4REOA

Mutant ribosomal protein l1 from thermus thermophilus with threonine 217 replaced by valine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
221
structure length
221
Chain Sequence
b'RALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTVMGPSVRINPHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Protein-RNA affinity of ribosomal protein L1 mutants does not correlate with the number of intermolecular interactions.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 57
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 4reoA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4reoA02
4REOA 1DWUA 3U56A 1U63A 4F9TA 3ZQJA 4QG3A 3TG8A 4QGBA 5DM60 1CJSA 5DM70 1MZPA 3FPNA 1AD2A 4LQ4A 3UMYA 2HW8A 1ZHOA 3U4MA 4DFCB 4QVIA 1I2AA 3QOYA
chains in the Genus database with same CATH superfamily
1YDFA 3WBKA 4XCQA 3PCTA 4AC9A 3FVQA 5KHLB 1SKQA 2C5HA 3GUUA 4BX9A 4KRXA 1CXZA 3S7TA 5JT1A 4FJ1A 3GBSA 1JSZA 3W3AH 1LSUA 2E4YA 2GS9A 4GZ3A 4KXNA 4E13A 5DULA 1FQWA 1E66A 3WLMA 1YFZA 3VR3D 1R12A 4D9JA 1JG2A 2H51A 4KEAA 1OGIA 4TWRA 2J6CA 4UM8B 4X1OA 4DWVA 1Z5WA 3RC7A 4EARA 5FA6A 3ZW9A 3NV9A 2PXAA 3DZ8A 3OY7A 2R47A 4IMRA 2JA1A 1JX6A 4PZZA 1L5QA 2EIXA 4RPJA 4D9EA 4R2WA 5IMSA 4N39A 2WB4A 5ADVA 1MDBA 3ZY4A 1PE0A 1XJ0A 2ENUA 1THTA 4K9NA 2PMWB 4DCTA 1T2DA 1Q21A 4IDOA 3P4YA 1QG2A 3WQSB 2F8TA 4D43A 2VPIA 3N75A 5A5VA 3L79A 5DHAA 1C3OB 4IDFA 4B6FA 2NAPA 3PF9A 4DY6A 3BHJA 3T3HA 3OIYA 4B3RB 3EVBA 2OTCA 2EYQA 3PFNA 2EW2A 3E6AA 3OX4A 3N39C 5AVRA 2JIDA 4CKEB 1L7PA 4YCJA 1PFWA 4RSGA 4PC6A 3GRRA 2QTMA 1R4AA 5AW7A 5FEUA 1M2EA 3CUKA 3WB2A 1YF3A 1YT5A 1EEXB 2XKAA 1LPBB 4QOJA 3AX6A 4TWIA 1E3EA 4BL5A 2ENWA 2R4TA 2DQYA 1E20A 2A1UA 4F5YA 5E0KB 1WCV1 4YRMA 2C9MA 2APJA 1GGHA 1MRZA 4PQRA 2X58A 3II6X 1V3TA 2KLHA 2JIQA 5BN5B 3VPXA 5GJCA 3AHGA 2M2IA 3RSSA 2O57A 1RRPA 3QYPA 5P8WA 2Z3VA 1Z8HA 2V96A 3B36A 3I9KA 4AULA 3ED1A 4ZO9A 2R8PA 2BEVB 4HWTA 4BNIA 4DBLC 3J80A 2BGWA 2UYOA 4JT4A 5TY0A 4CEIB 1VCIA 3OO1A 4Q82A 4NTZA 3ZC3A 3RAJA 3HYRA 1H4QA 4P38A 2FK8A 5D7NA 4TSFD 2G28A 4Q5IA 2PWZA 2Z9BA 3PQDA 3EVCA 1UK9A 3R6GA 2G71A 1LPAB 1LV8A 4KUGA 3MGKA 2FSGA 2X7JA 3RYFA 4KRFA 4M8IA 3IDQA 2DECA 3Q88A 4DR4B 2Z1MA 2O5VA 3GL9A 2BC9A 3VQTA 2WLSA 2PXHA 4F9FA 2DQZA 4LF9B 4I81A 2QAGA 4L7VA 3HRHA 2WILA 2H5LA 1KSJA 2JK1A 4EMTA 1DJOA 1CETA 1PGJA 1WQ3A 3PEWA 1N1EA 2B8TA 5KAMA 4J4TA 2YW2A 4O2AB 4L02A 2C84A 3FXAA 3P2OA 2D1FA 2YFHA 4LDAA 3W9YA 3I92A 2YJZA 3F7OA 1IONA 4Q4AB 4P53A 4EJFA 3HB4X 3IUYA 5K0SA 3DPIA 4L57A 2LGJA 3NV7A 4Q34A 2K6GA 3FB4A 1L5YA 1NYRA 5M3BA 5C31A 3T5BA 1ZUIA 4XA8A 1Q15A 4PZ9A 4FOPA 1Q7CA 4HNGA 1MGPA 2C07A 3X1DA 1DPFA 4ZGWA 3GWGA 2IS1A 4QGSA 1QCCA 2H85A 3DKVA 3OA0A 3EHDA 1J56A 3EC7A 3GFVA 3O83A 4FBGA 3L6CA 1Q3HA 1FFGA 4RAQA 3BQNB 2DH6A 3PLRA 1C1XA 1UODA 3SZLA 3EPLA 2ZT6A 1SCQA 2DGDA 4LQ4A 3UMYA 3CRNA 5FBWB 2AUMA 5K03A 3MGBA 3KETA 1T1JA 2Q5JA 2ZDGA 3T7TA 2GBLC 3ABIA 3HL0A 3NRJA 1ZHOA 3C1OA 2VJMB 4LCEA 2IEYA 2C3OA 4KUEA 5TVGA 5K3EA 2JBWA 1IY8A 2C98A 2CC2A 3R3YA 4RE6A 4B8YA 3HB9A 4PFQA 1YL5A 3BBPA 4KP7A 4R6WA 2E85A 1YA4A 3NZEA 4GLOA 3FCUB 3VR4A 2UZ4A 1KARA 4YPFA 4ZCTA 3MUNA 3TS1A 3DR3A 1KMMA 2OO3A 3QUAA 2AEMA 3HZRA 3TQQA 3JYOA 4R83A 5L7YA 1UANA 3G0BA 2WPDD 3ONNA 3LPDA 5J43A 3OBBA 4Z9YA 3EQ8A 3QKRB 4ES6A 1HTTA 2YRXA 3GN1A 2HWUA 3AWIA 4A5OA 5DE3A 2D7CA 4R7ZA 3BRSA 1VPLA 1KEEB 3K2BA 4KN8A 5LYJA 1ESDA 4P4LA 2VJPA 3E61A 3PJFA 2XYPA 4YRZA 1K3UB 3HGTA 1YS1X 5BSMA 4EB6A 5L3SA 4PLGA 5IP5A 4QQ8A 4ZOLF 4F9EA 1LRLA 2PZGA 3PNSA 4LDNA 1CP3A 1XTTA 3IB3A 2YASA 3BIJA 3RF6A 2HSDA 3RVKA 2XSZD 1DQYA 2CB9A 4JVNA 4I46A 3A06A 1A76A 4QU8A 4A10A 5IKEA 2ZRNA 3C87A 2J4DA 4R16A 4DMCA 1A72A 1I5RA 1XA3A 1OC2A 2XVAA 3DMNA 4Y2VA 4E51A 5CDSA 1CDOA 2AJBA 3DMTC 3PP8A 3PSHA 3AC0A 3RH0A 2R8ZA 2F00A 3QHAA 3TSCA 3CH5A 5C51B 4DA4A 2YZMA 3CU5A 1V11B 4K3VA 4WFIA 3S2FA 3OECA 3QUQA 1EU1A 4JOQA 3VRHA 4YAWA 3NCHA 1DAFA 4DCCA 5JS1A 2E5LB 3MQ2A 3EQ9A 2ODNA 1PCXA 1QYVA 2CFIA 1MJNA 4RPCA 4NEHB 5F51A 3AOEC 4C0KA 2WB2A 4HQ0A 4J6FA 2VBGA 5F2EA 4QFBA 4QBHA 4DSOA 1V45E 3ETNA 1L3BA 2VZ8A 4BB6A 4O29A 4IGIA 4YRNA 1CNEA 4AG6A 5BUCA 3OKCA 1NBOA 3KZVA 1EWQA 1ZD2P 2MWMA 4MO2A 4AF8A 3PGLA 3MMNA 1E2DA 5K0LA 2CBZA 4Y2QA 1NBWB 3JYQA 1HQYE 3EH2A 3H16A 3K5HA 3KS9A 1C3XA 1SZCA 4LWPA 2TMYA 2C2BA 2QTRA 9MHTA 3DMYA 4DR1B 3MWDA 4YLGA 3LCMA 4L5AA 4ZCIA 4HG2A 4GBGA 2WJ4A 2VTDA 1W4BA 4JI1B 1Y9AA 5LKRA 3UUGA 5J1SB 3ACBA 2FW9A 2GBIA 3ISJA 5DX0A 5GOZA 1SCAA 2ZB2A 4D96A 4BQIA 2WP0A 3G2HA 3HI6A 2K87A 2NX2A 3D8BA 1KP3A 1BVYF 3DDZX 3IRUA 1GRNA 4PANA 4L8FA 5ERGB 4D9CA 1OR8A 2OGTA 3EUFA 3IELA 2ZOSA 3K1AB 4NX2A 4RQAA 4CTJA 2P62A 4J43A 1R6XA 2P6OA 1NU6A 1JH8A 1RXIA 1W76A 2Q29A 2QL9A 3C4VA 4G25A 2JGIA 1SU7A 1ZOLA 3M6FA 4D2IA 4WBNA 1QP0A 1W5FA 2QTBA 1NG1A 1MB9A 4GMXA 2HTFA 3U37A 4KSYA 1ECPA 5JZOA 2UVQA 2HUPA 5FPTA 1XMJA 2Q1XA 1LTHR 1NZDA 3L18A 4LTMA 5A4AA 5ITZB 5KB3A 3BDAA 1OWMA 2GF0A 1NPDA 1BXNI 2GZ2A 4OKSA 1ESCA 1JSXA 1Y7LA 1TZMA 2BFCB 3LECA 3P2JA 4P86A 3UWDA 4C0XA 4TOIA 3KXDA 5E1DA 5G1PA 3WZ2A 2OO7A 1PFVA 2QEQA 2UUOA 4RHYA 4M0DA 5ALIA 2QRUA 3RJTA 1Y3FE 2BWJA 1Q14A 3AG6A 3COSA 5JMTA 3S55A 3OWOA 2O8EB 4Z5XA 4NEGA 3VO8A 1L5WA 4JLSA 4MQBA 5K0CA 4ROTA 1D0SA 1J8YF 1R5JA 1XJCA 2OD7A 5C5IA 3EXEB 2ZYDA 2CT8A 1WMFA 4B80A 3B9PA 3K0CA 4QDUA 3W5CA 5KC8A 3HDGA 1W88B 4GQIA 4R31A 4C2BA 1X70A 3K4HA 4N01A 1TM5E 3W2TA 5C1DA 1TF7A 4B2PA 3AY6A 5B53A 2J0UA 3ROEA 5J59A 7ADHA 1U11A 1FTWA 1MG5A 5GZ6A 4C03A 4UQPA 4CDRA 5B7PA 2IGTA 3GFQA 1L4BA 1VIVA 2H9YA 5DOZA 1M0EA 2O8VA 2JLRA 3HU1A 4GT1A 2C95A 2BFBB 1N92A 1WVGA 3FI0A 3VAYA 5K99A 1E9VA 4NFYA 5ISMA 1QTNA 5DPMA 1Z4IA 3FLMA 2C3YA 3PC3A 2BFOA 4GPZA 2EGGA 5KX5A 1CUCA 2V8OA 2XEXA 1P31A 1KO4A 3KUUA 4HVTA 2J7PA 3N0VA 4D26A 4MW9A 1MIHA 3S1SA 1AUPA 4R2IA 1MAVA 1CUWA 1R6VA 3SXJA 3JZFA 3K31A 2FR0A 1TCAA 4JU9A 1GV1A 4RXTA 3ZZ0A 4FMCB 4YPOA 3R24A 4U7DA 5ITSA 2C8JA 4DEXA 2LUOA 3L7CA 2BMVA 1E0KA 3ZDZB 3AR6A 3HKEB 1JQDA 2P91A 4HMQA 4YMIA 1WDKA 3IOCA 4KPUB 1IXZA 1RYHA 4TT3A 4PONA 4UU1A 4U9IS 4UATA 3V8VA 2IVZA 1LW7A 3LHSA 4MA5A 4QOHA 3TD2A 2IBTA 1S01A 4RLSA 3UK0A 1QQ7A 3E7XA 1MZVA 2HZBA 4NZOA 2CNNA 1GRRA 1P0FA 4JBYA 2Q6VA 3PC8C 1R8XA 4DC0A 3C4QA 4ZTZB 1XVVA 4C06A 3HWRA 4FNMA 2VHYA 1FYEA 3HK2A 4IWXA 2Q3EA 3R0IA 1YKFA 5C37A 1JPVA 1K3FA 1ISMA 1T5OA 1OKKA 2GRJA 4OV6B 3LG2A 1WZEA 4MJXA 4WOJA 3GPLA 3IQIX 4WCFB 4DV1B 5KTTA 1C8VB 1V16B 3A1SA 3NNDA 1D7OA 3VI3B 3VU0A 4DBLE 1UBCA 3JAWB 1CSEE 3TO5A 3GJQA 4NNJA 3FKJA 2ZJFA 1VSUA 2ZIUB 2I7CA 3L3BA 4XQ0A 4YI5A 1NI3A 4D92A 4D9MA 5J2TA 1QIFA 2FW6A 5ILOA 5GONB 3BMOA 1PI3A 3E70C 1SCKA 1FXWA 4UPDA 5B4UA 3HU2A 4MRAA 1UJBA 3L46A 4GM1A 4AVYA 1GTG1 3UTDA 2TMDA 4XPIA 2X8JA 2WWRA 3OFKA 3J81k 3UAYA 1OLOA 1TYEB 3BIWA 1TM3E 3LX4A 3MB5A 1VKRA 1VJTA 4TTPA 5IYZF 1TQ6A 3GLUA 4JT8A 4RW0A 4EG6A 1H1DA 4LECA 5IDVA 2HOQA 4IV0A 1E79A 1XEAA 3GHHA 2ZUDA 2NGRA 3QFFA 1IWPB 1ABFA 4ME6A 3S5UA 3ZU3A 2C7PA 2HPAA 3DBIA 4Q9NA 3OE7D 3T4UA 3EVNA 1ZC3A 2HH9A 1UPFA 3MS4A 2GTIA 2NAFA 3QHPA 4OYRA 3UA4A 1NI4A 2ZWVA 2W00A 3IAS1 4GLLA 1VZ2A 5EJGA 4EKDA 5CFZA 3LKBA 3OE1A 1NXWA 2B8WA 1SY7A 4XDZA 2X19A 3FYTA 3ZWVA 3AHDA 4PZAA 4EOGA 3HKDB 4LYJA 1OZGA 3ZGYA 2FFRA 1NDUA 3UMMA 3G23A 3IIJA 3TZQA 3OE5A 3GFOA 2GEJA 3CF4G 3PNVA 4X24A 3GT0A 1HY3A 1O94D 1CERA 2OHHA 3JZIA 1L5KA 2NMVA 1SHZA 3NETA 1X87A 1USGA 3F96A 3H3FA 3IQDB 4XM1A 2XOKA 4DJTA 4Q19A 4R8KA 2ZRMA 1RCOC 1CQZA 2CLDX 3KYDA 4WNAA 1X0XA 1DCTA 4G0WA 3UAGA 4FYIA 4MDEA 4BMYA 4CEJB 1JXMA 3ZWPA 2FZWA 4UHBA 2EHDA 2HMAA 2RFLA 2EERA 1FFSA 3R09A 2NXWA 2X3YA 3AWDA 2Q2WA 4XZ3A 3R7NA 5LFAA 2CLMB 1A5AB 1PJAA 3FCEA 3FIUA 3HMKA 3VKUA 4P31A 3VZPA 4F04A 3K6RA 4PCVA 3D1VA 2WNSA 4JLNA 3ZYZA 1AXRA 3FGZA 2C1EA 4X54A 3STHA 3B3FA 3DWGA 4LQLA 2XTJA 2Q9CA 3AP2A 4W82A 1FNMA 3B1KA 5FV4A 3GGPA 3N07A 1GD1O 3GARA 4M8LA 4UULA 5LPNA 4O6VA 2JW5A 3MD9A 1YB1A 1GCGA 2GZHA 5LA6B 2Z3WA 3L40A 4FFLA 2G07A 2HF9A 4OHCA 1TFUA 3KWFA 1RQNA 5GAJA 3VPAA 5IJ9B 5EZ5A 5EC8A 1W73A 2GDJA 2HADA 1ULTA 3GEEA 3C5CA 5H8WA 4IM7A 4BUCA 1PK9A 3C6MA 3H5NA 3P9YA 3IEVA 2OCGA 2JFFA 2VTVA 3IEIA 1R27A 2MYTA 2P9YA 5DHQA 2FPPA 1GA4A 5BN4A 3DWEX 3PEVA 3OIDA 1H4VB 2GCPA 4F45A 3DAPA 4BB0A 3A2KA 2XWPA 4YJ2F 4L73A 4X7MA 4R3NA 3U5TA 3R9XA 5K3SA 1PTJA 4U5QA 1ZITA 3ZWYA 3RYTC 3ER9A 4GZ6A 3TX2A 3OPYB 5HGXA 2CWDA 3USCS 4QPNA 3UM9A 3ZBUA 4DBZA 1BXZA 2B36A 1IVSA 1BJKA 4AUKA 1AS0A 1PYOA 3DFUA 3HCAA 2AFHB 3KJZA 4MA4A 4DZRA 2JGRA 4YRKA 2P27A 3H84A 5AOBA 1P7YA 1TQ8A 2ZUCA 3M89A 2NSJA 1VM6A 3P2KA 3R0ZA 4WY8A 1YZYA 5L95A 5JG7A 1BEUB 5ALXA 3ZZNA 4UAVA 4GGOA 3IODA 5COQA 5G4LA 3UAWA 3GFBA 5FFMA 4A0QA 3HYNA 1NW7A 3H97A 4K03A 5BMVB 4XGQA 2QZ4A 3SNHA 3MHPA 5LXTF 1LV7A 2CDCA 3JASB 5KKNB 4IUDS 5EJ5A 3ONWA 4F4UA 4UPVA 1UF9A 3C3JA 1PJ3A 2YY6A 4A2CA 2WWXA 3OQOA 4MQFB 4U2KA 1D2RA 3WNQA 3V3TA 1G59A 3OZWA 4D0RA 3KB1A 4LEIA 1X77A 5JLJA 4GOLD 4Z9XA 5DDIP 4D9NA 3PE3A 1VXRA 1FFHA 1JBKA 1YHZA 1O6GA 3AEXA 3MCUA 1WABA 3BCHA 3KCQA 4ZMBA 4MB0A 3E2IA 2E4UA 2Q46A 3CTPA 5EIOA 4ZVRA 5THKA 4BJ1A 3FCOA 4P58A 4IJVA 1X1SA 2EX0A 4KK3A 5LIPA 3RUPA 2QX9A 5L4NA 1KETA 2G7MC 4UXIA 3GLIE 4QM6A 1QK5A 3T41A 2Y1WA 3DFZA 4RHEA 1LKZA 3I6IA 5KDLA 4N5DA 1YUMA 1ARZA 1B0UA 3VDNB 4TRRA 4NR0A 3A6JA 1BVHA 2EFGA 1NUPA 2IZ6A 2Y9PB 3WLSA 2A3RA 4CCYA 2FN7A 5JYDA 5CIYA 3B9BA 2ZBFA 3B6ZA 3I2KA 3CEHA 2E4ZA 4FVTA 3O82A 4NCKA 4ZYZA 7REQA 3R5SA 4MV3A 3R7DA 3W5HA 4UFNA 3DBOB 5ENDA 4CGZA 1K8ZB 2XMBA 2FDRA 1ZGCA 3RROA 1X7DA 4DQ0A 4IQGA 3RUDA 3LYLA 1YAJA 2CCKA 1ISHA 2AMVA 4GDMA 4E94A 1FLAA 4DARA 1TTTA 4EG4A 2BVNA 4BLSA 1FXSA 4JFAA 3T35A 5BQFA 2G1JA 2WR8A 3KJEA 3KUDA 1PR1A 4IKEA 4MV7A 4TLDA 3SDZA 1GSHA 1ACLA 3SKVA 1NQ5A 1Y7IA 1DKPA 3HP1A 4WGFA 1YAHA 2BKAA 2XQJA 5AJHA 1I0ZA 821PA 1GDTA 3SIRA 4C2TA 1NVDA 4DUZB 1ONBA 4LRSB 3SYKA 1Q0HA 1CBUA 1PUIA 3WLNA 4DA7A 2V6AI 2PR7A 2JLXA 2BGRA 1A1VA 2Q8QA 1BHJA 4LCJA 4L5JA 5DIZA 2QJOA 4MLPA 1C0LA 2FP4B 2GM9A 2VUHB 2YYAA 3L6EA 4W9NC 4KH1A 3U7HB 1ISSA 2IIQA 2NQTA 1RBMA 2ZRAA 3FRHA 4TS4A 1HG0A 3IA2A 1QU3A 3N7TA 1IC6A 5FX2A 1HDGO 1OMOA 2OHGA 3FPKA 3KKKA 5T3YA 1ZUNB 3IDAA 4ZT5A 3H5IA 4Y9UA 5SY6A 3A6GA 1OZHA 1WIWA 4L8GA 1EEHA 2IPMA 2PRYA 4PX2A 1GDHA 3MCZA 2QZ9A 5EXSA 3REQA 3TSAA 2F43A 1GPAA 4BWVA 3NONA 1QYRA 2FPUA 4EGSA 3N8HA 5FHRA 1GPJA 3RADC 4N40A 2ALJA 4O4LB 4QQFA 5CMLA 3LQQA 4L76A 5AKGA 4V1CB 3QH4A 4ZP1A 4AT1A 2XRYA 3T5CA 4Y2RA 3FCSB 4IF4A 4L8WB 3UWOA 1KEVA 3FHJA 2HRBA 2RH9B 1NQAO 2WYVA 1MNQA 4HN9A 1WMDA 4I9FA 4JLMA 5CLFA 3LUAA 1A04A 1TJ3A 2DWCA 1QNLA 2ZRDA 3E7DA 1G3MA 3PQ3A 1A7KA 2B5OA 1JS1X 1Z5VA 2R8YA 2VSFA 1FTSA 3AHFA 4K9RA 3FFAA 4RXUA 3GH1A 1IZ9A 1E4EA 3IE2A 4R01A 1SM4A 3JVDA 3ITKA 5ALUA 2XDAA 5A5GA 3EVGA 5JQWA 1ZM9A 5BURA 5FOUA 3TKYA 4EHBA 4Y2HA 2Y1GA 1L5ZA 2QMYA 1RYMA 5A1TA 4UHJA 3QVSA 3R6TA 3ENNA 4N76A 1ZJWA 3GRKA 3NJRA 3MGAA 1XKTA 1XZFA 3WLEA 3GZNA 3TR5A 4BAUA 3FNIA 2JD1A 1PQWA 4LC1A 1EX6A 1FFEA 3GGSA 4I9HA 2DHQA 5EXEA 2XDQB 1QG4A 1V47A 2FMFA 3G0CA 3QK7A 3R5FA 1YK0A 2ONCA 2X0FA 4M98A 5JD6A 5BVHB 1H3EA 3RVDA 4V0MA 4TYYA 4O8ZA 4X1IA 3E8MA 1CLUA 4LYYA 3REFA 1XU7A 3SHQA 3ESYA 4DV7B 4UHHA 4ZZ2A 4PBSA 1ZG3A 3D1JA 1BXKA 3HTXA 3WK4A 1OXBB 2V63I 1YE3A 4Q4HB 1Z5OA 4OHFA 2Z1NA 3QE0A 4FJ0A 2AOXA 3A3YA 4G84A 2OXIA 5KBYA 2DBVO 3FUUA 4PF1A 1QFSA 3ZE6A 3ZJ5A 4F4DA 1T9BA 5U9CA 1MJHA 2DQKA 1GITA 4XQGA 3JQBA 1WCIB 3WFIA 1BGWA 5C53B 3IT3A 4IEIA 5D3QA 4I4CA 4B3TB 5LB2A 1Q3TA 2VCHA 1G60A 2FMKA 2F3UA 2D6FA 1G64A 2AZMA 3QRWA 3AT1A 4EBBA 2C94A 2VP5A 1WXIA 2PS9A 3ECCA 3OOSA 2W2VA 1XZEA 2XQGA 4R1LA 4YV7A 4JBIA 1O5TA 4N82A 3ROFA 1ZQ9A 2FZVA 2XMSA 1ODFA 5HFNA 3ZIDA 1U6JA 4KAXA 5IT5A 2J0QA 3I9V6 4MS4A 3QVMA 3WLIA 2RBEA 3EARA 4N4AA 1RD4A 1E9RA 2OB2A 2GAIA 3FSEA 3KJHA 4GOXA 4P7JA 1G2PA 4BN0A 2IYQA 4D0GA 1KGSA 5HG0A 4V0RA 2DR3A 3DYBA 3QU4A 4I8XA 4NMHA 3FKSD 4PXSA 5I4KA 3NEPX 3RVMA 2QG6A 1O0BA 3NBFA 4L6AA 2GX6A 4RSRA 1HYHA 1OBOA 2ZYTX 3H5TA 2J7KA 4AZWA 2LIPA 2QW0X 3J7AC 4WEQA 4EFDA 4EO9A 1LA2A 1QH8B 1RAFA 3E8SA 4HLCA 3RJ5A 3N0XA 4K2HA 5GMOA 3SAJA 1OLSA 5LJLA 3F3SA 4KVAA 3PTZA 4P32A 4KMRA 4AYXA 2EKLA 4ZODA 1P80A 4B74A 1XLTC 3SY8A 3NDPA 1L7MA 4QPCA 1AU9A 5AVVA 2XCSB 3IPLA 1EBBA 3REGA 1XLUA 1YI1A 3AVPA 1YCFA 2QLNA 3WRYC 1LZLA 3DJYA 3F0TA 3MSCA 4L5IA 5IT0A 4WECA 1JECA 2Y4NA 3BC1A 1GYRA 3JD3A 1R15A 4D3YA 4D8TA 1HETA 1EFHA 1AHIA 1BXGB 3R23A 1GZHB 4WLFA 1V95A 4GX5A 2JCYA 2OLJA 5JDIA 4HQNA 5KIAA 3SE7A 2AI3A 4AWAA 5IX8A 1SKBA 4OQFA 5GM1A 2JRCA 3QWBA 4ABYA 3O26A 2XT9A 3HHEA 3TTWA 4CM4A 2OXEA 1ZNQO 2FEMA 1B3BA 2FUKA 2YRFA 2AG1A 1M33A 3MS7A 5CM2Z 2NUAA 2XVXA 3UG6A 2GPBA 2PSSA 2ORED 2Q4RA 1MHPA 5D3MB 4MVWA 4KWHA 1A8IA 5A05A 4QAQA 4B3SB 2YINC 3KU4A 1PVOA 1G5FA 1N4AA 4FR2A 4DMHA 1Q6YA 2A84A 4GPIB 2C0CA 4IWYA 4MZXA 3GLQA 5K3DA 3GNTA 5BSUA 3RNOA 5JMOA 1WG8A 4RTPA 3AM3A 4AZ0B 3Q5EA 3ESRA 3IDOA 1IJEA 4N7BA 2O4UX 1UMCA 1Z2DA 1KI6A 2OYRA 1UXHA 3DCNA 4WX2B 1OX4B 3SYMA 4DDWA 2DHCA 3K6SA 4H4EA 3G5UA 4PR3A 2H3EA 1HOTA 2YX1A 4FW9A 4Y6GB 5IC5A 1VYTA 2YNMA 4RTOA 4PNZA 5FOVA 3K6JA 3SJBA 2XRZA 3N76A 3W3ZB 2G9UA 3QEMA 4AJLA 5GGXA 5JQGB 3CX3A 2JFNA 2HNKA 4A2QA 1GXSA 2JFPA 1T9ZA 3CUUA 3LO8A 1M6WA 1X1RA 4MVJD 4QUDA 2I4IA 3D43A 1XDWA 1VB3A 2IYUA 3NAGA 3KXLA 1H65A 1DINA 2PPLA 1UXGA 1YONA 2ZE7A 3CN7A 2AA3A 1K4MA 3DE3X 1G6Q1 3KX2A 2BE9A 2IE0A 3OM9A 4JR2A 4URFA 5K09A 4UVIA 3DZKA 2CLFB 4YCBA 1JPJA 2O7RA 1VTKA 2OG2A 1J24A 4MRRA 4R84A 4KOEC 3SF0A 2JH8A 3OFSA 3GAAA 4MUGA 1MX9A 1TOAA 3UMRA 1V0JA 4RVCA 1WY7A 4S2EA 5HIKA 4JGIA 3LO5A 1U9YA 4A82A 1CULC 1XPRA 5A9SB 3OEYA 2C4TA 3FMGA 4F9GA 1Z5NA 1ADCA 3HY3A 1EUCB 1W4ZA 1ZHHA 4EB0A 3JS5A 1N9ZA 1GPDG 4X1YB 3SBOA 2Q2VA 2P2ZA 2W8BB 4ZQIA 3QLUA 2HA7A 1G8FA 1PR6A 2V54A 1ZX1A 1YCGA 2YUTA 5GV7A 1KK3A 1FU8A 2QY9A 4K9QA 4PYLA 4X8LA 4A7PA 2RHJA 3M5CA 4LZNA 1F9EA 5I9MA 1IUOA 2G63A 3A3OA 2RG7A 4JL8A 4E5NA 1YU9A 4ZC1A 1AV6A 1L7NA 2GAOA 4OFWA 4D0SA 4JGGA 4K9LA 1NRJB 3RABA 1R5BA 4ENTA 3T4XA 4JP2A 2XYRA 5G4KA 2XADA 2UZ1A 3VU9A 5ALGA 2EV9A 1EWRA 1X7XA 3MJ4A 4IX1A 4MR8B 3KPUA 3R7LA 4WKGA 3TI9A 4UTVA 4RANA 2B2CA 3VPGA 4DT1A 2PRKA 2PNJA 1W5EA 4BV2A 2H2FA 1UM9A 1MX5A 3LFTA 2OV6A 2W6QA 1YL6A 2V4ZA 1DU4A 4N5LA 4BFUA 1OFHA 3O8LA 4YAFA 1SG9A 5FPKA 4H18A 3SICE 3HJAA 3F49S 4X64B 2JGLA 2ONYA 2W2LD 1W59A 4EB8A 4Z4FA 1M67A 1ZH0A 5CVTA 1TZBA 4IHJB 4L2IA 1H1LA 1W0JA 4OUDB 1P5FA 4Z7QB 1N2GA 1K8RA 2O8NA 2PZ8A 1YZKA 3HWX1 1HDXA 4PLZA 3O2SB 1WD5A 1M6NA 3I9JA 3GEBA 4HUQA 4JMLA 4B35A 1MW8X 3QBDA 5JMWA 1EIZA 2XIJA 2V9CA 3EGDB 4ISCA 4WFJA 1T4GA 2V6IA 1E2JA 1UQUA 5K45A 1VOTA 1I2BA 2BI7A 3BHIA 1EFUA 5CA1A 4Q66C 3CSUA 1R3UA 2YOFA 3I1JA 3OEHD 1F0PA 2BCJQ 1YZVA 5DYYA 4AP6A 5IJ0A 3S6JA 1O57A 5EIHA 1G6HA 2SCUA 4LRUA 2XBLA 2H4FA 3DMHA 1M75A 1XKXA 2JZCA 4BBAA 3K2QA 3VSCA 3X3HA 4Y6OA 4DA6A 2G70A 1K4KA 1BW9A 2XUAA 4O4HF 3OPYI 3ZCXA 5EKDA 1TJ4A 4HN4B 5B58C 4GVLA 1FXWF 3OT5A 1E9EA 2GYYA 2WD8A 4NZPA 2I8CA 4LF6B 3W6NA 2QTGA 2HUNA 2FG7C 2BI4A 2GO1A 1T3ZA 1PDVA 3L05A 3GLHB 2OOSA 1X8LA 5C1PA 2BFDA 5DX8A 1T6ZA 5IS2A 1N34B 3DAYA 3G7NA 3RASA 4QXQA 3IEPA 5B64A 2ZJ4A 3PQEA 2CXPA 1EE9A 3CPSA 4NCJA 1KOFA 3PGJA 1OOEA 2RCNA 4RTQA 4NBWA 4XWGA 2FW0A 4JSRA 3WL7A 4AMZA 2F1KA 1O03A 2PLNA 2KBFA 2X86A 2AJ8A 1SA0A 1DG9A 1OILA 2GVDC 4JQYA 4GLFA 4LMAA 4O5AA 4TVKA 3T5GA 3T3NA 2JJ2A 2I4OA 2X40A 4I1SA 1Z88A 3FNRA 3PVSA 4LUCA 5HIIA 2AKAB 5BWNA 5J4KA 2ZRLA 1QG0A 5DCWA 3WGGA 5D3ZA 3I1FA 1M2HA 2DHRA 5DH9A 4ZXPA 2RK6A 4YHBA 3RK1A 4D7AA 1T5HX 1FDRA 3N6RA 3OP1A 5B3AA 5DGIA 4B6PA 4DDTA 3SBDA 4DIOA 3GB9A 4R2XA 1GLNA 4EKYA 2JGAA 1BWPA 5HKKA 2VRBA 2PZLA 4NBRA 4QXMA 2AQIA 3EC1A 1GEEA 1AS3A 2W6ZA 2LE0A 4HNTA 1VSQA 4QRDA 3TOCA 2PJRA 4KE6A 1OC4A 5ALSA 1OLXA 1PWHA 3ESZA 2FZ4A 3I9NA 3OZBA 4ZKDA 5JYEA 2QRQA 1F0KA 2MYPA 1UC8A 3P96A 4NHOA 1N0HA 3EFOA 4WFQA 3LP5A 3ZHSA 2QP3A 4QULA 5JTTA 4NJEB 4J0GA 2BGLA 5DV9A 3NALA 1WXHA 4HEJA 1JL3A 1NV8A 4NV0A 5IKOA 3D0QA 4Q3LA 2IZ7A 4EMBA 1NE2A 1UBTS 4ZU1X 2WVJA 3AF4A 1EX1A 3EAFA 3LGSA 3IHTA 4LC0A 5AKXA 4J1QA 4AJ4A 4KOAA 1A3CA 1KYXA 5E8RA 3T1QA 1BWSA 2XQFA 5TEVA 3CNOA 3TLXA 3B9RA 3WYBA 3L0YA 4GC5A 1NATA 4MB2A 1A2KC 1CQIB 5J4HA 5JS6A 2NVUA 4F21A 2C59A 1PT7A 2O2EA 4XX0A 1SC9A 1AKMA 5EUBA 2NT4A 2Q3JA 1XAJA 1FW6A 1U7XA 2QLLA 1J4AA 2CFCA 1XF1A 4FD3A 2IZ0A 4H7HA 2FXIA 2IV3A 1WMBA 2R8OA 5TEWA 5JATA 4FGSA 5G1NA 1FZQA 4LV6A 2GB4A 2OE2A 4BPBA 1OXKB 1SUPA 4M1WA 3UHOA 2O19A 3DEAA 2CNOA 2V74B 3WNZA 4LJ5A 3PITA 4Y1RB 3FB1A 4EVQA 3OIFA 1KDRA 1TW2A 1J22A 1KKMA 4MR7B 2AXEA 2XB9A 3JX9A 4I9NA 4N18A 2Q1UA 2VRCA 2VBIA 3C3XA 1KWKA 2ZM5A 1NVFA 4QATA 1SJ9A 1E1YA 2JAXA 3SX2A 4J0DA 4E4RA 2R4QA 4LZZA 5LLSA 1F14A 1KEPA 1FDSA 4V1CI 4CQLB 2P0AA 4JI0B 1B4DA 1MB3A 3C70A 1Y9EA 2Z09A 3JQAD 3L0BA 1BMFD 1OT3A 4BNYA 1JHUA 3ESXA 3NC0C 5FOSA 4CQNA 3ZWCA 2YQZA 3ICEA 4B76A 2QX6A 3C5EA 1COZA 1XRNA 4YP5A 4R7TA 1PW5A 1PQ4A 4UU8A 1PV1A 3MLAA 1GUBA 4XW2A 4Y30A 2NV0A 1W36C 5DHRA 1JH9A 2I55A 3ORSA 2OUIA 2BMEA 4MLCA 1ZVVA 3UJ8A 5ICGA 2C82A 4M7PA 4ZPJA 4RNCA 1OVMA 4Q1AA 4WOKA 1LX6A 5EAIA 5FUVA 2PUTA 4D9BA 4EZIA 1EGQA 2WUDA 1E6CA 2H48A 1PNTA 5TS3A 3TBFA 3U56A 1RE1A 2J3JA 2XUGA 3UJAA 3VO9A 4B73A 5ERYA 4YUXA 4QJ3A 3P19A 2Z2ZA 4HYEA 4M88A 2IWHA 4B9EA 1U8AA 2CCGA 3TG8A 3PXBA 5B2FA 5AW2A 4KXUA 1E18A 4UCFA 5EHZA 3KEGA 2OILA 3GMDA 3EQ7A 1T5BA 3H4VA 5BO5A 3U9SA 2EFJA 3PHGA 4TMYA 1B43A 4ACAA 1PDWA 1BFDA 1UZMA 2ORIA 2ZLBA 2HMTA 2QENA 3C3WA 3H5AA 4MUBA 5LR6A 2PX0A 2W6IA 3EPKA 4FC6A 2HY7A 1DKLA 1SVKA 4QNRA 4JEHA 4GI7A 2HO5A 4PZEA 2GN9A 2P3OA 4B45A 3MF4A 6ADHA 3O7MA 3PHJA 3KD2A 3ZHXA 2VWHA 1N2HA 2C4MA 1L4YA 3PZRA 1L5GB 3VJMA 3ANXA 4Q3BA 5ITWA 3B3AA 3M6UA 4LOIA 1H0HA 2R86A 2ZR9A 5D51S 3QBJA 1I33A 1SKYB 2D8AA 3CLSC 1T4DA 1FSZA 3L5KA 2YW9A 1OLUA 4ZEMA 1UBKS 2OFOA 5BV1A 3ADBA 3ZVMA 4OUKX 1O6BA 2XXAA 1JVNA 1TYBE 1A8SA 2RCYA 5G1OA 5EQDA 1XTRA 3V5NA 1ZC4A 4BNTA 4MVJG 3GLGA 3UJHA 1E8NA 1L7EA 1LW6E 2NO9A 2I5PO 2ZTSA 3F4LA 2D74A 4JXZA 2H7YA 3QMVA 5AQ1A 2ON6A 5FYDA 1X1EA 4IOLA 4RD0A 1DQNA 1HKHA 1LQ2A 1HT2E 2R11A 4DLPA 2WTUA 1LK7A 2W6MA 2A1TS 4N7JA 5A1JA 3DFKA 1GO2A 4O3FA 1NA5A 1L6RA 5LQMA 4GVXA 3LT4A 4LVCA 2DBRA 3OQVA 1ODKA 2DU8A 3M83A 2HRZA 3OUTA 4DW8A 3GZJA 3O9VA 4MWZA 1VKZA 1V7CA 4WBSA 1N6HA 1QVVA 1U2EA 1U5AA 2FJUA 2NQ2C 2UVPB 2QIOA 1WKCA 2GARA 1A50B 3VNSA 4EUFA 4YWJA 5BOSB 5BW6B 3RVPA 2GF9A 1EFVA 4HDMB 3SK0A 4AIIA 2VKTA 5KQPA 4E70A 3P4UA 1NUSA 3DOOA 4H3KB 2GKGA 2NVOA 3DB1A 1GTL1 2SKEA 4IUBS 5DNAA 4JJIA 5FTJA 4S04A 1RZRD 4UNSA 2GH1A 4YHHB 1BX3A 3GC6A 4RTMA 4RF4A 3PX3A 4Q6WA 5AJTA 4MHSA 1QAMA 1W5AA 2ETXA 3DL0A 2QZJA 2YVAA 4NKRA 4OREX 1JZSA 3CVOA 2JDID 3FZEA 1RMQA 3TOZA 1A4IA 1E6MA 4X6UA 1FTGA 1XMSA 2DFNA 1INLA 2YJ6A 5JBNA 4PHCA 3SXUA 4E5VA 3LUCA 2RGAA 5F12A 5CITA 1QE0A 2F4VB 2VPQA 2E0IA 4NBVA 1QYXA 4R9UC 4F4JA 1VG1A 2YXLA 3TLEA 1T4CA 2OHOA 1A5SB 4QHSA 4R9RA 1XTPA 3EVDA 3S2ZA 4A0HA 3HCBA 2H1HA 3ML1A 1O97D 1YB4A 4PWZA 3AI7A 4DC9A 1ICIA 1V8FA 4IIDA 4WLUA 1CW2B 3X1YA 3A7DA 4DRXB 4JB3A 3Q7RA 4PCUA 4YO8A 5MHTA 4JUAA 2A9JA 4Z86A 2QRKA 1KAOA 1XN1A 3TRKA 4DM7A 4YAEA 1RQXA 3VMMA 1E9SA 4W5HA 3AP1A 1B1CA 1NP6A 3IURA 4AJHA 1JR6A 3B1ZA 3VPHA 5K51A 1ZS9A 3B7PA 5ENZA 3AO0B 3KHSA 4NYIR 4JVLA 4TTRA 3MTGA 5D6NA 1X7ZB 1Y5LA 2PMCA 2QTWB 4G1MB 2G36A 2HPZA 4X6XA 2VPYA 4X93A 1UMDA 8ADHA 4KE8A 3M34A 2YBVB 1APBA 3KQLA 2Z04A 1V1MA 3PZBA 5J4LA 1RC8A 1GWNA 1VGQA 1K63A 2B1IA 5EGSA 2LCIA 3DBLB 3IBSA 1N32B 1N7HA 1Z2CA 3A1CA 3UW1A 3ICOA 5BXQC 2VP2A 5AVWA 3JRWA 1Z3IX 3E7WA 3VPDA 3T9DA 2QR2A 3M1LA 3G6WA 4UAJA 5IPFA 1DBSA 1JWBB 1R0YA 2P3LA 4XM0A 3B9QA 3T52A 4YMVA 2C7QA 4EF6A 3COYA 3PXEA 4G9GA 1VJ5A 1DXYA 2Y1CA 3UEOA 2FOIA 2HF8A 2XZTA 1R4NA 3V1YA 1JILA 1JFVA 1E1KA 1JR4A 2JKYA 4H9GA 4NZ9A 3ZHBA 1UK6A 3CA8A 3GAFA 2ARKA 3QHQA 4CNQA 5M7EA 1PLKA 4LXHA 2ERCA 5JI2E 4ZIRB 2J4CA 2I62A 1C2TA 3P0JA 3IEUA 1HLGA 1TJ5A 2QRNA 1P4HA 2WZCA 3PDJA 4ZXFA 4C4PA 2QROA 5ECWA 4MV4A 2MDTA 2UYGA 4QQRA 1BCSB 3B13B 3OQHA 4YJ3B 1KJ9A 3R0JA 4R2HA 5HOQA 5ES4B 1DEXA 2E4WA 3DGFC 3HHPA 4I9UA 4QPJC 1Q7TA 1V35A 2P5TB 3O8QB 3PCXA 3T1HB 2C5FA 1ENZA 2YFKA 3AHEA 2DBZA 5L40A 3ZDDA 3WAKA 4WXRA 3OEWA 4HI0E 3ABRB 4FLEA 3BEDA 4ETWA 3G5AA 2JZNA 2Z83A 1P0IA 3H1BA 3F7NA 3OETA 4OLHA 4YVFA 3ZGNA 3EULA 3KB6A 4MRMA 1HMPA 2XOXA 5JFGA 5KNDD 4XGIA 2I1QA 2DR2A 5TQJA 3W4IA 3V00A 3EIWA 2WD9A 3R3ZA 4EFMA 2DLCX 1SZDA 3K05A 3ZV5A 2VT7A 3GFSA 1GTRA 1SCIA 2QMUA 2Q6KA 2I3ZA 3FRJA 1LLQA 4PQEA 1E63A 3B70A 2IYFA 4BRSA 1LBHA 5DTIA 2PU7A 3G13A 4AROA 2DCMA 3OCCA 4FOLA 3ZNQA 1E0AA 4IPTA 2EFCB 4M0FA 4B6SA 5CJPA 2VPPA 2WHXA 4NABA 1ECCA 4EA6A 5CDFE 2I6UA 2AJDA 2BFAA 2IOFK 2X76A 1D4OA 3H04A 1M2OB 2QN8A 4P84A 4W4TA 1U3VA 2J59A 2YIDA 2WFLA 4U6QA 3SYLA 4B4UA 3ZCTA 1B23P 3LK7A 2CHEA 3P97A 4AYWA 2W83A 4IX9A 2EOAA 4CXMA 1A2QA 2VSNA 5T41A 1UDAA 2NU9B 4BGDA 3P9CA 3MELA 4AFNA 2A8YA 4PSKA 3GIWA 1E1NA 1NW4A 2ZS8A 1JLSA 4Q4LA 1DIHA 4S1PA 1E1CA 1I10A 2WTAA 4BNKA 4WXHA 1XYGA 5HS4A 1PFUA 1QZUA 2E4VA 3FFBA 1DEKA 4FYXA 4NYJR 1QNFA 4TKZA 5HQTA 4RK7A 2AZXA 2WUGA 4M54A 3OTIA 4ANFA 2P35A 4KTVE 4DV5B 3KM0A 2FSPA 1D7AA 1Z6YA 2WAOA 1GPNA 3GZTB 2ZREA 5E3HA 1UAAA 4BXOB 1RAEA 1AO3A 4AI6A 1AK2A 2J8ZA 3WRWA 4G41A 2ZP1A 2AR7A 1JTEA 4GC9A 4UUPA 1DS6A 1T0IA 1YNOA 5BMVA 5DI9A 5JARA 3FF4A 2WUWE 5CBPB 2VAWA 2RB4A 2W48A 2PKEA 1CUBA 1E0JA 2I71A 3BPSA 3IMFA 3M0EA 5B30A 1FVFA 1BJTA 1R37A 4C78A 2QNRA 3MT0A 4JB0A 1T13A 4WDRA 4CL3A 2WHYA 3NXSA 3EDMA 4F3KA 4BNDB 1B6GA 1LDYA 2I80A 3PWZA 3REOA 1WOYA 1UWAC 2PKCA 1WXQA 1A9RA 2ATEA 2MMGA 4HDKA 4YMWA 3UXMA 1K8XB 2OBXA 3OZUA 2GCOB 3VR3A 4B17A 2OQ2A 4KR9A 5BN5A 3D81A 1BMQA 3CLRC 4KLRA 3FNQA 3EXAA 1AS2A 3T6KA 3UB3A 1H66A 2VEDA 3DOIA 2D4AA 3R3WA 4G9BA 2W2XA 1TM4E 1H3FA 5CNMA 3LIPA 2LIVA 3OZTA 3SJCA 4DLAA 2E18A 1KIMA 2B4AA 3NGXA 4OQ4A 5DGTA 3U17A 1ETUA 3F73A 5EJAA 1EFPA 2OFWA 4HOYA 4CEIA 3IP7A 5LL6P 4IDPA 3VR6D 3L1KA 1WHTB 2X4GA 3AUKA 2WRZA 5AIAA 1N9KA 4FW8A 1KI1A 3IMCA 4IXMA 4IFIA 1LTKA 3FCCA 4WZBE 1REQB 3WNBA 4I4TA 4X60A 3KDAA 3QY0A 1IVNA 4UZFA 3RFCA 2AR9A 2V7TA 1SG0A 2O5RA 4NOKA 3UB2A 4DV0B 2PD3A 1NW8A 4Q4JA 5KKCA 1KOJA 4FDAA 4OGFA 2VYVD 3IQEA 3PQFA 2L82A 3V2IA 5CDUA 1XPOA 1KJ8A 1OI4A 5EHQA 3A25A 2DM6A 3I76A 4MYHA 1KZ1A 5C7YA 3K4PA 4YT5A 3FUXA 4GNRA 4J0CA 4KC0A 4ER7A 4F72A 1T5SA 4YT4A 4M1SA 1Z2EA 1UOQA 1DDOA 1EZZA 1F38A 1GNRA 1M1NB 1W75A 3PRJA 4D46A 4LF8B 2VWPA 4P3XA 2PJUA 3CV3A 3HP7A 2XODA 3FJOA 3JZDA 1MJFA 4Q4AA 2X9NA 4K6FA 3S40A 3GUVA 4ZAFA 4BIMA 4E6PA 4RFVA 1KBQA 4LJ9A 5ENVA 3ESQA 1V9CA 3EBLA 2FCRA 4I5DA 5E8JA 2EIHA 3M6VA 1U3WA 1UJ4A 4IG4A 1C3EA 4TKVB 4XFJA 3OOHA 5JPIA 3RI3A 1SXQA 4JYZA 5FTKA 3OQ1A 2RGDA 2QVBA 3I4FA 4MIOA 1OASA 1VE7A 4NFSA 2NOAA 4RIGA 3IJ5A 4TSFA 3O4GA 1XHLA 1JQBA 3CFYA 3DP7A 3SZ3A 3OOYA 3T99A 3WDKA 2OFFA 4OI4A 2GQ0A 3CURA 3G0DA 2WEKA 4FT4A 1SUDA 3WRVA 2X1HA 4DR5B 3CX7A 5ABPA 4DGSA 4GX0A 4X94A 4BVGA 1C41A 1CR1A 1NWCA 1XOIA 2EX4A 2VJMA 1NG9A 2PGXA 1KI3A 3BF7A 3TD6A 4YRBA 4RKYA 4ZYLA 3GT3A 4HXFB 5TRTA 1Q0QA 3DBHB 2IWRA 2JFVA 2VDUE 5CURA 2IY7A 4OQLA 4R8RA 2A14A 1FU4A 2QLFA 2X1LA 2XUFA 2Y3IA 4MKRA 2W2PA 1V6SA 1FXUA 2QVGA 1QLWA 3RVRA 4D3SA 3KU1A 2FZLA 3PL1A 1DB3A 1USUA 2IV2X 1VP3A 1ZUHA 4ZGGA 2GJSA 5LP1A 4LIPD 3DDNA 2PDAA 1UBSB 2NTNA 1ZWKA 3OM1A 5FO1A 1DIRA 2WIKA 2YWFA 3UMGA 4EHAA 3BB1A 3QMPA 4JODA 3CRMA 4ZK2A 1I7SB 3CLUC 4GZMA 1L1FA 4CIYA 1MT3A 2B7LA 4TMVA 5B3LA 4I0WB 4QJ5A 5AXDA 1KEEA 1RLOA 5FWDA 1NQXA 4FB4A 2HHCA 2NUTB 2A5FA 1OJ7A 5FPYA 3CJTA 3ZWKA 2BTOA 3WL8A 3UJPA 2O8BA 1MH9A 2VT3A 1QONA 2XGGA 5CAEB 4G63A 4XOUA 3ETEA 4XLLA 3V7WA 1R18A 3NTVA 3U7JA 1VIDA 4EFKA 4JUIA 2BHNA 4N5HX 2WD7B 2CFRA 1IOLA 1ZH8A 2VNKA 4M0UA 1SBQA 3H19A 4M4SA 3P4XA 2RHDA 5T57A 3VOTA 4HDSB 4TLMB 4MDFA 3U1VA 2X8AA 1S8NA 3RQSA 2EL7A 3A36A 4E5YA 4FGZA 1J9EA 2EYUA 3C3EA 1YH3A 2YTZA 4C21A 4P6VF 3RLFA 1ZMTA 5TX7A 2WIFA 3VKGA 1CR6A 1PJCA 1U2GC 3T4EA 3TG2A 3RTCA 5A5EA 3DPUA 3FLEA 4QD3A 4RD3A 5D87A 3IILA 3ZG6A 2RKBA 2LD4A 2W37A 2ES4A 1ZLYA 2WPDA 4C89A 3B89A 1ACMA 3LGXA 3A3NA 3HNOA 2TMKA 1DX9A 1K4YA 1QCYA 1N57A 3LK6A 3NPAA 2Y77A 4GR9A 4OQPA 3SGLA 4P33A 3W6OA 5KTSA 1VLMA 4PQFA 1VE9A 1XB2A 3FPNA 1YDMA 1ZN7A 3IA7A 1FNCA 4JWTA 4BV8A 5IKPA 2OZKA 2AD5A 3A6KA 4HV4A 3ZWQA 3A37A 1LDMA 1QTRA 3ONDA 3SM9A 2WK1A 1T9AA 3EA0A 4O2LA 4OK6A 4BMZA 4ZO6A 4GWLA 4BQRA 4YROA 1I9CA 3FOZA 3CPEA 5IVIA 2G4CA 1ULBA 2XSZA 3IV9A 5I7SA 3NWEA 4BO8A 1AB5A 3A8TA 5AUNB 3T9FA 2FE4A 4FQ7A 5IXJA 4BKQA 5JEEA 2K5UA 3JV7A 4HGZA 2I33A 4PLVA 3AUSA 1XRLA 3LDHA 4W8GA 1ETHA 3AB3A 2QW1A 3R3VA 3AHJA 4HQ6A 5FNVA 4NDZA 2HQRA 2V58A 4AX4A 1FS6A 4PZYA 1XD2B 4RAOA 4DIMA 4KHPB 3WIVA 3VSBA 3ET4A 2QDKA 4R5HA 4KR6A 4C0HA 4FIZA 5FUXA 3TNLA 2Q5CA 4KQ1A 5FTWA 3HBMA 3KFLA 1YZGA 5KU7A 2HDOA 2O3UA 1Y6FA 3G89A 4JJZA 2G5PA 4EDFA 4YJDA 1MEJA 2VH5R 1VCMA 2VZ9A 1S8OA 3HLKA 4J0EA 1KJQA 2IHTA 4QXOA 4WMLA 4NFLA 3W9BA 4E15A 3WGQA 3MBKA 2REOA 2ZYIA 3DE4X 3GCXA 1FB5A 4JITA 1MO5A 4Q39A 4RKFA 1WA5A 2X6RA 4ZAGA 4XR9A 1V7QA 1HYQA 4XSVA 4DOMA 1WRBA 1AJEA 3NIWA 1XMOB 3UV7A 1WL8A 2ECKA 2C99A 2PUHA 1IRIA 4BO7A 1IN7A 1PR5A 5JSHA 4KACA 4RJLA 5GQSA 1F1BA 3R9KA 4BMPB 4CM6A 3AETA 5JCZA 5KC9A 2O8EA 1F5SA 1NYLA 1D04A 1UJ2A 1Z13A 1WMEA 1ZA2A 1E3WA 2J9FB 2QYSA 4KXQA 3EXEA 5CVEA 1GPH1 3HKCA 4CPDA 3EEOA 4LDJA 3V9PA 3RARA 3DA8A 4I1OA 3S99A 4FDLA 4WNIA 2CJWA 2QN2A 3HABA 3MFQA 3AW8A 4HH1A 3SJAA 1JDUA 1QH1A 4KSBA 2J3KA 4G01B 4X7RA 4R3WA 3ELUA 2MINB 4YUAA 2JFHA 2NG1A 4PRZA 4A5SA 1RRMA 3AHIA 1W5TA 2NP7A 4EBFA 2AG6A 2EKDA 2H0RA 2PYIA 4JYBA 3F8TA 4ZAYA 3PX2A 4L5YA 2I66A 4MWDA 2NTVA 2WP8J 3QFRA 1DP4A 1EMDA 1ORRA 4LXXA 5GGYA 3UOGA 3HZHA 2OAQ1 2QMZA 2C20A 2IYVA 2Q8PA 5F98A 5TF4A 2JASA 3MK31 2XKBA 2BFPA 1Y5NA 1TQ2A 1XQXA 1YFKA 3FH0A 4FINA 5EVCA 3INRA 3JQFC 3NTUA 4QHTA 1H2HA 1O77A 3Q0IA 2H1WA 2A58A 4IJUA 5TQ2B 2O2GA 1G98A 3LOUA 3O4HA 4BNXA 4Z54A 3GR6A 1YRWA 5JISA 2H4JA 1U0JA 2OWEA 2VWGA 3HKEA 4QYWA 1K97A 4UVDA 2HA5A 1AGRA 1ZVKA 2CXHA 1HA3A 1TQDA 2DRIA 4WV3A 4LJYA 2AOVA 1H5NA 2JRLA 5I3ZA 2O7QA 1R8JA 4MI9A 3D64A 2RH5A 4N5NA 2FYTA 4AD8A 1JQ3A 2H3HA 3D3QA 4K9MA 5AKJA 5J5CA 4ZI5A 4CETA 1RM3A 1EFAA 4KH0A 2WQ7A 1PD0A 4O33A 4JX8A 4YUWA 3SKXA 4L5BA 1E2PA 3D4BA 4J9UE 1FUIA 4GAEA 1HLDA 3OQMA 4TYQA 3EFHA 2XMPA 4HATA 1OH6A 5DNEA 4QUAA 1M8KA 4YV2A 1DDGA 2XXBA 3BL8A 5JW6A 2B2XA 3SEAA 3FRIA 1YE5A 4KQ6A 1KPHA 4B4VA 3CX4A 1A88A 5EJIA 4UEJA 1EGVB 1VBNA 4WCFA 2RONA 3ZIUA 2BCEA 5AOAA 2ZIFA 3BIFA 4S1VA 3O4RA 3JAWA 1UXOA 1B3RA 2KBEA 2QVZX 3IB6A 4CM8B 2BSAA 4RESA 4EENA 3V9AA 1PG0A 2GPTA 3TOXA 5ALVA 3T9AA 5ADHA 1HSOA 3RAPR 3ZUGA 5GONA 4DG8A 1C9JA 5DBFA 4RABA 1M10A 4ALKA 1DRJA 2C4NA 4ROSA 4QA9A 1DNPA 1R0SA 5FWYA 3GLKA 2CYBA 3I45A 2G17A 1NQOA 5F4ZA 4DLRA 2M1ZA 4GKJB 4RHUA 5J58A 4HFJA 3UKOA 5JSZB 2POQX 1E5QA 1XRRA 4N6NA 4ZYVA 1V43A 4OI0A 5LYYA 2B99A 2IIBA 2XEDA 3PV0A 1IL0A 3CGGA 3KYJB 2ZAYA 1CJKC 2IW1A 1VE3A 3AJRA 1OA1A 2QRGA 3I0NA 4P2BA 4QT4A 2B6HA 3N2KB 1Y6QA 3RUBS 3EASA 2C2WA 2R7KA 1HEUA 3LPCA 1TAUA 4DZZA 2ZJOA 1OFGA 2CK3D 5EXXA 3MUOA 2C7OA 1AHHA 5FAKA 4MNTA 1XU4A 1ONOA 4YAGA 4QGBA 1F60A 5G0VA 1XNQB 1KMCA 4G5YA 1BRMA 3RANA 3GRUA 2V69I 3PNPA 2Y76A 2Z2YA 4DA0A 5IXYA 3WISA 4B8ZA 1G5RA 1R64A 1SIOA 1UOPA 1Z4MA 2UVDA 3BXHA 2CF6A 2BONA 2C83A 2DFVA 4FLMA 3RRXA 4W5OA 3LXUX 4OU4A 4JUDX 1CUSA 1TTPB 1W49A 3KJIA 4BUZA 4XD2A 3M5PA 2H8KA 5IDYA 4BFYA 5JC1A 1G5TA 3B6KA 4JOCA 5CLJA 3KAKA 1NBAA 2HBZA 2A94A 3LUDA 2RD2A 4FIDA 3QE9Y 1GAXA 2W2QA 5LQCA 4OGWA 1L4GA 4DJ5X 3U3JA 4HLQB 5EEGA 2IEIA 4GPBA 4FN5A 2BGGA 2D2FA 4A0GA 2ADOA 2J31A 3SLRA 3FROA 1JB9A 3A05A 3HCWA 3OQPA 4UOQA 2GERA 4BP9A 5LNK1 1DCMA 2YWBA 4HAYA 4Q7QA 1QBKC 2DQSA 1DBIA 3OE7A 3H1EA 1K9VF 2GESA 2VDKB 4LZOA 1NSFA 7MHTA 2DUJA 2PGIA 1DBRA 4RZ2A 5EIBC 3CWQA 3ZLUA 1V39A 8MHTA 4EJMA 4FDMA 3OOWA 4O8CA 5LA6A 4DNFA 4I4IA 3CWCA 1IM5A 1SEVA 1NYQA 1P77A 4WLEA 4V03A 3KHUA 5LN1A 4LZJA 4P35A 2LRHA 4LMBA 2D5IA 2X0RA 4MUAA 1O94A 4PWYA 4LY6A 3CW2A 1I1NA 3WJ7A 4QPZA 4ARVA 5F23A 3G0IA 3ZKWA 4DREA 3CLTC 1K7XB 1NDHA 2GI4A 4TVBA 4MS3B 1P44A 2YMLA 4NAVA 1GDDA 4RJ2A 3IPRA 4CCWA 1G8SA 1MQAA 3EYAA 1GRQA 3PI6A 5IDQA 1W85B 1S5PA 4IDAA 3KWMA 5KYYA 2D7DA 3VKVA 1E9BA 4YDSA 1FFDA 4QZVA 5PGMA 1KFBB 4MGHA 1TYDE 4LBYA 1C50A 4GPTA 5K8UA 4C3UA 4E5MA 4KQFA 3C6QA 4HRYA 3I2GA 2NU8B 3WIDA 3BT7A 2PO7A 4OQZA 3TW8B 5CM8B 3L4BC 4ZRNA 1YA6A 4A92A 4YMLA 3TF5A 1TI7A 3LYHA 4L27A 5EQJB 4BKMA 2WG2A 3VHRA 1RYNA 2PFKA 5ARDA 4FFRA 2CDAA 2O14A 4FGUA 4KSCA 1EQ2A 3JASA 3UQZA 1XEWY 3PHBE 1CB7A 3O0TA 1OAOC 1FMFA 4YONB 2V67I 2WJIA 1FP1D 1Y1PA 4QTTB 4X7PA 2B3DA 5SYAA 3MINA 2OYSA 4MQFA 5AK5A 1OFIA 3GLFA 2FTKE 1X6VA 2WFAA 2YXPX 1YO6A 2ZT5A 3I1IA 3KLPX 3O90A 1AQUA 3P2IA 4JP5A 5ALFA 4OHZA 2DP4E 1EB8A 1M34B 1NFRA 2XBUA 3PQ5A 4X84A 1T8YA 4LGYA 1DQSA 1CZRA 4ARBA 4G36A 1M8FA 1JFRA 1QZXA 2CNKA 2WSYB 3HR8A 4ITRC 3FBGA 5ADUS 4N48A 5HSGA 2WWHA 4URUR 2JZOA 5EN4A 4ZKEA 1FP4B 2RIRA 2AG8A 4KMSA 4BV9A 3GUHA 8RUCI 2JI7A 2QE7D 3I8OA 2Y66A 1KIAA 2V6MA 2Q6IA 1N5DA 1MA3A 1I4LD 4IDNA 1TC2A 4OK3A 4QOFA 4QYIB 2R6AA 4WH0A 1PFGA 3G2PA 5FCDA 4S0XA 1I3LA 2YJ3A 2DOKA 2P1ZA 5BT8A 3RAEC 3SQDA 3AY3A 1ZGGA 2JIRA 5DWQA 3FI9A 2FX3A 5IAOA 1ZD3A 1KDVA 5JAOA 4RIFA 1Z37A 2ATIA 1JT2A 5L8VA 3T7EA 2GXSA 5EJ8A 5JXJA 1Z56C 5KINB 1MO4A 5JROA 4EUHA 2FWJA 4E2WA 3CM0A 3MRVA 5EZYB 3EEIA 4RVHA 4CBVA 2CVHA 1KSHA 2SNIE 4JT2A 4YP1A 5KEIA 3ROKA 1ZUD1 4EG5A 4N3NA 1RFGE 1P5ZB 1YXMA 1PR2A 3SKYA 2FEKA 4XIJA 4OQEA 5H82A 4FN4A 3TTUA 3X2EA 1H2ZA 3GYGA 3BE6A 1F2TB 1NTOA 4G5GA 2JGEA 3JQRA 4M8KA 4TMWA 3ZDXB 2VHJA 4HB2A 4HWGA 1P9LA 2JGDA 2I1LA 1G6OA 3QWFA 1ULUA 3SC3A 3NMUF 1S7GA 3VDQA 5CH3A 1NXTA 4CKZA 1I3KA 1N6PA 1W2GA 1W7AA 1F6WA 3I52A 4GXRA 4GXQA 2CNWD 1X7HA 3ZQ4A 3K32A 4HUTA 3ECSA 1NN3A 5KQMA 3DSRA 2DERA 2X9QA 4ITVA 3W7VA 1A9XB 3AUXA 5LUBA 5ULLA 2V98A 1NXOA 2HRQA 4F85A 2AR0A 5AKHA 1UT5A 3H87A 5ICSA 1LU9A 3H0KA 3ZEAA 5CB0A 2H0AA 3GJ0A 4I14A 4M9SA 1XROA 1RPNA 3BRQA 1ZCAA 3T54A 3PXUA 4O4LA 4B85A 1G19A 5E6RB 5A71A 1CHNA 2ZJ1A 1Z12A 3I8XA 4J2HA 4UNPA 3J7TA 1D6SA 1GT6A 3AM4A 3IUQA 5ALEA 3EF0A 4H60A 1JHXA 4FI3F 4G0PA 3W3AD 1BYUA 1LF5A 4G1FA 4I4TF 3A10A 5JCOC 1SQFA 1D4AA 1FW8A 2HF2A 2X3FA 3CZQA 3SVLA 4EJSC 4D8XA 1B26A 3K4QA 4QT0A 4TWZA 4AS2A 5JVDA 5LUAA 4LE2A 5FOXA 3O3OB 1A98A 1TMGE 2ORWA 3H13A 3EISA 2PWPA 2Q9UA 1PF7E 1RHMA 3GEGA 4DVGA 2WF5A 3M6MD 2FWRA 4ABTA 4EQZA 5D3KA 3FR8A 2CYCA 1IAVA 1SFRA 2PZEA 3WO1A 4ZCRA 2DFXI 1C9MA 3ROMA 1RHJA 3WWCA 1R0WA 1R9GA 2CB0A 5KOHA 4W5RA 3ICWA 3FHCB 1YR1A 5IN5A 3LVFO 3U7QA 5AW4A 2KYRA 4ECAA 3BIOA 1OWNA 3JWJA 4Q16A 1G7RA 2NZJA 4XCVA 1GPLA 4JJEA 5DMXA 4ENVA 1EESA 3NXKA 1T10A 2H4XA 2W2TA 3N0WA 1VPDA 4I8IA 1Y34E 3PJDA 4B7AA 1JQKA 1PYDA 3PC7A 3EDOA 1I6KA 5ER9A 3LC2O 3AV3A 5FL7D 3SSOA 4JJAA 4RTRA 1SKMA 3T1TA 5BORA 1RYEA 2OHVA 2RJOA 3O8BA 4GWKA 4U2EA 3TPZA 5EUCA 1J1IA 2QWXA 4O1MA 4Q4HA 3EXHA 1WQ1R 4H7IA 4DIFA 2EFHB 5A7GA 4EZEA 1YZUA 3Q7IA 4UZSA 3FE2A 4YMSA 4EUKA 1WB4A 1Z6GA 5T6MA 1PJSA 2XITA 3TCKA 1E4VA 3UCFA 3WL4A 2QTFA 3PDCA 3JAKB 2O0HA 4PBRA 4BZZA 3U49A 3Q6IA 2FUG1 4FPXA 1RRVA 3TB6A 3PDUA 4BCDA 4Q4CA 2AZTA 2EJCA 1J07A 3IT1A 1DRKA 4HTFB 1YACA 1IEWA 4MRVA 3VNVA 4XQEA 8LDHA 5AM4A 5GIPE 3CVVA 4DCJA 5TPWB 4ZDJA 5DGCA 3IMKA 3D4PA 4I50A 1R1DA 4JQOA 3UV6A 3QTBA 3Q87B 5ITVA 4MW6A 5F52A 1HNZB 5M34A 3IOBA 5FPPA 4RGBA 4IW3B 4WFKA 4DNXA 3N2LA 4DJFC 2DEUA 5B4TA 4REMA 2FPIA 4RKEA 1GLGA 5KTMA 5EUMA 1AO0A 3JD4A 1F17A 1RXUA 3F97A 4BZXA 3ASUA 2GSDA 3T5MA 5JAIA 3SZOA 3DOFA 4XPZA 3GCZA 1NW6A 2NUBA 2A0YA 2YZKA 5CVCA 2V3WA 2OXCA 3H1GA 3V1TC 5A02A 4ZQHA 1QH8A 2PLRA 5A06A 3KKZA 4X0EA 1N77A 4DMFA 1YZNA 1Y3AA 1PLLA 2R2AA 4FGJA 2IBSA 3U0VA 3B3GA 3MB8A 4LRQA 2OBFA 1RMTA 3TAHA 4M38A 1PKEA 4MUIA 2WSSD 1PIWA 3WRXA 4ZZIA 2IU0A 4JJ4A 4MCIA 2EWWA 3OZGA 4CYMA 4XWWA 2O8CB 1VFPA 4U7PB 4NU0A 1WB9A 3EVEA 4C0LA 4C29A 1O5IA 1RBOC 1N7JA 1Z4PX 2G9ZA 3DTVD 3KQQA 4JJKA 4CFZA 3ICQB 1D1SA 4Z7OB 3RTGA 1H2WA 1BXGA 4HZIA 3DDWA 4INZA 3B7GA 3A1EA 3U48A 2VQSA 2K7ZA 2O3RA 4MO9A 2BZ1A 3OZAA 4LK3A 3E5NA 2XZOA 2OECA 2RBGA 4LW8A 1QHGA 2FSIA 4C1NA 1E89A 4F4FA 2ST1A 3O5AA 5I5EA 5DHSA 1PWYE 5EL0A 2W42A 4EG0A 1PNVA 1AY0A 3P9ZA 4OTZA 4QNNA 5E3IA 5MGBA 2IF2A 3VZBA 5J2UF 1DX4A 2ZUSA 3AR4A 3GP8A 2VJQA 4MW5A 2G0AA 2J6BA 3RW9A 3FKSA 3RC1A 3BWMA 3ZCVA 4BATA 4M8NE 4Q15A 4KBYA 4TWJA 5IC6A 2FQYA 1STOA 1PEYA 4PCLA 4I6EA 5D00A 3CZ4A 3C43A 5FHQA 1B8VA 3UV3A 1DFHA 1JYFA 4TGLA 4YFYA 4KITB 2C5BA 4GYJA 4TYPA 4BV3A 3VBEA 2RGEA 4AZ0A 1U80A 1F8UA 4BYMA 4B6RA 2NV2B 4BIIA 5JJBA 1WDTA 1BS9A 1PL6A 3W8FA 2AC4A 3F67A 2VAPA 1ZISA 2BKVA 1PS0A 4BS9A 3N74A 2GLXA 2RC5A 2NU7A 3TM4A 1UT6A 5FNVF 4GUDA 4EPXA 2AMLA 4CCAA 4PNHA 2XCOA 5CG2A 3ZJUA 4YDHB 4V3CA 2O1EA 3L1IA 2IU6A 2O2ZA 1WSBA 3D8SA 4L4SA 3ZK7A 1SOAA 4ZTUB 2PKRA 2VF2A 5F33A 3G1TA 1UJ5A 4DR3B 1PK7A 2FHSA 2HLDD 3EG9B 4FXPA 5BUSA 4LJ7A 5ED0A 4L4XA 4EZBA 3BH7A 3K71B 3ER8A 3I9LA 2E1PA 3D6MA 2QUZA 2YDYA 3FWNA 4PAOA 3TZLA 1C4KA 1FFWA 3ZD8A 3U09A 5BNZA 1XR3A 1H23A 1ZRHA 2Q3MA 3IIEA 1FQKA 4EGAA 5HUJA 1QHEA 1EK5A 3L8GA 2P6PA 4Y3UA 3CE6A 1P5RA 3KXKA 5DBEX 3UFXB 1K06A 5EWJB 1F2VA 4IJWA 4AL4A 2VTEA 2YIMA 1PFYA 4FEAA 4ZN6A 1G0OA 1U0SY 2OB1A 5FF9A 3LAWA 1V6AA 1JIXA 4CMGA 4IZHA 2OM2A 3VVBA 3I05A 4BTEA 3GY0A 4MARA 4HQLA 5A9SA 4WUVA 1T0BA 3KQYA 6GPBA 1RFLA 1HT1E 4K9KA 3IR7A 5CDTA 4X3CA 4UQOA 5BN3A 2GPJA 1J6UA 1SOVA 4Y2JA 2YJGA 4NDAA 3DE5X 3LC7O 4HY3A 1DG1G 1S8AA 2Y9MB 1C1YA 1RQLA 1RCXC 2BM8A 4LVUA 3UMJA 2X9GA 1OIXA 5BQPA 1YDGA 4EK9A 4Q7EA 4BVFA 1B93A 3IPYA 4JDUA 4M89A 2R5WA 2FZ5A 2M6SA 2KMLA 3E0XA 2D59A 2J09A 3BMNB 4UVEA 3ZOZA 1H8HA 3SJZA 4YYEA 2WNHA 2H65A 3LF1A 3ZCRA 1JEJA 2Y1DA 4MVJA 3SSNA 3VHQA 2R85A 4DCMA 1M8PA 3AEQB 2AS0A 1C8KA 3WGIA 3ZS9A 4MR8A 1E2EA 1N1DA 3MWLA 3DHWC 4MR9A 4FS8A 5L7TA 1WB6A 3B3JA 3G59A 1FRFS 3IUEA 3CKYA 3PPIA 2P4EA 4RD2A 2KQUA 3H2KA 4UHFA 3RHTA 4HNUA 2OBMA 3HDQA 1HDIA 3DVSX 3LZDA 2P4UA 4D81A 4BTLA 2VWQA 2EC5A 2X2EA 3QNUA 4TS9A 4H08A 3IL2A 4MVCA 3OEED 4JCOA 3TLGA 1HWYA 4I55F 1RU3A 5CVJA 3UK6A 2P40A 3FDZB 4HPJB 5HBGA 5TPZD 4C6TB 4ZJZA 2A0KA 2VF7A 3PENA 3HADA 1OPXA 1GTZA 1W34A 5E4TA 3TUZC 3Q8XB 1PSDA 5CT4A 1SRRA 3BDIA 5FTLA 2ZJ0A 5IM4F 2BH2A 4RL6A 4CLEA 4OUDA 3ILHA 4LX8A 3ZDRA 5FXMA 4TTQA 2V4MA 4QPPA 3EWIA 1DBQA 2I9PA 3TMAA 4E14A 4J6EA 2B4RO 2BEJA 3AL0C 3RS0A 2XKKA 3H86A 3EGDA 3CMCO 3RAFC 1LTQA 1U28A 4OFXA 5CM9C 5H4HA 6YASA 2KS6A 1EINA 1OBFO 4NPCA 4XFDA 4U4AA 3UUWA 4XD7D 1CQJA 4OKNA 3HGQA 3VDRA 1EVQA 2ASVA 3KOMA 4FYWA 2A9OA 4MYTA 4M9XA 2IEGA 2BBSA 2WMDA 4NCAA 2OR3A 1VP9A 3DVRX 2ZUTA 1ZUWA 3FTPA 1ZK2A 1Y5IA 5DO9A 2PZJA 4PYJA 1N8NA 3KL2A 1J7KA 3VGPA 2GWRA 2O0KA 1DHRA 3L0SA 2W2KA 2PUDA 2Y99A 3GQBB 2G77B 3RS9A 3AI1A 3F5FA 5K3BA 4MW0A 4OMUA 5B1SA 3U7GA 4YJHA 4AKHA 1FSFA 1JLHA 4B0PA 3M82A 1SVMA 4MTCA 1E5TA 1QRTA 1W6UA 2IKQA 4OKIA 1DGQA 1ECJA 1YFJA 4KE9A 4ZOCA 2ZSKA 3RSLA 5A7HA 3NJ8A 5E7MA 1SCUA 4PAWA 3KJGA 3ZCQA 3OFJA 2W2LA 3R7WB 5LOVB 1NX6A 1QH9A 4L85A 1KK1A 2IEBA 2FPLA 1T2FA 1QP8A 1NP3A 2A30A 4U6SA 2B9EA 3SBXA 4BFXA 5L4SA 1MB2A 4B87A 3W6PA 4YASA 5LWHA 4LX0A 1NRXA 2VHTA 4GWGA 3RBVA 4N5MA 2G1KA 1TUBB 4RYDA 1XMQB 2RH4A 4OMFG 3AJDA 4KE7A 4C0BA 3EMBA 3NATA 4CGYA 1N3IA 2ZBRA 4HXEB 3KP1A 5IT4A 1G5PA 1QKKA 4ZO4A 5A3RA 3H17A 1DRWA 1B41A 3OEHA 2QRVB 1RBLI 3H2ZA 3A2MA 3QMMA 4LFAB 4IOKA 4P82A 1XVLA 1RWQA 5ALQA 1ECLA 2PWBA 2ZIZA 2QT1A 3R8FA 2ZAIA 1TJNA 5C2JB 1D6NA 5EEHA 1U8CB 2V0GA 5K4HA 1ZW6A 3FPLA 4KX3A 4M9UA 5HW0A 4QTYA 3GRFA 3PRKE 3IX7A 2NPOA 1CUVA 4QO7A 2CLLB 1NVVQ 3AONB 3V7UA 3SC6A 1T1SA 3RUEA 3RRFA 4KVFA 4D74A 1Q1EA 2H2WA 3TJMA 2PQ0A 2ZAMA 3E3LA 3FFXA 2EZ8A 5DBGA 3S29A 4GP6A 4F6RA 4TRJA 1TW3A 4NCBA 5IHXA 4D41A 4JUCA 3WDSA 4ZHSA 4OSOA 3GK3A 3NHLA 4RZSA 2JHCA 2QM3A 2HCTA 2LDXA 1JHYA 3DE2X 1DKUA 1VSVA 1XZQA 3GPIA 1D8TA 2OC4A 3OAAD 4L3VA 3SZUA 3WWEA 1PR9A 3HSYA 4KFSA 4CIWA 4TYMA 1R8YA 1RWVA 2AFIB 1CY8A 3K0FB 2EF1A 2EZ4A 4ALMA 5JNWA 4S35A 4YJFB 4Y67A 2H4ZA 3KRTA 3STVA 5JAHA 1SBNE 1Z7WA 4HQKA 2VK1A 5DSTA 4MB6A 2XY4A 5IEJA 3ROXA 3U3ZA 3F71A 2ZI3A 1ORWA 4MUMA 3W2IA 4BNJA 1YB2A 3WP1B 2QTVB 1OREA 1ZY2A 2I4NA 2AVNA 3LU1A 1HFEL 1XQ1A 2CHFA 1TVKB 2GSWA 3AILA 3RU9A 1QHFA 1LVHA 2RGXA 3MIIA 4D1YA 4DQVA 5AYVA 5TS2A 5I48A 1L5VA 1FLDA 2HRRA 5I7UA 2ZTVA 4MWEA 1GGKA 5F2OA 1O0SA 2PGAA 3ES9A 3LBAA 3UGQA 3LPMA 3QW2A 4TMFA 3X1KA 4B3GA 1U7UA 1DKMA 1H1TA 1PZNA 5LD2C 1CEEA 4H1WA 1XNRB 4NCIA 1S2LA 1T4MA 4MXDA 5CVUA 1PR4A 2POCA 3EDQA 3T3IA 4BMCA 2JLZA 1UBGA 4MR7A 2RAVA 3TEJA 3LPNA 4EHFA 2MT9A 1UEXC 4D6PA 2QUBA 2ZCUA 3W4KA 5C1IA 3PIRA 3ZX4A 1R6TA 2QD4A 3FTNA 4NZMA 2PX3A 1BROA 4JLBA 2CE7A 2EP7A 3TQCA 4CQLA 3ETHA 1FRQA 2O8FB 4XRRA 3PNMA 3A6FA 1G5QA 1ISGA 3JQDA 4Z2AA 1EIWA 1S2DA 3PEFA 5LQKA 5LZ7A 3OSUA 4G4SO 5HE8A 1CHDA 1VI2A 2GZSA 5EFZA 2O7NA 2RGWA 3GDWA 3TIFA 4ENQA 5KVCA 3O1IC 1GVNB 1MJ5A 3O3MB 3OMLA 4RS3A 5C4MA 3BZBA 2ODAA 2ASEA 2R6R1 2B92A 5FPSA 1RVDA 5J2UA 4ZT3A 4BKPA 4FHEA 3NB0A 4F1WA 4F38A 5GVSA 2IYZA 2L42A 5CW2A 2W9XA 3RKUA 1OW3B 1T8WA 4XIGS 2PX6A 5E9JA 3CN9A 2OUKA 3THSA 3PJRA 2MSWA 3CUTA 3DC7A 3LRTA 1RXEA 1NLFA 1LEHA 5C1OA 3A1VA 5J23A 4UHKA 5AWFC 3W5IA 2CUNA 3WA6A 2VDII 1IUNA 1SUFA 1CJUC 1FPQA 4UCWA 4DC1A 3O21A 4DBVO 3NBQA 3MERA 5DXJA 3E7PA 3WYFA 2HWYA 4PYOA 3FUTA 4GPEA 3RG2A 3CVUA 1WDWB 4EHNA 5I7AA 2AMJA 2R1TB 2QTHA 1DEHA 4JENA 1P5JA 2HK6A 3VX3A 1BMTA 1XCOA 3EAGA 1N7GA 4IDEA 3VYWA 1NN1A 1OTHA 4KO8A 3QVUA 4RTNA 5JBIA 2YJ5A 1KK0A 1JIIA 3GEPA 3JQBC 5H16A 4JLJA 2VBFA 3BAZA 3VKFA 3ZE7A 1MOZA 1ZOPA 2DBQA 2PQ2A 3JQAA 1IIRA 3LUBA 3IAM1 3NDJA 1BMFA 1UXKA 4C5BA 1FZTA 1UM8A 3PL5A 1D4FA 5FBLB 4P3PA 5EXPA 3LXRA 2DPGA 1VXOA 1L9KA 4WLVA 4KGXA 5JS7A 4FOTA 4NBLA 5A6SB 1KC3A 3P0EA 1TLLA 2WWGA 3L04A 1N1GA 2O4CA 3ND9A 2B5WA 2R62A 4RTLA 1C7QA 5CB4F 3T1VA 1G55A 5LDDC 3KAPA 3HEMA 3N86A 1YWGO 1COWD 4LOJA 4MVYA 3ZQ6A 1PVVA 4UM9B 4D4MA 4RK6A 4D45A 3E23A 1XGKA 5DWDA 1B0ZA 4GL4A 4EX6A 4RD1A 2WWVD 1KWGA 4KWEA 3TSYA 3HN6A 2EJWA 1N9GA 3GEHA 1S89A 1RYBA 2QGNA 5B1HA 3TZHA 3N05A 2P9EA 3OIVA 4JT9A 1CUIA 1TYAE 3GVPA 2MSEB 1EVLA 3MRSA 4IO0A 3I5XA 1T0HB 2HA3A 4C76A 2PRZA 4CKCB 4HNHA 1AGPA 4J7AA 4CMIA 5K0GA 2V68I 3DOCA 2AN5A 4L78A 3NVKI 3FNBA 4LXGA 3WYCA 3G8AA 1YTLA 4G85A 1KO7A 4K2AA 3WXMA 4AXXA 4B6GA 4FKBA 4B7UA 4C0AC 2QVCA 4F60A 3PDIA 5AI0A 4YRQA 2DFPA 2CV0A 4MUYA 5BYAA 4O4LF 3ZJ4A 4A26A 4WESB 5A4IS 2VSYA 2I1VB 4LJSA 4XLZA 2VZ0A 3D5TA 1W8IA 2YS7A 4OHKA 2Z6QA 4U7TB 1VQ1A 3W79A 2O7VA 2R25B 4QQNA 1BS1A 1G7SA 1P4GA 5JDIC 5K0TA 1DBWA 1FLNA 1EDOA 2V45A 3A6EA 2BGKA 4WADA 2J08A 3VSDA 3WWZA 3ZI0A 3ZWOA 1N78A 2AFHE 3ACDA 3KLOA 1N2JA 4CG3A 2J5XA 4FUQA 4CTOA 3NGLA 3Q10A 2AYXA 4RA6B 4UFPA 3I5YA 4DRZA 3QENA 2Q21A 5D1HA 1FA9A 5JVDF 3GA0A 2Q3CA 3QELB 1DX6A 1NF9A 3W2HA 3AF6A 2FRVA 2XUIA 1PAUA 3FMFA 4DKXA 3BGWA 3F90A 2ZZKA 4OSEA 4FX5A 4MKIA 3B6MA 4R9SA 4E1AA 1RPAA 2BP7A 3O8RA 1WZIA 1HE3A 3AR3A 2PUEA 1XZPA 3C8ZA 4R2MA 2CN1A 3I34X 3PFFA 4RM2A 1J9ZA 3X0DA 1GL6A 7MDHA 1SO8A 1ZJ6A 2VUTA 4A8JA 3BFKA 3RTBA 3Q6MA 3QLVA 2EKQA 2EWVA 2OC9A 3I6BA 1U0TA 4S0ZA 3W8EA 1L5OA 3H42B 2P1RA 4IJQA 1LNQA 3NC4A 3BRWD 5HF5A 2GTHA 3T3EA 1G3RA 1TIBA 2X9LA 2P1DA 4YUZA 2R6CA 3TTXA 4FQ5A 1TJYA 4LBWA 5CJJA 4DRXA 2G67A 2QYTA 2HSZA 3ER6A 2IEZA 2XYVA 1H85A 3TBKA 1Z73A 3N2GA 3Q5GA 1XJ5A 4X9XA 1FFXB 1HNNA 3IJPA 3FZGA 3CUYA 3GEMA 1SOWA 5GINE 1RZRA 5B6PA 3DMDA 4RLHA 2ZWIA 2PJDA 5C8YA 5FADA 4D9KA 1LLDA 1X7ZA 5A3SA 5C8VA 1JDPA 3S81A 2WHQA 1SUIA 5K8IA 4PW0A 2ZSIA 1J5EB 1ZKMA 1N2ZA 2A35A 3BWEA 4XSGA 1EJBA 2ATCA 3A14A 2OV1A 3E82A 4R8MA 2CVZA 3NRCA 2JDIA 3ZIAD 1FUEA 3FVVA 4E46A 5KTPA 3DPSA 1G3IA 1HZJA 3GXBA 4NH4A 1JG3A 2OPBA 3ZXWB 1YBVA 2G1AA 3LQ4A 4MP8A 1QIJA 1PP4A 5FQNA 5BPHA 2BJWA 4I50F 1XCGB 3PNYA 4EW2A 2LTAA 3C16C 1QSGA 3ZWBA 1J49A 2IA5A 2OZLA 4US0R 1RZVA 1ZCJA 5HCIA 4AICA 7ABPA 4Y8VA 5JNRA 3U3RA 3BWBA 5B3JA 2R6GA 2RHHA 4ZIRA 4Z4QA 3EWAA 1RHKA 3QX8A 4K88A 3VR0A 4Y1FA 3UHJA 3GFGA 4D4IA 3H2BA 4R3UC 5FBRB 2HWXA 1VJDA 2Y1FA 3H0EA 2EX1A 4PQGA 1XV5A 1BCSA 5LZ9A 3AVXA 1B76A 1TPYA 4HEQA 4RK4A 2Q5QA 2BSXA 1V8BA 2A9PA 2HQ1A 3BOSA 2I65A 3IQWA 4ID9A 4M0EA 3SLKA 1KZ7B 4HB4A 4OXQA 3O8QA 1IJBA 2CUTA 2FF5A 1J99A 2AOTB 3U40A 5AVTA 3G8BA 3IVGA 3UGJA 2NSYA 2V6FA 1ND6A 1Y6RA 4OF4A 1WAMA 1Y8QA 4PHTA 5GJBA 3EXIB 4R9VA 3S2UA 1QANA 3CH7A 3DE7X 1A0OA 4QJBA 4I3HA 3RYHA 4LHYA 4U2GA 1L8AA 2ZYAA 2WSIA 4MS1B 1TX4B 4J9VA 5HJ2A 4HXGA 1I4TD 1W5BA 2FXVA 3QVOA 4PGAA 4TQGA 3DHEA 3FOWA 3G9TA 3CPHA 1JUDA 4FZJA 2VG8A 3UPTA 3LSYA 5JHGB 1R0BA 3TVYA 3QX3A 3GHYA 1Z4QA 5HF8A 1KS9A 4ZMSA 4BVKA 1CIPA 5AOVA 1JLMA 1QQ6A 1U90A 1XK7A 1HM5A 1ZD5A 5KJFA 3SS8A 4XIIA 1XZDA 2R0QC 4XTRA 2P9CA 3H3JA 4UM7A 5IXSA 2WYHA 5F4BA 3RYCA 5CFMA 3NYWA 1AOXA 3TOVA 1W35A 5A03A 4QDZA 4NARA 1AK9A 1YR3A 1XEXB 4U2FA 3SYNA 1EGHA 3E1SA 1FL9A 4NICA 3WQBA 4OB7A 2VJAA 4L6IA 5K8VA 1MO6A 2NU9A 4L74A 3E18A 4AY6A 2IIPA 2Q2QA 1RI5A 3LNCA 4W99A 2R5FA 4U2BA 2ZRKA 4PC2A 2OCKA 3R7SA 4WZAB 5F64A 1R6BX 3KT8A 2AUTA 3LXMA 1DIAA 2FZKA 2VZLA 1AF4A 4IGKA 3K9NA 3WWYA 3WJ1A 3ONVA 2I03A 5DM70 5COBA 1JHZA 1MW9X 4DPKA 2E4AA 3FAKA 4HGQA 4N7RA 4V0QA 5KNDA 4MROA 2XECA 2WT4A 5FIUA 2JD2A 1UWVA 3R5TA 4PAQA 4Q1BA 3M5DA 2ZU0C 4BXOA 1RQGA 1US8B 1H69A 2JLUA 3HXMA 1Q0RA 1CE8B 1CUYA 1NIPA 4ND7A 4RF3A 4Y6SA 1XQ9A 1F3LA 3AEYA 3FOBA 4PY2A 4HLUA 1JEQB 3QTTA 4BBPA 2H1SA 4GLJA 3LT0A 3RT1A 1S2MA 3D6FA 2DHEA 5GZ1A 1V8PA 1SU8A 3RFXA 4RY9A 4BJ3A 3AFNA 4BNDA 5GY7A 4XYBA 3WK5A 2B20A 3MQ4A 1SBIA 4E7OA 3GUCA 1JG1A 3KKOA 5ECGC 4AQYB 4JYMA 2C7BA 4ENPA 1TUIA 4L0CA 1SMKA 3N8NA 3C3YA 3NHBA 4IH4A 2GOYA 3TE7A 1GEGA 3RFFA 3OJXA