4REJA

Crystal structure of ginseng major latex-like protein 151 (glp) from panax ginseng. (crystal-3)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
149
structure length
148
Chain Sequence
b'GLTGKLICQTGIKSDGDVFHELFGTRPHHVPNITPANIQGCDLHEGEFGKVGSVVIWNYSIDGNAMIAKEEIVAIDEEDKSVTFKVVEGHLFEEFKSIVFSVHVDTKGENLVTWSIDYEKLNESVKDPTSYLDFLLSVTRDIEAHHLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major latex-like protein
publication title Structure of ginseng major latex-like protein 151 and its proposed lysophosphatidic acid-binding mechanism.
pubmed doi rcsb
source organism Panax ginseng
molecule tags Protein binding
total genus 44
structure length 148
sequence length 149
ec nomenclature
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4rejA00
3NMTA 3NEFA 4C9CA 3GGNA 3JRSA 4JHGA 2K5GA 2FFSA 4IH0A 1XN5A 3CNWA 4A8VA 1T27A 3OJIA 4N3EA 5AMWA 4LGAA 3KL1A 3H3QA 3RT2A 3KDHA 4JDLA 4QIPA 1E09A 3P51A 2KTEA 2LUZA 4Q0KA 4LG5A 1H2OA 1JSSA 3RD6A 3NJOA 4LGBA 5JO2A 5JNNA 3IJTA 2LEQA 4LA7A 2KEWA 5E4BA 4A84A 2NN5A 3TVQA 5BRLA 1QMRA 1KCMA 3NJ0A 3TVRA 2LPXA 3NMPA 3NR4A 1T17A 2M89A 3Q64A 1BV1A 3JRQB 3RT0C 2LIOA 3KDIA 2E3RA 1LN1A 2Z9YA 4XRWA 4A8UA 3K90A 2LE1A 4DSCA 4REHA 4A80A 4IGXA 1VJHA 1LN3A 4BKDA 1BTVA 1IFVA 4JHHA 3P0LA 2A1LA 4M9WA 4A88A 2VNEA 3E85A 3NMNA 3H3RA 4Y31A 4BK7A 4REIA 2LF2A 2M47A 4BKCA 4DSBA 3NJ1A 3ELIA 3KAYA 5C9YA 1Z94A 4JHIA 2E3OA 4N0GC 4BTZA 4RYVA 3ZVUA 2E3PA 4A81A 4REJA 2E3SA 5I8FA 3Q6AA 4C94A 2N4AA 2Q3QA 2LDKA 4MNSA 2QPVA 3UQHA 4A83A 2RESA 2VQ5A 2PSOA 2KCZA 2RERA 3PU2A 4IGWA 4Z3LA 2E3QA 4FPWA 2QIMA 2D4RA 3TL1A 3KLXA 1LN2A 2N4BA 4WVOA 2KF2A 2GKDA 3NMHA 4BK6A 1B6FA 3R6PA 3NS2A 4IGYA 2BK0A 5E4MA 4IHRA 1UW5A 4A8GA 3QN1A 1XUVA 1ZXFA 2LCGA 3H3TA 2L65A 1XFSA 3KAZA 1LLTA 2FLHA 1FM4A 3F08A 1XDFA 3OH8A 2E3NA 3TFZA 3NEGA 4A86A 3UIDA 2IL5A 2MOUA 1FSKA 1TXCA 5E46A 3C0VA 3OQUA 4GY9A 1TW0A 2REZA 2NS9A 4MA6A 1XN6A 3W9KA 4MAPA 2WQLA 2LAKA 4IGVA 4OICA 1ICXA 2E3MA 3IE5A 3KB0A 3H3SA 2R55A 3FO5A 3KB3A 4A87A 4DS8A 2I9YA 2PCSA 2K7HA 3KDJA 3P9VA 3PUTA 1X53A 3NMVA 4B9RA 3K3KA 4C9IA 2L9PA 4R7KA 3WG8A 1EM2A 2Z9ZA 4A85A 3OTLA 4M9BA 4IH2A 5I9JA 5JO1A 3UJLA 5E4DA 3NI8A 2EJXA 3QSZA 4PSBA 2L8OA 3W9RA 2LGHA 4XRTA 4JDAA 3Q63A
chains in the Genus database with same CATH superfamily
3NMTA 3NEFA 4C9CA 3GGNA 3JRSA 3NQNA 4JHGA 2K5GA 4E6FA 2FFSA 5EKQC 4IH0A 4QDFA 1XN5A 3CNWA 4A8VA 4NCAA 1T27A 3OJIA 4N3EA 4QCKA 4LGAA 3KL1A 5AMWA 3H3QA 3RT2A 3KDHA 4QDCA 4N41A 4JDLA 4QIPA 1E09A 3P51A 2KTEA 2LUZA 4Q0KA 4LG5A 1H2OA 1JSSA 3RD6A 3NJOA 4LGBA 3GB4A 5JO2A 4N47A 4QDDA 3IJTA 5JNNA 2LEQA 3GL0A 4LA7A 2KEWA 5E4BA 4A84A 2NN5A 3TVQA 5BRLA 1QMRA 1KCMA 3NJ0A 3TVRA 2LPXA 3NMPA 3NR4A 1T17A 2M89A 3Q64A 1BV1A 3JRQB 3RT0C 2LIOA 3KDIA 3HJFA 2E3RA 1LN1A 2Z9YA 4QDFB 4XRWA 4A8UA 3K90A 2LE1A 4DSCA 4REHA 4A80A 3HM9A 4IGXA 1VJHA 1LN3A 4BKDA 1BTVA 1IFVA 4JHHA 3P0LA 2A1LA 3HK2A 4M9WA 4A88A 3GL2A 2VNEA 3E85A 3NMNA 2LAFA 3H3RA 4Y31A 4BK7A 4REIA 2LF2A 2M47A 4BKCA 4DSBA 3GKEA 3NJ1A 3ELIA 3KAYA 5C9YA 1Z94A 4JHIA 2E3OA 4N0GC 4BTZA 4RYVA 3ZVUA 3DLHA 2E3PA 4A81A 4REJA 2E3SA 5I8FA 3Q6AA 4C94A 2N4AA 2Q3QA 2LDKA 4MNSA 2QPVA 3UQHA 4A83A 3HVRA 2RESA 2VQ5A 3HXMA 4NCBA 2PSOA 2KCZA 2RERA 3PU2A 4IGWA 4Z3LA 2E3QA 4FPWA 2QIMA 2D4RA 3TL1A 3KLXA 1LN2A 2N4BA 4WVOA 2KF2A 3TGOC 3NMHA 2GKDA 4BK6A 1B6FA 3R6PA 3NS2A 4IGYA 2BK0A 5E4MA 4IHRA 1UW5A 3DLBA 3GTEA 3QN1A 4A8GA 1XUVA 1ZXFA 2LCGA 3H3TA 2L65A 1XFSA 3KAZA 1LLTA 2FLHA 3HO1A 1FM4A 3F08A 1XDFA 3OH8A 2E3NA 3TFZA 3NEGA 4KPYA 4A86A 3UIDA 2IL5A 2MOUA 4N76A 1FSKA 1TXCA 5E46A 3C0VA 3OQUA 4GY9A 1TW0A 2REZA 4JHYA 2NS9A 4MA6A 1XN6A 3W9KA 2ZYLA 4MAPA 2WQLA 2LAKA 4IGVA 4OICA 1ICXA 2E3MA 3IE5A 3KB0A 3H3SA 2R55A 3FO5A 3KB3A 4A87A 2YH6A 4DS8A 2I9YA 2PCSA 2K7HA 3GOBA 3KDJA 3P9VA 3PUTA 1X53A 3NMVA 4B9RA 3GTSA 3K3KA 4C9IA 2L9PA 4R7KA 3WG8A 1EM2A 2Z9ZA 4A85A 3OTLA 4M9BA 4IH2A 5I9JA 5JO1A 3F73A 3UJLA 5E4DA 3NI8A 2EJXA 3QSZA 4PSBA 2L8OA 3W9RA 2LGHA 4XRTA 4JDAA 3Q63A
chains in the Genus database with same CATH topology
3NMTA 3NEFA 4C9CA 3GGNA 3JRSA 3NQNA 4JHGA 2K5GA 4E6FA 2FFSA 5EKQC 4IH0A 4QDFA 1XN5A 3CNWA 4A8VA 4NCAA 1T27A 3OJIA 4N3EA 4QCKA 4LGAA 3KL1A 5AMWA 3H3QA 3RT2A 3KDHA 4QDCA 4N41A 4JDLA 4QIPA 1E09A 3P51A 2KTEA 2LUZA 4Q0KA 4LG5A 1H2OA 1JSSA 3RD6A 3NJOA 4LGBA 3GB4A 5JO2A 4N47A 4QDDA 3IJTA 5JNNA 2LEQA 3GL0A 4LA7A 2KEWA 5E4BA 4A84A 2NN5A 3TVQA 5BRLA 1QMRA 1KCMA 3NJ0A 3TVRA 2LPXA 3NMPA 3NR4A 1T17A 2M89A 3Q64A 1BV1A 3JRQB 3RT0C 2LIOA 3KDIA 3HJFA 2E3RA 1LN1A 2Z9YA 4QDFB 4XRWA 4A8UA 3K90A 2LE1A 4DSCA 4REHA 4A80A 3HM9A 4IGXA 1VJHA 1LN3A 4BKDA 1BTVA 1IFVA 4JHHA 3P0LA 2A1LA 3HK2A 4M9WA 4A88A 3GL2A 2VNEA 3E85A 3NMNA 2LAFA 3H3RA 4Y31A 4BK7A 4REIA 2LF2A 2M47A 4BKCA 4DSBA 3GKEA 3NJ1A 3ELIA 3KAYA 5C9YA 1Z94A 4JHIA 2E3OA 4N0GC 4BTZA 4RYVA 3ZVUA 3DLHA 2E3PA 4A81A 4REJA 2E3SA 5I8FA 3Q6AA 4C94A 2N4AA 2Q3QA 2LDKA 4MNSA 2QPVA 3UQHA 4A83A 3HVRA 2RESA 2VQ5A 3HXMA 4NCBA 2PSOA 2KCZA 2RERA 3PU2A 4IGWA 4Z3LA 2E3QA 4FPWA 2QIMA 2D4RA 3TL1A 3KLXA 1LN2A 2N4BA 4WVOA 2KF2A 3TGOC 3NMHA 2GKDA 4BK6A 1B6FA 3R6PA 3NS2A 4IGYA 2BK0A 5E4MA 4IHRA 1UW5A 3DLBA 3GTEA 3QN1A 4A8GA 1XUVA 1ZXFA 2LCGA 3H3TA 2L65A 1XFSA 3KAZA 1LLTA 2FLHA 3HO1A 1FM4A 3F08A 1XDFA 3OH8A 2E3NA 3TFZA 3NEGA 4KPYA 4A86A 3UIDA 2IL5A 2MOUA 4N76A 1FSKA 1TXCA 5E46A 3C0VA 3OQUA 4GY9A 1TW0A 2REZA 4JHYA 2NS9A 4MA6A 1XN6A 3W9KA 2ZYLA 4MAPA 2WQLA 2LAKA 4IGVA 4OICA 1ICXA 2E3MA 3IE5A 3KB0A 3H3SA 2R55A 3FO5A 3KB3A 4A87A 2YH6A 4DS8A 2I9YA 2PCSA 2K7HA 3GOBA 3KDJA 3P9VA 3PUTA 1X53A 3NMVA 4B9RA 3GTSA 3K3KA 4C9IA 2L9PA 4R7KA 3WG8A 1EM2A 2Z9ZA 4A85A 3OTLA 4M9BA 4IH2A 5I9JA 5JO1A 3F73A 3UJLA 5E4DA 3NI8A 2EJXA 3QSZA 4PSBA 2L8OA 3W9RA 2LGHA 4XRTA 4JDAA 3Q63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMT A;  3NEF A;  4C9C A;  3GGN A;  3JRS A;  4JHG A;  2K5G A;  2FFS A;  4IH0 A;  1XN5 A;  3CNW A;  4A8V A;  1T27 A;  3OJI A;  4N3E A;  5AMW A;  4LGA A;  3KL1 A;  3H3Q A;  3RT2 A;  3KDH A;  4JDL A;  4QIP A;  1E09 A;  3P51 A;  2KTE A;  2LUZ A;  4Q0K A;  4LG5 A;  1H2O A;  1JSS A;  3RD6 A;  3NJO A;  4LGB A;  5JO2 A;  5JNN A;  3IJT A;  2LEQ A;  4LA7 A;  2KEW A;  5E4B A;  4A84 A;  2NN5 A;  3TVQ A;  5BRL A;  1QMR A;  1KCM A;  3NJ0 A;  3TVR A;  2LPX A;  3NMP A;  3NR4 A;  1T17 A;  2M89 A;  3Q64 A;  1BV1 A;  3JRQ B;  3RT0 C;  2LIO A;  3KDI A;  2E3R A;  1LN1 A;  2Z9Y A;  4XRW A;  4A8U A;  3K90 A;  2LE1 A;  4DSC A;  4REH A;  4A80 A;  4IGX A;  1VJH A;  1LN3 A;  4BKD A;  1BTV A;  1IFV A;  4JHH A;  3P0L A;  2A1L A;  4M9W A;  4A88 A;  2VNE A;  3E85 A;  3NMN A;  3H3R A;  4Y31 A;  4BK7 A;  4REI A;  2LF2 A;  2M47 A;  4BKC A;  4DSB A;  3NJ1 A;  3ELI A;  3KAY A;  5C9Y A;  1Z94 A;  4JHI A;  2E3O A;  4N0G C;  4BTZ A;  4RYV A;  3ZVU A;  2E3P A;  4A81 A;  4REJ A;  2E3S A;  5I8F A;  3Q6A A;  4C94 A;  2N4A A;  2Q3Q A;  2LDK A;  4MNS A;  2QPV A;  3UQH A;  4A83 A;  2RES A;  2VQ5 A;  2PSO A;  2KCZ A;  2RER A;  3PU2 A;  4IGW A;  4Z3L A;  2E3Q A;  4FPW A;  2QIM A;  2D4R A;  3TL1 A;  3KLX A;  1LN2 A;  2N4B A;  4WVO A;  2KF2 A;  2GKD A;  3NMH A;  4BK6 A;  1B6F A;  3R6P A;  3NS2 A;  4IGY A;  2BK0 A;  5E4M A;  4IHR A;  1UW5 A;  4A8G A;  3QN1 A;  1XUV A;  1ZXF A;  2LCG A;  3H3T A;  2L65 A;  1XFS A;  3KAZ A;  1LLT A;  2FLH A;  1FM4 A;  3F08 A;  1XDF A;  3OH8 A;  2E3N A;  3TFZ A;  3NEG A;  4A86 A;  3UID A;  2IL5 A;  2MOU A;  1FSK A;  1TXC A;  5E46 A;  3C0V A;  3OQU A;  4GY9 A;  1TW0 A;  2REZ A;  2NS9 A;  4MA6 A;  1XN6 A;  3W9K A;  4MAP A;  2WQL A;  2LAK A;  4IGV A;  4OIC A;  1ICX A;  2E3M A;  3IE5 A;  3KB0 A;  3H3S A;  2R55 A;  3FO5 A;  3KB3 A;  4A87 A;  4DS8 A;  2I9Y A;  2PCS A;  2K7H A;  3KDJ A;  3P9V A;  3PUT A;  1X53 A;  3NMV A;  4B9R A;  3K3K A;  4C9I A;  2L9P A;  4R7K A;  3WG8 A;  1EM2 A;  2Z9Z A;  4A85 A;  3OTL A;  4M9B A;  4IH2 A;  5I9J A;  5JO1 A;  3UJL A;  5E4D A;  3NI8 A;  2EJX A;  3QSZ A;  4PSB A;  2L8O A;  3W9R A;  2LGH A;  4XRT A;  4JDA A;  3Q63 A; 
#chains in the Genus database with same CATH topology
 3NMT A;  3NEF A;  4C9C A;  3GGN A;  3JRS A;  3NQN A;  4JHG A;  2K5G A;  4E6F A;  2FFS A;  5EKQ C;  4IH0 A;  4QDF A;  1XN5 A;  3CNW A;  4A8V A;  4NCA A;  1T27 A;  3OJI A;  4N3E A;  4QCK A;  4LGA A;  3KL1 A;  5AMW A;  3H3Q A;  3RT2 A;  3KDH A;  4QDC A;  4N41 A;  4JDL A;  4QIP A;  1E09 A;  3P51 A;  2KTE A;  2LUZ A;  4Q0K A;  4LG5 A;  1H2O A;  1JSS A;  3RD6 A;  3NJO A;  4LGB A;  3GB4 A;  5JO2 A;  4N47 A;  4QDD A;  3IJT A;  5JNN A;  2LEQ A;  3GL0 A;  4LA7 A;  2KEW A;  5E4B A;  4A84 A;  2NN5 A;  3TVQ A;  5BRL A;  1QMR A;  1KCM A;  3NJ0 A;  3TVR A;  2LPX A;  3NMP A;  3NR4 A;  1T17 A;  2M89 A;  3Q64 A;  1BV1 A;  3JRQ B;  3RT0 C;  2LIO A;  3KDI A;  3HJF A;  2E3R A;  1LN1 A;  2Z9Y A;  4QDF B;  4XRW A;  4A8U A;  3K90 A;  2LE1 A;  4DSC A;  4REH A;  4A80 A;  3HM9 A;  4IGX A;  1VJH A;  1LN3 A;  4BKD A;  1BTV A;  1IFV A;  4JHH A;  3P0L A;  2A1L A;  3HK2 A;  4M9W A;  4A88 A;  3GL2 A;  2VNE A;  3E85 A;  3NMN A;  2LAF A;  3H3R A;  4Y31 A;  4BK7 A;  4REI A;  2LF2 A;  2M47 A;  4BKC A;  4DSB A;  3GKE A;  3NJ1 A;  3ELI A;  3KAY A;  5C9Y A;  1Z94 A;  4JHI A;  2E3O A;  4N0G C;  4BTZ A;  4RYV A;  3ZVU A;  3DLH A;  2E3P A;  4A81 A;  4REJ A;  2E3S A;  5I8F A;  3Q6A A;  4C94 A;  2N4A A;  2Q3Q A;  2LDK A;  4MNS A;  2QPV A;  3UQH A;  4A83 A;  3HVR A;  2RES A;  2VQ5 A;  3HXM A;  4NCB A;  2PSO A;  2KCZ A;  2RER A;  3PU2 A;  4IGW A;  4Z3L A;  2E3Q A;  4FPW A;  2QIM A;  2D4R A;  3TL1 A;  3KLX A;  1LN2 A;  2N4B A;  4WVO A;  2KF2 A;  3TGO C;  3NMH A;  2GKD A;  4BK6 A;  1B6F A;  3R6P A;  3NS2 A;  4IGY A;  2BK0 A;  5E4M A;  4IHR A;  1UW5 A;  3DLB A;  3GTE A;  3QN1 A;  4A8G A;  1XUV A;  1ZXF A;  2LCG A;  3H3T A;  2L65 A;  1XFS A;  3KAZ A;  1LLT A;  2FLH A;  3HO1 A;  1FM4 A;  3F08 A;  1XDF A;  3OH8 A;  2E3N A;  3TFZ A;  3NEG A;  4KPY A;  4A86 A;  3UID A;  2IL5 A;  2MOU A;  4N76 A;  1FSK A;  1TXC A;  5E46 A;  3C0V A;  3OQU A;  4GY9 A;  1TW0 A;  2REZ A;  4JHY A;  2NS9 A;  4MA6 A;  1XN6 A;  3W9K A;  2ZYL A;  4MAP A;  2WQL A;  2LAK A;  4IGV A;  4OIC A;  1ICX A;  2E3M A;  3IE5 A;  3KB0 A;  3H3S A;  2R55 A;  3FO5 A;  3KB3 A;  4A87 A;  2YH6 A;  4DS8 A;  2I9Y A;  2PCS A;  2K7H A;  3GOB A;  3KDJ A;  3P9V A;  3PUT A;  1X53 A;  3NMV A;  4B9R A;  3GTS A;  3K3K A;  4C9I A;  2L9P A;  4R7K A;  3WG8 A;  1EM2 A;  2Z9Z A;  4A85 A;  3OTL A;  4M9B A;  4IH2 A;  5I9J A;  5JO1 A;  3F73 A;  3UJL A;  5E4D A;  3NI8 A;  2EJX A;  3QSZ A;  4PSB A;  2L8O A;  3W9R A;  2LGH A;  4XRT A;  4JDA A;  3Q63 A; 
#chains in the Genus database with same CATH homology
 3NMT A;  3NEF A;  4C9C A;  3GGN A;  3JRS A;  3NQN A;  4JHG A;  2K5G A;  4E6F A;  2FFS A;  5EKQ C;  4IH0 A;  4QDF A;  1XN5 A;  3CNW A;  4A8V A;  4NCA A;  1T27 A;  3OJI A;  4N3E A;  4QCK A;  4LGA A;  3KL1 A;  5AMW A;  3H3Q A;  3RT2 A;  3KDH A;  4QDC A;  4N41 A;  4JDL A;  4QIP A;  1E09 A;  3P51 A;  2KTE A;  2LUZ A;  4Q0K A;  4LG5 A;  1H2O A;  1JSS A;  3RD6 A;  3NJO A;  4LGB A;  3GB4 A;  5JO2 A;  4N47 A;  4QDD A;  3IJT A;  5JNN A;  2LEQ A;  3GL0 A;  4LA7 A;  2KEW A;  5E4B A;  4A84 A;  2NN5 A;  3TVQ A;  5BRL A;  1QMR A;  1KCM A;  3NJ0 A;  3TVR A;  2LPX A;  3NMP A;  3NR4 A;  1T17 A;  2M89 A;  3Q64 A;  1BV1 A;  3JRQ B;  3RT0 C;  2LIO A;  3KDI A;  3HJF A;  2E3R A;  1LN1 A;  2Z9Y A;  4QDF B;  4XRW A;  4A8U A;  3K90 A;  2LE1 A;  4DSC A;  4REH A;  4A80 A;  3HM9 A;  4IGX A;  1VJH A;  1LN3 A;  4BKD A;  1BTV A;  1IFV A;  4JHH A;  3P0L A;  2A1L A;  3HK2 A;  4M9W A;  4A88 A;  3GL2 A;  2VNE A;  3E85 A;  3NMN A;  2LAF A;  3H3R A;  4Y31 A;  4BK7 A;  4REI A;  2LF2 A;  2M47 A;  4BKC A;  4DSB A;  3GKE A;  3NJ1 A;  3ELI A;  3KAY A;  5C9Y A;  1Z94 A;  4JHI A;  2E3O A;  4N0G C;  4BTZ A;  4RYV A;  3ZVU A;  3DLH A;  2E3P A;  4A81 A;  4REJ A;  2E3S A;  5I8F A;  3Q6A A;  4C94 A;  2N4A A;  2Q3Q A;  2LDK A;  4MNS A;  2QPV A;  3UQH A;  4A83 A;  3HVR A;  2RES A;  2VQ5 A;  3HXM A;  4NCB A;  2PSO A;  2KCZ A;  2RER A;  3PU2 A;  4IGW A;  4Z3L A;  2E3Q A;  4FPW A;  2QIM A;  2D4R A;  3TL1 A;  3KLX A;  1LN2 A;  2N4B A;  4WVO A;  2KF2 A;  3TGO C;  3NMH A;  2GKD A;  4BK6 A;  1B6F A;  3R6P A;  3NS2 A;  4IGY A;  2BK0 A;  5E4M A;  4IHR A;  1UW5 A;  3DLB A;  3GTE A;  3QN1 A;  4A8G A;  1XUV A;  1ZXF A;  2LCG A;  3H3T A;  2L65 A;  1XFS A;  3KAZ A;  1LLT A;  2FLH A;  3HO1 A;  1FM4 A;  3F08 A;  1XDF A;  3OH8 A;  2E3N A;  3TFZ A;  3NEG A;  4KPY A;  4A86 A;  3UID A;  2IL5 A;  2MOU A;  4N76 A;  1FSK A;  1TXC A;  5E46 A;  3C0V A;  3OQU A;  4GY9 A;  1TW0 A;  2REZ A;  4JHY A;  2NS9 A;  4MA6 A;  1XN6 A;  3W9K A;  2ZYL A;  4MAP A;  2WQL A;  2LAK A;  4IGV A;  4OIC A;  1ICX A;  2E3M A;  3IE5 A;  3KB0 A;  3H3S A;  2R55 A;  3FO5 A;  3KB3 A;  4A87 A;  2YH6 A;  4DS8 A;  2I9Y A;  2PCS A;  2K7H A;  3GOB A;  3KDJ A;  3P9V A;  3PUT A;  1X53 A;  3NMV A;  4B9R A;  3GTS A;  3K3K A;  4C9I A;  2L9P A;  4R7K A;  3WG8 A;  1EM2 A;  2Z9Z A;  4A85 A;  3OTL A;  4M9B A;  4IH2 A;  5I9J A;  5JO1 A;  3F73 A;  3UJL A;  5E4D A;  3NI8 A;  2EJX A;  3QSZ A;  4PSB A;  2L8O A;  3W9R A;  2LGH A;  4XRT A;  4JDA A;  3Q63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...