4REIA

Crystal structure of ginseng major latex-like protein 151 (glp) from panax ginseng. (crystal-2)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
146
Chain Sequence
GLTGKLICQTGIKSDGDVFHELFGTRPHHVPNITPANIQGCDLHEGEFGKVGSVVIWNYSIDGNAMIAKEEIVAIDEEDKSVTFKVVEGHLFEEFKSIVFSVHVDTKNLVTWSIDYEKLNESVKDPTSYLDFLLSVTRDIEAHHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major latex-like protein
publication title Structure of ginseng major latex-like protein 151 and its proposed lysophosphatidic acid-binding mechanism.
pubmed doi rcsb
source organism Panax ginseng
molecule tags Protein binding
total genus 43
structure length 146
sequence length 149
ec nomenclature
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4reiA00
4IGVA 1LN1A 2LAKA 2Z9YA 4C9IA 3KLXA 4JDLA 1JSSA 2LGHA 4B9RA 4M9BA 3K90A 1T27A 1ZXFA 5AMWA 3NJOA 3NEFA 4A86A 3KL1A 3RT2A 3W9RA 2I9YA 1TXCA 4REJA 4C94A 1KCMA 1T17A 2NS9A 3OQUA 3R6PA 5I8FA 2PCSA 2R55A 3OTLA 1XN6A 2IL5A 3H3TA 3KB3A 4JHHA 4A8GA 2K7HA 1LLTA 4IH2A 4RYVA 5E4DA 2L65A 1LN3A 3E85A 2E3PA 4LGAA 3KAYA 4BK7A 4A80A 5C9YA 3P0LA 4FPWA 3F08A 2FLHA 3H3RA 4MA6A 2RESA 4M9WA 3OH8A 4MAPA 2MOUA 3NMPA 2QPVA 4Q0KA 3TVQA 4A8UA 3C0VA 3Q6AA 4A85A 4BTZA 4IH0A 1BTVA 2E3MA 2Z9ZA 1B6FA 1IFVA 4IGWA 4LG5A 4QIPA 1ICXA 1BV1A 2KCZA 4JDAA 4N3EA 3JRQB 4A81A 4BKDA 3KDJA 3IJTA 4DSCA 5JNNA 5E4MA 2E3SA 2REZA 4N0GC 4XRWA 3Q64A 3NI8A 3NMHA 2M89A 2E3OA 3NMTA 3JRSA 2M47A 3GGNA 2LPXA 2LDKA 4Z3LA 3FO5A 1EM2A 1FSKA 4DSBA 4WVOA 4REIA 1XN5A 3KB0A 3P51A 3PU2A 4IGYA 4OICA 5BRLA 4IGXA 4BKCA 2N4BA 2E3NA 2LF2A 1XUVA 4IHRA 4GY9A 3RD6A 3UJLA 4A83A 3OJIA 3RT0C 4REHA 2E3RA 1X53A 2NN5A 2VQ5A 4R7KA 2L9PA 4MNSA 3WG8A 5JO2A 2E3QA 4JHGA 4A84A 3NR4A 4JHIA 3QN1A 2VNEA 5E46A 2N4AA 3UQHA 2QIMA 3NS2A 4BK6A 4C9CA 3TFZA 1XDFA 3P9VA 2LEQA 2KF2A 1QMRA 4A88A 2FFSA 1Z94A 2L8OA 3NJ0A 2RERA 3ZVUA 5E4BA 1H2OA 3NEGA 2LE1A 3QSZA 4XRTA 2LUZA 3TVRA 3Q63A 3KDHA 4Y31A 1LN2A 3KAZA 3ELIA 2Q3QA 1FM4A 1E09A 3KDIA 5I9JA 3H3QA 4A87A 5JO1A 3NMNA 4A8VA 2PSOA 3IE5A 4PSBA 2KEWA 2BK0A 2A1LA 3NJ1A 4LGBA 1VJHA 2D4RA 2K5GA 2WQLA 2GKDA 2EJXA 2LCGA 3NMVA 3UIDA 1UW5A 4LA7A 4DS8A 2LIOA 1TW0A 3CNWA 2KTEA 3PUTA 3TL1A 3K3KA 3W9KA 1XFSA 3H3SA
chains in the Genus database with same CATH superfamily
4IGVA 1LN1A 2LAKA 2Z9YA 4C9IA 3KLXA 4JDLA 1JSSA 2LGHA 4N76A 4B9RA 4M9BA 3K90A 1T27A 1ZXFA 5AMWA 3NJOA 3NEFA 4A86A 3KL1A 3RT2A 4QDFA 3W9RA 2I9YA 1TXCA 4REJA 3GTSA 4C94A 1KCMA 1T17A 2NS9A 3OQUA 3R6PA 5I8FA 5EKQC 3GKEA 2PCSA 2R55A 3OTLA 1XN6A 2IL5A 3H3TA 3KB3A 4JHHA 3DLHA 4A8GA 2K7HA 1LLTA 4IH2A 4RYVA 5E4DA 2L65A 3HXMA 1LN3A 3E85A 2E3PA 4LGAA 3KAYA 4BK7A 4A80A 5C9YA 3P0LA 4FPWA 3F08A 2FLHA 3H3RA 4MA6A 2RESA 4M9WA 3OH8A 4MAPA 4E6FA 2MOUA 3NMPA 2QPVA 4Q0KA 3TVQA 2LAFA 3C0VA 3GB4A 3Q6AA 4A8UA 4A85A 4BTZA 4KPYA 3HO1A 4IH0A 1BTVA 2E3MA 2Z9ZA 1B6FA 1IFVA 4IGWA 4LG5A 4QIPA 1ICXA 1BV1A 2KCZA 4JDAA 4N3EA 3JRQB 4A81A 4QCKA 4BKDA 3KDJA 3IJTA 4DSCA 5JNNA 5E4MA 2E3SA 2REZA 4N0GC 4XRWA 3Q64A 3NI8A 3NMHA 2M89A 2E3OA 3NMTA 3JRSA 2M47A 3GGNA 2LPXA 2LDKA 4Z3LA 3FO5A 1EM2A 1FSKA 4DSBA 4WVOA 2YH6A 4QDFB 4REIA 1XN5A 3KB0A 3P51A 3PU2A 4IGYA 4OICA 3HM9A 5BRLA 4IGXA 3F73A 4BKCA 2N4BA 2E3NA 2LF2A 1XUVA 4IHRA 4GY9A 3RD6A 3UJLA 4A83A 3GOBA 3OJIA 3RT0C 4REHA 3DLBA 2E3RA 1X53A 2NN5A 2VQ5A 3GL0A 2L9PA 4MNSA 4R7KA 3TGOC 3WG8A 5JO2A 2E3QA 4JHGA 4A84A 3NR4A 4JHIA 3QN1A 2VNEA 5E46A 2N4AA 3NQNA 3UQHA 2QIMA 3NS2A 4BK6A 4C9CA 3TFZA 4NCBA 1XDFA 3P9VA 2LEQA 2KF2A 1QMRA 4A88A 3HVRA 2ZYLA 2FFSA 1Z94A 2L8OA 3NJ0A 2RERA 3ZVUA 5E4BA 3GL2A 1H2OA 4QDDA 3NEGA 2LE1A 3QSZA 4XRTA 2LUZA 3TVRA 3GTEA 3KDHA 3Q63A 4Y31A 4JHYA 4N47A 1LN2A 3KAZA 3ELIA 2Q3QA 1FM4A 1E09A 3KDIA 3HJFA 5I9JA 3H3QA 4A87A 5JO1A 3NMNA 4A8VA 2PSOA 3IE5A 4PSBA 2KEWA 2BK0A 2A1LA 3NJ1A 3HK2A 4LGBA 4QDCA 1VJHA 2D4RA 2K5GA 2WQLA 2GKDA 2EJXA 2LCGA 3NMVA 3UIDA 1UW5A 4LA7A 4DS8A 2LIOA 1TW0A 3CNWA 2KTEA 3PUTA 3TL1A 4NCAA 3K3KA 3W9KA 4N41A 1XFSA 3H3SA
chains in the Genus database with same CATH topology
4IGVA 1LN1A 2LAKA 2Z9YA 4C9IA 3KLXA 4JDLA 1JSSA 2LGHA 4N76A 4B9RA 4M9BA 3K90A 1T27A 1ZXFA 5AMWA 3NJOA 3NEFA 4A86A 3KL1A 3RT2A 4QDFA 3W9RA 2I9YA 1TXCA 4REJA 3GTSA 4C94A 1KCMA 1T17A 2NS9A 3OQUA 3R6PA 5I8FA 5EKQC 3GKEA 2PCSA 2R55A 3OTLA 1XN6A 2IL5A 3H3TA 3KB3A 4JHHA 3DLHA 4A8GA 2K7HA 1LLTA 4IH2A 4RYVA 5E4DA 2L65A 3HXMA 1LN3A 3E85A 2E3PA 4LGAA 3KAYA 4BK7A 4A80A 5C9YA 3P0LA 4FPWA 3F08A 2FLHA 3H3RA 4MA6A 2RESA 4M9WA 3OH8A 4MAPA 4E6FA 2MOUA 3NMPA 2QPVA 4Q0KA 3TVQA 2LAFA 3C0VA 3GB4A 3Q6AA 4A8UA 4A85A 4BTZA 4KPYA 3HO1A 4IH0A 1BTVA 2E3MA 2Z9ZA 1B6FA 1IFVA 4IGWA 4LG5A 4QIPA 1ICXA 1BV1A 2KCZA 4JDAA 4N3EA 3JRQB 4A81A 4QCKA 4BKDA 3KDJA 3IJTA 4DSCA 5JNNA 5E4MA 2E3SA 2REZA 4N0GC 4XRWA 3Q64A 3NI8A 3NMHA 2M89A 2E3OA 3NMTA 3JRSA 2M47A 3GGNA 2LPXA 2LDKA 4Z3LA 3FO5A 1EM2A 1FSKA 4DSBA 4WVOA 2YH6A 4QDFB 4REIA 1XN5A 3KB0A 3P51A 3PU2A 4IGYA 4OICA 3HM9A 5BRLA 4IGXA 3F73A 4BKCA 2N4BA 2E3NA 2LF2A 1XUVA 4IHRA 4GY9A 3RD6A 3UJLA 4A83A 3GOBA 3OJIA 3RT0C 4REHA 3DLBA 2E3RA 1X53A 2NN5A 2VQ5A 3GL0A 2L9PA 4MNSA 4R7KA 3TGOC 3WG8A 5JO2A 2E3QA 4JHGA 4A84A 3NR4A 4JHIA 3QN1A 2VNEA 5E46A 2N4AA 3NQNA 3UQHA 2QIMA 3NS2A 4BK6A 4C9CA 3TFZA 4NCBA 1XDFA 3P9VA 2LEQA 2KF2A 1QMRA 4A88A 3HVRA 2ZYLA 2FFSA 1Z94A 2L8OA 3NJ0A 2RERA 3ZVUA 5E4BA 3GL2A 1H2OA 4QDDA 3NEGA 2LE1A 3QSZA 4XRTA 2LUZA 3TVRA 3GTEA 3KDHA 3Q63A 4Y31A 4JHYA 4N47A 1LN2A 3KAZA 3ELIA 2Q3QA 1FM4A 1E09A 3KDIA 3HJFA 5I9JA 3H3QA 4A87A 5JO1A 3NMNA 4A8VA 2PSOA 3IE5A 4PSBA 2KEWA 2BK0A 2A1LA 3NJ1A 3HK2A 4LGBA 4QDCA 1VJHA 2D4RA 2K5GA 2WQLA 2GKDA 2EJXA 2LCGA 3NMVA 3UIDA 1UW5A 4LA7A 4DS8A 2LIOA 1TW0A 3CNWA 2KTEA 3PUTA 3TL1A 4NCAA 3K3KA 3W9KA 4N41A 1XFSA 3H3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGV A;  1LN1 A;  2LAK A;  2Z9Y A;  4C9I A;  3KLX A;  4JDL A;  1JSS A;  2LGH A;  4B9R A;  4M9B A;  3K90 A;  1T27 A;  1ZXF A;  5AMW A;  3NJO A;  3NEF A;  4A86 A;  3KL1 A;  3RT2 A;  3W9R A;  2I9Y A;  1TXC A;  4REJ A;  4C94 A;  1KCM A;  1T17 A;  2NS9 A;  3OQU A;  3R6P A;  5I8F A;  2PCS A;  2R55 A;  3OTL A;  1XN6 A;  2IL5 A;  3H3T A;  3KB3 A;  4JHH A;  4A8G A;  2K7H A;  1LLT A;  4IH2 A;  4RYV A;  5E4D A;  2L65 A;  1LN3 A;  3E85 A;  2E3P A;  4LGA A;  3KAY A;  4BK7 A;  4A80 A;  5C9Y A;  3P0L A;  4FPW A;  3F08 A;  2FLH A;  3H3R A;  4MA6 A;  2RES A;  4M9W A;  3OH8 A;  4MAP A;  2MOU A;  3NMP A;  2QPV A;  4Q0K A;  3TVQ A;  4A8U A;  3C0V A;  3Q6A A;  4A85 A;  4BTZ A;  4IH0 A;  1BTV A;  2E3M A;  2Z9Z A;  1B6F A;  1IFV A;  4IGW A;  4LG5 A;  4QIP A;  1ICX A;  1BV1 A;  2KCZ A;  4JDA A;  4N3E A;  3JRQ B;  4A81 A;  4BKD A;  3KDJ A;  3IJT A;  4DSC A;  5JNN A;  5E4M A;  2E3S A;  2REZ A;  4N0G C;  4XRW A;  3Q64 A;  3NI8 A;  3NMH A;  2M89 A;  2E3O A;  3NMT A;  3JRS A;  2M47 A;  3GGN A;  2LPX A;  2LDK A;  4Z3L A;  3FO5 A;  1EM2 A;  1FSK A;  4DSB A;  4WVO A;  4REI A;  1XN5 A;  3KB0 A;  3P51 A;  3PU2 A;  4IGY A;  4OIC A;  5BRL A;  4IGX A;  4BKC A;  2N4B A;  2E3N A;  2LF2 A;  1XUV A;  4IHR A;  4GY9 A;  3RD6 A;  3UJL A;  4A83 A;  3OJI A;  3RT0 C;  4REH A;  2E3R A;  1X53 A;  2NN5 A;  2VQ5 A;  4R7K A;  2L9P A;  4MNS A;  3WG8 A;  5JO2 A;  2E3Q A;  4JHG A;  4A84 A;  3NR4 A;  4JHI A;  3QN1 A;  2VNE A;  5E46 A;  2N4A A;  3UQH A;  2QIM A;  3NS2 A;  4BK6 A;  4C9C A;  3TFZ A;  1XDF A;  3P9V A;  2LEQ A;  2KF2 A;  1QMR A;  4A88 A;  2FFS A;  1Z94 A;  2L8O A;  3NJ0 A;  2RER A;  3ZVU A;  5E4B A;  1H2O A;  3NEG A;  2LE1 A;  3QSZ A;  4XRT A;  2LUZ A;  3TVR A;  3Q63 A;  3KDH A;  4Y31 A;  1LN2 A;  3KAZ A;  3ELI A;  2Q3Q A;  1FM4 A;  1E09 A;  3KDI A;  5I9J A;  3H3Q A;  4A87 A;  5JO1 A;  3NMN A;  4A8V A;  2PSO A;  3IE5 A;  4PSB A;  2KEW A;  2BK0 A;  2A1L A;  3NJ1 A;  4LGB A;  1VJH A;  2D4R A;  2K5G A;  2WQL A;  2GKD A;  2EJX A;  2LCG A;  3NMV A;  3UID A;  1UW5 A;  4LA7 A;  4DS8 A;  2LIO A;  1TW0 A;  3CNW A;  2KTE A;  3PUT A;  3TL1 A;  3K3K A;  3W9K A;  1XFS A;  3H3S A; 
#chains in the Genus database with same CATH topology
 4IGV A;  1LN1 A;  2LAK A;  2Z9Y A;  4C9I A;  3KLX A;  4JDL A;  1JSS A;  2LGH A;  4N76 A;  4B9R A;  4M9B A;  3K90 A;  1T27 A;  1ZXF A;  5AMW A;  3NJO A;  3NEF A;  4A86 A;  3KL1 A;  3RT2 A;  4QDF A;  3W9R A;  2I9Y A;  1TXC A;  4REJ A;  3GTS A;  4C94 A;  1KCM A;  1T17 A;  2NS9 A;  3OQU A;  3R6P A;  5I8F A;  5EKQ C;  3GKE A;  2PCS A;  2R55 A;  3OTL A;  1XN6 A;  2IL5 A;  3H3T A;  3KB3 A;  4JHH A;  3DLH A;  4A8G A;  2K7H A;  1LLT A;  4IH2 A;  4RYV A;  5E4D A;  2L65 A;  3HXM A;  1LN3 A;  3E85 A;  2E3P A;  4LGA A;  3KAY A;  4BK7 A;  4A80 A;  5C9Y A;  3P0L A;  4FPW A;  3F08 A;  2FLH A;  3H3R A;  4MA6 A;  2RES A;  4M9W A;  3OH8 A;  4MAP A;  4E6F A;  2MOU A;  3NMP A;  2QPV A;  4Q0K A;  3TVQ A;  2LAF A;  3C0V A;  3GB4 A;  3Q6A A;  4A8U A;  4A85 A;  4BTZ A;  4KPY A;  3HO1 A;  4IH0 A;  1BTV A;  2E3M A;  2Z9Z A;  1B6F A;  1IFV A;  4IGW A;  4LG5 A;  4QIP A;  1ICX A;  1BV1 A;  2KCZ A;  4JDA A;  4N3E A;  3JRQ B;  4A81 A;  4QCK A;  4BKD A;  3KDJ A;  3IJT A;  4DSC A;  5JNN A;  5E4M A;  2E3S A;  2REZ A;  4N0G C;  4XRW A;  3Q64 A;  3NI8 A;  3NMH A;  2M89 A;  2E3O A;  3NMT A;  3JRS A;  2M47 A;  3GGN A;  2LPX A;  2LDK A;  4Z3L A;  3FO5 A;  1EM2 A;  1FSK A;  4DSB A;  4WVO A;  2YH6 A;  4QDF B;  4REI A;  1XN5 A;  3KB0 A;  3P51 A;  3PU2 A;  4IGY A;  4OIC A;  3HM9 A;  5BRL A;  4IGX A;  3F73 A;  4BKC A;  2N4B A;  2E3N A;  2LF2 A;  1XUV A;  4IHR A;  4GY9 A;  3RD6 A;  3UJL A;  4A83 A;  3GOB A;  3OJI A;  3RT0 C;  4REH A;  3DLB A;  2E3R A;  1X53 A;  2NN5 A;  2VQ5 A;  3GL0 A;  2L9P A;  4MNS A;  4R7K A;  3TGO C;  3WG8 A;  5JO2 A;  2E3Q A;  4JHG A;  4A84 A;  3NR4 A;  4JHI A;  3QN1 A;  2VNE A;  5E46 A;  2N4A A;  3NQN A;  3UQH A;  2QIM A;  3NS2 A;  4BK6 A;  4C9C A;  3TFZ A;  4NCB A;  1XDF A;  3P9V A;  2LEQ A;  2KF2 A;  1QMR A;  4A88 A;  3HVR A;  2ZYL A;  2FFS A;  1Z94 A;  2L8O A;  3NJ0 A;  2RER A;  3ZVU A;  5E4B A;  3GL2 A;  1H2O A;  4QDD A;  3NEG A;  2LE1 A;  3QSZ A;  4XRT A;  2LUZ A;  3TVR A;  3GTE A;  3KDH A;  3Q63 A;  4Y31 A;  4JHY A;  4N47 A;  1LN2 A;  3KAZ A;  3ELI A;  2Q3Q A;  1FM4 A;  1E09 A;  3KDI A;  3HJF A;  5I9J A;  3H3Q A;  4A87 A;  5JO1 A;  3NMN A;  4A8V A;  2PSO A;  3IE5 A;  4PSB A;  2KEW A;  2BK0 A;  2A1L A;  3NJ1 A;  3HK2 A;  4LGB A;  4QDC A;  1VJH A;  2D4R A;  2K5G A;  2WQL A;  2GKD A;  2EJX A;  2LCG A;  3NMV A;  3UID A;  1UW5 A;  4LA7 A;  4DS8 A;  2LIO A;  1TW0 A;  3CNW A;  2KTE A;  3PUT A;  3TL1 A;  4NCA A;  3K3K A;  3W9K A;  4N41 A;  1XFS A;  3H3S A; 
#chains in the Genus database with same CATH homology
 4IGV A;  1LN1 A;  2LAK A;  2Z9Y A;  4C9I A;  3KLX A;  4JDL A;  1JSS A;  2LGH A;  4N76 A;  4B9R A;  4M9B A;  3K90 A;  1T27 A;  1ZXF A;  5AMW A;  3NJO A;  3NEF A;  4A86 A;  3KL1 A;  3RT2 A;  4QDF A;  3W9R A;  2I9Y A;  1TXC A;  4REJ A;  3GTS A;  4C94 A;  1KCM A;  1T17 A;  2NS9 A;  3OQU A;  3R6P A;  5I8F A;  5EKQ C;  3GKE A;  2PCS A;  2R55 A;  3OTL A;  1XN6 A;  2IL5 A;  3H3T A;  3KB3 A;  4JHH A;  3DLH A;  4A8G A;  2K7H A;  1LLT A;  4IH2 A;  4RYV A;  5E4D A;  2L65 A;  3HXM A;  1LN3 A;  3E85 A;  2E3P A;  4LGA A;  3KAY A;  4BK7 A;  4A80 A;  5C9Y A;  3P0L A;  4FPW A;  3F08 A;  2FLH A;  3H3R A;  4MA6 A;  2RES A;  4M9W A;  3OH8 A;  4MAP A;  4E6F A;  2MOU A;  3NMP A;  2QPV A;  4Q0K A;  3TVQ A;  2LAF A;  3C0V A;  3GB4 A;  3Q6A A;  4A8U A;  4A85 A;  4BTZ A;  4KPY A;  3HO1 A;  4IH0 A;  1BTV A;  2E3M A;  2Z9Z A;  1B6F A;  1IFV A;  4IGW A;  4LG5 A;  4QIP A;  1ICX A;  1BV1 A;  2KCZ A;  4JDA A;  4N3E A;  3JRQ B;  4A81 A;  4QCK A;  4BKD A;  3KDJ A;  3IJT A;  4DSC A;  5JNN A;  5E4M A;  2E3S A;  2REZ A;  4N0G C;  4XRW A;  3Q64 A;  3NI8 A;  3NMH A;  2M89 A;  2E3O A;  3NMT A;  3JRS A;  2M47 A;  3GGN A;  2LPX A;  2LDK A;  4Z3L A;  3FO5 A;  1EM2 A;  1FSK A;  4DSB A;  4WVO A;  2YH6 A;  4QDF B;  4REI A;  1XN5 A;  3KB0 A;  3P51 A;  3PU2 A;  4IGY A;  4OIC A;  3HM9 A;  5BRL A;  4IGX A;  3F73 A;  4BKC A;  2N4B A;  2E3N A;  2LF2 A;  1XUV A;  4IHR A;  4GY9 A;  3RD6 A;  3UJL A;  4A83 A;  3GOB A;  3OJI A;  3RT0 C;  4REH A;  3DLB A;  2E3R A;  1X53 A;  2NN5 A;  2VQ5 A;  3GL0 A;  2L9P A;  4MNS A;  4R7K A;  3TGO C;  3WG8 A;  5JO2 A;  2E3Q A;  4JHG A;  4A84 A;  3NR4 A;  4JHI A;  3QN1 A;  2VNE A;  5E46 A;  2N4A A;  3NQN A;  3UQH A;  2QIM A;  3NS2 A;  4BK6 A;  4C9C A;  3TFZ A;  4NCB A;  1XDF A;  3P9V A;  2LEQ A;  2KF2 A;  1QMR A;  4A88 A;  3HVR A;  2ZYL A;  2FFS A;  1Z94 A;  2L8O A;  3NJ0 A;  2RER A;  3ZVU A;  5E4B A;  3GL2 A;  1H2O A;  4QDD A;  3NEG A;  2LE1 A;  3QSZ A;  4XRT A;  2LUZ A;  3TVR A;  3GTE A;  3KDH A;  3Q63 A;  4Y31 A;  4JHY A;  4N47 A;  1LN2 A;  3KAZ A;  3ELI A;  2Q3Q A;  1FM4 A;  1E09 A;  3KDI A;  3HJF A;  5I9J A;  3H3Q A;  4A87 A;  5JO1 A;  3NMN A;  4A8V A;  2PSO A;  3IE5 A;  4PSB A;  2KEW A;  2BK0 A;  2A1L A;  3NJ1 A;  3HK2 A;  4LGB A;  4QDC A;  1VJH A;  2D4R A;  2K5G A;  2WQL A;  2GKD A;  2EJX A;  2LCG A;  3NMV A;  3UID A;  1UW5 A;  4LA7 A;  4DS8 A;  2LIO A;  1TW0 A;  3CNW A;  2KTE A;  3PUT A;  3TL1 A;  4NCA A;  3K3K A;  3W9K A;  4N41 A;  1XFS A;  3H3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...