4RE0A

Crystal structure of vmolac in p622 space group
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
313
Chain Sequence
MVRISIAGGNEIDPGSMGLTLFHEHLRLITEVVRWNWPHLYNEDEELKRAIDAVNAAKKYGVKTIIDLTVAGIGCDVRFNEKVAKATGVNIIMGTGFYTYTEIPFYFKNRGIDSLVDAFVHDITIGIQGTNTRAAFVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLARTVIGHVGDTDDISFIEQILREGAFIGLDRFGLDIYLPLDKRVKTAIELIKRGWIDQLLLSHDYCPTIDWYPPEVVRSTVPDWTMTLIFEKVIPRMRSEGITEEQINRVLIDNPRRLFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of VmoLac, a tentative quorum quenching lactonase from the extremophilic crenarchaeon Vulcanisaeta moutnovskia.
pubmed doi rcsb
source organism Vulcanisaeta moutnovskia
molecule tags Hydrolase
molecule keywords Parathion hydrolase
total genus 118
structure length 313
sequence length 314
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02126 PTE Phosphotriesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4re0A00
4V1XA 1K70A 2AMXA 3MVTA 4H00A 4GY7A 4D8LA 3LNPA 2Z24A 2WJDA 1S3TC 3T8LA 4DLFA 4DZHA 3LSCA 3FDGA 1HZYA 3IGHX 1YRRA 2E25A 3SFWA 2ICSA 3TN6A 1FWAC 4RDZA 4B92A 2O4MA 3S2JA 1UBPC 3PANA 3RCMA 4L6DA 4PCNA 3CAKA 1EJVC 1RJPA 1XWYA 4ZSUA 2FTYA 3LS9A 4RE0A 1POJA 3NURA 3UF9A 3ID7A 4QS6A 3MDWA 2VUNA 1EJTC 3F4CA 2WJEA 2Z7GA 1W1IE 1YBQB 4C6MA 2G3FA 1J6OA 1R9XA 2FFIA 1EJWC 1QXLA 3UBPC 3F2CA 4IGNA 4QROA 1EJRC 2CZVA 2UBPC 3IPWA 3GRIA 4H9XA 2DVUA 4HA0A 2EG6A 2BB0A 4R85A 3RN6A 4IFKB 2Z25A 3GIQA 1POKA 1I0BA 3UR2A 4WHBA 3E2VA 4R7WA 3QY8A 2GZXA 3K5XA 3MJMA 3AU6A 2Z26A 1FWDC 2YB4A 3EWDA 1JGMA 2DVTA 4AC7C 3MSRA 3TNBA 2QT3A 4B90A 3GTFA 4KF1A 2GWNA 1NDZA 1DPMA 5A6TC 1R9ZA 4DNMA 2GSEA 4F0RA 3LA4A 1YBQA 4EPEC 4C6KA 2OODA 1ADDA 1R9YA 1XRFA 2Y1HA 2HNHA 3IRSA 1P6BA 4GBDA 4CQDA 1RAKA 2OGJA 4BY3A 2YZ5A 2O4QA 4C6EA 1K6WA 1FWJC 3S4TA 1ITUA 2PAJA 4LCRA 3URAA 4B3ZA 4KESA 4C6IA 2HQAA 2AQVA 3PBMA 1EJUC 3HTWA 3S2NA 4BJHA 4G7EA 2IMRA 2VR2A 4INFA 1BF6A 3BE7A 3GTIA 4C6PA 2Q09A 4KEUA 4AQLA 3URBA 3B40A 1YMYA 1A5LC 3FEQA 1KRBC 4RDVA 4HJWA 4IG2B 2QPXA 4DIAA 1ZZMA 3CJPA 4F0SA 4H9UA 1NDWA 3UPMA 1V7AA 4M51A 1WXZA 2HBXA 1FWIC 4GC3A 4CQBA 2RAGA 4H9YA 3A3XA 2XIOA 4H9VA 1GKPA 1J6PA 2R1MA 1A5MC 2VC5A 4C6LA 5FSEC 1A5KC 2A3LA 2I9UA 3DCPA 3URNA 4CNTA 1PTAA 4OFCA 4JOMA 1ONWA 2QS8A 1E9YB 1P6CA 2P53A 4GY1A 4IFRA 4GYFA 2R1NA 4PCPA 4IGMA 4XD3A 3MDUA 2VHLA 5CH9A 3GU1A 1O5RA 4LCQA 1FWCC 2GWGA 4EPBC 4UB9A 4ERIA 3QGKC 1RJRA 4CNUA 2P50A 4LCSA 5HMDA 4EPKA 3G77A 3KM8A 1EZ2A 4C65A 2OOFA 2VM8A 3K2GA 1UIPA 5LXXA 1PO9A 2R1PA 3PNUA 4GOAA 1EJXC 4XAZA 2Z27A 3T1GA 3MVIA 3WMLA 3UR5A 1M68A 1V4YA 2Z2BA 3OJGA 2FVKA 4QSFA 5AKQA 2Q01A 3URQA 1KRCC 2Z00A 4RDWA 4C6FA 4DZIA 3LSBA 4IFKA 1A4MA 1KRMA 2Z4GA 3R0DA 3MKVA 2FTWA 4I6VA 4NP7A 1EYWA 2E1WA 3DC8A 4B91A 3RYSA 2UZ9A 1GKQA 4Z42C 4XAGA 1UIOA 3HM7A 4YIWA 3RHGA 2AQOA 3E74A 3DUGA 2PUZA 4C60A 4LAOA 2PGRA 4DO7A 1PB0A 3E38A 4CNSA 5E5CA 1EF2A 4C5ZA 2D2GA 2HPIA 3ICJA 3ISIX 3QY7A 4BKNA 4GK8A 4C6BA 3AUOA 4E3TA 3IJ6A 4GXWA 4HK5A 4QTGA 3SO7A 2KAUC 4ZSTA 2D2HA 3TN3A 4LANA 4HK7A 1QW7A 4RZBA 3B0XA 2YXOA 3GU2A 1ONXA 4R88A 3F2BA 3MTWA 1KCXA 4C6DA 4DYKA 3A3WA 4IH3A 4RDYA 2ANUA 3PNZA 2VC7A 1PSCA 1NDVA 1YNYA 1RK5A 4KEVA 3GU9A 4CEXC 1IE7C 3NQBA 4PBFA 3IACA 2FVMA 3ITCA 1VFLA 3HPAA 3ORWA 2HPMA 1WXYA 3IARA 3PAOA 2D2JA 4EPDC 3QGAC 4KERA 3K4WA 2EG8A 4H9MA 1FWEC 4LAMA 3CS2A 3GIPA 4C5YA 3QY6A 4QRNA 1J5SA 4G2DA 3LGDA 4H9ZA 2DVXA 3FDKA 1P1MA 4P5UA 4C6QA 4IQJA 1RJQA 4J2MA 1XRTA 1FWFC 1NFGA 2ZC1A 4DI9A 1V79A 4NI8A 4LFYA 3N2CA 3S2LA 4GY0A 4XD6A 3NEHA 5G4HC 4C6CA 2Z28A 2OQLA 4H01A 3B0YA 4GZ7A 3V7PA 4C6JA 4KQNA 3GTXA 1FWBC 2PGFA 1M65A 3S2MA 3O7UA 1V51A 1NDYA 4NG3A 2W9MA 4EP8C 2PLMA 2Z2AA 4C6OA 1ITQA 3T81A 4KETA 4F0LA 3AU2A 3OOQA 2F6KA 4ERAA 1A5OC 1RA0A 4KIRA 4CQCA 2I5GA 2Z29A 3WYZA 1A5NC 3GTHA 3TN5A 3IV8A 4PE8A 4C6NA 2WM1A 1KRAC 4LEFA 1M7JA 1YIXA 3LY0A 4CEUC 5HMEA 1I0DA 2GOKA 3MPGA 2EG7A 3E3HA 3GG7A 3D6NA 3LGGA 3LU2A 2QVNA 1FWGC 2BGNE 3E0FA 1GKRA 5HMFA 4GX8A 4J35A 1A4LA 1FWHC 4LAKA 4DLMA 3OODA 4LH8A 3F4DA 3EWCA 4IFOA 4WGXA 2WJFA 4J5NA 3OQEA 1J79A 3O0FA 1RA5A 4XD5A 3GUWA 3TN4A 1FKWA 4ICMA 1EJSC 1XGEA 1FKXA 2R1KA 4MUPA 4QS5A 3A4JA 4TQTA 3F2DA 4ERGA 4G7EB 3OVGA 4GX9A 2OB3A 4V1YA 3WZ0E 4DI8A 1E9ZB 4XAYA 1V77A 2HBVA 4IG2A 4UBPC 1UMLA 4XAFA 2YB1A 3E0LA 4H9TA 4PBEA 1K1DA 4I6KA 1RK6A 2R1LA 4WVXA 4LALA 5FSDC 4HK6A 4L9XA 4XD4A 1O12A 2ADAA 4IF2A 3EGJA 4KEZA 3JZEA 3OU8A 3C86A
chains in the Genus database with same CATH superfamily
4HSNA 2OX1A 2ZRWA 4F8XA 4GY7A 1KA9F 3GDTA 3WLKX 4J3ZA 2C16A 5TAOA 4C91A 4K39A 3MZ2A 3W2KA 3UQNA 3DDMA 1EJVC 2C0AA 5HA7A 4GUHA 1JYNA 2VUNA 4HNCA 1JDDA 4C7GA 1H7OA 3M16A 3PWAA 2G3FA 1J6OA 1KV8A 1FWSA 2FFIA 5HNTA 2PD5A 2DSZA 3S1XA 3RMEA 4D72A 6REQB 2YR1A 3KCLA 1TX2A 1OD8A 3LRLA 4TVUA 1H41A 2C1HA 4IFKB 1GOIA 4KT2A 1HUVA 3CPRA 4WHBA 3V5FA 1D8CA 1XYCA 2GZXA 2WSRA 3USBA 1F3WA 4DJFD 1N8IA 4DO6A 1GHSA 4E5TA 4IIBA 2RJHA 3BOXA 2Y63A 4OQVA 3GHRA 2ZUMA 1V7YA 3R79A 3GW3A 1XXXA 3NEVA 3KCOA 4DNMA 3KOZA 2NUWA 1TJ2A 1KM6A 3W25A 4H8HA 3UCDA 1J0HA 2P5NA 3WK1A 2ZUNA 1QNOA 1TFVA 2VDIA 3CUHA 2YZ5A 3MMWA 4LUSA 1T40A 5I3IA 4IUOA 2BVWA 3RLVA 5F1VA 3H2CA 4B4FA 3CC1A 3ITOA 3PBMA 5FI8A 1I45A 1SO4A 1QI3A 4O57A 3OGSA 4HPNA 4E2VA 3W9ZA 2GPTA 1QAPA 3DN5A 4NT0A 1TQXA 3BLFA 3Q37A 4RDVA 1UA7A 3NSXA 2QPXA 1JEZA 3OGVA 1EBHA 2UY2A 2YW3A 4OHQA 2RDTA 2D69A 1GWJA 1PKYA 1Q4WA 4PRRA 2JF7A 3KAOA 3CL6A 1J12A 3BCFA 3ZSTA 5FSEC 1FDJA 1GZ1A 1PUDA 4BF7A 1SJBA 3RCYA 7REQB 1QDSA 4XVEA 3UT0A 4DEFA 2ACUA 2P53A 3WMSA 3V1PA 4C90A 1TG7A 1XLDA 4M1RA 9CGTA 2C7FA 4XD3A 3PPHA 2A85A 1GW1A 2VOTA 2GWGA 4EPBC 5EL1A 1N8FA 1ALDA 1ZLPA 5HNNA 2OOFA 2QAPA 3W2NA 3TWAA 1LRNA 3BH4A 3HPZA 3WLTA 3VDAA 3NUKA 4H04A 4RNJA 1GVSA 4QAWA 2ISSA 4M56A 1VC4A 3BWWA 3ZJ6A 1IZCA 5G1TA 3FW6A 1W5NA 3DH7A 4O4VA 3ONBA 4YPJA 4O1AA 2FTWA 4HHPA 1JQXA 4LQ1A 1MW2A 3R8HA 1XISA 4V27A 5BZAA 2J9XA 4QFUA 4O0ZA 1DE6A 4LPCA 1B1YA 3SUWA 3UERA 3P67A 4LC6A 2X2GA 3EDDA 4ENLA 4C6BA 3QV9A 3UXDA 3W84A 3HG3A 5KMYA 1HIZA 1XIEA 3QXBA 3DYMA 3MY9A 1GPFA 3F2BA 5BW6A 1PIGA 3ANYA 4IH3A 1EKOA 3QFEA 2OO0A 3CQIA 1RK5A 1CGVA 4EWND 3M0XA 1G9HA 3HA1A 1E6QM 1H3GA 3TSMA 4WDWA 4PYSA 1VFTA 3GAYA 1VFUA 1SW7A 2A3BA 4I8DA 5LYRA 1O5QA 4HBKA 4P5UA 2O7QA 2G8ZA 1PCKA 4GWEA 4C1LA 3VNKA 1KM0A 3Q58A 1TVLA 1LYXA 3TW6A 3GNDA 4PCFA 3LHWA 3HFYA 5H8UA 1C8YA 1YW1A 2VJXA 3ZWTA 1ZJIA 3AUJA 3GG8A 5EPDA 5IXEA 3CV1A 4AD3A 1IGSA 4Q7IA 3QMSA 2V67A 1W56A 3VM5A 1TX0A 1ITQA 5HWJA 2UY3A 1MFUA 1PX8A 2X16A 3RILA 1IIHA 4IGSA 5MKGB 2VWSA 3DKLA 1ZS2A 4H41A 2J7DA 4UTWA 5DY3A 4BQ4A 2OJPA 3VU2A 1MMFA 4TU1A 3GHUA 3LY0A 4JTLA 1HKVA 2PC8A 4YHGA 2YBUA 3H2EA 2DIKA 3LU2A 5EY5A 2YDQA 1GTEA 4RLIA 1SMDA 3UZJA 3MUAA 1K77A 2QCMA 1XL9A 1UMYA 1YNQA 2VRQA 3GXNA 4A4AA 1VCVA 3CT2A 3L0KA 5AB3A 5F4SA 4U4MA 3SRDA 1W1YA 5EBUA 3P61A 1JI1A 3HZ3A 4DJED 2BY0A 3FS2A 1XLIA 1XV8A 1OT2A 1IEWA 1WOAA 2E8ZA 1N82A 3SDOA 2PWFA 3LQLA 4GX9A 1GW9A 3W87A 3M6DA 3OW1A 3W72A 4DI8A 1RPXA 1E40A 4NAFA 4AHOA 2WBGA 3BAIA 2F84A 1UMLA 1Z42A 4S3EA 1UWUA 3DHFA 3FCPA 4I6KA 3T0AA 4UTFA 4E6MA 2X0SA 3GYEA 2JK2A 5GNZA 2WZMA 4QXIA 3SUSA 3EGJA 1D8WA 1A5BA 3ZT6A 1VHNA 3GVQA 3HGJA 1LLWA 3ITGA 2BOGX 2X2YA 3ATYA 3KVKA 4A8RA 1XSJA 5HJXA 1VCGA 1S3TC 2QUMA 2IKIA 1TR9A 2A6LA 4I9MA 2FDMA 3RR1A 1R0MA 4URIA 3IGHX 5AHLA 5D8WA 3BDKA 4DAIA 1WA3A 3CB3A 1SJAA 1XDMA 1H1ZA 2E0PA 3FAWA 3VILA 3BAKA 1UBPC 1DP0A 1PHQA 3N6JA 1RJPA 2POZA 3MA8A 4YS1A 4E4PA 1X7FA 1W1IE 3HQOA 1UZDA 5F2LA 3HFTA 1VIZA 3W07A 1RR2A 1U5VA 2HXTA 5A8QA 2W92A 1WP6A 2E40A 4H2HA 2BHYA 3BAYA 1ZALA 2J8GA 3IJIA 2QYGA 1IT7A 2VTFA 1XF0A 1M03A 1W17A 4WDXA 4JKMA 2DZTA 3BG5A 1G67A 4HNOA 1QNVA 1CDGA 1R9ZA 4GCAA 1YLVA 1LCOA 3LYEA 4EIVA 1YBQA 1SQ7A 1XR2A 2CESA 3LCXA 2HNHA 5G2HA 4GBDA 1XFCA 1CLKA 1XCFA 1KXHA 2O4QA 5A8NA 3O05A 3AS0A 4O16A 1I9CB 4B3ZA 1O60A 2ACQA 4TR9A 4PMOA 3VK5A 4LVGA 1BF6A 2CLEA 3WNNA 1ME8A 5C2XA 3URBA 3ATZA 3IS4A 4O18A 4HYWA 4MWAC 2QCNA 3MU7A 1HL2A 2WO5A 1L8PA 3TYDA 1QO2A 4CQ8A 2VGIA 1VF8A 1RLCL 4CQBA 1R3TA 3O6DA 3DFHA 2V5LA 3TJ4A 2O9OA 1B3WA 4AF0B 3OLGA 3MUY1 1M7OA 1A53A 1R6WA 2X40A 1FH7A 2I1OA 3E1F1 1NQ6A 4AF0A 1T99A 4GY1A 3ITTA 4FLQA 2E3ZA 2WMFA 1K9EA 1R2TA 3WCZA 3L21A 1QOXA 4NYYA 4BK9A 2DORA 3QSRA 3CTTA 2DW6A 5HANA 3O6YX 1NWRA 2PRLA 3T6CA 3OIHA 3W6YA 4QG6A 2OXNA 2DP3A 3VIGA 1OK6A 4UFLA 2VFFA 3GDRA 3UWQA 1YKWA 1ZP3A 3EMZA 1F74A 2GK1B 2FVLA 1I75A 1VH7A 3DX5A 5E6ZA 2WV8A 2Z00A 4C6FA 3R0DA 5HWNA 5E70A 4CU8A 4DXXA 2GYIA 3WQPA 4IPLA 3AHTA 3W7RA 4PUKA 1NF7A 1YDNA 4LAOA 5K7JA 3NOEA 4IOTA 2NT0A 4I5RA 5KSWA 1KFKA 2VFEA 3W7LA 5G2IA 3GM8A 4JIQA 4GK8A 1J0KA 3BJSA 1OGBA 2V3DA 1R7OA 3VNMA 3ZS4A 1QW7A 2C79A 1XYLA 2PTXA 1F3EA 1EO7A 4C6DA 1AW5A 1WUFA 1US3A 4AY8A 4RDYA 1LQAA 3H26A 4FB7A 2R6OA 1THFD 1K7XA 1BG9A 1V6WA 4TMBA 1SYTA 4F9DA 3ZXWA 3PAOA 4FP1A 3MWAA 4F0KA 1UD2A 4H6QA 4AWUA 1TA3A 2Y5EA 1TELA 3C0LA 4AHPA 1A3WA 2JIEA 1IWPA 3AHZA 5C8BB 3TUUA 1C7SA 4R3UA 5A2CA 1RJQA 2GOUA 4BHYA 1LQ2A 2CC0A 4WSJA 1YPXA 1HVXA 1IXNA 2P1FA 4NJIA 4AIOA 2I5IA 1CXLA 2JALA 5A1AA 3WFAA 1LJYA 1ZTVA 1TPVA 3L4YA 1E6ZA 3WQEA 1JPDX 2R24A 5A2AA 2QQ6A 2BSLA 1FP8A 3N9RA 4O15A 2ON3A 4QSHA 2FH6A 1CIUA 5GPRA 2ZUSA 3BPWA 1AL8A 1G5AA 1B9BA 1O6IA 2W9MA 5IHSA 3LZ5A 1Z9AA 2VDGA 3SZ8A 1V3JA 2G97A 3CEUA 5DRCA 3TP4A 3FGCA 1J0ZA 2RDWA 5G5IA 3VX1A 2BXYA 1GOWA 4W87A 4EXQA 4E8DA 5LKYA 1BG4A 3NVTA 4H4IA 3G5EA 3AYTA 3U4FA 2JFEX 3VOJA 4WJ8A 4UCFA 4DX3A 1B0IA 3CL8A 4LT9A 4CD7A 1W1A1 4UWMA 2EEXA 3VDGA 1C92A 1ZY9A 1TKKA 4MY8A 8TIMA 4DJEA 1MQPA 3OP2A 4REQA 1LT8A 2VFHA 1A0CA 1W3TA 3C61A 2ZXDA 1J79A 4TX9A 1XLGA 3GUWA 3MMDA 5JMUA 1FKXA 3H53A 1J5TA 3OVQA 2V3EA 2OOGA 1QT1A 1BYAA 2HVMA 3QOKA 2J9YA 3HMJG 3E0WA 1EC8A 4CCEA 3LPFA 3NL5A 1JF5A 4IG2A 2YA0A 1Z44A 4HPHA 2PTWA 4WKHA 5LNWA 1KGWA 3WQOA 1H1NA 3A47A 4JL2A 3N6HA 1ONEA 1P1XA 3R12A 4YTSA 4FNTA 1KCZA 3C86A 1SGJA 4QLLA 4M24A 2NQLA 2FZNA 1VJZA 3MVTA 2JQXA 1QI4A 4KCWA 4WGHA 4EVZA 3UYIA 1HZYA 2QCLA 3QW3A 5CG7A 1KBKA 4N9DA 2P0IA 4RDZA 1EQPA 3TWBA 3RCMA 1SFSA 5HULA 2PF8A 4MKNA 2ZUWA 1V08A 1XDLA 1Z32X 1D3HA 3F4NA 2ZRZA 5EMUA 1GOMA 2V63A 3G2GA 8CGTA 2CZVA 1NARA 1C8XA 3G1RA 2Y7EA 2V68A 4JAWA 4XISA 3P3BA 3VIJA 1V0LA 3M0YA 4PUDA 3BLOA 2O9TA 2HVNA 3PUOA 3S5OA 1MWOA 1SM9A 4FOUA 4R7WA 3VD9A 3AALA 1E1CB 3FK4A 4JXCA 3RPDA 1JDFA 1E70M 4GQGA 3EWDA 3G1VA 4EANA 1Z41A 5AVHA 1BWVA 2GDUA 1OZQA 4MB3A 3C0JA 3W76A 4ZODA 1S3HA 3E5BA 4WK9A 3WX7A 4K7VA 1TYGA 1AJZA 3H2NA 3WUEA 3B06A 4CCZA 4NYUA 1JJKA 1K8XA 4ZR8A 1V3KA 3WF0A 1H62A 4W8BA 1DJNA 4GZEA 4BI7A 3U7BA 3W7QA 9XIMA 2XVGA 4UFHA 2D22A 2DIJA 3AMGA 4KESA 2VZOA 1BSLA 3OYZA 3ZOAA 1IT0A 1EJUC 3MCOA 3W1NA 1GYNA 1AQ0A 3EOOA 4UR7A 2H3DA 1X8FA 1JD7A 5BNKA 3C8NA 2XN0A 1Y5WA 3QR3A 1R86A 4QIUA 5D9OA 4QHRA 4HPXA 5B80A 5C71A 3B0UX 2PWVA 3NQEA 1W3JA 1WOBA 3U57A 4JX4A 2QUNA 4P7NA 2JEQA 4GG9A 1U30A 4JX6A 2BOEX 2WC3A 2IQDA 2QVHA 3RU8X 4K1WA 3GIYA 2X30A 5FJOA 4XO7A 3ARPA 1D3GA 3OLDA 4IM4A 3W7DA 2QDEA 3UWYA 4CNTA 3FN9A 1O1ZA 4QJ4B 3QQ0A 4IFRA 1WKYA 3NR0A 1ELSA 3EB2A 1M7XA 3W38A 1O5RA 1HNYA 2ABAA 3S5YA 5E9AA 3VD4A 3ZIZA 1GOKA 1H7XA 4RR4A 5GJNA 1TWIA 3H54A 2PF0A 3UA4A 5ABFA 1QPQA 4NASA 1JZ2A 5C9ZA 1UIPA 1HJUA 4QM1A 4RE3A 4W7VA 4B9ZA 4J40A 3R11A 3TIMA 1E6NA 3AYSA 2QDGA 1EH9A 1OFRA 3H4XA 4Q8VA 1MZRA 5KZMA 4RDWA 1WAUA 3ITYA 1F6YA 4KWUA 2IKGA 1XBVA 4NP7A 3RUBL 1F3XA 4A8LA 2WYSA 4H8UA 2GJRA 1O5KA 4UQAA 2CHRA 4K2SA 3DENA 2OVLA 4GVGA 3TJXA 3PB2A 1Q6RA 1VBGA 3WJXA 4F2BA 1E15A 4Z2IA 1B54A 3LV5A 1UD4A 3WMBA 2GJXB 1JFXA 1U2YA 4HU0A 2WVTA 1EP3A 4JYFA 1KM5A 3T55A 5C7VA 4L4PA 2DJXA 4BR1A 1DHPA 1SUXA 4P7OA 3EWBX 1DJHA 3UU0A 3EKGA 3QYSA 2YA2A 3WQGA 1CTNA 3WBEA 3U2EA 4EXBA 1C93A 4GZJA 1SSDA 5D2VA 1G4SA 3WK0A 2XSBA 3W3OA 3M41A 3VO0A 1JZ8A 2EXOA 4PMYA 3M1ZA 4BEQA 1FWEC 4LAMA 1XLCA 4NXSA 3S9ZA 3ARRA 1YTKA 4DI9A 3B9NA 3CZ8A 3TQVA 3AIRA 5DBUA 3N2CA 4J3UA 5HNUA 1YYAA 2F61A 4XD6A 3HQ1A 4JTFA 4X61A 3WNKA 1JQVA 3LRKA 4ZL1A 1FWBC 3UYCA 3VIIA 1I2QA 2IXVA 3AIWA 4N6FA 3P5YA 4NG3A 5AZ0A 1E73M 1U1JA 2ASHA 2PDMA 4GUFA 4ZTYA 3TTOA 3ZFHA 2WXDM 2Z7KA 4ICNA 3KWSA 3OYXA 4HZ8A 5K3VA 5C9UA 5FD0A 3WYZA 2JKEA 3WQ4A 3KL5A 3SRHA 3HG4A 1TA3B 4LEFA 1CGUA 1XH2A 1TR1A 2H9AB 1BQCA 2QGYA 3S8HA 3ZYZA 4CNNA 3APGA 1VBJA 1IQ8A 3E6EA 4P8VA 1EQCA 5LIXX 1ODZA 1GVIA 4JTTA 3T08A 1J18A 2VCCA 3OODA 3SW6A 3F4DA 3NFUA 4AZCB 3NGJA 1KCLA 3GC4A 2BFGA 3OQEA 4O1FA 1F05A 3M0HA 4C1KA 2VD9A 2WSQA 5E0CA 4XD5A 3AIEA 3SSJA 1W8GA 1LWJA 4GQBA 3PBYA 3FYYA 5I6SA 4XB3A 3KBSA 4MUPA 1FOBA 3RF9A 2A2IA 4GFIA 4FIRA 3CIWA 4F2TA 2WHKA 5MHBA 1CW2A 3PFRA 4Z2KA 3WZ0E 3P5ZA 5T26A 1UROA 4O13A 1E9ZB 1OIMA 3NOYA 1V77A 4HMCA 3PZMA 2HBVA 2E5BA 4Z1CA 3AWNA 3IV3A 2J77A 1SVDA 4FS9A 2R1LA 3SCOA 4LALA 3W7GA 4L9XA 2QUVA 3GQYA 3M46A 3BVJA 1N55A 3ABXA 1US0A 2CBUA 3JZEA 4JQ4A 1DJIA 4YMZA 3W23A 1WPCA 2ZXAA 3MYOA 1OG0A 3RG6A 3FDGA 4K8EA 2Q3RA 1CCWB 2VQUA 3RM8A 1R8LA 1KC7A 3STPA 3UVIA 3CO4A 3KL3A 3FXYA 1XWYA 5E1QA 3W2LA 1I2RA 1KO0A 3BGJA 5DBTA 3OIXA 3VMNA 3T0CA 1UD5A 4Y9MA 2ZX5A 3O07A 4X60A 4JYDA 4KKXA 2A3AA 3WJYA 4GACA 3QEZA 1QI2A 2EG6A 2ZIDA 2W6RA 4ZB0A 2EF9A 3MYPA 3RXZA 1OCQA 2NQJA 5IM51 1UQZA 4IGHA 1SU5A 3NM3A 2Z6JA 4GI6A 3NDYA 4MYAA 4GO9A 2X7VA 3DKJA 3TVAA 1OT1A 3O15A 2AOSA 2QGHA 1X97A 5D05A 3RLGA 3ZJ8A 4DJFA 1E1CA 4IX0A 1JUBA 2WMHA 3K8LA 3H21A 1KLYA 2OU4A 4MMWA 1T7LA 2VD8A 4AEEA 3HO8A 4AY1A 2VEMA 4D2JA 4WKFA 1L6SA 4IIHA 4WDTA 2RHGA 3BGAA 3N3MA 4IXXA 3NGFA 5AYXA 2VR2A 4M80A 3ZO9A 3KRSA 1AH0A 2J74A 4UNKA 3PJUA 4H8NA 3GR7A 1YMYA 2LLEA 5HQLA 1F07A 3LBMA 4HJWA 4KFOA 4E0CA 4XQ6A 5LIYX 3PZQA 3T05A 1KXVA 2HK1A 4JDYA 4M51A 3ZR6A 3CPUA 1ITCA 4YWIA 3DU0A 2NWRA 4L56A 3G1YA 1JYWA 1FRBA 1A5KC 2FZ8A 1XBXA 4EACA 2QIWA 4YLWA 3AFBA 4UTIA 1TWSA 3DG6A 4GYFA 2ZADA 3W82A 4PCPA 3WQ6A 2XYLA 2NXIA 4KMQA 3GC5A 2EKCA 4LCQA 4MJ2A 1XRSA 1TV5A 1ZPTA 4XV0A 1DWAM 3NQFA 1PKLA 3T44A 1GVYA 4XVDA 4B5UA 1VS1A 5F7UA 3L4TA 4UOJA 5JH1A 2XM1A 2MANA 3EMQA 1B2YA 2C3ZA 2Z27A 4Q4PA 1CI1A 3PPCA 1XSKA 1V02A 2YFNA 3APYA 3FFSA 5FJIA 4DZIA 4CLMA 5D02A 1LQ0A 3MKVA 4NRRA 3FJNA 2EBNA 2BHZA 1EYWA 1RH9A 5BOEA 2YCKX 3CUXA 3ZQ9A 2UZ9A 1KBLA 1GJUA 1WZLA 4CNSA 5G1YA 2W91A 2A0NA 4FSAA 3W70A 4DWSA 3PULA 4QCFA 1WKDA 1NFBA 4LUIA 4RE4A 3ISIX 4IPIA 3VX0A 3ZR4A 1GG0A 3VE9A 1MXDA 4IMAA 3WD4A 3N4FA 1AQMA 3IVUA 1QOQA 1M41A 1S5MA 3WQDA 5DN1A 2ZZ3A 2PPGA 3KCJA 2G4FA 1IE7C 3BUVA 2QUUA 4DPPA 4WY0B 4LRSA 3ARQA 1L6GA 4GQQA 3IIPA 3R0KA 3VCCA 4PUJA 4KERA 5A6BD 2P76A 3RM9A 1B3OA 1Q3NA 1OEPA 4MVAA 3B4YA 4JIPA 4CU7A 1K8YA 4PMXA 3W7PA 5IOBA 3N13A 3VUPA 2NV2A 3KVLA 1RUSA 3ALGA 5CBJA 3TYEA 4MLRA 3EWUA 3W88A 5FF3A 4NXKA 1P6WA 5DFAA 1I2PA 4C6CA 1X6UA 2DV0A 2V38A 1LBFA 1MNSA 1XLKA 1A47A 5IBXA 3ES8A 1GHRA 3GTXA 3KBWA 3R5EA 2GJLA 4G8TA 1NP2A 1NWTA 2F9RA 3WH8A 4I9TA 4DF2A 4CD6A 3BOLA 1B3YA 3CT7A 4NKCA 2DT0A 4CQCA 4HPJA 2PWDA 2DSVA 2VI0A 3LHUA 1J8VA 4IQLA 2QZRA 3QTPA 2WZTA 3BW3A 3OVRA 4WUIA 5HQMA 4OKDA 4GX8A 3R6IA 1G7VA 1XS2A 3U5YA 1E55A 3R13A 4PTNA 1HO4A 4U5IA 4J3XA 3M43A 3ZLHA 1W32A 1HTIA 2C91A 3BC9A 3KRUA 2BVDA 1K9DA 3O3RA 2G37A 1RXOB 2YL5A 3VOGA 4JTQA 1LUCB 2IS7A 2VP8A 2OYMA 3SFKA 1F4HA 1J93A 2QNEA 2YXXA 1X6LA 1A80A 3G3MA 4S23A 1TE1A 1CX9A 2HTMA 3I68A 4W8LA 4Q6XA 2GLKA 1RQBA 2FMNA 4D6JA 1DWFM 4LVAA 3HPSA 3UXIA 4ACZA 4KW2A 1W5PA 4B2DA 5LA0A 3BG3A 3VFLA 2ISWA 1QPNA 5TNVA 5EB8A 1TVNA 4GGBA 1ZBKA 4XAPA 2HZGA 4JY8A 1UZ4A 3JS3A 4KCUA 2ZYFA 3CAKA 3N14A 2FTYA 3PUGA 3VOCA 1QFEA 1V0KA 1POJA 6ALDA 4GHRA 3U6WA 1JYVA 4O10A 4QS6A 2XZ9A 3E96A 1Q6FA 3HN3A 2Z7GA 2PA6A 4XTIA 1DWHM 1YTDA 3TDFA 3WBWA 3F2CA 1X98A 5TF0A 3WN6A 3TYBA 1FDZA 5KEZA 3CV7A 3VYLA 3IPWA 2Y88A 4NY2A 3FNDA 1HL8A 3SIMA 3BLKA 4MUZA 2V81A 2OEKA 1PZ2A 4U28A 1UP0A 3QY8A 5BCAA 4AAJA 3VOFA 5CBIA 4XTDA 3EWWA 3GW0A 4IPJA 4X2PA 2EJAA 2J9ZA 5A6TC 2XFFA 3B8VA 2DZUA 1W8SA 2IW0A 4GVHA 1S1RA 3W2JA 1R9YA 1XGDA 1XRFA 3W7NA 4DM2A 3N2OA 3QZ6A 4NJKA 3PUDA 1CWYA 2R8WA 4HZ6A 5L9FA 4MYXA 5DO8A 4AZBA 4U3CA 2VRKA 2OWWA 3OBEA 2Z1KA 1R3RA 3GC2A 1IZJA 3K4AA 5EA9A 3BZGA 2PP0A 4C6PA 2AKZA 3DFPA 3N2XA 4DQWA 3BANA 1J11A 4WSKA 4W8AA 3W7HA 3SGZA 4Q8OA 1ISWA 1QNRA 5HWMA 3O6CA 4I90A 4LUTA 1EP1A 4CGTA 3H12A 1UWIA 3NSNA 2ZDSA 3W6MA 3P93A 3WY1A 3I6TA 2DH3A 2V69A 2ISFA 3SQLA 3G0UA 3DHPA 1BAGA 1UOZA 1Z3NA 4Q8PA 4P61A 3TC3A 2GVGA 4FF5A 4P8UA 3S5NA 3I4EA 3S46A 4CD8A 4GVFA 3QGKC 1FCVA 2MUCA 1NQKA 5HMDA 1Z89A 3FIGA 4ZVJA 2VXNA 3WBAA 3HJEA 1BVNP 4IJCA 4GOAA 2FHCA 4XZHA 3U48A 1H5VA 3WMLA 1M68A 4QSFA 4GZIA 3S5SA 1LRTA 3H24A 1XLMA 1X96A 1B3XA 5BRBA 3LHVA 4TOQA 4Y8EA 1A4MA 2IXUA 4PFMA 2BNJA 5JIPA 3K30A 3F5LA 2W61A 3WQ5A 1XYZA 1E4IA 4EF9A 1GORA 4RXGA 3OZOA 4O1BA 5BXTA 1L9WA 2PUZA 2YYUA 1HJQA 1EEPA 4KGJA 1JPHA 5JQ9A 3HG5A 4PZVA 3W1MA 3E0VA 4F2UA 1N2VA 2E09A 3CWHA 2Q71A 3W7CA 4L80A 4NF7A 2A3CA 3S1UA 3AUOA 2P88A 1BSIA 4U10A 3TXVA 2WSYA 3WEZA 3B0XA 4GKLA 4K37A 5DMMA 2HWGA 5GNYA 4HD5A 1V6XA 2E68A 4MDOA 2EJ1A 1E72M 1N7KA 1ZJBA 3H4WA 4N4QA 1TMHA 1VAHA 3N29A 1JD9A 5IFTA 4FOKA 4KCVA 4KCTA 3HQNA 2D2JA 3OPSA 4HNUA 3P84A 4H9MA 3A64A 1RCQA 4L4MA 3ENLA 3N9SA 3WSUA 1J5SA 1TZ9A 2GQAA 3GWQA 2WKGA 3UA3A 4ACYA 3JRKA 3B0VC 3I3BA 2B7PA 2WCSA 1CXKA 1BKSA 4RJEA 1ZU8A 3KHDA 4QBXA 1ISXA 3CHEA 1Z6KA 2A3EA 3NQGA 3WK3A 2Z28A 2OQLA 4JTGA 2QCEA 3V7PA 2YLAA 4GVIA 1U22A 3KDNA 2PGFA 3P60A 3QKZA 4LF1A 5EMKA 2WPGA 2R14A 3M7WA 1UWQA 2PCQA 3P80A 4X9SA 1ICQA 4PB4A 4UR9A 4C1NA 5BROA 3S9IA 3OTRA 4B3KA 1C3FA 3VIFA 2FZ9A 4JHOA 5D09A 4GI8A 5T8GA 1E3ZA 2CBVA 3L0NA 5CGTA 4F0MA 5FAJA 5AECA 2X1TA 4UIOA 2YBTA 4YVVA 1VBRA 1FWGC 3PZOA 1E1FA 3SCUA 3AO0A 1K4HA 2VKZG 1XH0A 4AZ6A 1SO5A 3N12A 4OBSA 1SSGA 3K1GA 4HMEA 3CUJA 2C18A 5EGRA 1HKKA 1OWQA 3WLNA 4JN6A 1MUWA 5A69A 3XINA 2XFRA 5H91A 3TMQA 2VEKA 3WH9A 1G6CA 4LYRA 3EX2A 4QNWA 4LV4A 4YTQA 1JF6A 3GKAA 2ZWZA 2B31A 2X0HA 1I4NA 1G94A 4PBEA 1A3HA 1K1DA 1VEOA 3PS7A 4N6EA 1IZKA 3P62A 4XD4A 1W1ZA 1CZ1A 4L9ZA 4GH1A 2ZUVA 5E93A 2C14A 2V5DA 5D33A 4JTDA 2CXGA 2V0TA 2WCGA 3UG8A 4H00A 4MJ4A 4D8LA 3OEXA 3VC5A 3UFYA 4B3LA 7ODCA 3GDLA 2Z1SA 2HE5A 1AH3A 3LNMA 2VR4A 1Z7AA 2NV1A 1LTDA 1FXQA 4YL2A 3UP8A 4B92A 2CZEA 4WZHA 3PANA 4JTUA 1UWTA 1H4PA 3LUTA 2WWDA 3AMKA 4L61A 1VFFA 1E56A 4D8AA 3FXGA 2WMJA 3BSHA 4KWOA 1HKWA 3U0HA 4RXFA 1LZOA 3WNLA 4D6CA 4IMEA 1RP9A 3SGGA 4Y8FA 4LX4A 1YADA 3C4UA 3MO7A 3VZXA 2UBPC 2W4XA 1BXNA 2TAAA 1Q63A 4UQ9A 3WBXA 3A4XA 3CH9A 3QHNA 3UWVA 3ZSSA 4HA1A 2V2CA 3R0UA 2CNCA 3POCA 3K5XA 3WLPA 1FWDC 4G9PA 5HPOA 1R47A 5JU6A 1SMAA 1TJ1A 3MSRA 2VELA 1L6FA 3KLLA 2EPHA 2AAMA 1HX0A 5CEWA 4KF1A 2C1GA 3WD2A 1DPMA 6CGTA 1E71M 2FPVA 1KM4A 1ICPA 3ZR5A 1HQTA 3WJZA 4ZO8A 3SUTA 1AD4A 3CK5A 1ADDA 2PDBA 2ZVRA 1HJVA 3LHTA 4PH6A 5CC3A 4EAYA 3W26A 3WQFA 4QGCA 4KWVA 1T41A 3VVGA 3VNLA 1JCXA 4AYGA 1RHCA 1NOWA 2JKPA 5HJLA 1OFPA 3VNJA 1C90A 3U9IA 5I3JA 3EZ4A 4PRWA 3B40A 3FEQA 3PZNA 3TXZA 3UPMA 1DVJA 3V0UA 2HBXA 1KR1A 1GVFA 1S5NA 1XQKA 4MF4A 2QKFA 4GMEA 3UZYA 1ZFJA 6XIAA 1ZQ5A 4W7UA 3N1AA 3OBAA 4MB5A 1VR6A 1ZL1A 4ZE5A 4E2BA 3C2FA 4J7RA 3L2MA 3N2TA 3IK4A 5DT7A 4H3DA 3MC5A 3E2SA 3GK0A 4J2PA 1O4UA 5BWAA 1NY1A 1QO5A 3NSMA 1WX0A 1KB3A 3W2MA 4JTCA 1DJQA 1QASA 1TV4A 4NX5A 3T9PA 2WWCA 1KW1A 1VJSA 1TPEA 3PPGA 5J8LA 1A0EA 3SBFA 3ABRA 2ZUUA 2ZWYA 3A3HA 1IWBA 4KRUA 2XFYA 5AKQA 4ZOBA 1KRCC 5D03A 3M5VA 4JFSA 1FHUA 1OABA 1B90A 3TQPA 4IMFA 2XJ7A 5AYYA 3VGBA 5D9PA 4LB3A 1AK5A 4FXFA 3PG8A 3HPXA 1JPIA 3RU6A 4N4PA 5CC5A 4C5ZA 1XUUA 3DHUA 3LI0A 3QW4B 1OF8A 3ICJA 1Q7ZA 3KW3A 4RV8A 2QV5A 3MBDA 1ZAJA 1VBHA 1H09A 3DG7A 5AC8A 1XD1A 4LANA 1VYPX 1Y7VA 4HT3A 1SR9A 5M3WA 1YXDA 1E6XM 3H22A 2VMFA 1TJPA 1UWRA 5A8MA 1X6NA 3WO8A 1F76A 1LLOA 1OD0A 3GU9A 3GYCA 2TPSA 3NQBA 2BXZA 2QXWA 3KOWA 2XINA 3ORWA 3W1QA 3ARZA 1K02A 2YBVA 1VHCA 2HS8A 5LIKX 5C2CA 3OQ8A 2PDJA 5BOOA 1O95A 4LUYA 1TMQA 4G2DA 3VNYA 3LZ3A 4NZCA 3LCLA 1DQXA 3ITVA 1FX6A 4S38A 4ZMGA 4AMAA 1NFGA 2ZC1A 3U5UA 3ECQA 1Y65A 1JAEA 2VL4A 2REQB 3CHFA 1O66A 1A49A 4IXHA 3ZM8A 1TV7A 3NYDA 1M65A 1V3IA 1DORA 3S2MA 3V5CA 3AAMA 2G3NA 3PWIA 1KLZA 1CGTA 1P7TB 2G41A 2VT0A 3RMJA 3U2OA 3W2UA 3FSUA 3H7VA 1UASA 1SJCA 3BAXA 3G6MA 4QQUA 3PBWA 4WOQA 1QATA 4GNJA 4UTLA 2DT2A 4BI5A 1A5SA 4GI4A 1VLIA 2CHNA 2VCBA 4UTMA 1TSIA 1KRAC 2FYMA 4UTWC 3GO2A 2J88A 4IMCA 4QCEA 1RLDA 1BVWA 3T2OA 3CL7A 4D6GA 1V6TA 1XLFA 2I16A 2E6FA 4KBXA 3UETA 3Q67A 4DLMA 4PMUA 4Y9AA 4KEMA 3NWRA 3G0XA 3MV11 4NJJA 1LOLA 4YCPA 3REQB 3KTXA 5DCDA 3O0FA 3C52A 3D5HA 4J1OA 4GI9A 3GR8A 4ICMA 4AW7A 3RRAA 2W79A 4LAUA 3QLLA 4HZ7A 4JIIX 2NLYA 2WLYA 3AMCA 4S3DA 4A3UA 2DT3A 1ENUA 1JUEA 1OFOA 2ZX8A 1D2KA 1TE6A 1J0YA 2PDCA 3A4WA 1AVAA 3CIXA 1YPIA 3COTA 2C71A 2DSWA 3NQ2A 2YB1A 2F6XA 1GYLA 3PZ9A 4QDPA 2XN2A 1ZCCA 2YL6A 3AQUA 3EX1A 1K70A 2VO5A 1SJDA 3MSYA 3ANUA 4MZ8A 4UCGA 5D37A 4O1EA 4JN8A 1HXJA 3L0GA 4ZQOA 5DF0A 2J4GA 3S6DA 1XIDA 2IPGA 2PP1A 3NDOA 4X22A 4IL2A 3M9YA 5CGQA 2AQWA 5CPMA 1EJTC 4OWGA 3LLDA 3MB9A 3W02A 5EYWA 1EJWC 4V2XA 1KFBA 1FCBA 3VOHA 4P2VA 3EB3A 3O6AA 2DVUA 3UPWA 2XTKA 4GD0A 3W74A 5GVJA 1OZMA 2B7OA 3S83A 2NVDA 1OF6A 2WSPA 4DJEC 3D0CA 5AN7A 2G4JA 4BWLC 4DZAA 1W37A 4BEUA 4DWDA 5IFPA 3HGRA 1FVPA 4F3HA 2DVTA 1I6NA 2FJKA 2PP3A 2PDWA 4B90A 1OADA 5H2ZA 5ECUA 3GTFA 3WMCA 2X1RA 4C7FA 3P8IA 4F0RA 1BYDA 4QP0A 2AGKA 1WQ5A 2BY1A 1KTBA 3NIYA 4PULA 1U5HA 3BW2A 2HISA 7ENLA 2Z1WA 2RUSA 3FGCB 3FKRA 2J62A 2XIQA 3ITLA 1JPMA 1XP3A 2H90A 1NTHA 1GZJA 1XFBA 1UJQA 3URAA 3H7RA 1AMYA 5EBAA 5A2BA 1PAMA 1M9HA 2ZA1A 4QJ1A 3WDHA 4P8XA 5I78A 1HKMA 3GTIA 5CZJA 3PPFA 1H2JA 3RIKA 5A6BA 1W9DM 5BRPA 4JFTA 3M0LA 4O8RA 1SZGA 1IEXA 2X05A 1RCXB 4I5UA 1UPPA 1XLHA 1RBAA 4UTKA 3QPYA 2A5HA 3EBVA 2A79A 3M07A 2E6AA 1OC5A 5I09A 1XYFA 4JCLA 1ZHAA 5BXPA 1CT5A 3UY7A 1PTAA 4OFCA 3CTLA 4NUWA 1Z8AA 1KBIA 1R30A 1GJPA 2QF7A 3ZWSA 3MDUA 4XBKA 1UWAA 3N6QA 1EGVA 4PGLA 4UQDA 1OVDA 1E5JA 1RJRA 4US6A 4ORMA 3E9AA 3LCGA 3G1AA 3G77A 2Q02A 3DGRA 1OX5A 2W66A 1Q66A 5CJ5A 1VP5A 3GXPA 4BWLA 7CGTA 1W3KA 2XVNA 2EPLX 1TPH1 3PTMA 2XSXA 1HFBA 2AL1A 4DN1A 2XM2A 3CLMA 4G1NA 3K8MA 3INPA 3RFAA 3T4CA 2NUXA 2DGAA 4I6VA 2AAAA 2E77A 2DQXA 4XZ9A 2NVCA 4WD0A 1MO0A 2CHOA 4EE9A 4AWEA 1FP9A 3IJ7A 3DFNA 4OJYA 3O1NA 3WKZA 5I02A 2ACSA 3VI2A 1BVZA 1VCFA 3C2VA 5JXQA 1TMLA 4E3TA 4UMAA 4HK5A 1ZB5A 3TLQA 3SEPA 2DZPA 1CXEA 4HNTA 5GQBA 4Q7BA 4W89A 3GU2A 1H49A 4PTDA 3SJ3A 1QK0A 1TJRA 1PSCA 2NQZA 1HP5A 4CEXC 4BFAA 1DJXA 3ITCA 4ICCX 1VFLA 4JX5A 2NV9A 3IARA 2CZDA 3LX9A 3AS3A 3CHDA 1OYCA 1C91A 1PBGA 2XWEA 3NZPA 3UJFA 1TTJA 1DQUA 1XPGA 2YXGA 4C5YA 2ZZ6A 1F61A 2Y8KA 3QPZA 2BWGA 5CLTA 3VKBA 4O54A 2C13A 3UD6A 3GD6A 1WUEA 1FFQA 2IUZA 2BXVA 2GUUA 1WO2A 1TV8A 5G4HC 4HN8A 7TAAA 5CPQA 5LNVA 3LV6A 3BLLA 3DFQA 4U3AA 3MUZ1 4RZ6A 2JGQA 4L1WA 3PC0A 1CXFA 3FA3A 1V51A 3BV7A 1UKQA 4ZBCA 4N9BA 4ZOCA 2VENA 3SRKA 3P8JA 3UCCA 1PV8A 4F0LA 4JTEA 1E9LA 1ESWA 4JNYA 1YTEA 5H8MA 3SECA 2B0MA 3EA1A 1KM2A 4TVDA 4ATDA 2Z29A 2E1DA 3CASA 4CCDA 1O1HA 3CPGA 4NL1A 1UR0A 2GOKA 1EA0A 5BU9A 3MI2A 3LG3A 3GXMA 2ZZ1A 1HKJA 4CNPA 3NQ7A 2NQ9A 1XG3A 4JEJA 2J7FA 2YCIX 4Q7NA 1RD6A 4O50A 2EKGA 4AYSA 2X1SA 3SCWA 3W01A 3W27A 1H11A 1E0TA 3QR0A 2E28A 3W7IA 4IMGA 2HJPA 1UBSA 1S38A 3RJYA 1ZGDA 1GK8A 4CVUA 2DEPA 4YTUA 3GB6A 2QPSA 3VGEA 2CBIA 3CUFA 4L64A 1TCMA 4F9JA 8RUCA 5JVLA 3T4WA 3KL0A 4MZ1A 2ACRA 5CLWA 5DMYA 3I65A 4E2OA 2VGGA 2PDYA 2HNEA 3PG9A 2NQ5A 5FF7A 1JR1A 4AZGA 4HHLA 4AVFA 4FNQA 4KFNA 3GVGA 1JXKA 2YCJA 1EUAA 4XKYA 3SI9A 3WLRA 5C5YA 2CYGA 1XCXA 2J66A 3PZTA 4DELA 2VEGA 3E12A 1SO3A 2OWCA 2QDHA 4AB4A 4XIMA 5BMWA 2J24A 2WMIB 4EAMA 2G96A 1NOUA 4CN1A 2XPKA 2XVKA 4P7QA 3LNPA 4TTGA 6TAAA 5EU9A 4ZXLA 2QLYA 5XIAA 3CZGA 3BSMA 5F2MA 3WH5A 1EUNA 2Y61A 5RUBA 4PCNA 2Y7GA 3UG4A 1WDSA 4ZSUA 4A21A 2ZKMX 3JZUA 3LDVA 4TV6A 2XFWA 1SZFA 3MDWA 1A5UA 4MIMA 4BA0A 1XYAA 4C6MA 3NL6A 4IGNA 4GIEA 3QQ1A 3NXFA 3YPIA 4NNBA 3AS2A 3UWZA 4HA0A 2QMJA 3A5VA 3CMFA 3WDQA 4GC4A 1NAL1 2Z25A 2E9LA 1EDGA 4HTBA 3G1XA 2OQYA 3RNDA 5G4WA 1P0BA 3LCWA 5AYIA 4GYPC 4GQ0A 4UQCA 5LIUX 5T9CE 4HOXA 1E9IA 1VYRA 8A3HA 4XZIA 4XKMA 1DJGA 4HU8A 2WKJA 2PWUA 3GSMA 4S3GA 5D4YA 2DUZA 4XKYB 4LS0A 4ADTA 4CQDA 5HUPA 4UTTC 5CC7A 2O9PA 2DZWA 4O52A 4BQ2A 4H7CA 4E4FA 4B5TA 4R7OA 4QDWA 4OUIA 4AEOA 1F73A 2HK0A 4F48A 1VZWA 3ZZ1A 1UP2A 5LSMA 4QITA 3S6TA 3BZJA 2IMRA 2IPFA 4KEUA 4KS0A 1UB3A 4UQBA 3KFTA 4IG2B 3MP3A 1WXZA 1FWIC 3EDFA 4CN4A 4HB7A 3KTCA 4EKJA 1DJZA 1OC6A 1OJXA 3PJXA 1UC5A 1A5MC 2VC5A 2QF8A 1EDTA 1I60A 1EJ7L 4NIRA 2YX0A 3N9KA 4RK8A 5D8ZA 3VE7A 2WSKA 3CLWA 4MB1A 3BGGA 2GSJA 3MCMA 4E8CA 3ZVIA 1ONWA 3MUIA 3WD3A 3STCA 5M5DA 4KH2A 1KD0A 3H2AA 2R1NA 4HCDA 4IGMA 1KXQA 2YSWA 3GFYA 2V5JA 4RX0A 3B9EA 3RCNA 1XLBA 4OBTA 4GIYA 4CNUA 3KUMA 1LL6A 4JFUA 3E49A 4I9AA 2YA1A 2FJUB 1JCLA 3WF3A 4S3CA 2VWTA 1JZ5A 3LLFA 1XW8A 2OLHA 3B9AA 4M7SA 2VGBA 1FHLA 1BD0A 2D3LA 1PVNA 4ZQCA 3HPFA 4PB5A 3EX4A 4AZ7A 3DC0A 1FFRA 3C3NA 4J27A 5AC4A 1R2SA 4HPGA 1AJ0A 3LMYA 5HMSA 3T0TA 3TV8A 1QK2A 3WF4A 3N2MA 1QW9A 2FZMA 4QE5A 2Y4SA 2PGRA 1PE1A 3K4DA 3G8RA 1J2WA 3QZEA 1LT7A 2FGZA 2XVPA 1ML1A 5LZLA 5CAKA 3VNDA 2ZTKA 3DGBA 4YVXA 3FYOA 2KAUC 3VC6A 4D8ZA 4ILSA 1HVQA 1NP0A 4HOWA 4RZBA 1K7EA 1ONXA 3TR9A 1PWMA 3MKCA 3CB8A 3SQMA 4AWTA 1BQGA 2PTDA 4KEVA 1LBMA 3FLUA 3GXTA 3Q94A 3THUA 4B5XA 5FAGA 3WJWA 3IACA 3HPAA 5EMYA 2WC7A 5I79A 3GY1A 3K4WA 1REQA 5H1WA 3J7HA 4W93A 4XZWA 4PMNA 1UZHA 2YCLA 3K8KA 1PCWA 4LUSB 4UOZA 3AYRA 3NCOA 4KIEA 3D46A 3FKKA 3I6RA 2J79A 4NI8A 2X0YA 3QPEA 3NAVA 1A5CA 3PBUA 1RALA 2XHYA 3L23A 3THQA 3JVAA 1VPQA 5G2WA 1MEWA 2CITA 2WVSA 4C6JA 3VKJA 3FEMA 3M6YA 3BMVA 5TD4A 2WZEA 1H50A 2A3HA 3VPLA 4FXRA 4B5VA 1T8QA 1CEOA 4KETA 3SY5A 3TNOA 3CEPA 3U3HA 3L7RA 1IR1A 4D1JA 4KIRA 1HG3A 2HE8A 1KWKA 4AIEA 3EX6A 4JQ1A 3GBDA 3NQ8A 5BMXA 4AXKA 1R2RA 2VC6A 3WQWA 4XBSA 3WNPA 3AXHA 2P0OA 3OZPA 4EF8A 2ISVA 1BXCA 3AMLA 3F5JA 4LH8A 4ROQA 4Q8WA 3A9BA 1VFHA 3FJLA 4RW3A 3AIUA 3ARXA 3TN4A 4AD4A 3ARYA 4LS1A 4JKLA 2W67A 2PDNA 3R25A 1KR0A 1UR2A 2JGYA 1YXCA 1PYFA 2DUXA 1E43A 1GJWA 3I6EA 4OT7A 4O28A 4LOCA 1E0XA 3QM3A 1A0DA 2VEIA 2C8NA 3DIPA 2QV4A 3EOEA 3PJWA 4X0NA 1QNQA 1RK6A 3TROA 2WNWA 3BJFA 2J78A 4HK6A 4BQ5A 1O12A 5EKYA 4GA8A 5LA1A 3PFMA 1W1PA 3V35A 2WZHA 2ZZ4A 2AKMA 4NZ1A 3PTQA 3ME3A 3SIZA 3RPTA 3BV4A 3B8TA 1J10A 1KFLA 2Y6ZA 3TW9A 1C9WA 1S2AA 3MCNA 1TPC1 1DWIM 4DXVA 1UR3M 3R89A 4I8YA 1YRRA 4ZB5A 2ICSA 3EAUA 1FH9A 4ZZ9A 2MNRA 2RDXA 3H2OA 4UTUA 2BGQA 3H2FA 3NURA 4L1GA 3LMZA 1G69A 1BEUA 3T0DA 1QI5A 4JDBA 5CZ0A 1EWEA 2CPUA 4V33A 3UBPC 4IP7A 4O17A 4CQAA 1AD1A 3A6OA 3M44A 4P8WA 4PUMA 3GX9A 4UNLA 5AOUA 2C19A 1JDCA 1DIEA 2BB0A 3GDMA 4MWAE 3SB0A 1HL9A 2J25A 4PEKA 3C0QA 3ABZA 4LRTA 4LVFA 1RPKA 1M5WA 3G1HA 1WZKA 3TAOA 5I3DA 2INEA 4I5XA 3TK7A 3IJDA 5FKYA 3MJMA 2XIBA 1PIFA 2YB4A 3T07A 3QMTA 1JGMA 2OKOA 4TTUA 3THAA 1GT8A 3IEBA 2PDPA 4PFHA 1GOQA 3MP4A 3T42A 4M3PA 4X63A 1QCWA 5DXXA 5AHEA 5AC6A 3WNMA 5HPCA 4C6KA 3E5PA 2HMCA 1ME9A 4IIDA 4WXZA 4EOUA 1MW1A 2ESCA 4M6VA 2RFGA 1K6WA 4BS0A 3C3UA 2WLZA 2IQ0A 3IIZA 1UW9A 3HF3A 1ITXA 2AQVA 4QX4A 1V3MA 4FNRA 3GH5A 1TUFA 3VNZA 3AWOA 3STGA 5F2IA 4DUVA 1XICA 1LG2A 3IGXA 1K3UA 1IYXA 3I10A 1TZ7A 1EF3A 4F0SA 3V18A 4AUBA 4XSLA 4DO4A 2FPTA 4ZFMA 1UWSA 3TSDA 4GC3A 4LB4A 3PTDA 1P43A 2ZQ0A 2XIOA 2NT1A 5K9XA 1NEYA 4H9VA 3GHTA 2GQ9A 5K4ZA 2CBJA 2UV8G 4DXKA 3LQGA 3DCPA 2B4GA 2L5HA 2TSYA 3BAWA 4E8GA 4RNHA 2GVEA 4HA4A 3GNXA 2CLFA 4O8AA 3T8QA 4H2CA 3MP5A 3V3WA 2PC4A 3MV01 4PRTA 3W1TA 2J7BA 1IXQA 2VHLA 5G4EA 1HO1A 2F38A 5GNXA 5C2GA 4GNKB 1KNWA 4S1FA 4UFKA 3SCPA 4HNVA 2CWNA 3LK6A 2DZBA 2WMIA 1G0CA 1AQFA 2WHLA 2YPIA 3W24A 4LGXA 2NQHA 5C0QA 1CENA 2J75A 1HF6A 2D0HA 4NZJA 3OVPA 1MW0A 4IICA 3MUCA 3S42A 3LSBA 3TQKA 2Z4GA 2CXEA 1Q6DA 2E9BA 5M17A 4IIFA 4JFVA 1JRCA 1SFJA 3VZYA 4ZO7A 3L67A 2QDDA 1E6SM 3S47A 3BMWA 4CQ9A 3WJSA 1AG1O 2XG9A 3SURA 3UZWA 4BKNA 4X9YA 1AQHA 3FYPA 2XISA 3V16A 2CLHA 4B2DD 3H2MA 3EPMA 3A23A 4B5WA 1W5QA 4FMVA 4R9OA 1YNYA 1F2JA 1LG1A 4MJMA 1Q7QA 5BU6A 2Y2WA 1J0JA 1TQJA 3BLPX 1DKWA 4EPDC 4MGGA 2YCLB 4NSBA 3LBOA 1YEYA 4Q4RA 4IT1A 3D47A 2EQDA 4WJEA 4ML9A 1Q8AA 1QUMA 3R2GA 3KOXA 3LTPA 2GGIA 1H7NA 5E6YA 1WXJA 4IJBA 4HSOA 1QNSA 2BG5A 1Y8BA 3M5XA 1OX4A 4M6QA 4GZ7A 1W5MA 1K6AA 1W3NA 1YQ2A 4M7TA 1B9ZA 3O7UA 4QAIA 3LTSA 2GQ3A 2P8BA 4HCLA 2Z2AA 1OHLA 3C56A 4AZIA 2XWDA 1XIBA 1F6PA 2F6KA 3E0IA 4NNCA 4QG8A 1RA0A 3WLLA 4KFPA 5EMMA 3GVRA 1OBAA 1A5NC 3GTHA 3PZVA 3W7JA 4A3YA 3LPGA 3ANVA 3DEQA 1BFNA 3MKKA 2Q8ZA 4O53A 1EHAA 2OO6A 2GVJA 1TWDA 3MPGA 3TH6A 3CZJA 1ISYA 1W0MA 3E0FA 1GTHA 2FTPA 1PXGA 4DBUA 2XIJA 5DANA 3SN4A 1ONRA 3W22A 2ODOA 1BF2A 4WGXA 3ARVA 2PDGA 4AY7A 3GFZA 2Y5SA 3LM3A 1S39A 2QJJA 2Y85A 2RH9A 4PTWA 5I5RA 1MEHA 1EXPA 1XGEA 5FF0A 3EEGA 3TC6A 3PZUA 3NQAA 5A8OA 3QJAA 3NTYA 3CIVA 3TFCA 3AXMA 3LENA 4FPSA 4RCXA 4V1YA 6ENLA 1ZBVA 2VVSA 1FY6A 4XAYA 3BG9A 3ARTA 1GOOA 2Z2UA 3BTNA 1NVMA 4MKSA 3VIPA 4DBEA 4I7VA 1OY0A 1R3WA 3QR1A 3LBCA 3TYAA 4A3RA 4WEVX 5XIMA 4ZENA 1XYBA 2FQIA 3QVQA 1REQB 3KE0A 1QMLA 4ZCWA 4CKQA 4JTKA 2EPKX 3OU8A 5D2WA 1E1EA 1KQYA 2O9RA 4UOQA 2VRJA 5C6MA 1FA2A 1DYSA 4DLFA 3W83A 4J9JA 3PBVA 3CBWA 1PZ3A 3VUSA 2PDFA 5CAHA 4S3BA 1AW2A 1K9FA 2J6VA 1J4EA 5I07A 4XBJA 7A3HA 2GGGA 3BLIA 3MHGA 4LBRA 2XGZA 5FJUA 3SADA 3HGSA 3NPVA 3UF9A 4GFSA 1ZENA 2WJEA 1RP8A 1QXLA 1PKNA 1LM1A 2BLEA 3CGTA 4HTYA 4Y7EA 2QJHA 1OFDA 4EXAA 4ZOAA 2V9DA 3MWCA 1ZUAX 3B8WA 2RGLA 3FSTA 4PODA 3AISA 3GDKA 4R85A 2PMQA 1CLXA 5FJRA 2Z6IA 3ERPA 3RN6A 2NUYA 4IZGA 2GFTA 3WDIA 3VDHA 1V6UA 3IVTA 1XDJA 3KBNA 3RO8A 3D3AA 4F0HA 3U2ZA 2I57A 4XUGA 4Y9NA 4EPEC 1FQ0A 1SW0A 3LB0A 4XO6A 3B04A 1YPFA 3TJIA 1XLEA 4MTVA 2FFCA 3TCEA 3UEQA 1FDYA 4R33A 1O7AA 2P3EA 1TPFA 1R3QA 3RX3A 1HW6A 2CKRA 2GJNA 1JNDA 2Y5JA 4Z1YA 1OX6A 2E5CA 4MB4A 2EHHA 2PE4A 3I4KA 4ZXOA 5HDRA 1IHIA 4INFA 3FV9A 1KM1A 3UG5A 2DSKA 2NX1A 2W3ZA 3N25A 2VGFA 1V7AA 3UJSA 3C2EA 5AZ1A 3SRFA 4RNIA 2B7NA 1QBAA 3KLKA 2RAGA 3A3XA 4GJJA 4EWJA 4DBSA 4PSPA 4ZB2A 2ALDA 3DI0A 4DVOA 3PN8A 4GNVA 3CXOA 2ZZ2A 3P0WA 2FZDA 3GFXA 2WNZA 1YHTA 1FWNA 4JPGA 3I7SA 4YTTA 1W91A 3GUGA 3QRHA 3WNOA 3WEOA 3F7JA 3AIQA 1WAWA 3WH6A 4YTRA 4ES4A 5LIWX 4DRSA 4Y6GA 1DXIA 3IGUA 2BY3A 4IIGA 1HP4A 4WXYA 1BHGA 2R1PA 2WK2A 1OYAA 1S5WA 2CLLA 3A21A 1K8CA 3EXSA 1CXIA 4JR5A 1KKRA 5KZ6A 3ABOA 2O56A 5DMNA 3NQCA 1SZRA 3MUXA 3DFTA 2GGHA 3RYSA 3EWZA 2I7GA 1XQLA 1EO5A 3RHGA 1VRDA 3MI6A 3GBEA 4FLSA 3THDA 4DO7A 1LLZA 3NVDA 1KTCA 2VCAA 4W7WA 3QZAA 4CNOA 3IRDA 3L2LA 3QY7A 2V2HA 5EFFA 1BYBA 3PTKA 1S2CA 3IJ6A 1PDZA 3KDOA 1RY8A 1W3LA 3ZMRA 4JGDA 4R88A 4ATWA 5C9WA 4A2RA 2V2DA 4Q22A 3LERA 2I14A 5A6MA 3W7OA 5H8PA 3SCNA 3CYVA 5IRPA 1MUCA 5FL1A 2XSAA 3AIBA 2FGBA 4LAZA 5A94A 2WNNA 2D1ZA 3BCJA 3CS2A 1VRXA 3QY6A 4E38A 4UXDA 2DVXA 3FDKA 4CD4A 3WK2A 5JBEA 2OKTA 3IJQA 1V3HA 1YDVA 1FWFC 3II1A 5HAOA 4US5A 1ECQA 3TAKA 3OZMA 5K9DA 4GBUA 2HSAA 4Z1DA 4GY0A 4BF9A 4DB7A 3HBLA 3CQ0A 3NEHA 4HMNA 3P0XA 4AD0A 3RM4A 3MS8A 5AVNA 1KFJA 2J8FA 3W0KA 1MQRA 5FF2A 1OM0A 3CMGA 1ZBWA 2XGIA 2NX9A 2CU0A 3IJ9A 4QLJA 3UVAA 3GAKA 1KBJA 4LNCA 2TRSA 1GONA 5K4XA 3FX4A 3LXBA 5XINA 4AIBA 3PUEA 3CZKA 2I5GA 4IJRA 1HN1A 1V0MA 4J3TA 4Y2WA 5AHIA 4ML4A 1UKOA 1BRLA 1M7JA 1ISVA 2OTDA 4CEUC 2F2HA 3CM4A 3WQCA 3LHYA 4B4HA 1DQWA 4M1BA 1QR7A 3A4AA 3IJLA 4D6HA 5HMFA 2PSNA 3XIMA 2CLKA 5KTLA 1UH4A 2Y7DA 1S2VA 3AI0A 4G56A 3DFYA 5LGXA 2GDQA 2VEFA 4ZOEA 1U83A 1XYMA 3AICA 3UWEA 4QJ3B 1MEIA 3WD0A 3TFXA 2WMKA 3FVMA 1JL8A 4Q8TA 2XH7A 2RKXA 4DJDA 2ZUTA 5I23A 3UJ2A 1Q6GA 2WC4A 2CLIA 1BXBA 3VMPA 4FK9A 3QGVA 4AWSA 4ZO6A 1UKTA 4HMDA 3TKFA 4UUIA 3WUBA 1B3VA 4XAFA 5I3FA 3OA5A 4D6IA 3NYZA 3TTSA 1DE5A 4G6CA 4PR4A 2PCEA 1OYBA 1ISZA 4PA8A 1XUZA 4MNLA 3UR8A 4HSHA 3NQVA 5REQB 1U1HA 3E2QA 3EDKA 5CBBA 1FWTA 5CKSA 3ZLFA 3NZGA 1H0GA 1ZNNA 1DL3A 2OT0A 3NO1A 4JHZA 3NDZA 3KBMA 1W3IA 2ZRXA 1D7KA 2PLCA 4XWUA 2VZUA 2OCZA 1KFWA 2BHUA 3R7MA 4DUXA 3R10A 3F4CA 1XIFA 2F2KA 3TMLA 2BV9A 2VX6A 4KRZA 5REQA 1XIHA 1UP3A 3MO4A 2VZVA 5AHMA 1G4EA 3VXGA 3W53A 4NILA 5E9XA 4WSHA 4W88A 4S3KA 3V1HA 1POKA 4MM1A 1JUKA 3B03A 2XU2A 3H4GA 3A22A 1GNXA 4W5ZA 4ZEPA 3AU6A 1H1YA 2Y7FA 4Q32A 1MDLA 5BXRA 5C7HA 3QN3A 4B9YA 4DJFC 1JYXA 4OU1A 4PL2A 5J04A 5HOSA 4PMZA 1NDZA 3JR2A 2PU1A 3K1DA 2ZZ5A 1LUCA 1Q2SA 5F2GA 4XSMA 3TSBA 5HXMA 2Q8LA 5ABEA 2WANA 2QW5A 4Q4KA 3QMRA 4ZFCA 1W9BM 5C55A 3AHXA 1M6JA 4MZYA 3I7QA 2AL2A 4C6EA 4OBRA 3STEA 1ITUA 4Y90A 4RE2A 4OOUA 1DWGM 3MANA 1DTUA 1PZ0A 1NFPA 5M2FX 4FNSA 3M47A 4BJHA 1JZ4A 3CYJA 1M53A 1X1ZA 1UOKA 4MFEA 5I24A 2Y62A 5HBFA 1F3TA 2NSXA 1Q65A 2HCVA 3CJPA 3RO6A 1PX4A 4MOZA 3AXXA 3K46A 4L1XA 4HHHA 4H9YA 3SN1A 4H8VA 1R7AA 1IXOA 1YXYA 1EZWA 4FO4A 7XIMA 4CVWA 3KWXA 3TQ0A 1RY0A 4GPNA 2E4TA 4DY1A 3W29A 3SUVA 4IWWA 3MI3A 3R1ZA 1GEQA 1P6CA 3V0SA 2WCAA 4FA3A 4C1NB 3OA3A 3FAXA 3EMCA 3F4WA 3I7RA 2PLKA 4UB9A 4ERIA 5A6LA 1WDRA 2VX7A 2P50A 4GQRA 3RDKA 3S1VA 1V6YA 3T2PA 2KZHA 4PB3A 5LXXA 3REQA 2YCEA 1PHWA 2FHFA 3AXIA 3C5QA 4F66A 1S5VA 2PRHA 3OJGA 5D9NA 4K38A 1IEQA 2X09A 3VKAA 1QRQA 3P2VA 1W1B1 2PZ0A 4XIAA 2X42A 3DBNA 2F7FA 5J5RA 1C8VA 4WY0A 3MT1A 3QV8A 2GJXA 3VD7A 1AL7A 1NJJA 1KXTA 1XKYA 1K9TA 5LXEA 5PTDA 4M81A 2NW0A 2VX4A 2R82A 1Q85A 1EF2A 3AROA 5E09A 3TA6A 2BS9A 4UZUA 6REQA 1T6MA 3ARUA 2ZE0A 1NIUA 4Z08A 2CKSA 3SCVA 4MSSA 4Q6JA 3ZJKA 4RZ4A 4OV9A 2NSOA 2GDVA 4M29A 2CLMA 4OUEA 1UR8A 1MRQA 1QPRA 1KM3A 4K36A 4B15A 4H7VA 1X1NA 3FHAA 1TJ0A 1EWDA 5CZTA 2PB1A 4NQ1A 3WLIA 1L6WA 1H0IA 1JFHA 2HPMA 4CN6A 3W81A 2YOCA 3QGAC 2EG8A 4TX8A 3BQ6A 1ADOA 3RLHA 1EDQA 3DZ1A 3ES7A 2J47A 3NQMA 4TX6A 1OIFA 3M64A 2BOFX 4DJDC 3IUDA 4JKKA 1XH1A 4UQEA 5GJPA 3N73A 4FNUA 2OMAA 1E4MM 3GR4A 2UY4A 1QWGA 5CSRA 3W6LA 1R3VA 1Z48A 3NJ3A 2CERA 4I3GA 4P7LA 3GZ3A 4O11A 2GL5A 1NH6A 3IUIA 2IKJA 1HT6A 3ZJ7A 4C6OA 1QHPA 3AHYA 1E51A 1FH8A 4GH3A 4Z2LA 1OB0A 3W1AA 4YYFA 4HA3A 2NWSA 4LY4A 1UA3A 3SCQA 1TB3A 3TN5A 1OC7A 3W1PA 1MQQA 2O7SA 1YIXA 3T7VA 2PTYA 4HJFA 3A24A 5HMEA 1Q7MA 1XHGA 4WQ6A 2R94A 5I7GA 1UJPA 4LW7A 1TWZA 1BKHA 3UXKA 4J35A 1S2WA 5DCEA 1F8IA 2R91A 2PDHA 1AZ1A 4B16A 4YXGA 5CPLA 1WBHA 5K2ZA 5IBXC 4AEFA 2TODA 1O68A 3OHIA 1FKWA 2EO7A 2YKKA 3R43A 5A3HA 2Z1XA 3G1FA 4W9TA 3L5LA 5FEWA 3F2DA 4TQTA 4LJ3A 4PSRA 4IUGA 2OYLA 2H8ZA 2PU0A 3EX3A 3W1UA 1IWAA 2J7CA 3W7MA 1BTMA 1W6TA 2FKPA 2ZCGA 1LOSA 4JQ2A 3VIKA 1QJWA 2HEJA 4ASTA 4R9XA 3VFCA 5CGMA 1UD3A 4NAEA 2B81A 1W9UA 3CAVA 1P7TA 3HU7A 1V6VA 3OZYA 3DXIA 2AMXA 1VFMA 2EPMX 3OLEA 5DMLA 2WJDA 3JU2A 1KBBA 3T8LA 3NZ1A 5FACA 1R46A 5DY2A 2YL9A 4I7WA 3MHUA 5D04C 5I77A 3WFZA 2INZA 3EXTA 4MY9A 2W0UA 2WQPA 4DWSC 4Z1AA 4RE0A 4JTRA 1WYIA 1V02E 2Y8UA 5EFDA 2QUTA 1WBJA 1IEIA 4BF5A 2F6UA 5J5DA 3NPUA 4H9XA 3UCQA 4PBGA 5JUVA 4BCEA 1EFZA 2B7QA 4LXFA 3VA8A 4WLCA 2WKLA 1TRDA 2OZTA 2ONEA 2VFGA 3BSGA 5HINA 2YDAA 1YDOA 3E02A 4AXNA 1MSSA 4MJZA 4AC7C 3F5KA 5D30A 1G1YA 4QNEA 2Y70A 2QT3A 3THCA 4PCTA 3H6OA 2JF6A 1W9VA 1H5YA 1W2VA 4ZTXA 4I9JA 1US2A 2DH2A 1JCYA 1VQTA 2X1IA 3KTSA 3SY8A 2F8QA 3CQJA 3SJNA 1H63A 3I3DA 3LI1A 3S3GA 1ODUA 1G01A 4GLEA 4NZFA 1QI0A 3UXAA 5KETA 2WHJA 3S4TA 2VUYA 3KP1A 5MF5A 2HROA 4JTSA 3SSZA 1R85A 2WOQA 4MY1A 1CYGA 4FR6A 3H70A 4LVBA 2E6YA 3H23A 1YDYA 3KRZA 1QBBA 4FAMA 2OQHA 1J0IA 4WKAA 3DFOA 2GVYA 3MMUA 3EOLA 4OGZA 2G3IA 3G22A 1VBUA 2PDIA 5HR7A 3V0TA 1S5TA 1RBOB 3WL0A 4OIFA 3QV7A 3GNRA 5D2TA 1UPMB 1CLVA 5FJJA 4K68A 3U8GA 3WUGA 1S1PA 1Q6OA 3MW7A 1Q6QA 3WLQA 5DLCA 1Z69A 1A50A 1PS9A 1XX1A 3RGTA 1DIKA 3SCTA 1GEHA 2H9AA 3TYUA 1E9YB 3UR7A 3LCHA 2ZRUA 4H7ZA 1VENA 3IWPA 4ALDA 4RUBA 1L0PA 2BZNA 1FWCC 6TIMA 9RUBA 1EXBA 1QOPA 1EIXA 3L9CA 3FJ6A 3Q45A 4UFIA 4ATLA 4A3HA 1PO9A 4ACZB 3PNUA 2OSYA 5DQPA 1EJXC 4DYEA 4PMJA 1V4YA 3BLDA 2WAGA 4ZQNA 2W63A 3IAPA 2OSXA 3URQA 3L4XA 1AH4A 3C2RA 4Q8QA 4H6RA 4AD5A 2EPNA 3PY2A 2E1WA 1VIWA 1WZAA 1AA1B 1PDYA 1GKQA 4Q8UA 4XAGA 1UIOA 2ZX6A 3OG2A 1OGGA 4YIWA 1W1TA 3DUGA 3ZVHB 4GXMA 1CXHA 3E38A 1M7PA 2HPIA 4TVCA 3NZRA 3GKFA 1GVQA 3P6LA 1JCJA 3WLJA 2CFFA 4C7DA 3WELA 4JBRA 5DEZA 1KV5A 3N4EA 4DBWA 3WLHA 2VOMA 4WR3A 1CBGA 1IT8A 3W7EA 1TREA 1Q13A 3W37A 1GOXA 3QH2A 2PODA 3A3WA 4S2CA 2J27A 1L8NA 2ANUA 4M19A 2TMDA 1F6KA 3TTYA 3AXKA 1EGMA 4QLKA 2G50A 5LGZA 3S1GA 2C6QA 2WJZA 1Q6EA 3LPOA 3UWWA 3SQSA 1JULA 2NXHA 4O4WA 4PL1A 4AIUA 2A21A 5DT5A 3GIPA 4KGLA 4HCHA 1PPIA 1DOSA 1X7IA 2FZBA 3TA9A 2D20A 4LY8A 1KWGA 1OCBA 4GYKA 5CPNA 2ZE3A 3PM6A 1M04A 1GYMA 4JD4A 3U7VA 3S2LA 4J3WA 4PN2A 1UG6A 4O0KA 3CZEA 2ZTJA 1ZAHA 1BYCA 5BRQA 3IGSA 4JIEA 3C2YA 3OBKA 3R94A 5BXSA 4WCJA 2XIIA 2FH8A 3TX9A 3O8AA 4MAZA 3AIVA 3GXDA 2CZFA 3VGHA 1GQKA 2WMGA 3HQPA 2GQ8A 5A6SA 1RD5A 3N4AA 4GISA 5CZKA 1O94A 3W7KA 1VLWA 4BQ3A 3JUGA 4QR6A 4JS3A 4R7JA 4IQDA 4GUGA 1JZ3A 4N02A 3QFWA 1YE6A 3T0BA 4GABA 1MVYA 3R8RA 3GG7A 2AMGA 3PAJA 2QVNA 4P7RA 4JNMA 1A4LA 2V82A 5SWUA 1FWHC 2WNQA 1QWKA 2DFAA 4JTAA 5ABFB 1QNPA 1ZSXA 1FCQA 1X38A 4TXEA 1EYEA 3EWCA 3VDBA 4NZ3A 1RV8A 1TPB1 2POTA 5DXYA 1U1UA 4NAEB 3WQVA 4RW5A 4PUNA 1B31A 1OFBA 5FIPA 2JEPA 1Q5MA 2G95A 1T0OA 3CUZA 2PDUA 4ECLA 5AHFA 3VD3A 2OEMA 2DZAA 3A4JA 2ZBTA 4G7EB 3NXLA 2PI6A 1YE4A 2W5FA 3AOFA 2A6NA 3WF2A 1TTIA 4MADA 4JTJA 1AUSL 3O16A 1UCWA 1OFQA 4WY0F 4HGXA 2REQA 4US5D 2QR6A 2BP1A 1P4CA 3KXQA 3SM0A 4F4RA 4Y9OA 3SUUA 2CZ5A 4H19A 4MKVA 3M4HA 2HV5A 3KOYA 1EPXA 4JL1A 4ZA0A 3TOPA 5AC5A 3QF0A 1I2NA 4ADSA 1PEZA 3GVWA 1AODA 5FEZA 5CJMA 2XDFA 1BGGA 1R38A 5LNRA 4G1KA 5FJPA 2H6RA 4U5KA 3TU9A 2ZRYA 4E3VA 1D7FA 3UNDA 4ONVA 3O2LA 1XCWA 2Y8VA 4GJIA 4FLOA 1HGYA 5AFDA 3IAQA 1IIGA 3M7SA 2TYSA 2OFJA 1OCJA 3N15A 3GDBA 2G0WA 4QROA 1EJRC 3M0ZA 3M0IA 3UW6A 1W54A 1XIJA 3IANA 3GRIA 5IDIA 4Q4SA 4HU4A 1Q2RA 3ITXA 4NNAA 1LWHA 2FPYA 2YZRA 4BZYA 4MNMA 4TUFA 2HDJA 4UTTA 2D3NA 3DAQA 3POHA 4HP5A 2A7NA 1ECEA 3SN0A 3LCFA 2ZX7A 3GG0A 4J4KA 4DBDA 2Z26A 2G3JA 3KZPA 2PURA 5H6HA 4AVOA 3KEHA 2A7RA 2OEJA 1IEVA 3L12A 4NHVA 1MNZA 1M1BA 2GSEA 4IP5A 2PEVA 4NRSA 3VD5A 2FGLA 5DX7A 2CLPA 2BASA 2VVNA 4WJXA 4M8UA 1D3CA 3FHQA 4OZOA 3BURA 4Z0SA 3UWUA 4JCMA 5A6KA 2OGJA 1LRQA 1EL3A 1FWJC 2WZIA 4Q8MA 4REQB 2P8CA 7REQA 3PF3A 1J2BA 2BODX 4G7FA 2J6XA 5FJTA 3S2NA 2FDSA 1W31A 4G7EA 1JIBA 2BVYA 5BWFA 4AFYA 4L5ZA 3IVSA 1KRBC 3GE7A 3G0SA 4DIAA 1TWWA 1ZZMA 3CQKA 5KZEA 2GUYA 3TEVA 3PSVA 1KGUA 2IPJA 4LS2A 3O0KA 1G7UA 1GKPA 1J6PA 2Z1BA 3HG2A 3SGUA 3IIOA 3URNA 3B8IA 1JDEA 3T78A 4FHAA 1TV2A 2WBKA 1QHZA 3RRXA 2QJGA 4A6GA 4N9EA 1UUOA 3BXWA 1VPYA 5CH9A 2GK1A 1GQNA 2I17A 3KBVA 1ICSA 1XIMA 2VQTA 2A7PA 5T91A 1TUXA 3KM8A 4AMCA 2DJLA 4XG1A 4IISA 2E67A 2ZVIA 2QCDA 1TPDA 3T1GA 3UZZA 4D9PA 4ZQRA 2Z2BA 4QDMA 3OG3A 1OK4A 1VEPA 2VDHA 1J01A 4IFKA 5JBDA 1XC4A 3ZVHA 1QW8A 2WVVB 3DC8A 1P5BA 4S3JA 3W4RA 2DQWA 4A8IA 1RSCA 1C29A 3E2RA 3NL2A 4OTKA 5CXPA 5E5CA 2J7GA 3HB9A 2D2GA 2XH4A 3W86A 2YFOA 2XVLA 3LRMA 2OYKA 2VNCA 1DXFA 4FR1A 5DRIA 3RR4A 4MPQA 3MMTA 2VX5A 1C7TA 2CEQA 2DIEA 2P3ZA 1EOKA 4R53A 4ZSTA 7TIMA 3P7YA 4NZ4A 4DWSD 4HK7A 1IV8A 2X1UA 2ZDRA 2YXOA 4AC1X 3MTWA 3L5AA 4IL0A 4NVTA 4Z0JA 1XKJA 2FIQA 1PL9A 4B5NA 2QJMA 3RITA 3ABQA 3S1WA 4FX6M 2OX4A 4PBFA 2YL8A 2FVMA 3HJZA 3ELFA 3OO2A 4U2YA 3HGOA 1WE5A 2CLOA 2FB3A 3IK2A 3LGDA 3EB4A 1F5ZA 3UGRA 4JQAA 2DU2A 1PIIA 2YDRA 1XRTA 3F4VA 2PBOA 4J3VA 3EXRA 2VFIA 3N3TA 1V79A 4GJ1A 3GHSA 1GZGA 5TQLA 3B8SA 5CPSA 4QE4A 4I7UA 3NG3A 2QJNA 2GGJA 3GNPA 4MG4A 1MYRA 3WD1A 2DSUA 1I2OA 2QJIA 4O12A 1NDYA 2EAWA 2UY5A 1YNPA 3B97A 1Q45A 3N18A 3SCSA 4EP8C 2QAFA 5HR6A 1FHDA 3T81A 2H3BA 4G5DA 3EA3A 3AU2A 1SW3A 3MSGA 3VKKA 4ZGYA 4ERAA 1VFOA 4D71A 1SFLA 4FNPA 4DWSB 4V15A 2DZVA 3AS1A 3W85A 2ZA3A 4W85A 3IV8A 4GUJA 4R5EA 1A5AA 2AL2B 4QEHA 3EDEA 7PTDA 3EA2A 5ENLA 3AMDA 4A3QA 1P0KA 2PDKA 4H6KA 4FX8A 1E5NA 4DHGA 1UZ1A 4U31A 4HNLA 3BK0A 1WNOA 1E6RA 3QTGA 1UH2A 4PC8A 2YW4A 3WENA 3APTA 2QHAA 2WM0A 2WW5A 4JTHA 4JIRA 3FVDA 3O63A 3ZT5A 1ADSA 3EEZA 5B7YA 2V5BA 3M0JA 2R1KA 3S6OA 1LORA 4FZIA 1E4LA 2D24A 2C0HA 2OT1A 4KWSA 4QS5A 1WV2A 4NAFB 2OB3A 3L4WA 1BRLB 2NX3A 1PWLA 2OLSA 5CQ1A 1VPXA 2OZ0A 2DT1A 1DTNA 1B5TA 2VYOA 4DJDD 2PDQA 4H9TA 3GTNA 3LXAA 4ZQMA 3PSWA 2ZZ7A 4PTMA 4IIEA 4ZQPA 4WOZA 4KEZA 3RJXA 3W1RA 3ARWA 4JY9A 5LHFA 3UJRA 3S0CA 4A8NA 4NI3A 1XM3A 1JI2A 1FTXA 3SFWA 3ONCA 1FWAC 1JG9A 1E0VA 2O4MA 3DHDA 1PZ1A 3W71A 2J7HA 2HS6A 4L6DA 2PGEA 4QEEA 1P0EA 5HK4A 3GS6A 5AY7A 1YBQB 2KX9A 1NOFA 2PWEA 5K9CA 3QBUA 4EX4A 4PMVA 2VR5A 2PDXA 1F7BA 1S2TA 2OWXA 3QSTA 5L6UA 4W86A 1V3LA 1UUMA 3UY8A 1H7PA 4N9CA 3GIQA 1HJSA 5A8GA 2QMKA 4O0QA 3QKEA 4X3ZA 3N2BA 3T2QA 1V03A 4GCXA 1QHOA 2PD9A 3TNBA 2GUBA 2E8YA 4W5UA 3LXCA 4UR8A 1CPUA 1L6YA 4CD5A 4MHBA 8XIAA 1I1XA 2GWNA 1E6PA 4K3ZA 3W00A 4D6EA 3LA4A 4LTSA 1BWLA 5CG0A 1F8MA 1GQIA 2OODA 2XZ7A 4LNYA 1OFAA 2Y1HA 4RZ5A 3R4IA 3LCIA 4BY3A 2NVAA 3CMJA 3AC0A 4FOJA 1XINA 2PDLA 2PAJA 1RVGA 2I9EA 1EHNA 3M0KA 3L4UA 3W1LA 4UC5A 1JGIA 3QHOA 1J96A 4HNNA 2VZTA 4DAFA 1NELA 4AQLA 2FHBA 3M5ZA 4QJ5B 1T5AA 4JHMA 1SPQA 3R58A 4CU6A 4YN5A 1IGWA 3L68A 4XZMX 5IHRA 3BQ5A 5C9XA 3NZQA 3QV6A 1DV7A 1H61A 3ABSA 4Q33A 3VGDA 3RPMA 4N0RA 2O55A 1RVKA 2QS8A 4KPLA 2G5WA 1BGAA 3DBPA 2R9RA 4GXPA 4LUTB 1B30A 3QOMA 2XGBA 4PEEA 5E0KA 2EGZA 2HVOA 4O19A 3GU1A 1H7RA 4LCSA 4EPKA 2D0GA 1EZ2A 3T09A 4L6OA 1XLJA 3N17A 3BICA 2GGEA 3UJEA 4FLRA 3NQDA 5ABHA 1PTGA 4FF7A 5D2YA 4AZ5A 3UR5A 4MNJA 3BW4A 1Q8JA 4GIAA 5FCZA 2ABBA 2PWGA 1NWSA 5CPOA 1WDWA 3BMXA 1KRMA 3NO3A 5FA5A 4B91A 1YX1A 4K7YA 3NL3A 1SR0A 3HM7A 5F4XA 3B9DA 1B4KA 3G1SA 2HRWA 2DZXA 2OZ8A 2BVTA 1TZZA 5D2XA 1JVNA 1JCTA 3EKLA 1JPKA 1C9DA 3GZAA 4AU0A 3MZNA 2D73A 2WVVA 3L4VA 3DG3A 4A29A 2WQDA 1ZBCA 1TO3A 2X8RA 1XLLA 3GG1A 3PK7A 3SO7A 4JZ5A 2OR2A 3BL3A 3UZXA 5I0DA 3GLCA 4JQ3A 3W28A 3QYQA 4RKAA 4Y96A 4YWSA 5C70A 1KCXA 1OX4B 3QC3A 2A4AA 3G18A 4O1CA 3UGVA 3C8FA 4UTHA 4FEZA 2RDUA 2VC7A 1NDVA 2C15A 4HOZA 2OG9A 1F9CA 1HJWA 1JDAA 4JICA 1MW3A 1WXYA 9XIAA 5I3GA 1GVRA 1LL4A 2WB5A 2D2OA 1KGXA 4RPQA 3BCDA 1XLAA 4U33A 1IXPA 1RQHA 4QRNA 1P1MA 3VIHA 4IQJA 4J2MA 3PHAA 4Z2JA