1JDAA 2V2CA 4WHBA 4J27A 3O1NA 1EEPA 1AQ0A 4KCVA 3WMSA 4C6CA 4GI9A 1PX3A 2PLMA 4HZ8A 2G41A 4PULA 2Z2UA 1ZTVA 4JTKA 2Z7KA 2ACUA 1E3ZA 1KR1A 1SUXA 4DUOA 3UXLA 1PBGA 3VZXA 3VINA 3WMLA 1O5XA 2JIEA 5LSMA 4AC1X 1VPYA 1XLAA 1HIZA 1PX8A 2ZX7A 1UBPC 3AHTA 4JTSA 1UA7A 4O1FA 4EP8C 4AHQA 3O16A 2WMJA 4LAOA 3WMBA 6A3HA 5IXEA 3NL3A 2XGIA 3BZGA 4K37A 4PMUA 1OB0A 3PG9A 3MCNA 3D47A 1FHVA 5CQ1A 3A24A 1X1ZA 2C1IA 2NLIA 2QUNA 1H50A 2D23A 4WOZA 4FXRA 3QTGA 3IIPA 2FB2A 4B5UA 1R86A 1RR2A 2HV5A 1QO2A 2J8FA 1RD5A 2E3ZA 3LM3A 1ZBCA 4ASTA 7TAAA 1M5WA 5CPNA 2XFFA 4MFEA 1JFXA 4KESA 3W7EA 2WV8A 3N17A 4FXSA 3QGKC 1YKWA 3NDZA 1PCKA 1R6WA 2FFCA 2OXNA 3E0LA 4MDOA 2CBUA 1W8GA 1MSSA 2CZVA 1N8IA 3URBA 3SN1A 4RNIA 4F0SA 1F3XA 1UWUA 3ERPA 1GKPA 4FO4A 2OWXA 3BUVA 3SADA 1VHNA 2PBGA 2H8ZA 5DO8A 2Y5EA 1PEZA 2E8YA 4Z1DA 4W7WA 4PCPA 4XBJA 2PD9A 4O19A 1CBGA 1QK0A 5HWJA 3HV8A 3BARA 3QH2A 4DPQA 1I2OA 5F4SA 2R94A 4LUTB 1WBHA 4QISA 4XSLA 2VXNA 3CUXA 5XINA 3LXBA 4CQ8A 2YL8A 1LQAA 4M29A 5FF0A 3SCVA 4HN4A 3W2KA 3URAA 3GNPA 3ZT6A 4KETA 3GDMA 4JIRA 1DJZA 2IUZA 3MI3A 3H4XA 3HPSA 2GQ3A 1JCTA 2PLJA 2DT2A 2QNEA 2Y88A 1HGWA 3QXBA 4XBKA 2FKPA 3NSNA 2XVGA 4KPLA 1YADA 4XKYA 1OCJA 2YZRA 4UQBA 1HUVA 4NX0A 3VIFA 4J28A 3MCMA 5H8PA 1LRNA 3CASA 3LXCA 1TV2A 2F2KA 1TUFA 1E0XA 5D2XA 1CLKA 2XGZA 3F4VA 4XTIA 4B4FA 1VB9A 3OHMB 5D37A 1WB0A 1LT8A 4GI6A 5C6MA 3HGSA 1E6XM 3ATYA 4XUYA 3GC4A 1UA3A 3S0CA 3WLHA 2ZRXA 3AHVA 3UGVA 1M03A 4O50A 1OM0A 4ZTYA 4US6A 3JZEA 1FWAC 3KBNA 3DAQA 3E1F1 1VHCA 3FKRA 3V16A 1AG1O 3DC8A 3GDKA 2QF8A 5I5RA 2F2HA 2BMBA 1R3YA 1T8XA 2JFEX 3NQVA 1AQHA 1F6PA 3WQEA 4GYFA 3PZMA 4GINA 2BVWA 1JCJA 3DYMA 2AKMA 4G7EB 3UCDA 4I6VA 2VC5A 3AICA 3EWYA 3ZJ7A 3C56A 3QGVA 3O15A 3DHPA 1WZLA 4FNTA 4LS2A 4BI5A 2OYLA 2OPJA 3WMCA 4WY0F 4UR9A 2A0NA 2QKFA 3T2PA 3QKEA 3CYVA 3PZNA 2CHRA 5CLWA 1XX1A 1TTPA 3LLFA 4C6PA 4JN8A 2PTYA 1OABA 2YPIA 4DYEA 1AD4A 4M1RA 3GU1A 4H7ZA 2XISA 3GFYA 4H9XA 3W74A 1REQB 3N2CA 2P0OA 2ZADA 4H01A 3EDDA 2VURA 2VHLA 3QN3A 4XG1A 2VEPA 2DJLA 5HQMA 2PWGA 3AXHA 4IIDA 2F38A 3K13A 3P62A 4GYKA 1OFEA 4PCFA 4ALDA 3WQ6A 2EF9A 3U5YA 1PIIA 1CXFA 4HSOA 2OMAA 3CQ0A 3F2DA 2XN0A 3PVFA 1U83A 3PB0A 3RPDA 1EB3A 4MSSA 4F79A 1OF8A 5CC5A 1QCWA 4AQLA 4KEUA 4AYGA 3CH9A 1JI1A 5HA7A 4L6HA 4MM1A 1XBVA 4JY9A 2IPWA 3G3MA 1WZMA 3CUFA 1ECEA 4PTNA 1HQTA 2J79A 3K4DA 5DCEA 3UEQA 4E2VA 4M7SA 2VFFA 5IM51 3KDOA 4LVAA 5D4YA 3DFYA 2INZA 1W9BM 1DJQA 4TTGA 4FXFA 1C3FA 3LY0A 2OSYA 3MUCA 3NPWA 2HBXA 4IG2B 1W2VA 3CV6A 2A7PA 4EF9A 2V82A 4PTWA 4XZWA 3MUY1 4H9ZA 3F4CA 2C18A 3VCRA 1IR1A 2WVUA 5EMLA 2ZDRA 1FP8A 4UC5A 1UD4A 1K9DA 3HN3A 3QM3A 1MEHA 3KVMA 3VGEA 2WSPA 1S5WA 4NJJA 1SO3A 3M0IA 4PBGA 1MO0A 2EAWA 4MHBA 2FPTA 4JTTA 1YTDA 1BTMA 1PUDA 1BG4A 2OO0A 1ONEA 3M0VA 5AC7A 1UMYA 4W5ZA 4ZA0A 3G8RA 3DI1A 1NOWA 2IKHA 1ZUAX 2GSHA 2ZWZA 1H7PA 1L6FA 1MEWA 5HINA 2NQJA 3QBUA 2DZAA 3C8NA 4IP4A