4REOA

Mutant ribosomal protein l1 from thermus thermophilus with threonine 217 replaced by valine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
221
structure length
221
Chain Sequence
b'RALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTVMGPSVRINPHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Protein-RNA affinity of ribosomal protein L1 mutants does not correlate with the number of intermolecular interactions.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 57
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 4reoA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4reoA02
4REOA 1ZHOA 5DM60 4QVIA 3UMYA 3TG8A 3U4MA 1AD2A 3QOYA 4QG3A 3FPNA 1I2AA 5DM70 4F9TA 1DWUA 3ZQJA 4DFCB 2HW8A 1CJSA 4LQ4A 1U63A 4QGBA 3U56A 1MZPA
chains in the Genus database with same CATH superfamily
1VSUA 2NM0A 1TAHA 3E4CA 3EFEA 3RD5A 1CKEA 4QTYA 4HX2A 1DC6A 3KZ1E 2CHGA 4BAGA 2XIQA 1UPBA 4HXFB 4BVEA 2YVKA 5TS2A 3ESDA 4BE4A 1RC1A 1CEXA 2VDLB 2I2CA 4WXEA 1Q14A 5GJCA 1N6NA 2EV9A 4CKWB 2O9JA 2BLNA 4MDYA 1BCRB 1JQBA 2ZRNA 5H3LA 1U3CA 3GLUA 3GI1A 3DDCA 1MDFA 5CIWA 5CG1A 1D8AA 3MERA 1HR0B 4IIVA 4OL0A 3PDUA 5IYZA 2B1IA 1R15A 2FJUA 4Q0MA 1QX3A 4H0NA 4EMBA 4ZJUA 5K0LA 3RLFA 4EY3A 4ZEWA 2FG6C 3I6MA 5CT9A 2GXAA 1BE6A 1LC0A 3KR9A 3MOSA 1IEVA 4AXXA 1D2GA 1KRHA 2CLCX 4NMMA 1EBFA 1GPMA 2R00C 2WABA 3UHFA 3A6DA 4DLZA 1SXIA 2QRGA 3ONNA 4LXXA 4UXIA 5GM1A 4UEQA 1ADBA 1FFSA 3V1KA 1PUXA 4CTOA 3NT5A 2QW1A 4ND6A 2D1QA 2HQ1A 4XA8A 3L82B 2NZYA 5EWLA 3QEMB 4IDHA 3VGPA 4IAOA 5B4VA 2IDZA 1TK3A 4I2NA 1T5LA 4UAJA 5ALNA 1WSBA 3BVPA 5BRAA 1T9KA 1WEKA 3NP9A 4GICA 3SXUB 4BMSA 1RYYA 4KGVA 4LJ4A 3ER8A 3K2EA 1RE0A 4L15A 3MQ2A 2VAPA 4WD3A 3V4FA 3N2LA 2H2FA 4AB1A 2BFOA 1K9SA 4NV0A 1FFYA 2C2MA 2QRUA 5CNMA 3IUJA 4Z7NB 4HNRA 1B2RA 1UPTA 2PUJA 3B1XA 5I4KA 3H86A 2HTEA 3JQRA 4D46A 2YWDA 1R16A 1YE3A 1EVJA 3CN9A 4ESOA 2ZPTX 1MO6A 4QA9A 4BO0A 2Q1SA 3DVSX 4XCQA 3ZLUA 3FYDA 3R9XA 3ZKWA 4F6LA 3DBOB 4P22A 4PEVA 5KB3A 3RAFC 1H8HD 2ABWA 3JZAA 2TYSB 3AIKA 4O4LF 4RNCA 4ZVMA 4I66A 2C2ZA 4NCHA 4AI6A 4HDMA 4UJ3A 3C87A 4OAQA 5HF9A 1I9CA 3MXOA 2ANBA 2IY9A 3NM4A 4QARA 4V0OA 5LNK6 3L6OO 1RKUA 1OFUA 3MB5A 1JA1A 4ER7A 3K9HA 4PG8A 2AFVA 3ORFA 2UXBB 3AVOA 2PFSA 3LP8A 2YBDA 3AI1A 4DLLA 4QOHA 4IIBA 1WXXA 1EFCA 4KGDA 3K6SB 4CXMA 2YZMA 2PJUA 3RUDA 3M4YA 4DTIA 2GAOA 1USKA 2VP0A 2K4MA 1KMCA 1SQGA 1A8IA 1B6RA 3TQTA 1B1CA 1EVZA 3D6FA 1KZ1A 3H5NA 2CB9A 2I8AA 3FROA 3OQIB 4RABA 5J63A 6NULA 2C7QA 1YBAA 2DFXI 1D1QA 1FP6A 2EKBA 4YDQA 1N57A 1NMQA 4MB2A 3RT1A 2DWPA 3AONB 2F1JA 2GYYA 3HB9A 4HAIA 4P7GA 1UBLS 5ALDA 1KMIY 3TTYA 4IF6A 3CB4A 1U7HA 1P18A 3REOA 1HQKA 2YHSA 4MWDA 1WMSA 4URXR 1XNQB 2CK3D 2HJHA 4MA0A 4Z4EA 1G63A 3K8ZA 4QEKA 6REQB 4H4DA 2PXAA 3GEMA 1T36B 4RY0A 5DHFA 2HU7A 3THRA 1KR5A 1N2HA 2ZRMA 4ENSA 4NC9A 2BHLA 1YR7A 2CLIB 2FMHA 2CDNA 5FHRA 3UH1A 5JT1A 4IL5A 2Q99A 3GQBB 3JD0A 3NRJA 1AOXA 4KIGA 4RY8A 2XVAA 4EY8A 4ENWA 2CV0A 3SC4A 4EJ0A 1IBRA 1UPAA 4M1TA 1W6RA 2FDXA 3E27A 3ILHA 3KB8A 3FR7A 4MMYB 3E7PA 1HG0A 5EIFA 4JIMA 1EA7A 4DIUA 4K03A 1ZKDA 2FRDA 3PWKA 1L9KA 5E2IA 2EQ5A 3Q0TA 1CQIB 5EKTA 2BMVA 2BMFA 2Q2OA 3OKFA 4WECA 1K63A 1VLVA 1OZAA 4WLUA 1M75A 5B6IA 4I1PA 4LHVA 1BDMA 2GN1A 4AX8A 4WN9B 1TPZA 1Z4KA 1W34A 1N0WA 1WPRA 2NPIA 3EGDA 1NW7A 1J7KA 2I1WA 3L8DA 4Y1RB 4Y2GA 1WHTA 2DQZA 5JW6A 4G8DA 1PNOA 1U7OA 4NDNE 2NX2A 3KOOA 2HK8A 3NTQA 1NG9A 4FBMA 2PGNA 4HAXA 2FSGA 2VPWA 3VOAA 3KDSE 2VP3A 3KAJA 2P40A 3GLVA 3EX7C 3G13A 3KHUA 2PUAA 2NU6A 2O3QA 3K72B 2EOAA 2WV9A 1RXSA 2CVOA 5AUQA 1QIGA 2PD4A 4CVNA 1U8AA 1OI3A 4LDQA 3G5UA 1G3UA 1QH8A 2AFHB 4HLQB 1DPFA 5F5NA 1SBZA 4Z9BA 2V74B 3PGJA 1RZRA 3PD0A 1GA1A 3OOJA 4BBPA 1B76A 2NT3A 5K3FB 3U5TA 3QEBZ 3OZGA 2ZIEA 1UK9A 3GFFA 4GI3A 1E98A 1EE1A 5HX7A 3NTLA 2OPBA 4U5QA 4IKEA 1YZLA 5FLXA 3OG9A 1JLKA 2QNIA 5IJAA 1L4LA 4N7RA 1VYTA 3TSWA 4ARIA 1N6IA 2OYCA 3K9CA 2B2XA 1JJAA 5HILA 3HN7A 2XCSB 1A7JA 2DJIA 2R6GA 1ZNQO 1MC5A 3C7TA 1QBKC 4DMRA 1BXRB 1R6TA 2FRXA 3A4VA 3WKCA 2PGOA 4GSLA 1EDDA 1DCMA 4M8KA 1RI4A 2CVHA 3ABZA 3L7JA 3MWJA 3KTDA 5BYBA 2QD2A 3U3ZA 5KDOA 4B3SB 1BQ3A 1VKOA 2RHTA 2ZVPX 3LQFA 1TM7E 2F8LA 4WKCA 5FYDA 4FWIB 3SM9A 5JAUA 5GGYA 4HRYA 4JA2A 3HSKA 3NIGB 1RMTA 5CH3A 3KQNA 4HGPA 2WM3A 4P3OA 3MRSA 4KQIA 5IMSA 2ZYAA 4K6FA 3M83A 5AIAA 1U0FA 3S81A 2WR8A 2AOTA 3OPNA 2ORVA 4HS9A 1E9SA 1G20B 2OHJA 2QZZA 2VDWA 2A88A 1BVYF 2QTLA 1DB3A 3DL0A 4R51A 3UC9A 4DUPA 3R09A 4DY4A 4Z51A 2AD5A 1DKLA 2GRUA 3FCOA 1S89A 2QSJA 2V97A 3CA8A 3P2KA 1I51A 1KETA 4IPTA 4QVKA 5JISA 4YV7A 1SPXA 1NLUA 3FHTA 9MHTA 3MT0A 4HFNA 5KQGA 1RWOA 1F6BA 2B2NA 1MJGM 1MJFA 1SKAA 2BISA 2DBRA 3DCIA 3FCAA 1B8VA 2WF5A 3O90A 4BO3A 1GM5A 1LK5A 2D54A 3WS7A 1PWHA 1GKKA 5CFNA 2I4LA 5H83A 3TMAA 3PG5A 3L5OA 3ICQB 3FGOA 3HXPA 3SX4A 5M5BA 5KJCA 2C8VA 1VPDA 1BS2A 3QKWA 4JC0A 1U1CA 2QZ9A 1YASA 3G88A 1CZOA 2GD2A 4EQ6B 4K0KB 4ARZA 4DW8A 1T8SA 2I6SA 4PAOA 1GUBA 1WBBA 2VRBA 2GA9A 4GXRA 2E55A 4PPNA 1Z8HA 2LW7A 1PGPA 2X77A 3NUGA 1T0JB 5K3AA 1P0QA 1V47A 2RAUA 4EDFA 3L79A 1THZA 2WAYA 4AY6A 4A10A 2Q4OA 3HYLA 4JLKA 3DE0X 3I8XA 3C5WP 4L57A 4BO4A 2XWBF 1JDZA 3LPMA 3D0KA 3DAPA 5CT6A 3IOCA 4BNIA 3BORA 3RYCA 4G5QA 5BWBA 5AKZA 1M2WA 2PS1A 5DN9A 5FPQA 5TMEA 3N6VA 5E3JA 1HLFA 5ICCA 1MORA 1YS7A 2ZFUA 4M6WA 1F0PA 1RCFA 5BMOA 2GAIA 2VHJA 1WVIA 3Q1KA 3ITDA 1J21A 3OZXA 3JZMA 4BVAA 4D8TA 4ETMA 3HZHA 3CW8X 1BWQA 2CC2A 2WZCA 1AKQA 2I7TA 3KB6A 4M38A 1O6BA 4O4LA 4OHOA 1I32A 1UL1X 4RZQA 4TV8B 3W5VA 1VM6A 2DX7A 4C4RA 5J1SB 1QJCA 3CTPA 4UHDA 2R8ZA 1DJQA 1FE8A 1SVUA 4G0WA 1GADO 3O3CA 1A27A 5AO9A 4NZOA 3L77A 1PNQA 1THMA 2GK3A 2WTXA 2XY4A 3FHJA 4MQ5A 3JASB 5ALHA 5FBHA 4E3WA 5KVVA 2HBZA 1WVGA 4BV8A 4EARA 4KPEC 1R0LA 3OE7D 3QOXA 1Q22A 2REXB 3F6YA 3NC1C 4KSYA 3EZ7A 4NAHA 4R6WA 2HFKA 4D9JA 4CIAA 3ZVNA 3MCAA 4Q4JA 2XDAA 1UC5B 2QRKA 1FDTA 5LZ4A 1KE2A 2MSLA 1G41A 1L4MA 1V2GA 4YXWA 4UU8A 2CL7X 2FLWA 3NHBA 3QVUA 4CM9D 3E22B 4EPWA 2ZUSA 4EPXA 1O58A 2HZBA 2QVBA 4OQMA 3BUSA 1RM4A 4B8ZA 4JLDA 4KWCA 5EQJB 1WW2A 4MX8A 1XJ5A 3GCWA 4HFJA 3RF7A 5CD1A 2BBOA 3L7AA 3BWBA 8MHTA 4UDOA 2AZTA 3PNQA 4G1EB 1RYZA 3F3MA 3JAKA 4MW5A 2O8EA 2PE5A 4Q37A 5KWSA 3DEKA 3E58A 3WGUA 2BFEA 2EG9A 3NB0A 1W4ZA 2D1SA 5AI8A 4CLOB 3QUBA 4ZC1A 2AN9A 2YIVX 1IH8A 3K05A 3GBSA 3NIBA 4Z9FA 3IO5A 1DCTA 2W6OA 4RPHA 4F1WA 1E7WA 3EXIA 1TW2A 4FX5A 4NH0A 3VR6D 4EGFA 1Q1EA 1QVAA 1WSWA 3AQIA 5JYEA 1Z3IX 4OXNA 3QJYA 3IJPA 3D5TA 2WSBA 2D2IA 3ANTA 3BRSA 1X1BA 3KHKA 3C3EA 1Q12A 3VH2A 3G5LA 5AKYA 5IT0A 1J97A 3SF8B 1WSAA 3PUJA 1ORRA 1F20A 3CRZA 5DF1A 3R23A 5A5GA 4UHKA 1ULZA 3VC1A 4F4CA 5EJ8A 3STTA 1EWTA 3U3KA 3BWVA 1QVVA 4YJHB 3WL6A 2QTGA 4LBZA 1N8TA 2Q3MA 4MGEA 2VBIA 5IWAB 2ZRGA 3AV0B 1KJIA 1WCWA 3C41J 1MRZA 2R4QA 2QI9C 3HN6A 4LJLA 4QLBA 4NG5A 4HAZA 3E9MA 3FYUA 2NACA 1NUUA 4LWOA 2HY7A 3U9SA 1Z8FA 2AJ8A 3I58A 2B4RO 3DT8A 4R2JA 3MF4A 2GZ1A 3GA7A 3A9VA 2Z9DA 5ALTA 2HAEA 5EI5A 5KVQA 1FUUA 4IZIA 1YJBA 5HCNA 4FB5A 5ALWA 1C7IA 2H00A 4NYMR 2O8CA 4GLJA 3WBBA 3JWJA 3ZK8A 1S3IA 1DQRA 4X91A 3CX8A 3EVGA 4G0QA 1W4BA 4QXAA 3CKYA 3DF7A 2BR3A 4E1BA 1KQOA 4I50B 1MX1A 4JJ7A 5CDHA 3EG9A 1L7EA 1V5WA 2O5VA 3IQEA 3KZNA 2J9YB 5KKAA 3J81A 1VA5A 2VJBA 3OSZA 1Z47A 3VC2A 4YCSA 3EPKA 1Y3AA 4E21A 3E82A 2EX0A 1RR6A 1M9NA 3GUUA 1PGNA 2H85A 4WHMA 3TLMA 4U2EA 2I33A 2A30A 3WJAA 3ZBUA 3QRWA 3OF3A 2CXOA 5EWJA 3PFHA 3ICWA 4FX2A 3LC2O 1XZNA 2Y93A 3BRWD 2P9HA 2DLCX 3TSCA 2CJFA 1FZTA 3A3OA 4M88A 4RH3A 1ZGBA 5AVYA 1M8JA 4YI3A 5T8KA 2J5KA 4Q1VA 1O0CA 1K0UA 4BVFA 4Y9SA 1E2GA 5ECWA 2WJ3A 2RIRA 3I09A 4OGLA 3JAWA 1EMDA 4XYEA 4N0MA 1RBYA 1R6VA 2LXNA 4PYIA 2A14A 3EZLA 3KYBA 4PTYA 2C4WA 1U6JA 3R7FA 3SICE 3D8RA 4I9FA 3SKXA 1HDEA 3V3TA 1MG0A 1OJ7A 3I2KA 1SXJB 2WWVD 3S70A 5FP0A 3L49A 2WKQA 3DV2A 2DE0X 1JBEA 4DIKA 1K3TA 3KJZA 5JAIA 4NZPA 4ZIRA 1L7PA 4MVJF 3GFGA 4OBWA 4ZAGA 5GJWC 1QE0A 1O77A 4PYLA 1WHSB 2H2WA 3ZDCA 1YH3A 1II0A 3VOTA 1F3OA 1U2DA 4BNWA 4UAUA 1I30A 3DGEC 4BBZA 3E23A 3CO5A 1CJKC 1M2VA 3I1FA 1ZUHA 4RH1A 4G9BA 4A03A 3R5HA 1A1SA 4RD6A 2CNWA 3UFXB 5KNCA 2W6QA 2PLFA 2OQ2A 4B80A 4D1YA 4E46A 2EL7A 4FLFA 4YJ3A 3LQRA 2BZ0A 2QR2A 3AESA 1EFPB 4YRFA 4IF4A 4ZP1A 1M2OA 3NHKA 5TLSA 2WIDA 2QDKA 2X0EA 2EZ8A 4J0KA 1K97A 4X1OA 2P5SA 4YR7A 2UZ4A 4NPCA 2NZXA 3W05A 3UB4A 1ZW6A 1Y6QA 1A8HA 2PWAA 4JLUA 2XMRA 2ZBVA 1Y8CA 1AS2A 1MB4A 4TS1A 3CUSA 5JJIA 1KY5A 2G8NA 1DS6A 2FEOA 3IV9A 1ZI8A 4QODA 2IHJA 3ICPA 2VZLA 4ER6A 3FTPA 4LXGA 2EFEB 4M86A 4MVWA 3A14A 4HNAA 1INLA 5TNXA 3UJ9A 4GPTA 1YDHA 2C7BA 1OHHD 1E2IA 3AH8A 1WB6A 4KZPA 4DIBA 1CY4A 4H1HA 4ZHSA 3UBTA 1VBNA 5FH9A 4OQEA 1WMDA 3CPJB 4R2XA 4AJEA 5J23A 3G2IA 4FONA 1HX7A 5MGNA 1EXVA 3F6PA 3U4GA 1AJEA 3LY8A 3VPAA 1NJFA 4C2BA 1EHCA 2DYKA 3LECA 4TLCA 2GX6A 4N3NA 1G3MA 4RJTA 4ENPA 5JJLA 4MS3B 4OA5A 3ZIUA 1J1ZA 2ERYA 1IN7A 1DFGA 3L07A 1N6RA 3ZTTA 2RK4A 1G7RA 1XZQA 4FCTA 1W0CA 3DP7A 4O2BF 2AKAB 5SZHB 3MJHA 3RBAA 2BH2A 4NXMB 3U60B 2OA0A 3DWGA 3DH0A 3FWZA 1MAHA 4JH0A 4F45A 3SS9X 3A27A 1PHRA 2A1TR 4MW7A 1MHTA 4FNGA 3ZH2A 2WD7B 2CCGA 3QWAA 4ICIA 4OP2A 1WIWA 2H07A 3V4VB 4P4UA 7YASA 1H5NA 5ADUS 5FOTA 3RR2A 1M34A 1QQBA 1Z9BA 1HI9A 3MM4A 4DCPA 2XI4A 2P6MA 4IOJA 4E4RA 1EJ2A 1G21A 4KXNA 2WIBA 4DCTA 2QRZA 1CP2A 1CV2A 3RUIA 3MQFA 5IBRA 1HLDA 3JVDA 3MS4A 2ZSDA 5F2EA 1G2PA 4PYNA 1Z16A 1PEYA 3OPYB 4J1TA 2RHGB 2RBEA 5AOCA 1CUFA 1CQJA 2FRVA 2P3QA 2QD5A 5EMJA 3SQDA 2YHUA 1ULBA 4XGIA 3QI7A 2DECA 2BFPA 2OCKA 4HTFB 1HFEL 3D6UA 3PL1A 3PSHA 3DOJA 1C4OA 2LKDA 3AFHA 4YMLA 1T5OA 3TXAA 1L5FA 4OLFA 1U8FO 1Z3CA 1THGA 4ZZIA 1PKEA 2PG3A 3MUEA 3U7FB 1MTOA 3ZK9A 5AQ1A 1V7QA 2QWXA 1NWHA 2W0MA 2VYVA 3LIPA 4R31A 1V1MB 3N58A 4FSXA 3T5PA 2QIOA 4Q3OA 4JVOA 4ZK6A 4EGCB 4ZT7A 3DZ8A 3L3BA 2NU9B 1XDGA 4BFCA 2WV7A 1GP2A 1OA0A 3UH0A 3F6SA 2X6RA 3BE8A 3TBFA 5E6UA 1AF7A 3OCCA 3JALB 4NFSA 2DFKB 3SG0A 4PRKA 1WUYA 3PHHA 4FFSA 1BE1A 4NX2A 3RGWS 1I2CA 4J7XA 1DOZA 1PR5A 3H4TA 3L8EA 4JASB 5HDBB 3ZYZA 2Z2ZA 1JYFA 1PJLA 4DE5A 3F5SA 3ZXWB 4XE5A 1CUAA 1PR6A 4CW7A 2H06A 1G64A 4O2AF 1R4ZA 4DRYA 5G53C 5IJ9A 2W48A 4ZEMA 4Y67A 1SKUA 2LDBA 2HPAA 1JQDA 2ZYHA 4AKHA 3VVBA 4TYYA 4F21A 3LCUA 1JAYA 5GZ1A 4J4TA 2A7QA 2HCTA 3UJCA 4X8MA 3IBFA 2PT6A 4F6CA 1IR21 4U7FA 2ZRDA 1DINA 4MYRA 2J3MA 3IEIA 4HY3A 5ENVA 4HQOA 4WACA 2IOFA 1JEAA 5BV1A 1TUIA 4E5SA 3NYWA 4LBVA 1II8A 3EIQA 4NY1A 4R5HA 1Z5WA 3T3GA 4H7IA 3CH4B 4ENVA 4XUGB 1O97D 1JIUA 4E1VA 1KYZA 2IW3A 1JTFA 2O8FB 3G0CA 5K0GA 1QK5A 5ITVA 1J09A 3CLTC 5JXIA 1Q91A 3I9MA 1M76A 3DVAB 4FFPA 4BQQA 2QVXX 1H85A 1TUBB 4LJ5A 4RYLA 1EINA 2F17A 1DAGA 4DAEA 4YDSA 4QT4A 3LXUX 1KO4A 4YMWA 3T7SA 1G8SA 3IKLA 3OVMA 1ND6A 2J3JA 3LHFA 3V8MA 4PIVA 1XIVA 4NCXA 3AEZA 5CA1F 4FLMA 5BW4A 5COQA 1IQUA 2GS9A 3JQ8A 1G5PA 4BVGA 2J0UB 3FVRA 3E9RA 1V71A 1UAGA 1Y5NA 3SMQA 4FFRA 2V6JA 2VF7A 4O25A 2GZMA 4W63A 4NI5A 1KFKB 3BT7A 1ZD1A 2DKOA 4TS4A 4L8LA 1CCWA 1AUXA 1MJGA 1OYYA 2FRDC 2O2CA 4R1LA 5JIBA 2DQKA 4XQCA 4BDSA 3EYAA 4HYTA 1VL0A 1P0PA 5K3SA 1LDMA 2VYND 3T1OA 1HQDA 4U2KA 2PD3A 2C95A 4GLFA 4KWHA 4MVJA 5AHOA 4B44A 3BMOA 3TRFA 2V58A 1KGDA 4IXMA 4J9UE 4K3VA 4MARA 4RUKA 4EA7A 5BN3A 1BDIA 4MKVS 1HMYA 2YN4A 1A9RA 4RMNA 1SXQA 4FD2A 4JB8A 3CJQA 1O54A 1S2DA 2LZ0A 3CX7A 4ONEA 3U5ZB 5CPFA 5KSOA 2XA9A 3E7FA 4LDRA 3FNEA 4MYHA 2IHTA 4M46A 2INGX 1IBLB 4MYTA 4J07A 2MSNA 3W34A 2N42A 3RFVA 1A88A 3EXFA 3L9WA 4JXKA 5AKGA 3I53A 3EC2A 1UJ5A 3QM1A 2R7NA 1TUEA 5CB4A 1C3OB 5DTEA 5TGTA 1XDZA 421PA 4DKJA 1CU1A 3FMFA 4ES6A 5BR4A 4HRVA 3KX2A 3ZX4A 4L5BA 2AC7A 3PKIA 1JSCA 2EFYA 2H59A 3MJFA 3D7SA 4CQMD 2IS6A 4HUQA 2UZ1A 1NF3A 1CUSA 2G9ZA 4R9VA 3I5XA 3MG9A 4GYYA 5AESA 1K7FB 4CQMB 2B92A 4OHXA 2C4TA 1GTRA 2ZJ3A 2ZYIA 2R6AA 2XVZA 5E7QA 1P9RA 2RAVA 3I34X 2G83A 1QCDA 2PO5A 1Q5PA 4V1CA 3V4RA 4AWXA 3TCXB 3TAXA 1IONA 3RIHA 2QX4A 4C5CA 1SCDA 1R00A 2Z8ZA 3CISA 4ZRMA 3SN6A 1W36D 2QYTA 3LYLA 1R50A 3DCNA 3MAAC 1U65A 4HWPA 2W6IA 3U31A 3DXYA 1ADGA 4Q9AA 1ZOOA 5ALXA 4DNOA 2HU8A 4XR9A 3IJRA 4ZVKA 3SC3A 3EDOA 2DPMA 4JI3B 5C8VA 3PLAE 2IS2A 2YWCA 2IYZA 3T9AA 5H68A 2XH8A 1HDCA 3IKMB 3JATA 4O2BA 1Y34E 4P80A 2YX1A 4CZ2A 5IDQA 5AHKA 4J2HA 2V9CA 3N8KA 1K75A 3NHUA 3JQ9A 1XU9A 2GUGA 2RHDA 4JROA 4KYIB 3OCYA 4Q7MB 4RE6A 4GD3Q 4X93A 2VFAA 3TM4A 2PXHA 2KYRA 1R64A 3A1DA 4UUQA 1LVHA 1I24A 4AIRA 1J1IA 1W9HA 3BMXA 3CX6A 4V0KA 1P77A 3ZR4B 1EM8A 2HV9A 2XCTB 3O8OB 3TLKA 1R4NA 1Y8AA 2X0JA 3W3ZB 4I6EA 3ZUPA 2R8RA 2JA2A 3B38A 4A9AA 3EG5A 1CS0B 1UJBA 2VRWA 3L8ZA 3WNCA 4EI2A 1I2ZA 3M4XA 5B1SA 1IZ0A 3WGQA 4KYUA 3MUNA 5M3BA 1JKIA 5LQSA 4N5IX 3EAGA 4P84A 1ECCA 2QY6A 4ANFA 3FPHA 1RYBA 3QXXA 3O8RA 1K1EA 2W6MA 2WWWA 4C78A 4OQNA 3D4OA 1H6BA 4RNDB 3N76A 5D01A 3UJAA 1PI3A 3I6BA 2C83A 4L27A 4AZVA 1TA4A 4BLOA 4O4IF 1WCYA 1GDHA 3IVXA 3DS8A 4BEWA 1LGYA 2YS6A 2V9PA 3HU2A 3KFLA 3P9PA 1ZKMA 3EEOA 4DV3B 4UPDA 3DFKA 2NGRA 3QFCA 3UQZA 1ZOLA 4E4TA 3UOAB 3HCDA 4KVAA 2PKQO 3ZV7A 5KCZA 5LMUB 1TEXA 1X2BA 1G3IA 1UP6A 1SB9A 3OHPA 3AERB 1RWBA 121PA 1ZUNA 5ALLA 3WLMA 2RE8A 2G25A 3VZQA 1LI5A 1K5PA 2YHAA 1F0KA 5ERGB 4HNGA 4NEQA 3C6QA 4TQ9A 2YXBA 4TSKA 1JF8A 5JV5A 3EB9A 3AHGA 4FYPA 4RVGA 4MWOA 4XOIA 1SD2A 3IB6A 4DR7B 1XQ1A 3KIPA 1LA2A 3LPLA 1AGRA 4NTZA 4UMDA 1Z0UA 3CINA 1EJ7S 1DU4A 1NW9B 2AZ4A 3OFJA 1BMFD 2QRVA 3D2CA 4LOHA 3RAPR 5DNUA 1J1UA 4YV1A 3OZ7A 1Y3IA 3LA8A 1HE2A 3LUHA 1UDXA 2JGJA 2NOAA 2P2LA 4GMDA 4GVLA 2Y68A 4WNIA 4IDCA 4JR0A 3RNLA 2Z4TA 4PFSA 2FG7C 1GTVA 4BMOB 3WKAA 1YBVA 1NBMA 1EZ1A 4Z9AA 2FPXA 3HBFA 3AEUB 5CFOA 2HF9A 3I6ZA 1B0AA 3PC4A 1R0YA 3LYUA 5EUQB 3WK5A 3ZHTA 2ICAA 4QXQA 5I01A 2IDKA 2QUAA 4N3GA 5DYWA 2ROQA 5CVDA 2R25B 4FMDF 3E05A 5B1HA 3SOZA 1AG9A 3CKKA 4G0VA 2VL7A 3W2HA 2QRMA 3RVMA 4BUJA 5DCLA 1AS3A 1H2EA 2GFHA 2IPAB 2K6GA 4KQEA 3RADC 1FFCA 4JV5B 5F73A 1MR3F 2GOYA 2RGRA 1FCJA 2OXCA 3R4VA 4WEOA 1GPBA 4BQOA 5HHTA 1PQ4A 3BGDA 4V0SA 1R66A 5KX5A 1ZEJA 3RRJA 3IP6A 4TPKA 3QVMA 4RV4A 4BRWA 4D4HA 4MIYA 1LJUA 2HSWA 5IJ0B 3BMNB 4RH0A 1DKMA 4UUOA 1ES9A 3V34A 1QTQA 2DQYA 1N0UA 5CR9A 4ZPXA 1G9SA 1WTCA 1XO1A 2P30A 3VZPA 2YV2A 3GGSA 3HJAA 5L6LB 4DT1B 5TJHA 4LYYA 3ZWWA 5IVKA 2WFZA 2OLKA 4FXOA 1H3FA 3VU9B 1L1QA 4OBBA 1OKKD 4EH1A 5JZSA 2MINA 3TXXA 4QDZA 1PL8A 6CHYA 1TE2A 1A2BA 1X0VA 4IG9A 2K87A 5K0BA 3FLMA 3CURA 1CY1A 1NTOA 1LRJA 1WXQA 2PA0A 2WMOB 1J39A 3MCUA 1WS6A 3UJDA 4G09A 2JCYA 1YCGA 5A4KA 3UJ8A 5JZ9A 1J0CA 5CA1A 3KAKA 1LC3A 4TTIA 3ZWQA 4QUHA 3BG5A 2CVPA 1F3LA 2J3LA 2AOUA 2WTBA 2C07A 3PEEA 1RWKA 3L0SA 3SI7A 3C3WA 3I04M 1GNLA 4HO1X 1CJSA 1RTKA 4J16A 1MGOA 5BQ5A 1RMQA 5BSRA 3IODA 3V48A 1FSZA 3DMFA 4AMBA 4R71A 1HE3A 2ZJBA 4R0VA 3RV3A 1P1HA 1B6GA 3X1YA 2IEAA 2WHPA 3EW9A 3UOGA 2PEYA 5SZKB 3D3KA 2R65A 4DBVO 1TVKB 1Z07A 5A1JA 2C99A 4KWIA 1PNRA 2BDTA 3O82A 1HLGA 1X2EA 4DJJA 2JCBA 4UFPA 2BMWA 2J08A 2AXQA 2H3HA 4S35A 1LS1A 1YS4A 1PJ4A 4XQ0A 5G1OA 5J5VA 2VP6A 4GYWA 2HF2A 5IM4A 3UMSA 2PTGA 1N5KA 1Z2CA 5B3JA 2PQMA 3QVGB 3UT0A 3AKCA 1HEYA 4JP8A 4MUGA 5FUYA 4YPOA 1UM9B 2ZCUA 2BKVA 4AF7A 3GJ7A 3ZDRA 5LXTB 2HDHA 2PUWA 1Q15A 4KDFA 1QV9A 3LCMA 4B3FX 3DE1X 3R6GA 4F85A 3V46A 5LQUA 1W7AA 3FCXA 4KE9A 4G3XA 3B3QA 13PKA 2AXNA 2KBFA 4P4TA 4DA6A 1AHPA 4H6XA 5LB4A 5ALRA 5LFAA 2I67A 1SIWA 1OF1A 2BTQA 3UGKA 2KI5A 3DBHB 4EHDA 3NNDA 1PS0A 3H2ZA 2XITA 2XZLA 1PDVA 2OXRA 1XMJA 4FZVA 4NYJQ 1KH2A 4B83A 1AM4D 1YS6A 5J2TA 1J07A 1QYVA 1B8UA 3FG9A 2Y1OA 2BE7A 3IELA 3LP6A 3WA7A 4ZT5A 3H5IA 1BVHA 4YLGA 4HLUA 1ZJZA 1K4YA 3VDNB 1NRJB 2PT7A 4D81A 2VJYA 2Y77A 1IUPA 4HYYA 3K32A 2J7PD 3R75A 9LDTA 1JVBA 3L7IA 4GVPA 4N01A 1IXYA 1N9ZA 1OC4A 2GJKA 3BB4A 4ZO7A 1UXJA 5H3HA 1OXKB 4XD2A 5I48A 3UT6A 5F76A 3A6GA 2PMWB 3L1JA 2QZ4A 3I9LA 1LLUA 2QM3A 5GVRA 4ZI5A 3GWGA 4NXNB 1H1LB 1VXRA 4L3WA 1KY4A 3FVVA 1KMHB 1CETA 2XOXA 2QX6A 3C1UA 5F4BA 2ZRHA 2RH8A 2ONZA 3HVUA 3O4VA 1NHWA 3K09A 3QZUA 1NL3A 4XLLA 2YYZA 4E7OA 4TMXA 3OU7A 2JFUA 1QQ6A 2O3SA 2W4QA 1XUOA 4RK6A 5AQEA 2ZTLA 1P9NA 1Z56C 3F9RA 3OKCA 2CF6A 3HR8A 2AMLA 4D4KA 1H8HA 2R8EA 4AP9A 3E84A 3E8MA 1SFRA 4YAJA 1JBKA 5JCXA 3SIPA 3O74A 5BSMA 1KZ4A 4LDZA 2BD0A 2O5RA 3PXEA 3U26A 1V3TA 2VHYA 1PCXA 2GZRA 2PT9A 2XDQA 3DPUA 1PT9A 1W25A 3G17A 1MMFB 2A4MA 3NAMA 3IBYA 2XT6A 3DDZX 1QQ5A 2IPXA 4LW8A 4ZVPA 4FYIA 1GRRA 4MV5A 4PLHA 4RY2A 5SYMA 3TIFA 3PRYA 4R8VA 3DBRA 1N9GA 4EGAA 2RHHA 2R1TA 2BHSA 4J8PA 4O5AA 5BN5B 4X92A 2VHEA 1NF8A 1M67A 4FDAA 1PEKE 1UQRA 1ZJ5A 4A6DA 1TYAE 3NEPX 4CM8A 1ZQ9A 3WNDA 4A0RA 3OJOA 4NESA 1KVRA 4J6EA 1DQPA 2E9SA 1FMCA 1YHYA 1N2IA 2D2XA 3NU1A 4FOTA 3UVEA 3WQRA 4N6GA 2ZJAA 4OKNA 2JLBA 3A05A 4DLWA 2VH5R 4LY9A 4S1VA 3R7LA 3NKVA 2IU3A 1YKFA 1CSEE 1SPBS 1IQRA 3P1JA 4K6KA 3GLGA 1SD1A 3L43A 3WGJA 2GHQA 3KYCB 3KM0A 5G02A 3OEYA 4WZAB 3DEFA 2DH5A 4W99A 1F12A 4XGQA 1CS4C 2Q07A 2X1VA 3UGTA 3WLSA 1DRWA 2WW8A 1W8IA 1WXFA 3A37A 2CK3A 2YRXA 2VCYA 3H9CA 4LX0A 2JJ1D 4G8CA 2IOQA 1GGMA 3AXTA 3DAGA 1C7JA 1I0LA 1T3HA 5G4LA 5AFSA 1CUHA 4Q3CA 3B1VA 1J0DA 2Q27A 2J3DA 4I1RA 1LQUA 1IHOA 1QFSA 2ODTX 1VLQA 3DOEA 3L0ZA 1JHAA 1U3GA 3VAAA 3PXDA 3ID6C 3HEBA 3AXMS 4GUDA 2HKIA 5JAPA 1ESEA 2W37A 5K0FA 4R6XA 3SHVA 1K08A 4DC1A 5LD2B 4BMNA 1K27A 2W83A 3FIJA 1JJ7A 2AQIA 2EYUA 2JGKA 3G6KA 1UBJS 3IQIX 1DT5A 1FDIA 4FKZA 1RW4A 4JJEA 5LKAA 1U5BB 1SXHA 1UXGA 3FCCA 4KQ6A 4MP8A 1P8JA 5HKLA 3PJDA 5AW3A 1VRCA 1YDMA 2JPDA 3EC7A 1RHJA 4JAVC 3BMCB 3H6KA 3AIOA 3B2QA 2Q1WA 1ODKA 2Z5VA 2CDCA 3PFIA 4YP0A 2L2QA 1FX0B 2F2TA 3CRRA 4QD3A 3RBVA 3R7DA 3P26A 2DR2A 1ZMBA 3HABA 1V8OA 1JHVA 5JYDA 1ZIPA 1OWNA 3DXFA 1ST3A 2BZ1A 2R9VA 3A1FA 3DE3X 3KOZA 2A84A 4K3UA 1OTYA 4NCNA 1LLCA 4ZMRA 2DUJA 2VSXA 2UYOA 5JJCA 2BBWA 5FX2A 3RBXA 4WVFA 5BOSA 3C15C 1YD7A 2MYTA 5AICA 5EIXA 1L8XA 2DWCA 4RIIA 1UDCA 4F9FA 4I46A 1A4UA 4WCDA 5GIOE 4KQJA 1N8KA 1YDEA 1ENOA 5AT1A 4M22A 1DDOA 4RHXA 1QBGA 2QAGA 3CR7A 2PRKA 3JPYA 3MINB 4DG5A 3AM3A 1G60A 2FW0A 4TZKA 2XR1A 4B2IA 1T2NA 2H63A 2BEWA 4JYMA 3WMGA 3HLYA 1M83A 5T7BA 2VLIA 2IJGX 4JUBA 3T5CA 4OLHA 4CMKA 5HIMA 5FDFA 4JBGA 5E1DA 4ZT6A 1SIUA 4DQXA 4FFVA 4DV1B 3DYIA 3G9QA 3R0VA 4MIEA 2BONA 2QQGA 3D2LA 2G9VA 1LS6A 4DQLA 3UB2A 3CC8A 1TCCA 2WF6A 4LJ9A 3ZLTA 2GD6A 2PS0A 5IAAA 5F3WB 1UZHC 1COZA 1V16B 1Z2EA 1NRIA 4RDCA 4ZYZA 3QMMA 3DNMA 5HUQA 5CNIA 4QOSA 4QOFA 5DX8A 1AXRA 3UHOA 3OT5A 4M1MA 4UTZA 3I1YA 3DAFA 3LLUA 1RWXA 2KB0A 2Q6VA 4MS4A 5JD3A 4UMVA 1YU9A 2HO5A 5EKXA 3WQSB 1R6AA 1C7FA 3N8DA 3U1VA 4B6OA 3TL2A 3ZD8A 4BFXA 4BX8A 1QPGA 5KOYA 1GRCA 1Z15A 3PHIA 1XLWA 2GZAA 3SOPA 1SOAA 4HVAA 5EYPB 1PFWA 1HNNA 4FMPA 3M6VA 4ZT4A 4MI1A 4ZJZA 2VEOA 3BYZA 1RJ9A 3NBMA 5DMHA 2Q7XA 5TJ9A 4RIFA 4RJKA 2OM2A 1DFHA 4RDIA 1RIIA 2OXIA 5H81A 4DRXA 4UM8B 5JAMA 1DUSA 1G3RA 3FNQA 4ZEVA 2W6PA 2YN2A 1VHQA 5JR3A 3SBDA 4NK5A 3R3SA 3STYA 2AR0A 3A2NA 5AI9A 4EKGA 4HNSA 5CVJA 5JU6A 3EXAA 1R0BA 1XKTA 2Z95A 4MAMA 3KEFA 4BU1A 5I7WA 1I5RA 4IFEA 5H16A 3P9IA 5FAKA 3MELA 5FTKA 5IJZA 4XFJA 4A82A 5FTJA 2A1TS 1N36B 3DOOA 4B3JA 4GOJA 1JKJB 2VH1A 4IW3B 1C29B 2A4KA 3I9V6 4LXIA 4OK6A 4UFOA 4AURA 3KJQA 1GWNA 3EHDA 1LX6A 5EVCA 1V95A 2EX4A 3DLHA 2HMWA 1V4BA 4WCFC 1NR5A 1PK7A 3HADA 2QTBA 3I2GA 3LK6A 1IJBA 4D57A 2DPXA 2CN1A 1QG0A 4HAYA 1SUWA 4LXUA 4XJXA 1YK0A 2O05A 1UH5A 2C00A 4UVHA 1WMAA 2XGSA 3VR4D 1BWSA 2F6RA 2EBFX 3N0XA 4JLBA 2GPAA 4YFVA 3CLUC 2HDWA 1I4DD 1S3SA 3KEGA 5MF6A 3HRKA 3D8SA 2QZPA 2GEVA 5JQWA 1RWQA 3EFHA 4NZ9A 4XWGA 1ZNXA 3NHWA 1J42A 1F8XA 2F48A 2CLOB 5K8JB 3SVLA 5DI3B 4BP9A 1N8SA 5DNDA 5IAKA 2YZ7A 2AG6A 4AYXA 4CM4B 3FTDA 2IDMA 2HRZA 3PVSA 1L4KA 1FPMA 2FTKE 5A4MS 2DFDA 2AMFA 1Y3FE 5LQJA 4TKUB 3F1KA 2G71A 1UJMA 1Y7PA 2FFJA 4J0QA 3VC7A 2JI6A 2Q28A 4MQMA 3T9FA 2EKQA 2I65A 2HRQA 2PMBA 2YZ2A 3GRPA 1M7HA 2WJ6A 4Q93A 5DYYA 5A3QA 2CXQA 1M6VB 1E4OA 2QN3A 4L8YA 3FZEA 3WDKA 5G0WA 6ADHA 4RFVA 5JANA 4KN8A 4N8DA 1GG9A 1MB0A 4YRTA 2I9KA 2ZQ5A 5CAEB 2DP4E 3PDCA 4DM7A 1HQYE 1HFJA 3FGZA 1Y5MA 2QUHA 5HTOA 3OEHA 3ZNPA 1G18A 2GTPA 3TRKA 2I1QA 2X2OA 4HDKB 4N8EA 3AUJB 3JQCA 5FL7A 4WDRA 1RXIA 1GQYA 3EZ6A 1VKHA 1Z4IA 3NLLA 3D6TB 3I28A 1P7VA 1GFZA 1N92A 4WRRA 4UOEA 5K9ZA 1YOBA 2VAWA 3W5JA 3INNA 5AM3A 1YI1A 5A5VA 3BCUA 5T5QA 5TQ2A 4BPRA 2NUPA 1BWRA 2NZVG 4H2DA 4A8JC 3O7WA 4RTKA 5CHEA 1BVUA 2F3RA 2FZVA 3WOHA 1U6IA 2JI9A 2OB2A 3ESZA 3OH8A 3RVDA 4NV3A 1M6YA 3W8EA 1MA3A 2YICA 3PUYA 2FB9A 5CMLA 3CB2A 1C2TA 5IAEA 3SYRA 1J2YA 2JFOA 1DEXA 2BEKA 3OLXA 1XEXA 1ZJ6A 3QX9A 3T1VA 1XEFA 2FJ0A 1DADA 4IIEA 1JHOA 3L0PA 5I9BA 4AMZA 4KXLA 1JXQA 2I2AA 1DUIA 1W88B 4OQQA 4C7OA 2O1WA 1K3FA 1OLSA 3B6IA 3JQ9C 4PZ0A 4UQLA 2V7QD 1OYWA 3IQFA 3TBHA 1WJGA 1EK2A 3BEOA 3ROXA 4BFSA 3ZCSA 1GPJA 1CDOA 3R7NA 5HXAA 2B5OA 1JEYA 2NU7B 3PPIA 3QSYA 4LHSA 2JIZA 5AJHA 3TS1A 1G7SA 3ER9A 4ZTZB 2D6FA 1MXHA 2X7HA 5E7IA 3R0JA 5L4NA 2PK3A 1R10A 1D5WA 1L6RA 2DR3A 4DLKA 2ISCA 1DAKA 2IX9A 1UKEA 5DYTA 5BQOA 3RTDA 5LP6F 4KNVA 2ZBRA 3OA0A 3PF9A 2CUKA 2ASEA 2ZJ5A 4B3RB 4BNVA 4F4HA 1JQAA 3KPUA 5BXYA 3T7RA 1Z0ZA 4DLUA 3KJFA 4Q01A 4GAEA 2ZWIA 5KHOC 2JK0A 1G8YA 1E79A 1Y6RA 1CUUA 3CFYA 2R1UA 4R2KA 3A3NA 1LW6E 1M2JA 2JHGA 4F1JA 5M34A 3ADPA 3S2UA 1Z2AA 3V1NA 3HC7A 3IBTA 1KP3A 2QUIA 1G2OA 5ALVA 1PEDA 4MWTA 3K0AA 2P4HX 1DC4A 3AR2A 3PR3A 1YR9A 3RUFA 1BJKA 1NY5A 2A9PA 2H1RA 3K16A 4ZYTA 5FUMA 3GLIB 2HEIA 2NN3C 2OFWA 3I6YA 3B36A 4LRSB 5B6PA 2VQDA 4UAGA 2PVSA 1A4RA 1D2RA 3LIIA 4B32A 3G0HA 3PFBA 1JEJA 2IOFK 3MFYA 1QFYA 2QRLA 3PUHA 3BRWA 3LY5A 1TM1E 3AKYA 4UCWA 3U37A 2VYFA 4IQ8A 5DW0A 3EPRA 3I32A 2J4CA 5E8RA 4EABA 4ETIA 3K1TA 2NV2B 5DLPA 3IDOA 4MUKA 4AJKA 4F56A 4PAQA 1BE0A 3OM8A 1AMUA 1ZUD1 1MABB 1VFNA 5KNDD 5IEBA 1VGRA 2C1XA 2WILA 4XVUA 4EB6B 1EQ2A 1IHUA 2Q4EA 4NWIA 4CL0A 4XCVA 2VHUA 1KXJA 3R5TA 3BILA 3IBGA 4OJKA 4WNCA 1VPVA 5HK9A 5A3VA 1Q1ZA 4RCYA 4OI0A 1KEPA 3ZVMA 1WY7A 1R3DA 3FM9A 1ULHA 4E5NA 3OCJA 1MFZA 2N1MA 5EMHA 2X9LA 1VBMA 3L6DA 5EP1A 2COUA 3U1TA 1FZQA 5ABPA 5AIBA 3C3PA 4LFAB 2DCMA 4OGWA 4G0NA 4AY4A 3EUAA 4JEUA 3S3TA 1X80B 2B9VA 2BFCB 5F1PA 1K4KA 4F4DA 1WQ4A 2JI4A 5SICE 1E0JA 1C9KA 2V6FA 2TMYA 4AFNA 1N4AA 3COVA 3FKSD 2A1UA 4ZJYA 1WCXA 2JVJA 1Z0KA 3NFYA 1KYIA 4GPD1 1Z5OA 1SUIA 2HWUA 1J7JA 5CYFA 3IKJA 621PA 1JWBB 2B20A 3IP7A 1S4MA 1EFLA 3BHNA 4XX1A 1XD8A 3DV0B 4EIWA 5D5PA 2VWQA 3C8DA 3L41A 4AJLA 1KJYA 2ZULA 3HR4A 3PX7A 2XXBA 3ANXA 1C80A 1A8SA 4R16A 4YALA 1DKOA 1U0NA 1Y6ZA 2QNRA 2G1KA 2GFIA 4MA5A 4V0RA 5ALKA 2W2OA 1Z75A 2L17A 4KXXA 4WV3A 4Y30A 2V0NA 4L4ZA 1CR2A 1Q0LA 3BWYA 1I6MA 1WPXA 2X3UA 2EQBA 2ZVJA 3CONA 5B37A 4BV9A 1QPZA 3OD5A 2PX2A 4B40A 4ZXFA 2FEAA 1VG8A 3CUKA 4J16C 2HF8A 3K0SA 4HF7A 5I6DA 5EIAA 3G2PA 4BCCA 2R11A 3SYNA 3BBPA 2E82A 1EESA 2IBTA 4DA9A 5H4HA 1YV9A 4EI9A 2EJUA 3URMA 3FJOA 2I6QA 4FN5A 1YQUA 2VJNA 4L16A 4TYPA 5K0TA 2OHXA 1UK6A 5I8WA 4HEHA 4M9RA 1AQYA 4B09A 3GN1A 3HL4A 3CH6A 2XOKD 3KR2A 5HZKA 2JJ8A 1NV9A 3QF4B 4F9GA 3M1LA 1G42A 2OL4A 4IILA 3RWBA 3CR8A 1YRWA 2FPGB 2JFPA 5JTUA 5B3JC 2Z9BA 3AZOA 3F5DA 4I4TB 1CZRA 3WYGA 3BFXA 4J4BA 3ZV5A 4A6EA 2I62A 5E1OA 4N0EA 1TF7A 3G49A 1KOFA 3LDGA 1M34E 2CJPA 2IYVA 2PRYA 4FOOA 2ZYDA 4TZTA 2Z5FA 4HGZA 4ESEA 4F8EA 5HVNA 3HVIA 4DDHA 3T54A 3GARA 1G21E 2WTEA 2Z6UA 1C3EA 3B89A 3WMRA 1W59A 1VIAA 2OO5C 1Z2NX 4AG3A 3V7UA 3THYB 2IQ5A 1GZHB 1CDEA 1GTSA 2A0WA 4JUIA 1M54A 1RZUA 1GN9A 2HL6A 3WC4A 1MW8X 2I3GA 4ND2A 1QFZA 1X94A 4QAQA 4RHEA 1J25A 3FN4A 3LOQA 2DERA 3B20A 1UOOA 1RYHA 2VSFA 4D4JA 1H5UA 2ZE8A 3LW7A 1WXWA 4QJBA 5E6RB 4OU4A 5JATA 2ET6A 4BLPA 3OI7A 4W82A 1G98A 3NJRA 4F84A 2Y0PA 2ADMA 1J8YF 2QW0X 2VOJA 4ER5A 1B3RA 2OCIA 4RORA 2I1VB 1DEOA 3N0WA 1TU4A 1GHTA 3GAAA 4JEHA 3SR4A 1PSDA 2J7KA 1XPUA 3QPUA 1BJTA 1HRKA 1KYVA 1JNYA 1ZW1A 4OTZA 4YMGA 2SCUA 3LWDA 4YCLA 5EZYB 4TLBA 2GCOA 2JBWA 4OO3A 4BKMA 4KLAA 5FNVB 4EG1A 3X2SA 1M1YA 3T34A 4O2LA 1NNI1 2Q21A 1KI7A 2WZBA 3BK2A 3O38A 4OXIA 4Q3DA 4KOEC 1TMOA 1QNLA 1LDNA 3R20A 4N1AA 5JJKA 2JH3A 3K5PA 4JSYA 1S2LA 4QDTA 2IUFA 3ANMA 4I4IA 4B3IA 3LKZA 1OIXA 4RTSA 2C7OA 2WSSD 3DONA 1TRHA 5ER6A 2RHBA 1NVEA 4JEIA 3UKOA 4EY4A 2Q5IA 3WGTA 4Q19A 5JE8A 5LP6A 4C0KA 2I54A 2Z2JA 2JASA 2J0EA 3AM5A 5DW3A 1ITZA 1KIMA 3PD1A 3L7NA 4BN5A 3PX2A 2R86A 1SY7A 2JAXA 2NQ2C 3PDIB 2QG6A 3B7GA 3TR5A 3LT5A 1GV0A 3FOBA 3IQXA 2ZI7A 1Y9EA 2BM9A 3PEFA 1KC1A 3OM1A 4QHTA 2PIAA 2VTBA 2A59A 3HB5X 4M8LA 1V6CA 2GKGA 1UMKA 4S1WA 5L7YA 1C1HA 2X0RA 2XWPA 3Q0IA 4KQ1A 2NYVA 4M83A 4DDVA 4RXMA 5KTKA 1C7QA 3ZWYA 4GX0A 4OJTA 2HQRA 5G4KA 1UBHS 4BX9A 3U7GA 1MJ5A 2R8OA 1FMLA 1PWYE 1H5QA 3GDWA 3QXCA 4GS5A 4N12A 4TSRA 4XUDA 1GGJA 1QGUB 2NSJA 5HJ5A 2HREA 3WIVA 5A3SA 3G1WA 2FLKA 4MVJH 4EYEA 7MHTA 3G3EA 3JTMA 2P67A 4BO1A 4MLPA 3K1JA 1E5DA 3QHQA 1NC3A 1F2UA 1XTIA 4R4JA 4GBMA 2ZI4A 4TKVA 2C61A 2H7XA 2ZZMA 3SEZA 4CRWB 4BMYA 4IIJA 1JDBB 3Q6NA 4IDFA 3S6JA 1T34A 4ZA2A 4F5WA 1JFLA 3ZE1B 4KQHA 1TYBE 3TOZA 4C2AA 3U7HB 4BLUA 3GRAA 3PI7A 4H1VA 1ZJJA 3AF3A 2VJMB 4ZCQA 1AXEA 1NBAA 1EEXB 3NHFA 5ELLA 2QP3A 1ZXXA 2B69A 4TQGA 3TKYA 1TXGA 3Q3CA 5K3CA 3ZU4A 1C81A 2AOVA 3JARB 1WUJS 1H2WA 1E3EA 1K4MA 5DHPA 1P5RA 2I6TA 2F9MA 4M7PA 1AO0A 3TGWA 1B74A 3H8WA 4PZLA 4MVJE 2NSLA 4UHJA 4YMSA 2X22A 3LBYA 2VYNA 2JLYA 1QHHB 1WZUA 1QH1B 3JSXA 3JYLA 2F3TA 3PQ7A 4IHAA 5AKKA 3LLCA 3STXA 2O7SA 2I03A 1KJ9A 3LKDA 5DXFA 2B83A 2Z30A 5EFZA 4CMEA 1TO2E 3PV0A 4IVPA 3EXG2 3GLRA 3GWZA 3PQFA 4US0R 2D3WA 4O5OA 1G16A 2D0PB 2BFBB 3WDLA 2J9XB 3NNNA 4ZGGA 2FMFA 1Q16A 3G0IA 5GV8A 5F4ZA 1FFWA 4KBYA 4P4SA 4GT1A 3L2OB 4G5RA 4RMHA 3EJ6A 2W2TA 2ZREA 2GDZA 3M81A 3W79A 2ATVA 3TJZA 3ZHQA 5CA0B 2HRDA 1A8PA 1CX9B 5DNEA 2P2YA 4GX2A 3TZ6A 3TTTA 3V8EA 2ZYTX 4N5HX 3K30A 3VPBA 2Q5CA 4FI3F 3U9LA 4BFTA 2F9FA 3TD6A 2YFHA 3VH1A 4K2AA 1QE5A 1UBSB 1XKXA 1D4AA 1NU6A 2AFRA 3OOYA 5FTLA 1E9CA 3M9LA 2P68A 1J24A 1XD2B 5B7PA 1JECA 2WFAA 1O08A 3HI6A 4LMAA 3F6BX 2YWHA 5KOHA 3T1QA 1BU5A 4KUGA 4NKRA 5HG0A 2OGSA 4YRRA 3ZGZA 4LHXA 4LNUA 3WO1A 3JVVA 3BXZA 1Z25A 1FA9A 1W30A 4ADSG 1OVGA 1WZEA 1V11A 2FPUA 3EHEA 2OBMA 3ND7A 3BWMA 1DG1G 1ISIA 3O8QA 4HDRA 4PC3A 2JFXA 3SQLA 3U13A 4D6XA 5HNKA 4JSTA 4G4IA 1Y82A 3T9DA 3EVEA 1CE8A 3DJFA 3D3QA 2A6PA 2EKZA 2NVUA 3EDYA 4KXUA 3H0CA 4KITB 2QUBA 1XALA 3K94A 1NW6A 1I5EA 2GZDA 1E3TA 4DUGA 2A7XA 4DABA 1S9DA 3KL4A 3KP1A 4K8OA 1GXSB 1U04A 4DQ0A 1VKZA 3C3KA 1H9AA 3AUTA 1IXRC 3UPDA 4XR4A 2YJ5A 1JTVA 1J90A 4R7TA 3HL0A 1CRZA 1YRBA 1KMMA 3ZUGA 2OE2A 4UUBA 3EQ6A 3LV8A 3GJYA 4R2LA 1A98A 5BV2P 5TVGA 5LA6F 1PK8A 3NBXX 2WOOA 5NLLA 2IKSA 3QYPA 1EPUA 2ZWPA 5DGXA 2BBSA 1ZRSA 1GILA 2H2HA 2OFOA 4RL6A 2JGNA 3TRDA 5AVVA 2RC5A 2CDAA 1JR4A 2VPXA 2WWFA 3K8OE 1ORHA 5K01A 5FPTA 2ZM5A 1JAXA 2EGUA 3G6WA 4HHHS 5TE9A 1TD9A 1U0LA 5A4DA 4EEZA 4UNIA 4LF9B 1CF2O 1E0DA 4WADA 1FC0A 1RKBA 4X85A 1L2TA 1KYTA 4C0JA 1GUFA 3O6VA 3ZHXA 2BSQA 2DR0A 1WO8A 2WF9A 3ZQKA 4C6SA 5JVDF 4TV9F 4M1SA 1U8YA 5CLGA 4J76A 4I5GA 1LVUA 3OE1A 5INTA 3AVWA 3BH7A 1U2GC 1ODJA 3Q3GE 2I4RA 3K31A 1W0KD 3ANSA 2I4MA 1GLGA 4U02A 4EG3A 1PZNA 1P4AA 4WVLA 1S8NA 3CEJA 5AI0A 3TZHA 3WJ1A 1D2AA 3L7OA 3ELBA 2ZWOA 5ERXA 1M0EA 3NATA 4M0UA 2W70A 4ABYA 1TTPB 2NV6A 1HZZC 3IE2A 1ZX1A 1QVWA 4RQTA 1E1CB 1JSXA 1JIXA 2A5FA 2I7VA 2O48X 2XCLA 2ZE5A 3BFJA 4HZIA 3PT5A 3SZOA 1VCHA 1TYDE 5AXCA 3W4JA 1RC8A 1URPA 5GP1A 1RQ7A 1DJNA 2OAQ1 3AR4A 1Y0BA 4BGVA 2Z1MA 2HWXA 4U7GA 4W5RA 1I3OA 2ARKA 4JJKA 2XF2A 3GLSA 4W6QA 2BFNA 1L5QA 4AQDA 1NBME 2ATIA 2FZCA 3OZSA 3OU2A 1PBNA 5C5DA 2IELA 4C0LA 2O3RA 2BHRA 2V7TA 2XEDA 4UCQA 1OFHA 5L3ZA 3DW3X 4O59O 4NRDA 3OOEA 4CR7A 4XB2A 3RASA 5EE3A 4A1OA 1QCCA 1RQPA 4YROA 4AZ3B 1ZPDA 1WZ2A 1QGDA 1FQJA 3QELB 3SD7A 2Q8PA 2BGKA 2HPHA 1YBFA 2ZXUA 5FOSA 16PKA 5JEEA 4YCCA 1XU7A 2CUZA 1AZWA 1NYQA 3ZWBA 1QP7A 2WQ7A 4BWYA 4C7OB 3C8HA 1Q3KA 1YVDA 2IZ6A 1S6YA 3D8HA 1B23P 3T5DA 1GPH1 3QXJA 4CCAA 3KYDA 5A1TA 3E35A 1AGXA 1EP9A 2D5IA 2J5RA 4C1NA 4D8UA 2FR0A 2GN0A 1VPTA 2AEMA 3OIWA 3PXAA 4IHJB 5KMGA 4QPNA 2OCGA 2EFCB 5BV8A 1MQAA 4PR0A 3GRUA 3RK4A 4AJ4A 3WMWA 5BMVB 3FNRA 4IY1A 5CG2A 1RC0A 1U9YA 2AJBA 4A27A 3QEAZ 2X9NA 1N1EA 4Q1DA 3PIDA 2JGRA 3VYWA 3EPLA 5TT1A 3QYFA 3ZY6A 2Y4NA 1ECJA 2FWPA 3WK7A 2W6ZA 4RWZA 4CF5A 2W43A 1RRGA 4YREA 4RCVA 2D5AA 2GN6A 2PAFA 2WRZA 3SIXA 1SO8A 4BYGA 3ESRA 3FBTA 2B82A 2Q2VA 3C6YA 3U62A 1OYVA 2CL5A 4CG1A 4EVQA 3TW0A 4BO7A 1NPDA 2J3KA 2JB9A 2XDWA 3L7KA 2FG5A 2R7LA 1WXEA 2AI1A 1UZMA 1TZCA 1FFHA 2HBQA 1H3NA 2RKWA 4M9ZA 4LWZA 3LRXA 4UU7A 1KEKA 4AZ0B 1ZVKA 4NMLA 2J46A 1C9YA 3ZHZA 2PGIA 2R3SA 5A0FA 3HZOA 4J7UA 4E07A 4FDUA 1QHYA 1U0TA 4XX0B 4B76A 3K4QA 4PLCA 3LU1A 3VKUA 1ND5A 1YXMA 2UXCB 1DDIA 1AKVA 1GZSA 4E31A 3VSEA 3N8NA 5I4BA 4WUTA 4BNFA 4YXFA 4MV6A 3MJCA 1WG8A 2P6OA 5KWEA 1JEEA 4C21A 4Q4DA 4CT5A 2LCFA 2WG2A 4TXJA 2AK2A 3TGLA 4WLFA 4GPAA 3DTVD 1SVOA 5FQNA 1DAHA 2DPHA 1SBQA 1T3TA 3EXHC 2ETVA 4JXZA 3Q41A 3DTVB 1FTYA 1DXQA 1S2NA 4OB7A 3C48A 2E1RA 1EG2A 1G2QA 2YVQA 4FDTA 2VT3A 7ADHA 2W4IA 4KO3S 3PENA 1AZSC 5D3KA 4HVLA 4RK5A 3K9FC 3WOVA 3EEBA 4CN8A 3W3AH 4C0QC 2DF8A 2XGGA 2IOYA 3F5MA 5IM5A 1YIAA 1PVVA 1A5TA 4JVLA 3UB3A 4D44A 4EX6A 1YZVA 1JFFA 2AWNA 1GAJA 4DA0A 1BMDA 5CPBA 1EFTA 4U4AA 2QK4A 2ENUA 3OOHA 5T4HA 4V0MA 1VLHA 1NDUA 5BQXA 2VDRB 2DBQA 1B7GO 1BX1A 4K9OA 4OYHA 1L4EA 1H1DA 1VB3A 3WLNA 1ISJA 3RABA 2QD3A 4KPFC 4IIFA 4UKDA 2XW6A 4X8HA 1P39A 1TCBA 4RPLA 2BFAA 3MLBA 1MW9X 2WK1A 3SMVA 2Q45A 3A10A 3UXMA 1NVWQ 5CLFA 1SG0A 1O95D 1RHUA 1YRAA 2I3AA 1FFDA 3PQ3A 4LVCA 3VJLA 3KTAB 3I73A 4KV7A 4X1YB 1EIZA 5FOWA 1U28A 4AS2A 1U8TA 1PWZA 4MJLA 5BSUA 5A5FA 4W5OA 4CGZA 2HK6A 1XCJA 4F9EA 1KI8A 1JJBA 1MVOA 1JI0A 2I0FA 1QRRA 3LZCA 3NHSA 3WSWA 1PZGA 1I01A 3R3WA 2Y1LA 1NAIA 2WVHA 1IEWA 3HCEA 1BWVS 1YQQA 3INYA 3TQQA 3U0BA 1UXHA 4MS1B 3VR2D 3WIUA 3ZDBA 1VZ2A 3OO0A 3SR3A 1KL7A 2WPNA 2C4MA 2NUAB 1JPUA 5IF9A 5JQGF 3RT7A 4MGIR 2AEFA 5E4TA 4DPLA 5ED4A 1O57A 1NNSA 4QO8A 1LY1A 2O7QA 2ZRJA 3NV9A 3CNQS 4EUNA 1FRVA 5FLKA 1I14A 1X0XA 3IDZA 3RRNA 4D45A 2AX4A 5J2UB 1I6KA 1PUIA 2IHBA 2V9ZA 4WIAA 4UU1A 1O89A 4M0DA 5F2KA 4QYWA 5FYQA 1PL7A 3GVIA 1RM0A 2YQ5A 1XZGA 2FFBA 2YHIA 4HYQA 4V2IA 3VR5D 2IY7A 4L8WB 2Y76A 4U2DA 1ZCZA 3EQ8A 3M82A 4MKFA 1V96A 4BNUA 5GJVC 3AB3A 5EJMA 4TV9A 3EWIA 1E2KA 4K28A 5F7OA 1R9MA 3TQOA 3YASA 3KVOA 4F4UA 2CWWA 3SGLA 4BY9E 3HPRA 3T15A 2VLBA 1H2FA 1NQWA 2MSCB 4B3CA 4LF6B 1HFKA 1XNHA 1VE5A 3H16A 5FUBA 3NAZA 1PRYA 2C3UA 1FDSA 2OHOA 3CGGA 4HGRA 4QDJA 5IHPA 2H9IA 4HAVA 2RG1A 3JRWA 2P8SA 4IO1A 3KKEA 4MV0A 4ZOLB 5CBPB 2XCRB 2NP7A 3A6HA 3O1LA 2PVPA 1FP4B 4IEEA 1XCOA 1NNLA 1CR0A 4I1IA 1IWBB 4JLOA 3S1AA 5CLQA 5HCUA 4CKCA 3OECA 2NXCA 2PO7A 3G89A 4ETWA 2OCPA 2WJAA 3MCTA 4JR2A 4XSVA 1EJBA 3EK2A 1DAIA 1F4PA 3DBLA 4QYTA 3VGJA 5FWAA 2F3QA 5ADVA 5JFOA 4HGYA 1LPNA 2HCFA 3L92A 4BJ1A 3BZBA 3R76A 5AVRA 3PF8A 3R6LA 3WGGA 3Q87B 4MLZA 1J49A 4X7RA 3UQYS 1XYVA 3EF3A 4ID9A 5CUQA 3EOBI 1HPLA 2GF2A 4G4SO 2VVTA 1ISFA 2GBIA 2VSOA 4IGEA 4LNHA 4S1OA 5MFZA 2HGZA 1TLTA 2R60A 1GQFA 2V7WA 4LOJA 3P9SA 5ESDA 4GF5A 5BR1A 1E20A 1R9NA 1C1XB 2GEBA 4FT4A 4Q4LA 5AOBA 2JGDB 1BA2A 2JJMA 3BEDA 4S3MA 4DV4B 3F3KA 4II7A 3D4BA 3L8FA 1AHNA 3ABRB 1D04A 2D0OB 4K05A 4A15A 2OK7A 2OGUA 2MJLA 2VXYA 3F5QA 3I5AA 4OUDA 2QBYA 4EKYA 3F96A 3QTLA 4FE7A 4NULA 3QVJA 3N87A 2YVAA 1QGAA 3ZDEA 5BPHA 4KWTA 4PSUA 2F9LA 4GRAA 4FR5A 4C3ZA 4QSMA 1E5XA 5FT9A 5LJLA 5BR8B 1KERA 5BWOA 3BHJA 2VDNB 4MINA 4CQJA 2VUUA 4PS1A 2PBZA 4UNRA 1T4CB 3IP5A 4NZZA 4R8RA 1KAMA 2XMSA 1VYVA 4KN5A 2ZPAA 1MOQA 2IV2X 3B9BA 2P9CA 3JQPA 4LGCA 4NK4A 3GLFA 3KC2A 4QFCA 3GRFA 1APBA 4QREA 2DRIA 2L0XA 3QEOA 3ZHCA 5B6JA 1XNRB 4MRAA 1NBEA 1I4EB 5DNYB 1W1WA 3ZXSA 3OE4A 1VG9B 3LDHA 3C70A 3HU3A 4IICA 4PHHA 3VNRA 3KPVA 1TT5B 2IXEA 4XEHA 4YYEA 2JIPA 4DREA 3ISVA 4QUBA 1E3WA 2P1DA 1WDWB 1GT91 1XVUA 1KPIA 2YCLA 4CHGA 5C7LO 1NW3A 3QG5A 2QYSA 4L9WA 3HV0A 2I99A 4Y9UA 1P2GA 4TT8A 3VR3D 5EN4A 3F98A 5EJ7A 2OBFA 1HNZB 1EUCA 3CIFA 5DM60 1G5IA 1Z2PX 2A67A 3MOIA 3D9QX 4LJRA 4IXWA 2Q6KA 3GEBA 4G5GA 3E3AA 2C5SA 3DDOA 4P83A 5T6MA 5EKUA 5L53A 3O1JC 3UXHA 2LE0A 3HBAA 1D4ZA 4HSEA 4AF6A 5KKCA 3IALA 2H4FA 4RVCA 4JR1A 1Z74A 2X14A 4MKHA 4Y1GA 1JT2A 2XNDD 3IEKA 1XMVA 3OA2A 1L5OA 2DPGA 1NQTA 4G0OA 4YMIA 4BLRA 1R0KA 4CKEA 2GILA 2J9ZB 5COBA 3TRJA 2WA1A 4CL2A 2J3HA 3UF0A 1JB1A 1JIIA 3IIEA 5EAIA 3QITA 3TUZC 5YASA 2X4DA 4WJKB 2GAAA 4BCBA 4CMBA 1K0FA 5AK5A 3N05A 3Q1LA 5LP6C 1JFSA 4ROTA 4LIPD 3OQPA 4BE7B 1BOOA 3HVHA 5FORA 5KYUB 4FCVA 4F0HB 1GPDG 3NC4A 2VS1A 4KIWA 2ZUBA 3LUCA 1HDIA 1PG0A 4Q66C 4OHVA 3L6EA 3MFQA 1RCOC 3X43A 1YHZA 4R1TA 3HJBA 1CYEA 5IN5A 3BFKA 1JH8A 1Y1QA 3PNLA 5A03A 5FPKA 2W2KA 4CPDA 3I45A 4DA7A 4FR0A 3G9TA 2W11A 2C78A 1ISMA 3GJ8A 4EL5A 2YMLA 3NKLA 3X1KA 4N49A 1R0SA 4TTPA 1CRQA 4Q3LA 3ACDA 1ESCA 3UGQA 1AVTA 4MV8A 1KDPA 3D81A 4YUVA 4FHZA 3RAJA 4DSOA 5B7QA 3C3AA 3DMNA 2WD8A 4RVOA 5JC8A 4JC4A 2VDJA 2YNMC 3FY4A 3P20A 4LK3A 2JLXA 3W1WA 2PJRA 2C94A 2PBFA 4X8OA 1KVSA 2G40A 3A26A 4KXFB 2CKMA 1IR1S 1RQRA 4IJ5A 5CB4B 1QFXA 1IHXA 2NTYC 3SPXA 4KO2S 1X1QA 1MIOA 1G19A 2PA3A 3GVCA 1NE7A 2I4TA 2PMDA 2Z98A 1QZUA 5JQGA 2W5UA 2XRZA 1H0RA 1RVV1 1XRSB 2NQTA 3PP8A 4DR2B 1ZUIA 2VF5X 1T3LA 4WW0A 3WYNA 1SC9A 3HHPA 3M5CA 4TRRA 4TROA 1PJAA 4L5JA 4FKBA 2MSKA 2ADFA 3GEGA 4G5OA 4KLCA 1V5IA 4YO7A 2BC9A 4MXDA 1R18A 4US2R 3A4YA 4DM4A 4H7EA 4EUKA 4YJ2B 1KDOA 2A33A 4B46A 2VATA 3WZLA 1IMJA 3LL4A 1DRVA 5JECA 3L6UA 1IAQA 4H7DA 1QH0A 3FYTA 3IAS6 4JI8B 1CUDA 2F62A 1CRLA 1F2DA 2I6UA 3CVJA 1RXEA 3K2BA 5BYJA 4CUZA 1O94A 1QC5A 2CXUA 4RHFA 3SSAA 3C1TA 1C30A 4LTNA 5DLEA 1YUMA 3S2EA 4JJIA 1X15A 1Y4AE 2CSXA 2X6QA 5FV7A 1X86B 4BXOB 1OLOA 3WZ2A 2D1FA 3H2KA 4HWOA 2IYRA 5C8YB 3EZYA 2EFDB 2M32A 1CUVA 4RIGA 3RFTA 1DQNA 4DXHA 1BYIA 3PKJA 2MU1A 4F0KB 1RI5A 2IPMA 4ZAWA 5EINA 1CVIA 3K1AB 1HURA 1TCVA 3HPQA 1NVFA 1GNVA 5DISB 4YLYA 3V9AA 3OY7A 2SKCA 4O4HF 5C1PA 1CDDA 4TKZA 3OX3A 4DLXA 5KYXB 3QVWA 4P08A 2J3EA 1H6DA 4W8HA 3BSYA 3K0CA 1YS1X 4IIXA 4MR8B 4UNPA 5AVUA 3NBYC 5L7WA 1NXXA 3PJFA 4XWAA 3L8GA 2WUFA 1BC5A 5CM8B 5DLDA 3QIVA 4PO9A 4D82A 3H9EO 1CJCA 3FYHA 6Q21A 5HUJA 4O8ZA 2HIGA 1N6PA 3AL0C 5GMOA 1UJ4A 3DVRX 4GKBA 1CF9A 1DRKA 4CEIB 1IB0A 1T0IA 4PYRA 4X84A 3GAFA 4RELA 4RZ2A 3I5YA 1JDTA 1HNWB 5AW6A 5LZ9A 2XE4A 2JRCA 4XIGS 1M10A 2G9UA 5I8ZA 1VE1A 3RSOA 1XT6A 4DLVA 1KTVA 1KSGA 1NW4A 3EWAA 2J67A 4D8VA 3KQQA 4WKBA 3DQQA 4LDNA 1NXPA 2WSIA 2RK6A 1ZVMA 5ALZA 4AUNA 4MHTA 4AKGA 4EFDA 3DNPA 4ZI7B 1AC5A 1J8QA 1YO6A 3GMSA 2NQ8A 1VSVA 2V7QA 4MR9B 4MUXA 5JXHA 5A7HA 1KSJA 4JBXA 2IIVA 3IPRA 1UT8A 4JZYA 1XJWA 2CXNA 2CUTA 1CFZA 5BN4B 4MOWA 5C5CA 5DGIA 1BE8A 3Q12A 3R74A 4R0MA 3E9ZA 4AW9A 3A9SA 5B2EA 3U1BA 2JBHA 4M8IA 4M8NE 1IIRA 2AYYA 5DT2A 1GNTA 1OI2A 5HFJA 1KDZA 2PY6A 4R8LA 4IDAA 3H1TA 3NDJA 3X0DA 1LW7A 1VL1A 1LXCA 2O0JA 3RSHA 4F8YA 1DC7A 2EAUA 3FW1A 5AK0A 2DHEA 3O3NB 4N7BA 3V6LA 1GSOA 1TFRA 4ZALA 1H2XA 3G7UA 2YZGA 3ESBA 3GT0A 3OT4A 5KPDA 3QFRA 4CKWA 3FPKA 2VBCA 1ABFA 3QWIA 1BCRA 4BYMA 1S1CA 2QTVA 1PS8A 3A6KA 1OFVA 1K86A 2RCNA 2ZT5A 3N7TA 3PHCA 2H4JA 3MGBA 4FFMA 2PPVA 3CEMA 3PJEA 2IYTA 4C89A 4ZQEA 5H9VA 4DV5B 4RTLA 1OXBB 3AM4A 2WKSA 1OX5A 2UYGA 1GZ7A 3CCCA 3REFA 3C8UA 1T5BA 3Q3EA 3CV3A 3PKZA 4O2RA 1P1BA 2JK1A 1BX3A 1O7JA 4WNAB 2YY6A 4PGFA 5FJIA 1NJGA 1U3UA 3L04A 1CBUA 4LCJA 4IH9A 1RI2A 3PGXA 4RANA 2HIAA 1T5DX 2PYZA 3P94A 3A3YA 3FDFA 4XEUA 2P3OA 4KHPB 3C3BA 4YGYA 8OHMA 4Z0TA 2HO4A 2B0JA 2QX9A 4BBJA 3BCRA 1BTOA 1SCUB 2D2EA 3N0RA 2V63I 1S8FA 4FZJA 1XZIA 4GZ6A 1I80A 1WKBA 3DZCA 4PINA 9ABPA 1F6WA 2HMTA 4EUFA 3LNTA 2POQX 5TPWB 1DO8A 1UJ6A 1MEEA 2BEUB 1CIJA 3EF1A 5I51A 4GKKB 4WKPA 3JQ7A 3JD2A 4TN1A 1QKIA 1DG3A 4Y2HA 5LZ2A 2CZCA 2X1MA 1TJ4A 1W85A 2OAEA 1B14A 3D6AA 1YKGA 4MVJG 3U19A 2PYIA 1SC4A 1WUIS 4DC0A 2GD1O 5KDDA 4JMPA 1J22A 3K73O 1IVNA 3REQA 4ZFNA 2Q1UA 4JP2A 2IS4A 1DLIA 1EQUA 5CTAA 1XXHA 5E6SA 1GKIA 4N7MA 4F3RA 4Z54A 3MTEA 4KDCA 4G01B 1FYFA 2C54A 2ZJ4A 4BZZA 4RA9A 4TMVA 3VYUB 3NORA 2R6HA 3TPZA 3KT6A 1WMFA 3FPGA 7MDHA 4HPJB 1A7UA 1UBRS 3CUUA 4GXQA 4XQ9A 2H8GA 4TV8F 3BREA 1Z7EA 3EDRA 4OQYA 3F4BA 5BNIA 5GY7A 3FNBA 3KXDA 4Y1FA 1OU4A 2YOHA 4NENB 3ZE2B 2EHJA 1QB7A 4X44A 2NUTA 2Y2VA 4IV0A 1TL7C 2OQRA 1GDTA 4D41A 1TX4B 2OAGA 4RLHA 4GSKA 3AR6A 1JKFA 2R1VA 3I2YX 4MO2A 1E2QA 4PSDA 2GM5A 3Q8WA 3O1IC 5DMXA 5EGSA 3S2ZA 3B51X 3U0VA 3NM6B 4F3YA 1I8TA 2E2WA 5E3IA 4B8YA 1L5KA 1QRSA 2WHYA 4DMCA 1Z35A 2Q6OA 3OOWA 4WXPA 2VHTA 4CL8A 1JV2B 3K6SA 4RK4A 1S4QA 2HWKA 2G07A 2OO7A 4LC0A 3M9WA 4WZZA 1E4YA 1ZS9A 4OVKA 1I2AA 1LK0A 4UVEA 4EGSA 5JMWA 1BNCA 1XCMA 3W8FA 3MYYA 5LMNB 2XB2A 4RFSB 4EO9A 4LFBB 3ZHVA 3OQIA 4WPGA 2KBEA 2M1ZA 1BYUA 1FMFA 4J9VA 4MWEA 1M74A 2DHRA 3OBBA 3MJEA 3QVXA 4EG6A 3HXOA 1Z4PX 1PR4A 5BSTA 3DKRA 1KDVA 2XNHA 3ZZNA 1B8PA 3TZEA 4I6JA 3W78A 1K2WA 3HBMA 4KMSA 5EEGA 4MITA 1KFJB 2NXWA 4EG7A 3GNSA 4G1UC 2QQ0A 3ZWVA 3GGJA 2IYFA 1M2HA 2QX8A 2OOSA 4GNKA 4QL3A 4R1UA 1E3IA 3M33A 6REQA 4UPVA 4RA6A 1JH9A 3OT1B 1CQWA 2IXFA 5D84A 5J40A 3MRXA 2QTHA 3RYHB 1ZM9A 5A9SA 3VOBA 3X1MA 2ONCA 1KQ3A 1OFIA 1KIAA 2FJPA 3TWOA 2C5AA 1DEAA 1US8A 5K8LA 3ENZA 2I6GA 3QKSA 3QX8A 5LOVA 4FI3C 3BZUA 4B3GA 2MSDB 1ICEA 4XD7A 3IQHX 4V38A 2JCSA 3OWHA 1PV1A 4EJ6A 2YFQA 4O4HA 4OA8A 5K0CA 1QO7A 3LFUA 4GX5A 4FDMA 1O6CA 2R85A 5CCXA 3DFZA 3V7NA 4M55A 4G9EA 2IT1A 3C8MA 4QTXA 5LLSA 3TQHA 3WQHA 3UJ7A 2R2AA 3N0VA 3AF5A 4FIDA 3W1EA 3K70D 1Y80A 1MVNA 2C2KA 1H4VB 3AHJA 3EEQA 1RYFA 2OWDA 1J06A 1XTPA 1WA5A 3JWPA 4G1CA 4X9XA 5REQA 5C32A 1VL8A 3K70B 1L7BA 3ASZA 3OM0A 2WMDA 4D4IA 2GBCA 2J85A 2ZTVA 5A7GA 1X7ZB 2FSSA 2OP1A 2PLAA 3OJLA 4PGHA 1A69A 4W7IA 2ODNA 1C9DB 1JFRA 2HLDA 2HJVA 3NHJA 4PRLA 4TMZA 4U8GA 4BOYA 2AFHA 2NWQA 1NASA 2YWEA 2ZYGA 4REOA 3BE6A 1DV2A 2JAQA 1WVMA 5FXMA 2GVNA 4LYAA 2XUFA 4D98A 3ZD6A 1EFAA 4YBZA 4U00A 2XVMA 3THSA 1P0IA 3N8GA 4ZDWA 2GPJA 5K3FA 5AW8A 4X62B 3N8IA 3OQVA 5IPFA 4X6LA 1M1YE 3GLTA 4U8HA 4IEIA 4BB5A 3GUHA 1XX6A 1WR8A 5AVZA 5BVGB 4JL6A 2JHFA 5KZMB 4YAUA 3ON5A 3UK6A 1L5WA 4I50F 2O8DB 1AS0A 2XWSA 2GO1A 2RH9B 1A9YA 3F7TA 2PN1A 5DE3A 3SKVA 5JNVA 3AF6A 4BVBA 2A0FA 2QL6A 3WQBA 4CMAA 4PO8A 1X13A 3I0NA 3KUKA 2RBGA 4GP9A 4OQDA 4RETA 1Z28A 1Z29A 2Y6UA 5ILGA 2AB0A 4BEJA 1W19A 2I66A 4M7RA 3CPEA 1RAHA 2VQ6A 3D31A 2VZ8A 4P98A 4AQYB 3HCCA 3ZXIA 4OEHA 3FZNA 2P2ZA 3PQ5A 1GKLA 5EMLA 4FEGA 3ZVKA 2HHJA 1LSUA 4WAUA 4RIEA 4JBLA 3C74A 5G1NA 3UCFA 4JS0A 2ZDHA 2GJ8A 1AB6A 2V3VA 3NGXA 2XE7A 4NNOA 1OBVA 3L7CA 2O0KA 3O2JA 3IDSA 3Q5DA 1YJAA 5ICGA 2DQ4A 3SXJA 4QGFA 3I8OA 2NSHA 4L0DA 5L3RA 3KQKA 4O4JA 4LHWA 3AR5A 1RPZA 3CUWA 3G2NA 4OMUA 1Y8RA 1WDTA 4C87A 2IHVA 2PVCA 4HN4B 1RJEA 2GPYA 5HF8A 4PV7A 1TTQB 5F98A 4L4RA 5EMMA 5KTNA 1BEZA 2CB0A 2FSFA 2H18A 2ZRQA 5L6MB 3VDXA 1YZGA 3QF7A 1BN6A 3A2LA 4E5DA 5BP7A 4DDUA 5K2OA 2E4VA 2PRJA 1P0FA 4MUFA 3NBQA 1V8FA 2P4UA 1DG9A 1YONA 3TI7A 1ADFA 4NF2A 3VV2A 3AEXA 1QZ3A 3HVJA 4DFDA 3HJFA 4ARVA 1OBFO 3KWLA 1W5TA 3QH4A 5EA2A 3U3XA 3V8VA 3ZS9A 1JSZA 5HKOA 2FEPA 5HUHA 4EFLA 3RRBA 5AH0A 4Y18A 4JU8A 4ENQA 5I9MA 2KQUA 2UZIR 4QELA 221PA 2AS0A 4MUHA 1QJ4A 2NYUA 4BMPB 1JALA 1IN8A 3S7ZA 4AUMA 3L4BA 2E85A 4W9MC 1XMSA 1XZHA 1AUOA 4YQEA 1EVLA 3L93A 2RI6A 2R68A 1SUSA 3U80A 2HUNA 4U3JA 4CM6A 3A04A 3LUJA 2J5XA 4HBZA 1SVSA 2YC4C 3HDJA 4OIMA 5FTMA 2C57A 4TL6A 3JAMA 3OZDA 2NPFA 3ZKWB 1GZUA 2HQOA 2OSBA 3UK7A 1NUPA 1SBIA 4KXMA 5HJEA 4XXHA 2HA5A 1WXDA 2ODEA 4Y2JA 1JLMA 3NFRA 3JD1A 4TV8A 4JP1A 2X2FA 4C5BA 2HXSA 3OTQA 2XCOA 4IMIB 2GJ4A 4OATA 3WK9A 3WTBA 9GPBA 3MTGA 3RS9A 1JILA 3Q2OA 2OGWA 3DWIA 4FC6A 4KQ9A 4C7VA 1MQ9A 1IIBA 4UE2A 3HWRA 3JRXA 3LVQE 2UUBB 4Q7EA 4P0PB 1E8MA 3FNHA 3MVEA 5EUMA 4JMLA 3ZI0A 2XZPA 1KYXA 4Y9TA 4DWJA 3RG2A 1KYQA 3BD9A 3G2JA 3F3YA 3AHCA 1FFGA 4YP5A 4C88A 2E87A 3CO0S 4HDNA 2YV3A 2CNLA 2OBYA 5HTKA 4LCBA 2FOIA 5DP2A 1BU8A 2W00A 3BGSA 1V5GA 2P75A 2FA9A 2PX0A 2GWHA 2XNKA 3A3PA 3ELWA 2XZOA 1QQ7A 3H9UA 5ECGC 1PZFA 3E22A 3BGIA 4IH1A 3LD9A 3ZZUA 4B7AA 2E4YA 1U7DA 4FN4A 4LPSA 5DYIA 5D00A 2B1JA 4CM7A 3CLTD 5T67A 1SN7A 3O2NA 5DM1A 5MN5A 1ATZA 1OE0A 2AJLI 2ACEA 2QP4A 3D8BA 3V9PA 5FPYA 1KRWA 3VDRA 2IIBA 3H65A 4TMKA 3GBPA 4KO4S 4D0SA 3C97A 5D85A 1NI3A 2HNAA 3EDCA 2VJQA 3VO1A 3W6NA 3RGGA 1I3NA 1JQKA 1VLZA 3A2KA 2C31A 1JU4A 2WAOA 4DSTA 2Z3VA 1QK4A 5D6NA 3ZGNA 2CFSA 1YGPA 3ZGXA 1KQPA 3KLBA 4LKRA 4Z1MA 1LF5A 4A6XA 3B1ZA 1J56A 4NMWA 1K9VF 1MPXA 4B4WA 4YJDA 1CY0A 9LDBA 3J80A 5IAOA 1FNCA 2CDRA 4CR8A 4EA8A 5JS7A 1QV7A 4A1FA 1TEHA 1VCNA 2JRLA 1XCPA 3FE2A 4FZRA 3TFOA 4KWEA 4C4SA 4BX3A 4Z4CA 4LI3X 3S2YA 2B37A 2EF0A 3AVPA 3SF8A 2A9RA 4LQDA 1PJSA 3WFZA 1KMQA 3E70C 3ETCA 2ZIVB 4RV5A 1Q83A 2ZBGA 3OO1A 5GADl 3HP7A 2FQWA 1DTWA 1WHTB 4MMXB 3OFNA 4BMCA 2F8MA 2XV1A 3PGKA 3JQFC 4B6GA 2O1XA 3BGOS 4FKMA 3TNFA 2Q4DA 4PBTA 2QG9A 2W42A 1UC9A 2PSSA 2P9FA 4C14A 3FHLA 4LE2A 4M1OA 5HKAA 1KR2A 1CF4A 4DPKA 1CZNA 5I9LA 2NU6B 2ZBDA 3O03A 3W6UA 3HGTA 3VNSA 2R6ZA 4QG7A 1GUZA 3VR1A 2RB5A 1E62A 3ZXXA 1RZRD 5JRJA 1A8UA 3AX6A 4GZLA 3QLUC 4WJLA 2VWPA 1FBTA 1M6NA 1DXHA 4XIIA 4H9GA 5HIKA 2A57A 4PZUA 1SC1A 2HJRA 3OLQA 2BHNA 5DNAA 4KR0A 5IT5A 3AFMA 3CZQA 4KI7A 4QYIB 1KEWA 2H2IA 4XM2A 5L3SA 1T9AA 2F59A 3RIXA 4A5OA 1QGZA 2WUDA 3KKKA 4OF4A 3EVCA 3GNLA 3OD1A 1UP4A 4O3FA 4C7MA 2OSVA 2R66A 2DUNA 3PWSA 5U1PA 1GCIA 2P2GA 3MWKA 1BFUA 5HDQA 2QB5A 1DZ3A 2VNKA 1R0RE 3T7EA 5BO5A 1WW3A 2GF0A 2QN7A 3NXSA 2Z2YA 4HJRA 4N82A 1NVTA 3PLNA 1TIKA 4N54A 3H1EA 5JLJA 1KP2A 3ILSA 4H7FA 4N65A 1N77A 2VTVA 3KLMX 1ZY2A 5F33A 2RHLA 3GFOA 5DJ5A 3GH1A 1UADA 4B3XA 1H69A 1IWOA 4Q3EA 5JROA 1TKAA 3WAJA 5A7FA 4WY2A 3ENNA 1ZOPA 2HCBA 2GHTA 2JDIA 1A5ZA 3GFPA 5EIHA 4AP6A 4F7DA 3E2PA 3SK0A 3NDRA 3ZY5A 3ND6A 2ZRIA 3EEIA 2BM8A 4M89A 3JX9A 4OP3A 3W2EA 1O94C 4OP1A 3MHTA 2VDWB 1ZNZA 1IE3A 2OGTA 2R47A 4DS3A 4XWTA 4QQRA 3UWSA