4RF2A

Crystal structure of nadp+ bound ketoreductase from lactobacillus kefir
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
250
Chain Sequence
DRLKGKVAIVTGGTLGIGLAIADKFVEEGAKVVITGRHADVGEKAAKSIGGTDVIRFVQHDASDEAGWTKLFDTTEEAFGPVTTVVNNAGIAVSKSVEDTTTEEWRKLLSVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPTLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLEGAEEMMSQRTKTPMGHIGEPNDIAWICVYLASDESKFATGAEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH dependent R-specific alcohol dehydrogenase
publication title Origins of stereoselectivity in evolved ketoreductases.
pubmed doi rcsb
source organism Lactobacillus kefiri
total genus 96
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rf2A00
2RHRA 4Z0PA 4YAIA 3WSWA 4NH4A 2Y66A 4BB6A 1ARZA 3QA9A 1UXGA 1YWGO 4AJ2A 1PL7A 4AVYA 1U4OA 4WLFA 3VZSA 3RI3A 3EVNA 2I3AA 3EUWA 2PD3A 3TJRA 3ONDA 4BV9A 1NHWA 3EY4A 3HQ4O 2I67A 3H3FA 5L7WA 3CH6A 3K9QO 2R00A 1FMCA 2FHSA 4GMGA 1ZK1A 2VZ8A 2W98A 1QLJA 1E92A 4GKVA 1G0NA 2WD7B 2Q3EA 4HNGA 1LLDA 4MVJM 4RF2A 4IUYA 4M87A 1X7GA 2VZ0A 1YQGA 3F47A 4YQZA 2DKNA 4EJ6A 4BO7A 4HBGA 1CWUA 3GR6A 3JSAA 4WCFC 1TT5B 2ZB4A 3Q11A 1WDKA 1K6IA 4AG3A 4EITA 4WK6A 4TRJA 4J7XA 1DC4A 4AJ4A 2EJWA 5DOZA 2DPHA 1DRWA 1T1SA 1LDGA 2UV8A 4AJIA 2FR8A 4NMHA 4I9UA 4EZBA 3Q6IA 3FPLA 3QWAA 4GGOA 2B69A 4MKZA 4B79A 3ZWMA 1B8VA 1T2EA 3JD2A 5CG1A 4I08A 2GD1O 1E1NA 1DLJA 1LSSA 3HWRA 4DWVA 1B2LA 1MUUA 1V9LA 2BFPA 5JCJD 4YYZA 2VTEA 5T5QA 5AOVA 3K92A 1H0KA 5B4VA 3WJ7A 3ZV3A 2F00A 2JFFA 1VPDA 5KVVA 5F1PA 2P4QA 4RPJA 1ZKMA 3FR7A 4J49A 3WTCA 4D0RA 4CMBA 2C82A 3F6YA 4RCVA 2DLDA 1BDBA 5EN4A 1QRRA 1EUZA 4CUJA 3ZV6A 3AUUA 1HDRA 3PIDA 2OHXA 1A4IA 3DDNA 3GZNB 2ZTUA 3AW9A 4CM8A 1B8UA 1HDZA 1PL6A 1ZSYA 3GHYA 4KUGA 1T2CA 1N9GA 3P2OA 1BVRA 2HKIA 3GGOA 2B4TO 3OICA 4BNKA 4NFHA 3OP4A 3FTNA 2GUGA 3UN1A 1DIAA 3WNQA 2VRBA 1CETA 3T7CA 1PJBA 4JBHA 4IY1A 3WGIA 4IMPA 2IXBA 3GVCA 5L40A 2Q4BA 2I99A 2HMWA 2EF1A 3A1NA 5U4QA 1M66A 4B7UA 1LTHR 3IIEA 4BUCA 4XGNA 1N1GA 2AQKA 3AU9A 2B83A 1ONPA 2VYVA 2XOXA 2EGGA 1ZJZA 2JD1A 3W6ZA 1RM3A 4DLBA 1BWSA 3KEQA 2D3TA 5FF9A 4DVJA 3RC9A 3GQVA 1Z73A 3OSUA 1XWFA 2FWMX 4TZKA 5KKAA 1UXKA 2O50A 2PTGA 3A28A 3IKVA 2P9CA 1G6KA 2WE8A 4BO4A 4BMVA 3S2EA 1E3IA 3ZU3A 1WDMA 2EEZA 5TT0A 3CZMA 1U3TA 3NJ4A 3NDIA 3OJFA 3PWZA 1X0XA 5F1KA 5TGDA 4DGSA 3ITDA 1JWBB 3JD4A 1XR3A 1Q7BA 3DAGA 4D3FA 4BNGA 3K96A 3MTGA 1I3MA 1H5QA 2NADA 3JYLA 4P38A 1MG5A 5COQA 1P45A 4FN4A 4ITUA 2ET6A 1HTBA 4PZEA 4FB5A 2OBYA 4EEXA 5DP1A 1DDOA 5JBIA 3FR8A 4W6ZA 1R6DA 4XDYA 3RSHA 1XQ1A 4NK5A 3GPDG 3WGYA 3IMFA 5A9SA 4Y67A 1HE4A 1K6JA 4WNIA 4I5FA 5JO0A 1PWXA 1WPQA 1ZSVA 4J1NA 4R5MA 4R1UA 8ADHA 3PQFA 2D5CA 3EW7A 4PRLA 2X9VA 5KIAA 4MP3A 5C7OO 4L0QA 1S7CA 2NU8A 2I5PO 3OQBA 2J5RA 3P2YA 1PEDA 3JD3A 5BSFA 2VYND 3JQBA 4Q3AA 3VDQA 1BXKA 3INTA 2AHRA 3WGZA 4CMIB 3ZGYA 1XKQA 2AXQA 1DC3A 5KVCA 4YAGA 1R37A 3TL3A 1VSUA 1EVYA 1UH5A 4DQUA 1PR9A 1UJMA 2HK7A 3K2BA 5BSGA 1BHSA 1MP0A 3N58A 4B4OA 1I5RA 1B0AA 3Q9NA 4D3SA 1E7YA 3MOIA 3CIFA 4EJMA 1VM6A 1K0UA 2EJVA 3E6AA 5JDCA 3WDSA 2JL1A 4JNKA 3GFBA 3HFGA 2PA3A 1V3TA 2CDAA 2P9GA 3WGTA 3L9WA 4J2HA 1PQUA 2Y1OA 3G17A 2HRZA 1LJ8A 3CINA 1R16A 3AFMA 2AEFA 2JCXA 2HRBA 3GZ4A 1F06A 1N7GA 3RIHA 3EZYA 5EPOA 5JCXA 4N5LA 1BTOA 1EK6A 4PGFA 4CUZA 3VPFA 1ZBQA 3JQ8B 3DMYA 3DQPA 1FDTA 4RDIA 3E9QA 3U4DA 3ZNOA 3ON5A 3AOGA 3U09A 4BKOA 4BKRA 4JBGA 3LF1A 1E3WB 2GCGA 4JBIA 2VQ3A 4M86A 3ZWCA 4NIMA 3PFFA 4CM7A 4OH1A 4FJ0A 1SOVA 1PS0A 2O2SA 3IOYA 3W4IA 1SEVA 1AXGA 1GPJA 2NVUB 4R4JA 5TC4A 1BSVA 4CQLA 1GUYA 4MVJF 1HE3A 3K30A 1GU7A 2YY7A 5AVOA 4M55A 2V7PA 1HRDA 4MKXA 4PLZA 5DOVA 3UOGA 4RVUA 1DFIA 1QYVA 4KQXA 5IZ4A 1NHGA 3JYQA 3AI1A 1SAYA 3TZQA 3L0DA 3S55A 1PQPA 1ZK0A 2C7GA 3VOSA 4BNZA 4J7UA 1MX3A 3E9MA 3AOEA 1WW8A 3MOGA 3LT2A 2IEBA 3PIIA 3V2HA 2OOSA 3I9LA 3LZ6A 3GUCA 3EK2A 3ONFA 2YJZA 1OMOA 3HG7A 3MWDB 1EVIA 1HSZA 4CMAA 1U3WA 1I2BA 3V8BA 3ZWVA 1VJ0A 3ZWNA 4QSMA 1ENZA 2VHVA 4KDEA 4LMPA 4AJOA 1C0KA 1YH3A 4FSHA 2O3RA 4U6QA 1MA0A 1DFHA 4IDAA 4HUJA 3PYLA 4CLRB 4WLVA 5L95A 5TJHA 1PZGA 1I01A 1VSVA 3E9NA 1EFKA 2AW5A 2YZ7A 2W2LA 1ZK3A 3FF4A 2FN7A 1MXHA 3JD1A 3DHNA 1Y6JA 3E8XA 1PIWA 1C14A 2UAGA 3VVCA 4JJIA 4PG6A 3AJRA 3AM3A 1GZ4A 2C2YA 4YB8A 5JFOA 2X9GA 2PZJA 1GY8A 1Y9AA 2NUAA 5A9RA 1NR1A 4FPXA 1CDOA 5L51A 1GQ2A 2O3QA 5ENDA 4B8WA 3VC7A 1R0SA 1PJSA 1F12A 2GR9A 2NM0A 4IDCA 4M54A 2J3KA 1ZH8A 4J43A 2JFHA 1BDMA 2YUTA 1GADO 1I33A 3HB4X 2NSDA 3HN7A 1G1AA 2AA3A 4NU5A 4QQRA 1Y5RA 3ZWOA 3CTMA 3LF2A 1X15A 4FQ8A 3A14A 1KBZA 5MGBA 2VUTA 4XB2A 2D2IA 4Z6KA 3SC6A 5JMWA 2CF5A 3W8FA 4CMCA 2RH8A 2J3HA 2Q2VA 4GX5A 4DC0A 1R12A 3RCBA 2Y1CA 4ZD6A 3FBTA 3RBZA 2JCYA 5DT9A 1KC3A 4CV2A 3IUPA 5B1YA 1DC5A 1HYHA 2NACA 4ND5A 1R4NA 5KJEA 4BNIA 4EBFA 4IZHA 5A5FA 2X58A 3QLJA 2ZYAA 2EP5A 5CPBA 4WKGA 4RF5A 3QJ5A 4YAJA 2FZEA 2QG4A 3GHHA 3DOOA 3WQQA 4R1SA 2I66A 5BSEA 4CLDA 4G81A 4URFA 4CJXA 2XXBA 3E1KA 1UDAA 1I3NA 3PHHA 3GNQA 1QR6A 2PKRA 3WYCA 1V3VA 5CDYA 3RC1A 4PZCA 2IEDA 1PQWA 4LISA 5T64A 3UFXA 2X0NA 4ALNA 4DMMA 1HT0A 3WGQA 3ZWBA 1QV6A 3BMQA 1NAHA 4YWJA 5LCXA 1M76A 2Q2WA 2J6IA 5U1PA 3ZNNA 4AJ1A 3TFOA 3DZGA 4BNLA 1OZAA 4WCDA 3BTSA 4ESOA 3FNHA 5A3VA 1MGOA 4RZIA 3CXRA 2Q46A 1U2DA 4PG7A 2Y93A 1VL0A 3ULKA 5IAAA 1JQBA 1GEEA 5DCWA 3TL2A 3RC7A 5JS6A 3HHPA 1GDHA 4YVFA 5KOIA 1ENYA 3UGKA 2FOIA 1H2BA 4GI2A 3AI2A 4WPGA 4RVDA 2V6GA 4RPGA 2HQ1A 4W99A 1A7KA 2QZ9A 1AN9A 1DHRA 1XQ6A 3GMSA 4BGIA 3KYCA 3GDOA 2V6MA 4J91A 4NPCA 5A5EA 1KVTA 4CV1A 3GC6A 1IULA 7MDHA 3MJCA 1NPDA 4XB1A 1B8PA 3DZBA 4WEQA 3W4JA 2HK8A 1I3KA 1EZ4A 5HM8A 2X6TA 2JFGA 3EYWA 3TRIA 5G0SA 2CMDA 3S2IA 4YT2A 4OMUA 4UVIA 3VPGA 4MIOA 3VVBA 5HTOA 1JU9A 1PJ3A 4RZHA 4DQVA 1LXCA 3KRTA 2UDPA 1V0JA 1ONOA 4PVDA 3UICA 2FPGA 1FJHA 1DHTA 3DBRB 4M89A 4CQMB 3FI9A 5IDWA 3BTOA 4XYEA 4AFNA 3KYBA 4YRDA 1EQUA 1ZUD1 1H6BA 1RJWA 4RLSA 4XIYA 3DZJA 4XKJA 2ILTA 1V3UA 4RPLA 3HZZA 3NTOA 2V6BA 1GEGA 3HSKA 2I6TA 1HDCA 3D0OA 1CEQA 1EK5A 4MJLA 5EERA 4TVBA 5DCYA 3B70A 2UYYA 2YQ5A 4W4TA 4KMSA 2BFAA 3SXPA 3BAZA 4R69A 4MP8A 1XLTA 1HYGA 2PGLA 3AI3A 4ZQEA 4IM7A 2YHIA 4YJHB 3TSCA 1JAXA 4WUVA 1GYRA 4FOSA 4TRNA 1Y1PA 1DIGA 3PDJA 2Y99A 1DAOA 4E21A 4CM3A 2PNFA 4ONEA 1OC4A 1EE2A 1XIVA 3KOUA 1RM0A 1QKIA 3AY7A 4FS3A 5C7LO 3GG2A 2E37A 1JDJA 3GMDA 4GWKA 5K9ZA 3IS3A 5CEFA 1DSSG 1GQQA 3FRJA 2C0CA 4OQYA 1VKOA 1U7HA 3C1TA 3VH2A 3DZFA 4J9VA 3I9MA 5THKA 1VE9A 3WMWA 3LC7O 5KCZA 5EINA 1YJQA 3G1UA 5KTKA 1K89A 1LQUA 3G1TA 1XSEA 4OGWA 2FR1A 4R41A 4WNCA 2JAPA 4F46A 4BOYA 1NFFA 1WVGA 3R0IA 3I9NA 3ADPA 2ZKLA 3RKUA 4HKTA 4BGUA 1CIVA 3K31A 4PLTA 4UUPA 5K0ZA 2WYUA 5CP8A 2W2KA 3GDGA 4DREA 1E6EA 1KEVA 2WEKA 2E82A 2J3IA 2P4HX 4ROSA 5AXBA 5JNLA 3EGOA 1ADBA 2ZQYA 2NVWA 4WCFB 5T8KC 1LSOA 1WP4A 4CR7A 1GUFA 2NTNA 3I3OA 4MVJA 1GV0A 4CR8A 1N92A 3M1LA 4CV0A 5IZCC 1LNQA 4II2A 1SCUA 1NWCA 1SC6A 2EG9A 3BYZA 5G0VA 5THQA 2AQ8A 2ZYDA 2WD7A 4XX0A 3GVXA 4YT5A 5COAA 2IZ0A 3F5SA 5F5LA 4YJFB 1A5ZA 1SZJG 1N8KA 3OQ1A 3IJRA 4BNMA 1YO6A 3ORFA 2Y67A 3BMOA 3WGGA 4CM4A 2GN6A 4D44A 2JKVA 4RLHA 1QLHA 4PLVA 2Y0EA 3LK7A 1TT5A 2ZB3A 3PFWO 4ND2A 4DYDA 1E77A 4BNTA 5JYEA 3O9ZA 1B7GO 2UUOA 5TIIA 3P19A 1HDXA 1NFRA 3EDMA 1N7HA 3Q9UA 4J3FA 1I30A 3NEPX 3NT4A 4BV8A 3FNGA 1PX0A 1KVRA 4XYLA 2PFGA 3C7AA 4FW8A 2P5UA 5I9LA 2WDZA 4BL5A 2OUIA 4GLLA 4D7AA 1FDWA 1OC2A 3TNLA 3WQSB 4DMLA 1LDMA 4CLXA 2DTDA 5G4KB 4EDFA 2C2XA 4AJNA 4RJTA 3ETGA 4FD3A 4GMFA 4OXKA 4WOKA 3ADOA 1VJ1A 1ADCA 3I1JA 4ALIA 3TPCA 1GL3A 4NBWA 4QO8A 1QV7A 1JAYA 3ZW8A 2O23A 3RUIA 3UW3A 1E7MA 2NLOA 3W1VA 3GZNA 2PH5A 3JQAD 1ISHA 1KY5A 1O89A 3QHAA 4NFYA 2B36A 3CSDA 2O7SA 2HMUA 5GZ6A 2D59A 2IXAA 4BO3A 3TFQA 4WECA 2QRJA 3CMMA 1HZJA 1KIFA 4LN1A 4GPD1 1LX6A 4IMRA 1O8CA 3DONA 3WIEA 4E5NA 3KEOA 3F1KA 4RGBA 1O94A 1Q0QA 1P1KA 5MDHA 3M1AA 1X1EA 7ADHA 1D3AA 4Z3KA 1GYQA 4P4NA 2VN8A 3G0OA 4B4VA 2GDZA 4GQAA 3LLVA 4NBUA 3DOCA 1E7SA 1PGPA 2PGDA 5AXCA 4BKPA 1LDYA 1WZIA 2P2SA 3Q1LA 4E4YA 3QIVA 3WBBA 5BR7A 4K28A 1NTOA 4M8SA 3TN7A 4DL9A 4HWKA 4Q3DA 4CM1A 1IY8A 1DRVA 1HDOA 3UXYA 1Y5MA 4IPTA 1BXGA 4I5GA 1NPTO 3DAFA 4XYBA 3OJLA 2VRCD 4FBGA 4CQMD 3MJVA 2CY0A 2O4UX 4OYRA 4BNNA 3JQEA 5JXWA 3BXXA 3F5QA 1P1FA 3RU7A 4MINA 5BNTA 2RBEA 4A03A 2W4QA 1E7QA 3JQCA 2E6UX 1P9LA 1Y8QB 4QFCA 1ZVMA 5DNAA 3T4EA 3DBHB 3K2EA 3DWFA 2HMVA 3KZVA 2AEMA 3QE3A 5BT9A 3ZWWA 1J5PA 1WNTA 5KKCA 5KJ6A 4F3YA 4WLOA 3DMTC 2ZYGA 3I6IA 4GL4A 1ML3A 2BF7A 4I5EA 4J6FA 3ROQA 2VWQA 4CM6A 4YRBA 1VLLA 2WWRA 3QVSA 5I7EA 5I9MA 2B4QA 5H81A 1NQTA 4NQZA 1H2HA 1P74A 4NNJA 1NVGA 2CFCA 3UCXA 1HE5A 4IDGA 4CM9D 2CVZA 2SCUA 4XGIA 4ZRMA 4KOAA 2YFQA 1J0XO 2W90A 4MVJE 1QXSA 1RYDA 1T2DA 5A06A 4F6CA 3Q2KA 3WBFA 4CMIA 5KVQA 2YV3A 2GPTA 2PZKA 2PK3A 1YVEI 3AFNA 5EQFA 5TF4A 1P1RA 3OFSA 4D45A 3DHEA 5H82A 2EKLA 4R9RA 5IXYA 1MFPA 3A9WA 4ND1A 4FGWA 5JDIC 3GLQA 1HZZA 2OFPA 2FP4A 4YT8A 3MCVA 4GVXA 4OIMA 5ICSA 3KTDA 1MG0A 2Q2QA 1C1DB 1L7DA 5JAIA 3FNFA 3L77A 5L3ZA 3SVTA 2YDYA 5C37A 3HDQA 1QSGA 2VUSA 1HEUA 4II3A 1U1IA 4L75A 3DEYX 5TNXA 3WSVA 3LC1O 2POQX 3RBVA 1Z82A 2AG8A 5IDQA 3H8VA 2PH3A 5HS4A 4RL6A 1PJ4A 1EUDA 3PLRA 3I9JA 3E03A 4WASA 3D5TA 1NWHA 2AG5A 3QVWA 4DPKA 3ENNA 4FDAA 3GGPA 2A9FA 2H1SA 4Y6SA 3JQ8A 2VZ9A 3JQ7B 1U5AA 4NHEA 4BNYA 2X1HA 3QVOA 2Y1EA 1I0ZA 4UUMA 3D3WA 3KM0A 4PLGA 2D1YA 3D3EA 3T4XA 1F17A 3WQRA 1HKUA 4PCVA 2X0IA 1E3WA 1X7HA 1JA9A 4ALJA 5CDUA 4XQGA 5JC1A 1ULUA 2I3GA 1C3VA 5AXAA 5JAZA 3EVTA 4Z9YA 2WTBA 3N7UA 4E2XA 4D46A 4XQCA 4NJMA 2CDBA 3PQEA 2PV7A 4A5OA 4AJHA 3IC5A 1GR0A 1A7AA 4D79A 5A02A 2EXXA 1NVTA 5ER6A 2GASA 3ASVA 1ISFA 4UEOA 3F1LA 1YBVA 3D4PA 4WE3A 3OQ6A 4ND3A 1P31A 1U9JA 4IJUA 2QQ5A 4YQYA 6LDHA 1U8XX 1F14A 2IZ1A 2Q1TA 3PJGA 3JQFC 1YE3A 3CEAA 4TQGA 4EW6A 2YV2A 3DBLB 4BGEA 2NVBA 4U6SA 3QRWA 3IQDB 3UUWA 4YR9A 4QEDA 4KP7A 3NTRA 4OOFA 2DFVA 2FRDA 1ENPA 5IJZA 5J23A 1GV1A 4N5MA 1AHHA 2LDXA 2Q49A 4XQEA 2I76A 4IZIA 2DFDA 4OQZA 4F45A 1SBYA 4CLRA 3UKOA 2CNBA 4KTTE 3AM5A 1QYXA 1LSUA 3ANNA 1DOHA 5I8WA 3HN2A 2P68A 1IB6A 1C0LA 3B20A 3NYWA 3KHUA 2WJPA 2WYWA 4M49A 3GDFA 4N5NA 1E3EA 4OKNA 1X14A 2QRLA 3C3XA 2HUNA 4MDHA 3VPSA 4JK3A 4RQTA 2OP0A 4R01A 3TZHA 2ZCVA 3O8QA 1ZFNA 4QT0A 4NG5A 3IP3A 3L07A 1H9AA 2GZ2A 5DCUA 5A4DA 1JW9B 1T25A 2ZJ1A 4A10A 1IHXA 3GT0A 4CLEA 2E48A 1P3DA 1B3RA 3KBOA 4XA8A 4E2ZA 3TWOA 1I24A 2O48X 2BRUA 3HFSA 3V1UA 2BGLA 2Q1WA 4KTVE 5L45A 5KVSA 2HJSA 2NWQA 1XYGA 3WFJA 2XF8A 4HNHA 3GG9A 2ZCUA 3JYOA 2Q99A 1PJ2A 3H7AA 2CZCA 2R00C 3ZNQA 2J8ZA 5CEJA 4YEDA 3TQHA 4BQRA 1LU9A 3RAJA 4UREA 1UXJA 2O2YA 2B35A 4A26A 1PL8A 2C29D 5I7VA 1CERA 1ZNQO 3RUDA 2ZIZA 1PGJA 1K2WA 1I36A 4Q3NA 5FFFA 1T2FA 3ROKA 3TZ6A 1OBFO 1GD1O 4BIIA 3H6KA 3M2PA 4BO9A 1LEHA 3BZUA 4R1NA 5AQ1A 1RYEA 1W8DA 3OIDA 3AUTA 4HFRA 2EV9A 2C5AA 4BGVA 2WSBA 4CMHA 2A92A 1P1JA 4G2NA 5L7YA 4ZA2A 3PYMA 3GH3A 1KEUA 4D0SA 1K6XA 2EGHA 3LT0A 4Y8VA 3V2GA 4E31A 5C7IO 4RORA 4J4HA 4NFSA 4E5YA 2VHXA 1JKFA 1QYWA 4TKLA 2Y0CA 2PZLA 2I9PA 2B5WA 5HS6A 3OA0A 2RIRA 4TVOA 3GNSA 3DFUA 2P5YA 2VHWA 1Q7CA 2C5EA 3M6IA 3ZU4A 4DUPA 4HV4A 1U4SA 2O7QA 3TZCA 1WAMA 2PGJA 1LLQA 1KVQA 4U0KA 5K6AA 3JQGA 1WXDA 3GOHA 3EMKA 1LRKA 1B16A 4EGFA 4OHUA 1NAIA 1XA0A 3B6ZA 2AE1A 3MJTA 4IJVA 3OJ0A 3JQ9C 3LT4A 2WD8A 1XELA 3H9UA 1W0CA 4XR4A 4MO2A 3MJEA 3H9JA 4MVJG 4MVJH 1CQIA 3DFZA 3NDRA 4J1QA 5GZ3A 3WGOA 1XU9A 3FSRA 3RUCA 3GY0A 4NDNE 4EEZA 2JD0A 3K73O 1MC5A 2BGMA 3ONEA 3UCFA 2NU9A 2DBQA 1Z7EA 2J5QA 4Y9DA 5F1OA 1DPGA 4EUEA 3LSYA 2DT5A 5JY1A 4BO6A 5T8KA 1V6AA 2HLPA 4J16A 1A9ZA 2GN8A 2RAFA 3UHAA 3L4BA 1I2ZA 5ES3A 5IZCA 3S1LA 2GRAA 2FMUA 1T24A 2VNSA 3SEFA 5KJ1A 3AUAA 1Z7BA 4QXMA 5ILGA 5JC8A 4QFDA 3RVDA 1VI2A 1U28A 4O1MA 3KO8A 3BMCB 1LA2A 2OZPA 5KJFA 4BNVA 2F1KA 3DTYA 3KYDB 3PP8A 4J90A 2H9IA 1O0SA 1GCOA 5L4NA 3PHJA 2VT2A 4X54A 3VAZA 2JHGA 3H4VA 3CPSA 3FWNA 3L6EA 4CMEC 4CQLB 2IYOA 4FFNA 3ZU2A 2GN9A 3VPXA 2YYYA 3WNVA 4LSWA 2TMGA 4BKQA 1YONA 2EKQA 3OF2A 1WZEA 4DRYA 4RQUA 4DLLA 4XD2A 5JCJA 2PWZA 3WMXA 3X2FA 3HE3A 4OL9A 1MV8A 1IZ0A 4RVSA 4E5MA 3BTVA 3QWHA 1D1SA 4LVCA 4YJHA 1XCBA 3ZHXA 4CL3A 5CG2A 1O6ZA 1Y9EA 2D0IA 4J0FA 1Z45A 1I8TA 1P1HA 1ZIDA 3KVOA 1MXFA 3RUEA 3U0BA 3GRKA 3WS7A 2QZZA 3JQAB 2BH9A 4HFJA 2FPIA 1TXGA 3DOJA 2NTJA 4ZRNA 3BHMA 1F8GA 4BNFA 1KYQA 4LK3A 5TJ9A 1YOVB 2Q4EA 5EMHA 3WJAA 1E3JA 1NQAO 4P4LA 3B1KA 2G1UA 5IDXA 3IKTA 4BMNA 1ID1A 2GZ3A 4HFMA 4IGFA 4PLYA 4RV9A 1Q7GA 1U2GA 1W4ZA 1GQYA 1YL5A 4RPHA 2C59A 2QRKA 1H6AA 4GX1A 9LDBA 1JWAB 1HLPA 4K6FA 1X13A 4YACA 4D42A 5FEUA 1N2SA 4RVGA 1T26A 1NX6A 2X0JA 1DB3A 4IDEA 4C4OA 2PKQP 3W6UA 4AJJA 3MTJA 4H16A 4IDDA 2HO5A 1XG5A 5TT1A 4B8ZA 4GWGA 4OO3A 5DBIA 4PN3A 3D4NA 3RU9A 4LRTB 1T4DA 5LC1A 4AJKA 3FWZA 5L9AA 3GVHA 5ADHA 4TWRA 1Y81A 1PWZA 5L4SA 1T2AA 4Z9FA 4OAQA 5TRTA 5BNIA 2VUUA 1XHLA 4ZJUA 2IDZA 4K1LA 3HNPA 3S2FA 4UVDA 1GTMA 4F6LA 2NQTA 4Z0TA 1C1XB 1IUKA 3TZKA 2BFMA 2Y1DA 4I1IA 1P33A 4ZVVA 4YRAA 2HK9A 2GYYA 2VYVD 5DF1A 1X0VA 4WCFA 2HMTA 4CV3A 3A4VA 5CAEA 3KSZO 3NV9A 2ZB8A 5T6BA 4GLOA 4OSOA 3PDUA 2P91A 1AUPA 1PGOA 4KDFA 4HADA 3BTUA 2PKQO 1TT7A 3PWKA 2EP7A 2YW9A 3VKVA 1YXMA 3JQDA 4FIZA 1ZMOA 4GAEA 1YS4A 1UP7A 3QVXA 4GH5A 4JROA 4A73A 4DBZA 4LSMA 2FR0A 1UDCA 4DIFA 3H2SA 5IN4A 3RWBA 2QYSA 2DUUA 3PRJA 1SO8A 3KSDO 4XR9A 5I7SA 2OP1A 1PJQA 4MVJI 1R4MB 4WJZA 3ABIA 2GNAA 2G17A 1A4UA 4W82A 3RUHA 4CMKA 4J9UE 1SMKA 3HUDA 1E6UA 2VYNA 4ZU3A 4XZ3A 4B4UA 4I9NA 1LRLA 3K5PA 2XAAA 5LDHA 1HLDA 1X1TA 2RHCA 1RKXA 3ZDFA 5T67A 2D5AA 4J1TA 5B4TA 3M2TA 2DPGA 3AOEC 1ZW1A 4W7IA 4YAEA 5G4KA 3WICA 4UVGA 4FFLA 3ZI0A 4Y98A 4LRSB 1E1KA 4KQWA 1LBEA 3GPIA 3K6JA 2CF6A 1O95A 4XRRA 4Z3DA 3FHLA 2AQIA 4GVLA 1O9BA 3D5QA 2R2GA 3FCOA 3UAGA 4CMJA 2WM3A 2QYTA 5TS3A 4ZQHA 1RM5A 2B4RO 5A9TA 1B14A 4XJSA 3LYLA 3WLFA 1LLUA 1JLLA 1I3LA 1QYCA 3OJOA 1H94A 3CE6A 4RVFA 2BHLA 2NNLD 3BIOA 4FC6A 1WMAA 2CUKA 3KYCB 4C7KA 4ALLA 5IF3A 3QVTA 1TLTA 1JKJA 3VTFA 4GX2A 3W8DA 3G3EA 4L4RA 4XCVA 6ADHA 1GAEO 3SLKA 1AGNA 4GSKA 1Y8RB 4J0EA 4JX8A 1C0PA 2Y68A 4LVUA 1U7TA 4N18A 3SX2A 1WLYA 1VRWA 1I32A 3R3JA 4LCEA 2X7HA 1RWBA 1L1FA 4DPLA 2V6FA 4GSLA 2BGKA 2O3SA 4ALKA 4FFRA 1ZCJA 2EW2A 3GEGA 2AMFA 2ZB7A 1ZZEA 1KC1A 3R1IA 1JN0A 4E13A 1TA4A 2GF2A 2AQHA 3I83A 3WFIA 4DXHA 4P8RA 1K5HA 4W9NC 3LT1A 4NBTA 4R3WA 5GY7A 1KOLA 1QG6A 1ORRA 4J2OA 4OXYA 8LDHA 3LDHA 1CYDA 1BG6A 2VWHA 1KS9A 1NPYA 1OI7A 1P0FA 4NU6A 4MPDA 4RF4A 1D4FA 3KXDA 1QYDA 3L6DA 4FC7A 1SPXA 4AJEA 1GZ3A 2VTDA 2ZQZA 4IDFA 4UEKA 3OECA 4IQ0A 2A35A 3COSA 3WYEA 3PJEA 1Y8QA 2PR2A 3S2GA 1BW9B 2X8LA 3I4FA 4YTEA 4UEJA 1UZLA 1PZFA 2YHIB 3HJAA 3ROPA 1NFQA 3GK3A 2ZTMA 3ZV5A 3PK0A 4EYEA 1M67A 2Q45A 3JQFA 1Q2XA 1ULSA 3DZKA 2X23A 1P1IA 1E5LA 1YQDA 5ILOA 3NKLA 3B1JA 4J4BA 4RVHA 1ISMA 3DO5A 3ICCA 4ILKA 1E7RA 2Y05A 2WYVA 3G79A 4IIUA 5I8ZA 4GBJA 2X5JO 2Z1MA 3OBBA 2DBRA 3H2ZA 2DTXA 5CPFA 1YGYA 5HWSA 1HETA 2VCYA 3GAFA 1AHIA 5G0UA 5JO9A 4B7CA 3VTZA 4BO1A 1EVJA 3UF0A 3VZRA 4YJGB 3RFVA 4D43A 4N7RA 2NV6A 5ITWA 1ZEMA 4FJ2A 3F46A 1M75A 4JIGA 3JV7A 4B4WA 5EJ2A 3ENKA 3L9XA 2X5OA 5L7TA 2W2LD 3HDYA 3PHLA 3PTZA 3DXFA 3QP9A 2G76A 3PWSA 4IS3A 1CQJA 3BMNB 4KUHA 4CODB 1PSDA 3H9GA 5B12A 5IG2A 4J1SA 1PR3A 1NYTA 3GUYA 3WWYA 3DC2A 4OKIA 3C24A 1UP4A 2Z5LA 1LSJA 1XDWA 2W2KB 3KETA 2G0TA 3SJUA 3O4RA 5IFLA 1J49A 1SOWA 1E3SA 5GZ1A 3PHIA 4NI5A 1X7DA 3LLSA 1R66A 4FFOA 4O0LA 2GO1A 1GZ6A 3FBGA 4E2WA 5F5NA 4IXWA 3GAZA 3STHA 4PLFA 3JQ7A 3H9EO 5EQDA 3RQSA 4R1TA 3C1AA 3NGLA 5EIOA 1ZK2A 3V1TC 4CPDA 4TROA 1R0KA 4P22A 5TSDA 2BLLA 1YDWA 3JTMA 2BI8A 1IE3A 3ZWPA 3BMOB 4R16A 3PJDA 2I65A 4CM4B 1RM4A 3UCEA 4XYGA 3JCZA 1HF3A 3SJ7A 4JLWA 2HAEA 1UXHA 4GX0A 2Z1NA 1PGNA 2D4AA 2GSDA 1DO8A 5DN9A 4Q9NA 1N1EA 4BNWA 4TMFA 3C8MA 3JD0A 3NT2A 4H3VA 3S8MA 1W73A 3BHIA 2JCVA 5EESA 2GLXA 2NU6A 4M1QA 1SNYA 4KUEA 3FN4A 2LDBA 5GMOA 1N5DA 2DAPA 2IODA 5JAMA 1GCUA 2BELA 4IJWA 4UUNA 2QIOA 5DZSA 2YHUA 1S6YA 1HL3A 4NK4A 4BKUA 2IZZA 4LCJA 3PI7A 2HCTA 4CLOB 1U5CA 1I2CA 3SLGA 3V1YA 2IYPA 3I6QA 3AY3A 4BHTA 3DBLA 4U0JA 2PZMA 4FGSA 3E5RA 1E3LA 1IYZA 3MEQA 4NR0A 2OBNA 1T4BA 3C7DB 1NQ5A 1E1MA 1YJ8A 3H5AA 1NM5A 1SEPA 2A94A 2Z95A 3C85A 3D7LA 3H65A 3JQ9A 3OM9A 4E32A 3OETA 5TX7A 4WLNA 5A3JA 1HYEA 1B15A 1DIBA 3PXXA 3V5NA 2FSSA 2CVOA 1EMDA 1FK8A 2D8AA 1JVSA 2ZTVA 2IRWA 3ANMA 2VWPA 4L8VA 4UULA 1IPEA 4MP6A 1ZSNA 1JVBA 2WMDA 4HY3A 3ZWAA 1IL0A 2ZTLA 4UVEA 2FZWA 3RBXA 3DAPA 4BO2A 4JN6B 4JCOA 1D1TA 4BNUA 3NAQA 1MLDA 1E1LA 3QWFA 1W6UA 5U9CA 3ZWYA 1GFSA 4L4SA 1DIHA 2AEJA 2UUPA 5C3MA 4YT4A 4PG5A 3WOHA 1BRMA 3QY9A 2EKPA 4IINA 4WOJA 2CD9A 2X5KO 3NDJA 4PRKA 3ZWXA 4R3NA 4TKMA 4UAGA 5ITVA 4S3MA 4OJNA 3LU1A 4R5HA 1H6CA 1EBUA 3MWEB 1BXGB 4L73A 4YA6A 5FI5A 1EBFA 1JKIA 5JSFA 4CMEA 1YBMA 2NVUA 1L7EA 1NNUA 1TVEA 1LQTA 2OL4A 3EHEA 1GPDG 3O38A 1ZK4A 4QUKA 1RPNA 3PEFA 1U3UA 4GKBA 1KY4A 3ITKA 3NJ8A 3ZZNA 3AY6A 3AWDA 3D1LA 3I4CA 4BO5A 4BMSA 4WLUA 3NX4A 1NASA 4HX5A 5CDTA 4B7XA 2X4GA 2BKAA 2XPCA 3ZCXA 4TRRA 1JTVA 5COBA 4Z0HO 1ISGA 3MZ0A 4E5KA 1NR7A 4HFNA 4CL8A 2YDXA 3O26A 2IE0A 3DR3A 3IUSA 3P5SA 1OAAA 2DUWA 3U49A 1P77A 1LRJA 2HJRA 3E5MA 3Q0EA 3WG9A 1M2WA 4DYVA 3ROMA 1ADGA 1EDZA 4NBVA 5G0TA 3VH4A 3F3SA 1FXSA 3C1OA 4JGBA 5DBGA 4CM8B 2B0JA 5AYVA 3AM4A 4O59O 3RUAA 4C7JA 1N9GB 3PZRA 1EUCA 2HSDA 1E0DA 1SB9A 1CJCA 2UVDA 4BVAA 1XGKA 2VWGA 4AL4A 3LVFO 1FDVA 4DQXA 3ZH2A 4E33A 3IJPA 1WWKA 5TLSA 2OORA 4GGPA 2ZK7A 4CM5A 2DM6A 4DC1A 5JY6A 3PVZA 1PU2A 1DFGA 3DHYA 4OXNA 1VJTA 4EJ0A 1WDLA 4DIBA 4PLCA 4DTIA 1R15A 2XXJA 4NBRA 1NP3A 3ASUA 2PD4A 3L4SO 4DA9A 4BS9A 4A2CA 1QP8A 3KLMX 2O3UA 3WYBA 4BO0A 4AICA 3B1FA 1EQ2A 4N54A 3ETEA 3E18A 4L76A 4L4XA 2P9EA 4Q3CA 5KNLA 1YQXA 3NTQA 4A7PA 1VL8A 1KERA 2VNAA 1MFZA 3C7CB 1QMGA 1ISIA 1E6WA 3D3WB 3KB6A 2H63A 3SC4A 3QV1A 3ZHYA 4RDHA 4Y6RA 5T57A 4MVJD 4PG8A 3BMCA 1UZMA 1XEAA 5JE8A 1KVSA 4RPKA 4CR6A 4PLWA 3VZQA 2QX7A 4XGKA 3DTTA 3DL2A 3O03A 3VDRA 3KYDA 4MKRA 4JQCA 4KWHA 4ZN6A 5CDGA 1KETA 2FPPA 4NJMB 4E12A 3U5TA 3OIGA 3I5MA 3INRA 2JD2A 4RF3A 3HADA 4Q3BA 2AE2A 1DIRA 3INGA 4RO0A 4YJDA 3ZV4A 3NUGA 4BO8A 2QHXA 4XQ9A 5A9SB 4L74A 1D8AA 1PZHA 3F4BA 3ST7A 1TEHA 2BMAA 5BSHA 4DPMA 4EI2A 4ZICA 1DXYA 3HDHA 5C5IA 4ZQBA 1PZEA 1OFGA 4H7PA 3U4IA 1LUAA 3QQPA 4A27A 1PS9A 3PQDA 1YB5A 1V8BA 4IQGA 3U3XA 2E4AA 1K3TA 2Y0DA 5F3RA 3WXBA 1NBOA 5A04A 1IPFA 4QTZA 2VOEA 3OH8A 3R3SA 4O5OA 2YV1A 3GFGA 2VT3A 1A27A 2FSVA 3JQAA 4HP8A 4IDBA 1BXZA 3AU8A 1G0OA 3U4HA 1OOEA 1ZXBA 3G49A 3GGGA 1B3BA 9LDTA 1XU7A 1YOVA 4XYMA 4ID9A 4K9DA 1UAYA 4JP3A 3WLEA 2H6EA 3KUXA 4A0SA 2RH4A 4D41A 1NQOA 1Y7TA 5EL0A 4BQPA 2X9NA 1O5IA 5G2OA 5L53A 3QSGA 1U3VA 3F9IA 3H9QA 4OSPA 5A05A 2JHFA 5F21A 3O8QB 3QWBA 2OO5A 4KWIA 1EDOA 3WGHA 4IQ8A 1DJQA 1AXEA 5JLAA 1Z6ZA 3E82A 4FJ1A 3ZHBA 5CFZA 2C07A 4ND4A 4O63O 1Z74A 3PGXA 5FI3A 1UDBA 4BNJA 1M6WA 4W9NA 3L6OO 5KWEA 1B26A 1LC3A 3E48A 2B37A 2JAHA 3UVEA 2VRCA 4D3DA 2O3JA 1VC2A 3DBRA 3CMCO 4R68A 4CQMA 3IL2A 1C1XA 2EERA 2Y1GA 3CZRA 4JXKA 1DLIA 3ANLA 3SBOA 4PLPA 3W8EA 2HDHA 4AJLA 3WTBA 1YB4A 3OEWA 1VKNA 3RJ5A 2PLAA 2DQ4A 4K6CA 1CF2O 4WLEA 2VOJA 1PS8A 4E30A 2OMEA 1F0YA 3RFXA 2EWMA 2J5KA 3OEYA 1IOLA 2RCYA 2Q50A 3GVIA 3RUFA 2Y1FA 1ENOA 5H83A 3RC2A 5CHEA 3VH1A 2EHDA 3RJ9A 1J6UA 5JW6A 5CEEA 4J7CA 4PFJA 1EFLA 1FDUA 1NVMB 3W4KA 3WWZA 1LC0A 4FFMA 4I8XA 1HWYA 1DBVO 3VHRA 4XJTA 4ZGWA 3Q3CA 3X2EA 2GZ1A 1GYPA 5LDGA 4WEOA 4CM9A 1Q1NA 3GEDA 1ZMTA 1R4MA 2ZJ0A 4G5HA 3VZPA 1HXHA 2G5CA 3CKYA 4E3ZA 2C54A 4DBVO 5B4UA 3TDKA 3OJEA 3AK4A 3GNTA 4IS2A 3BA1A 5DULA 4E0BA 1ZO8A 3ZW9A 3ICPA 4WGGA 5FYDA 2EW8A 4YCAA 1UP6A 3QWIA 3JQBC 3IP1A 1DEHA 1UUFA 4Z9XA 3GN2A 3JQGB 3I52A 3T7EA 1T1RA 2Q1UA 2HU2A 3ZNPA 2R6JA 5FWNA 5A1TA 3KV3O 4UVHA 3LC2O 5ICMA 3PJFA 4JJFA 3FD8A 3OIFA 2DBZA 5DP2A 5IXSA 3U4CA 1ZEJA 1UZNA 4R51A 2CDCA 3PGJA 2DC1A 5JDCC 2J3JA 2H5LA 1HSOA 4MIYA 4XDZA 5AXDA 3RD5A 4XIJA 1KVUA 2W8ZA 1ADFA 3HDJA 3RROA 1LI4A 4JP2A 4TSKA 5IDYA 1EVZA 3EAGA 3GN1A 4B3IA 4IGEA 2JJYA 1YDEA 2PY6A 4FCCA 4JJGA 2EIHA 1Y8RA 2O4CA 2YQ4A 2A4KA 2Q1SA 1EEHA 3PLNA 2NTVA 1R0LA 4MOWA 2DTEA 2GN4A 2OXIA 3TF5A 1DJNA 3Q2IA 1Z75A 4LGVA 2HMSA 3OHSX 4YXFA 4XWYA 3VPHA 1LDEA 3BHJA 1J4AA 1FF9A 4ZQGA 4E6PA 3P7MA 4YJFA 1PTJA 1R4NB 4CUKA 2TMDA 4R54A 1SB8A 3DZHA 2BFOA 4I5DA 3WIDA 3H5NA 1YB1A 4XEHA 5ENVA 3DMTA 1LLCA 3QW2A 3ZHZA 2ZATA 3K8ZA 5BQFA 5ER9A 3FPCA 1A72A 3MJSA 1M6HA 4OM8A 2OGUA 2C20A 1P0CA 1KEPA 2X0RA 5HRUA 3CUKA 5CDSA 3PHGA 4G65A 2QW8A 2PD6A 4INAA 4U5QA 4FFPA 3GRPA 1BW9A 1D7OA 3BMQB 3H3JA 3MJ4A 1PJLA 4PLHA 1A9YA 1VL6A 1Q0LA 4J4TA 4EUFA 3GVPA 1LDBA 3PPIA 3VH3A 2C7VA 3UH1A 4K26A 1UXIA 4PZDA 1P44A 4CLHA 2DU8A 3FNEA 4ALMA 4E2YA 1HDYA 5JPIA 5DDIP 3NRCA 4QECA 4Q39A 5JDIA 3ETDA 4B3JA 4AJPA 3D64A 4BNHA 4ZHSA 3GA0A 3TOZA 1BVUA 4QO7A 2B5VA 3WR5A 1YBAA 1ZJYA 2GGSA 4FR5A 3IAHA 4P4GA 4YJGA 3I9KA 4TZTA 4YDRA 4B3HA 1DAPA 1U8FO 3FTPA 4YAKA 3V2UA 3DBVO 2YFHA 5L4LA 3WB9A 3I9OA 4PG4A 1IZ9A 1V35A 3JQ6A 4IBOA 5K6AC 1H9BA 5I7FA 2VHZA 2O3TA 1KEWA 3BMNA 3N74A 2G82A 1ISJA 1BGVA 4DLAA 1MB4A 4XRGA 1HDGO 3NT5A 4MIEA 1UR5A 1YL7A 3ZN2A 3NGXA 1I10A 1E5QA 1PJCA 1A71A 2VHYA 5I9NA 3PZBA 5DBFA 1NXQA 3TOXA 4IJKA 2DVMA 3JYNA 3OA2A 5JAQA 1ZXLA 4HXYA 4PIVA 4Q3EA 4R9SA 3U62A 3A06A 3EC7A 3HB5X 3D4OA 1DRUA 4LW8A 4O6VA 3U9LA 3L4BC 3RKRA 3RFTA 5BNFA 1FDSA 3PYXA 1CRWG 2V65A 4UUOA 4YPOA 1EE9A 4U7WA 1MC4A 4LMRA 1BMDA 4OOEA 1C0IA 5HBRA 1E7WA 3DB2A 2E49A 5TQVA 2GERA 3DBHA 1H93A 5A03A 3VKUA 2FY8A 3R6DA 2NU7A 4I9HA 5G4LA 4FOOA 1YRLA 1Q0HA 4NJOA 5JYDA 3I23A 2X86A 4NZ9A 3KSUA 4Y6PA 2CSUA 5B37A 1AE1A 4MVJP 1YKFA 1UAGA 3H5RA 1IHYA 4S1VA 3GF4A 3DZIA 4QX6A 5IN5A 4IIVA 2NQ8A 4IXTA 3EZLA 4EUHA 2DBVO 4H15A 3JYPA 4U8GA 4KZPA 3RASA 1HE2A 3WX0A 3KLPX 1YL6A 4TRMA 2CVQA 3LQFA 4E5PA 4CLOA 1TI7A 1LDNA 5G0WA 3IDSA 1GUZA 4ZQFA 4W7HA 1QORA 2WE7A 3OMLA 2BI7A 3ZU5A 4L9RA 2X22A 4DIOA 4BNXA 3GEMA 4BB5A 4CMGA 1WMBA 4YBZA 4PVCA 3F4LA 5HA5A 2BD0A 1ONNA 1TB4A 1DC6A 1PGQA 5KJCA 1PJTA 1H6DA 5JMPA 3AUSA 1F8FA 1C1DA
chains in the Genus database with same CATH superfamily
3M6AA 2E4YA 2RHRA 1R3DA 3WSWA 2BGNA 1U2GC 1FJXA 3AR6A 3LWZA 3ZWDA 1W1WA 3SMQA 4W8HA 1UXGA 2OD7A 3GCXA 3W3AD 2WWGA 2XZPA 1U4OA 2PZGA 2JLAA 3FMFA 3UTCA 4NECA 4QVKA 3VZSA 1NZFA 2ZAMA 1E6CA 1FUKA 3L05A 4LNHA 1UDRA 5FOQA 4HWTA 4OLFA 5E4YA 3HQ4O 1VB5A 2I67A 4YCMA 3O4VA 1T9ZA 1JR2A 1FMCA 2OHVA 3EIHA 4FYJA 1ZK1A 1SCUB 3D9QX 2XX3A 2VZ8A 3IXQA 3Q87B 2V4ZA 4ERNA 3RNLA 4JI4B 2OENG 3TSWA 4DEVA 1IUOA 1EP3B 1JBKA 2GF9A 3D02A 4IUYA 2F8SA 8MHTA 1ZNWA 4L16A 2GJ9A 1NJGA 2VZ0A 5ALMA 3F47A 5CIQA 5DYYA 2EJTA 3FYTA 1FQKA 1RLUA 2DKNA 2WAAA 4HLQB 4YQZA 4TS4A 4ZVMA 4DV7B 5IJWA 4OQ4A 1CXZA 1X1SA 4US2R 3C8UA 3MWEA 5IYZF 3T7JA 4HWGA 4KWCA 2PANA 2ZB4A 2M2IA 5CX1A 1WDKA 1K6IA 3N05A 3HKEB 2QA5A 4D6YA 4DUGD 4EA9A 4OMFG 4TRJA 2M9MA 2RHBA 4J7XA 4BE7B 1MW9X 4P3YA 2RDMA 2EJWA 4YFVA 2RKWA 4PF1A 3LZDA 1DRWA 4XM1A 5CGQB 1LDGA 2UV8A 4AJIA 5CA1B 1MZPA 1O87A 1XDZA 1XCJA 2RG7A 4I9UA 3DDUA 4LOIA 2QBYB 3CW2A 5EMNA 2WJZB 3SFZA 3QWAA 1AU9A 2B69A 4MKZA 4B79A 2B98A 1QGYA 1T2EA 3JD2A 4EWLA 4ZJZA 3HCRA 3R9XA 4FI3F 5CT4A 5A7HA 4NZOA 3L79A 1E1NA 1NN5A 2DSTA 2W22A 3HWRA 1XNRB 2PQ0A 1ZH6A 3QPVA 4DJJA 1MUUA 3RT7A 1QOZA 1Z2DA 5EXEA 3DUWA 2OXFA 5BRNA 4IO1A 3UHFA 2VHCA 5AOVA 3K92A 1H0KA 3E8SA 5EKTA 2GPNA 3R5XA 1VPDA 3HPRA 4GEKA 1G20E 5F1PA 3ZEIA 3B5IA 1ZVQA 4MJ7A 3N9IA 5M34A 1ZKMA 4I55F 5BOSA 4D0RA 1RPZA 2BT4A 1JR3D 5IAOA 3CRNA 3L8EA 5C1IA 2A2ZA 3NHSA 2KYRA 3TIXB 4OXIA 3UMVA 3WLMA 1BDBA 3IP8A 3VO9A 1HDRA 3PIDA 1IN4A 1N2GA 4GDFA 3CLVA 3DDNA 3H1TA 2WF6A 4MW7A 1NZJA 2VP4A 5BQ5A 3M34A 3ZWKA 3I0ZA 2QTVA 3AKEA 1N9GA 3N8HA 3SOZA 3GGOA 1ZAYA 3D8SA 5ICEA 1IU9A 2CE7A 5AICA 3VU3A 1K6EA 4ZV7A 1T2VA 3CC8A 3GEBA 4O25A 4BASA 1GLGA 4BDTA 1SD2A 1SUEA 1T0HB 4EA6A 2G09A 1ISSA 3WNQA 3ZH9B 4H17A 3T7CA 3REQA 1WOMA 1PJBA 1PZXA 3RVLA 3WHPA 3G8AA 4IMPA 1WXHA 3BE6A 3GVCA 4V3CA 1XAHA 4PHFA 4N03A 2VYCA 4KAJA 3VU9B 3P20A 2GPSA 4R81A 4JQZA 2HMWA 2BKLA 5U4QA 1UIMA 1C9YA 1ZD2P 1LTHR 3IIEA 3PSHA 2J09A 3IQEA 3TLGA 5E1DA 2VYVA 2XOXA 2I2BA 4R6WA 1E2IA 1ZJZA 4EX6A 3TG2A 3RRZA 3DVQX 1T5BA 2CVHA 5C1BA 1B6GA 1JE1A 3KPUA 3KEQA 1XF1A 2A5GA 2D3TA 3PPWA 4PYOA 3ZYZA 4G5SA 3S99A 1UXKA 2O50A 5ESDA 5CB4F 4LJLA 1QO0A 1B23P 1G6KA 3I6MA 3QMMA 2WE8A 1W7AA 3SJAA 4RD1A 1WCV1 3NVKI 1LPAB 3IPXA 4TLMB 3BS4A 3GJSA 4A6EA 5LLSA 4DLXA 4U2BA 3KAQA 3NHJA 4DGSA 1HLGA 2NPOA 1A2BA 3T06B 1UBFA 3JD4A 3CXUA 1XR3A 3W5IA 2ZSKA 3MLAA 3D6MA 2NADA 1MG5A 2DWCA 2JAOA 2RIPA 4LJ7A 1T13A 1DPFA 1WZNA 1ZD8A 2BISA 4FN4A 1Z6AA 4HWPA 4Q7QA 1VL1A 1FP4B 1HTBA 3H75A 4PZEA 5IC6A 2XQGA 3A31A 3LBAA 5JBIA 2WBLC 3PE4A 1G8SA 5E3IA 4UJ5A 3RAEC 3WL4A 5EJGA 3R0ZA 2RHWA 4QBGB 1XQ1A 2G4LA 1WHTA 3FLMA 1A8SA 1L1QA 2O20A 3IMFA 3INNA 1HE4A 3OZFA 4TPKA 5CT6A 4ACAA 4BV8A 2JIQA 3RSSA 4I5FA 4QATA 5J4YA 4MS4B 1WPQA 3L7YA 4J1NA 2FUEA 3EVFA 4R1UA 2AN5A 3I8SA 3D7KA 3EW7A 3S1AA 4MDFA 2X9VA 4MVYA 4TMKA 2PO5A 2NMVA 1CY1A 3OOEA 2NZ8A 5J2TB 1I7DA 3RH0A 3HDVA 1S7CA 1ANKA 2I5PO 1VE3A 3PS9A 1Z5VA 4NQRA 1OWMA 5BV1A 4E03A 5BSFA 2VYND 4P3NA 3RF7A 3NYQA 4X8LA 3VDQA 1VL2A 2AHRA 2BMWA 2XT0A 4OGFA 3TI9A 4LE1A 4HC4A 3WGZA 1L4BA 3ZG6A 2O8BB 1N78A 2RD2A 2ZM5A 3SF0A 2D4HA 4YAGA 2CK3A 5I48A 3ND8A 4BCCA 1EVYA 1KZ4A 4DAOA 1X6VA 1B4DA 1RI3A 1UJMA 1JEAA 5KBYA 5BSGA 3OZIA 1E7YA 1SGWA 1NJ1A 1KTVA 2J1LA 3CIFA 3FY4A 4TXJA 2IBTA 3LKBA 2PUBA 3E6AA 1SQ6A 4N8DA 1NUAA 4JT9A 2IHKA 1O95D 4JNKA 2C3UA 4AYTA 2B8TA 3CN7A 2ON6A 3EQ2A 1GQSA 3HUEA 4YP1A 2RAUA 4V0SA 1KZHA 2CDAA 3QY0A 5LNK1 2HK6A 2Y1OA 3R0XA 2ZSAA 3K7EA 5EXDA 4J0CA 4HUQA 1HG1A 4G1FA 5EIEA 1AGRA 1QGUA 2WZDA 1GKKA 2HRBA 2A0KA 5SZIA 5AUQA 1F06A 1N7GA 1RAFA 5BNWA 5A5DA 4YRPA 3KEGA 2F3TA 2I91A 1RRVA 5K3AA 2AD5A 3HB7A 4FNOA 2P0AA 4U00A 4HR7A 1BTOA 1K27A 2W7TA 5KTRA 2GAJA 2CEKA 2W2OA 1ZBQA 3DNMA 1G5RA 2BMVA 4AUNA 5FPPA 1KO1A 3LX6A 3ZZ0A 3ZXUB 5AW4A 3E9QA 3U4DA 3UJDA 4A8PA 1JFFB 3ON5A 3AOGA 4EPRA 3P9IA 5HKOA 5KMGB 3U09A 4BKOA 1JDZA 1KORA 4JBGA 3PC8C 3N0WA 1E3WB 2YJGA 7GPBA 2GCGA 4JBIA 3O8RA 3ZWCA 4M86A 1U2QA 4NIMA 4LX0A 5JIBA 3FTEA 3U6KA 1CUWA 3FRHA 1MEJA 4RGYA 3OTOB 2FEPA 4Q3LA 1KPHA 3BCUA 4U7FA 2Q7DA 3W4IA 3W7VA 2I4RA 4BUJA 3KU1A 2WIDA 5EJFA 1GN8A 4JLPA 1ULAA 2YUIA 4R4JA 3BM5A 2NVUB 4B4DA 4K0KB 5L6LB 4CQLA 1HE3A 4CFZA 4ENPA 3I39X 5KWJA 4FWBA 3O84A 1FRNA 2B3DA 4U9HS 2OCKA 3L7OA 3R3UA 3PBKA 4B84A 2V7PA 1HRDA 1FNDA 4PAGA 4PLZA 4RVUA 1QYVA 3OE7A 3ZD9A 3AI1A 1PSZA 3DEKA 1TFRA 3ID6C 1ZK0A 3L0DA 4QNRA 2I6GA 4R1LA 3S0JA 4MX8A 1V4NA 3VOSA 4Q9JA 1KR5A 3MK31 2GK7A 4WW0A 1TW2A 4Y18A 1UMCA 1MX3A 2V7WA 4MQ4A 3AOEA 4XM2A 1ML4A 4RVOA 5B6JA 2D13A 1R6XA 1WU8A 2YN0A 3PIIA 2OOSA 6YASA 5IC4A 2YJZA 3FVWA 3KEFA 5CH3A 1M0TA 1VYUA 3MWDB 5JV5A 5KSWB 3T52A 3P9ZA 4CMAA 3VAAA 4UPEA 1FJGB 1I2BA 1U4NA 4CW7A 4QRDA 4KDEA 4XIFA 1OB5A 2BR3A 3QF4B 4FGKA 1YH3A 1VP9A 1E2JA 1FTQA 2JGMA 4PICA 1MA0A 3ZUPA 4F96A 4N1AA 1Y82A 4XWTA 5CA1F 1KKUA 2HO4A 4IDAA 1Y3FE 5EE9A 3PNKA 1M6VA 2H59A 1PZGA 2RFLA 5HE8A 2NPIA 1EUCB 3WP0A 4GKKB 3QELA 4G8CA 1N2IA 2VCHA 4MW1A 5CM9C 2X14A 2VSOA 3UJ7A 2FN7A 3GFRA 2J7PA 4LJ6A 2LD4A 3ROZA 1Y6JA 2Z98A 2WFLB 3IYLW 4OX9Y 2AN1A 1PIWA 1C14A 5E0KB 1UBMS 4PG6A 2CXRA 2ZRBA 3M5CA 1ZP6A 2O2IA 1A04A 1GZ4A 2HSGA 2VHJA 4UBIA 5FTWA 1EK1A 5FWAA 3P2EA 4QUDA 4YB8A 3ETNA 1RYYA 4IHQA 3W3ZB 3ZGZA 4FPXA 1CDOA 4TTRA 2ILVA 5H02A 1OV4A 1DJLA 3ROEA 3M1IA 1PJSA 3D0QA 4IDCA 4M54A 4X5OA 4I1PA 1ORTA 2OZKA 5DTEA 2FNAA 1Z4KA 1YDFA 2ZSHA 4WVFA 3R2JA 2YUTA 4O33A 3VM6A 5J4VA 1EK2A 1JHAA 1K7YA 3MYRA 5LUAA 4PCUA 1Y5RA 3C6YA 3AHJA 3PQ8A 4JHXA 4YJ3B 5CVCA 5JWRA 4JLKA 1DV2A 1V16B 2OYCA 3G8DA 3LPLA 4NS4A 3V8PA 2XB6A 4W5QA 5D87A 3E3AA 4KAXA 2D2IA 1JEYA 3SC6A 3FPEA 5JMWA 2VR1A 1TC1A 2PMWB 5DHFA 2EVWX 1V45E 3C3WA 2WPDA 1ESMA 3RCBA 4DC0A 1VI6A 4G0QA 3IULA 1E61A 3NB0A 4YRNA 2WWXA 2JCYA 2YBDA 3B7PA 4A2WA 1SCQA 4KPUA 5DT9A 4FDMA 1Z4NA 1KC3A 4UMEA 5DE3A 1XWIA 3IUPA 4J0QA 4KYUA 1DC5A 4BLQA 4URVR 4DDVA 1HYHA 3ELYA 2XYRA 2H7VA 2HEIA 3CUUA 3AHHA 2P1RA 3CG4A 2ZYAA 3UYKA 5BRAA 3ICEA 3OLZA 1V11A 4RF5A 4EG3A 3WQQA 4OVKA 2XNSA 2MIIA 1JXQA 2AEEA 3CNHA 1MB0A 4URFA 2WC1A 3DO6A 5EZYA 3WWPA 3ZI0A 4CJXA 4EH1A 5HKAA 3P26A 2CZQA 1QK5A 1UDAA 5G1OA 1SUCA 4AW9A 3PHHA 3GNQA 4DNPA 1T4MA 1IEWA 2CUNA 1DO0A 4L4ZA 4AWBA 3LHSA 4LISA 3UFXA 1JPVA 4MYHA 3W90A 3DL0A 4YWJA 1U2PA 3WMGA 2J6IA 2C1EA 3TFOA 2AOXA 1FUIA 1XCMA 3THRA 1NR5A 4KQCA 2B30A 2QN9A 1YRYE 3M4NA 3OLXA 4JSRA 2GZSA 5JR3A 3TNFA 2DEUA 4PG7A 3AF2A 2HHAA 1CZKA 4B3TB 4A1OA 5EXTA 3G2MA 2HF8A 4CT5A 3E0QA 1JQBA 1GEEA 5DCWA 3TL2A 3QXCA 1N1MA 4PR0A 3KPJA 5ALKA 4EAQA 4F8YA 3BMXA 4G1VA 1VB3A 2C96A 3NVMB 3OLVA 2J6HA 4UOEA 4GI2A 4RPGA 4FYWA 1UEIA 3ZY6A 1TQDA 1A7KA 4QGGA 3EF1A 2PX2A 2QZ9A 5J2TF 2WUEA 2F3UA 3SM9A 3W78A 3A10A 3QU7A 3PICA 2Q0XA 1JQLB 1GG2A 3FHJA 3Q7EA 4UU8A 1MVOA 3F4KA 1LBTA 4JH0A 1RVDA 1L5WA 5JISA 5JNSA 1SG0A 4LY0A 1LZKA 3FOAA 1ACMA 3QBEA 4HQLA 5MN5A 5A5EA 3GEIA 3EFOA 2CYBA 7MDHA 3UATA 1U6KA 1NPDA 3ZKWA 1USVA 1WJGA 2DQYA 3DZBA 3H2KA 1U1FA 3IMCA 4WEQA 5BWBA 5CCEA 5H4GA 2HK8A 1NY5A 1EZ4A 1T1GA 2DPYA 2QUHA 3FA2A 3NETA 4KMMA 3O8NA 4QHSA 5L6MB 2FN9A 3Q7SA 1VG9B 3TRIA 2RGNC 2BSXA 3V7FA 1P4HA 1L7VC 4OMUA 4QC2A 4UVIA 3VVBA 2IEYA 3WRXA 3ZTTA 1CV2A 3HY4A 2KPOA 1JU9A 4RZHA 4F3CA 2Y1KA 4E4RA 4Q4CA 2XI4A 3NRBA 3KOWA 2CXSA 1ONOA 3PC4A 5H3HA 3T7TA 4QDUA 3CLRD 3ETJA 3IJEB 5D8DA 4AY2A 2C2MA 5EVJA 3IUJA 1BHQ1 1NXSA 5FTKA 3BTOA 4K9RA 4AFNA 3FPBA 2HWUA 4YRDA 4DLTA 2WJHA 1EQUA 4H7EA 5HGJA 5AVYA 5LP6B 4GOLD 3LW7A 4AXBA 4C7OA 1QANA 2ILTA 3H1FA 3HYNA 5AI5A 3HZZA 2ONYA 3DO8A 4JQSA 4N01A 2D1FA 5BPHA 1SVNA 2KX7A 1CB7A 4HVCA 4NFLA 5BN5A 1HDCA 4GRDA 4HRAA 4E3WA 4HL6A 5AM0A 1THTA 2NXJA 3D0OA 3TDNA 4LOKA 5HCUA 3B70A 3AL2A 1W76A 4W4TA 3W5BA 5BO5A 3BAZA 3DVRX 4MR9B 4ZXPA 4DR3B 3AFIA 1O4VA 1IBMB 1ZIPA 2JB9A 2J3QA 2PGLA 3MBKA 3PVCA 4MWOA 4ZQEA 3SZOA 3ZPXA 1TUBA 4YJHB 1IRXA 4NYJR 1SFRA 1JAXA 1UZAA 4LYFA 5HOEA 3A0RB 4DCPA 4TRNA 4FOSA 4JJEA 1L4FA 3ZXYA 4TYPA 1DIGA 4C20A 5C4IA 3ZGLA 3PDJA 4LRXA 4MW9A 5DTIA 3LMKA 4JSYA 2NOAA 1HBJA 1FOEB 1S96A 3EY9A 4LECA 4ONEA 2FPIB 4WNYA 2NXWA 3VDNB 4CM3A 3K6RA 4MV9A 5KC9A 1EE2A 1HEIA 2HPVA 2PWPA 3KOUA 3R5TA 5G53C 4H1VA 2YWBA 1QKIA 5AI9A 1W1IA 5KINB 3GG2A 4JIMA 1QK3A 3DTVD 4NOJA 3MAJA 3R09A 3LGXA 2MWMA 4HN4B 2JHAA 1FW6A 1DSSG 2PV0A 3W0LB 2PKYX 2ZIEA 5DLDA 3FRJA 1XCOA 4WERA 5FXMA 1E4VA 3C1TA 3DZFA 3ZC3A 3I9MA 2C9OA 4GM1A 2TSYB 2GJKA 1OXKB 1IUNA 1OF1A 1VE9A 2HN9A 2B3TA 3AEUA 3BXFA 4IV0A 1G1MA 1XFAA 4PBRA 4REOA 2GILA 5KTKA 1K89A 3G1TA 4MQBA 2YJTD 5FHQA 3VYRB 3PVSA 3A9VA 3L1HA 1NFFA 4HAZA 2GEFA 4Y2SA 5FJIA 3ZBTA 1Q16A 3A9UA 4Z7OB 1VMAA 2HU5A 3I9NA 2P79A 4OM7A 3T5GA 2ZKLA 3PENA 4TLAA 3GPCA 2C9MA 3GJQA 3IQWA 2O2HA 4N0EA 3RKUA 2XF2A 2WV9A 3KKOA 4BGUA 3K31A 4Y2QA 1BJKA 2OWEA 5HTKA 3GDGA 5ITSA 4QOGA 3IQHX 2WEKA 2E82A 2J3IA 4ROSA 3C7TA 5F2EA 4XUGB 5AVRA 5JNLA 3BL6A 5AJYA 4PHHA 1BRTA 1G2QA 2NVWA 2OMKA 3A6EA 5T8KC 1LSOA 1Q92A 2BV3A 1YRHA 1GUFA 3I3OA 3K3PA 3MRVA 1RZVA 4KXMA 4MICA 5AJWA 4LCBA 4DC9A 4LWPA 1ZI6A 1LV8A 3DBIA 4L8LA 2UYCA 5HK9A 1MX5A 3J81k 1GVNB 1QRTA 1JR3E 3IEPA 3EVAA 2WJWA 5G0VA 5THQA 4DIDA 5EHIA 1GDDA 3GVXA 4TT3A 5CGZA 1TAUA 2IZ0A 1P2TA 1NQUA 1VFNA 1JHXA 3G7UA 1TGYA 2PVSA 5EG5A 3RUPA 1A5ZA 1JSZA 4FLEA 3BK2A 2HGZA 3OQ1A 3SY8A 5K8LA 3IAM1 4TLEA 3DMGA 3LQ4A 3N2GA 5DHQA 5AW9A 3TQRA 4GOJA 5ETJA 3OUUA 2J0UB 2GN6A 3DYBA 3E4CA 1YD7A 3O1JC 1TE2A 2ASVA 3TCNA 2HCRA 1LGYA 1YI8A 4RIIA 2Y0EA 4MYTA 1C41A 2VPWA 1TT5A 2JFZA 2VEOA 4TMXA 4YJ3F 5G40A 5LP6C 3GX1A 3RAGA 1DINA 3IHKA 1M34E 2P30A 3Q40A 4IHJA 4UMDA 4HPXB 5KNCA 5JYEA 2G5TA 3O9ZA 2EFHB 3I32A 1FFGA 4KBGA 1WG8A 3OQIB 2QJTA 3KK0A 3UKDA 1NFRA 1N7HA 4WSOA 5EVCA 1I9CA 3ZXXA 2XMSA 3NT4A 1AZSC 5FAKA 1GLVA 3JWEA 4RGVA 4W1RA 2XNJA 5E1MA 3V80A 1SPBS 5IVPA 3BSSA 4FW8A 2P5UA 2GNOA 3BHNA 5IDVA 2OUIA 2VF7A 5DBOA 4GLLA 4D7AA 2V03A 5CD1A 4G41A 5ECDA 5AUPB 3KQQA 4QQFA 1L4GA 4FW9A 2DWQA 4J0DA 4FINA 4NHOA 1G8HA 4MWTA 4R2MA 2AUMA 3RHFA 4ASUD 5AOAA 3LC0A 3GL9A 3IHTA 4TM8A 3ZOKA 1RP1A 4HATA 4OXRA 5HIMA 4NBWA 4C2BA 1R64A 3KKKA 2V7TA 2V0GA 2GKSA 1JAYA 1O03A 2Q62A 1HLFA 2O23A 3QE4A 4GECA 2B78A 5EUBA 2R1TA 2NLOA 3ZD7A 1UL1X 1R88A 1J2EA 2PH5A 2PX8A 3JQAD 3QYJA 3T3DA 3VR3A 2IXTA 3T5DA 1EIWA 1T3ZA 1KY5A 2ONCA 5CFNA 1G3QA 1P6XA 2B36A 2FVYA 3EA5A 1AM4D 1JKJB 2LPMA 4EMUA 5I01A 3VR1A 2BI4A 3TFQA 2OYSA 1T6YA 1UWCA 4RNCA 3CMMA 1KDOA 1OWNA 4O4IF 4ESHA 2AXPA 1LX6A 1GP2A 1YAJA 2VA9A 3EXFA 3KPVA 4MWSA 4AY3A 3HJNA 5CT5A 2ZRQA 2ZS7A 3C87A 3KEOA 4ENWA 4DVGA 2CD7A 2ZVQX 3M1AA 4OBWA 4RK6A 3KT6A 3OHPA 2Z8YM 4ABTA 1GYQA 2PRSA 4FGJA 4FYPA 5KC8A 4JXXA 1LW6E 2GDZA 4EKYA 1N8TA 1R8XA 4GNKA 2QTLA 3DOCA 4BKPA 1EG7A 5IKOA 3MT8A 2V3WA 3K8YA 4DCMA 3Q1LA 2VQDA 3UPUA 4UHKA 2HCBA 3ODPA 2VQEB 4ZWNA 3AM1A 3QIVA 2AX3A 1XTUA 4AKIA 4ETNA 1DQZA 3Q5DA 4OCZA 3PUZA 4N8EA 3AUYA 1RWPA 1E32A 3BX1A 5CLHA 4EHKA 3IQFA 1G3IA 2I1LA 5FORA 2YJ6A 3WB1A 1XJ5A 1XTJA 1SU8A 3H04A 4I5GA 3EJ6A 3DAFA 1TU4A 2I8AA 1U65A 1SBHA 5K03A 3ELUA 3PKJA 3FPJA 4K9SA 2AMVA 4Q9AA 3UANA 1SHUX 3VR4D 3WKDA 4F4DA 4KE9A 1X3SA 3UEOA 1P1FA 1ZN9A 1SCKA 5GM2A 2RBEA 1L6RA 3DNPA 2W4QA 1E7QA 3T4EA 1AKEA 2AYZA 3K2EA 3F8TA 5JANA 1NL3A 2XH8A 1F9AA 4EF5A 1BH6A 1DTEA 3Q41A 1J5PA 4BJ6A 1G41A 5KJ6A 3OC0A 3PFIA 4WLOA 3FWKA 2OT3B 1M5UA 1O58A 3I6IA 2WKSA 4I5EA 5CX4A 3J7AC 1BX0A 3ELWA 2OAP1 1MJFA 1J0DA 1MAWA 4QTUB 2EARA 1HY3A 2C4VA 5C3UA 1QAQA 1VLLA 1RXSA 4QIHA 4YO8A 5C3MA 2ZSJA 5GM1A 5I9MA 3QMPA 1NQTA 2EU8A 2IXEA 1TM5E 1S3SA 2OQVA 1MOPA 4RFSA 3CKMA 1HE5A 1CR4A 2YW2A 3FUUA 5BVGB 4HK4A 2IEGA 4PC1A 4WQMA 1ZOPA 2CVZA 2CLHB 4C0AC 4H0CA 5JASA 4ZTZB 1V8ZA 5AVZA 2HJ9A 4PXAA 3ZHCA 1T2DA 2QGNA 3MJRA 3HB1A 3OX3A 2LCFA 5FUVA 3Q2KA 4ZJYA 3VO8A 5IULC 2XV1A 2L69A 4LAFA 2PZKA 4EVQA 4PC6A 2L2QA 3AL3A 4HZUB 2J41A 4PEVA 4NCKA 2QVYX 3SBDA 3SC2B 4D45A 4Q9HA 2EKLA 3FSEA 3UGJA 4ZANA 2YTZA 4NONA 1TCUA 4KITB 1HZZA 3I76A 3BF8A 4X6UA 5LQNA 4GVXA 2PUGA 1VLJA 1MG0A 2E4XA 2XGMA 3R4CA 1L7DA 5JAIA 3EPKA 1Z8NA 4GE0A 1M2VA 3A1CA 2WAXA 3SVTA 3WL5A 1E4EB 1HEUA 1T0BA 1U1IA 2ZBVA 2CXXA 3VI3B 5DH9A 2AG8A 2O2EA 3WX0A 1BDJA 3H8VA 1XVTA 4RL6A 1EUDA 1N5OX 1QO9A 3I9JA 3QFCA 1SKAA 2C5GA 2AG5A 2G07A 1ZC4A 2WIGA 3BN3A 3D5TA 3GLHA 1XDGA 4BBJA 1IJBA 4YR7A 1SU6A 3DFIA 1PR0A 4WNAA 4Y6SA 5KHLB 4XM0A 2VZ9A 2P4UA 4NHEA 4TLCA 3KUCA 3RTBA 4EUSA 1W0KD 2X1HA 3QVOA 2Y1EA 4N7JA 1I0ZA 1A76A 3D3WA 3IR6A 1TMGE 2I6XA 3OIVA 4OMCA 4PLGA 4UUMA 1F17A 3ECSA 4FBLA 1PT5A 4PCVA 1TYZA 3LIIA 2P6PA 4NF2A 1EVLA 5IH7A 4G0YA 4JITA 1JA9A 1CSEE 1TUGA 4DDWA 4KGZA 1EGVB 1OHHD 4JLJA 1K9VF 1OQAA 2E4UA 2NN3C 5JAZA 2DB3A 1D6NA 2XCUA 3N7UA 3Q7RA 1GPAA 4TXNA 1J2RA 1SCIA 2CDBA 5C34B 4BAUA 2I7DA 4GPTA 3SFVA 4GOKA 5AKJA 5BURA 1QO7A 2M1XA 4AJHA 3KUDA 5AP9A 4X20A 4ZVRA 2V45A 2VAXA 4YDQA 2CVFA 4LYYA 4N4AA 3EPRA 1QIJA 2ECFA 2NU6B 3AUFA 4JYPA 4MZXA 2GASA 3LM8A 5ER6A 3F1LA 2CCGA 4ND3A 4ZIRA 1C4OA 1MB9A 1RMTA 4MQEB 1G8AA 3ROFA 1AB6A 3OZRA 2H9YA 4BWYA 3G9XA 4C01A 1UKVY 4E21A 3WLTA 3V1MA 2HIHA 1KJ8A 1F14A 1WCXA 1WXFA 3ONNA 3IIMA 1MJNA 1ZNXA 3G6WA 5FPYA 5GOTA 1JP7A 1YE3A 3RVNA 2W0SA 2WWYA 4EL5A 1QB7A 2NVBA 4AUMA 1D1PA 4QEDA 3RRNA 5LOVB 1L5QA 3HZOA 4KP7A 3H1BA 4D92A 1ENPA 5IJZA 1SK9A 4B85A 5J23A 2F8TA 4N5MA 1SCDA 3WJ2A 1OGIA 3HNOA 5JVDB 1GTG1 3K0FB 1E79A 3QXJA 3AERB 4LHXA 4XQEA 5FT9A 4AULA 1KWGA 1GG9A 2YWGA 3D43A 4G1EB 4IZIA 4OQZA 1SBYA 3T4UA 2HA3A 4ITVA 3UKOA 1J24A 3KVYA 3O8DA 3EF3A 5F73A 2K5UA 2R8ZA 3F5MA 1AQJA 2K7FA 1LSUA 1TJ3A 1SIBE 3INYA 1SUFA 4ZT7A 4X62B 3EXEA 3HN2A 3LQQA 5IH3A 1C0LA 1PK8A 3T6KA 3KHUA 1K63A 4N5NA 3QSYA 2D0DA 4TUYB 1MU0A 1X14A 3GLTA 4QU9A 3SGLA 4MDHA 1O0BA 1HNZB 4JK3A 1BMQA 4URWR 4FP9A 3TZHA 1KKMA 2ABWA 2OSBA 3O8QA 1UK9A 1R6VA 3C39A 4QT0A 1U11A 2VLIA 4NG5A 2IH5A 3IP3A 1L7RA 2HA6A 3R7NA 1H9AA 3LV8A 3U4GA 4RL4A 4DV3B 1KO5A 3C6KA 1JW9B 1T25A 4DSTA 1CLEA 2Z08A 1Q11A 2E1PA 1NOIA 4R1PA 5A3RA 2O0MA 1CJMA 3JWPA 1GT91 3IR7A 4DG8A 2N1BA 4XA8A 1UFRA 4FD2A 4CIBA 3FCUB 3OTQA 5AM3A 3P9SA 5C5DA 3HFSA 3ZHUA 4KTVE 1DAHA 1RACA 2HJSA 1EZZA 2NWQA 4MQ5A 3ZK9A 4DCSA 3M5WA 3OBIA 1RI1A 3SQWA 4LVOA 2IW3A 4G9GA 1RYMA 2OCXA 3KSAC 2Q0HA 3RR2A 4BMYA 4G9BA 2DE0X 3TJZA 1OWLA 1FUYB 2SKCA 4QGHA 1CHDA 2Q99A 3K20A 3K9NA 5EZ6B 1PJ2A 3H7AA 2P9BA 1XTVA 4OLAA 2CZCA 2R00C 3VXKA 4YEDA 3TQHA 4ZOLB 2B2NA 1E66A 3QPUA 4UREA 3A2MA 3B9PA 3I3SR 3UIEA 2ETVA 1NYLA 2B35A 1QUEA 3LUDA 1NN1A 1WEKA 1XX6A 2DFPA 2SECE 3CJQA 3NOVA 4EHLA 1U2EA 4MV4A 2BUCA 1YZNA 1F4PA 1MH9A 2VXBA 4HDRB 5AT1A 3U26A 1CNFA 2F3SA 3F3MA 4UBLA 2Q4RA 3VSEA 3X1KA 5BN3B 4W5RA 1Q3KA 2IPNA 1GA4A 3A3PA 1Y3IA 4OI4A 1XZBA 2QE7A 3M2PA 4UFNA 1JH9A 4BO9A 2EJBA 3GROA 3G9UA 4L4UA 1T3LA 3Q0IA 5AQ1A 1G66A 4TM7A 4HFRA 2EV9A 2PRJA 4FYYA 4ND7A 1M1UA 1RKVA 2W6JD 4PW0A 4U7TB 2VAVA 1IK4A 2BM1A 4CMHA 1KIAA 6REQA 1BE6A 4FDUA 1ONSA 2VJNA 3VKGA 3GH3A 3JZMA 1QG0A 3RV4A 4PZAA 1K6XA 3RLIA 4D6PA 4WKPA 3VC2A 5AUNB 1BZYA 1F0NA 2H29A 2HU8A 4I4NA 4OHMA 4NFSA 2NU8B 1GT6A 4BX2A 2ECQA 2PX4A 5I7HA 5IM4A 4TKLA 1DKQA 3A2NA 5HMMA 3SJZA 1RLMA 3CNLA 5JRJA 2I9PA 2D2VA 2I1QA 3RK4A 5K3BA 2B5WA 3EXHB 3OA0A 2RIRA 3SYLA 3WMRA 5BUZA 5FI0B 2IELA 4JEUA 3V7WA 2P5YA 4B82A 4EIWA 3BGSA 3ZU4A 1B0UA 2QD3A 5FBLB 4DUPA 1L5MA 3BVPA 2XUPA 5BMVF 2EL7A 1MAHA 4YRJA 2PGJA 4U0KA 1KVQA 4C6HA 1J8DA 1QV9A 3GOHA 1CUHA 1LRKA 1L7AA 3ACCA 4EGFA 5B53A 2RGEA 4C4YA 1XA0A 3QEAZ 3DDCA 3ROGA 4M36A 1QIIA 4G24A 3JQ9C 2QENA 4P54A 4TV8A 3TD9A 2IBSA 3LT4A 3SHQA 2DR2A 4F2PA 5IVHA 4XR4A 3RSZA 3CLUD 3G0DA 4MVJG 5GZ3A 5JXIA 3VZDA 1QVVA 4FT4A 5ES4B 3DC7A 3FSRA 2IS2A 3GY0A 4EEZA 2JD0A 3T35A 1RPTA 2BGMA 2X1MA 2MSKA 1TDJA 3B78A 1OCEA 1LB1B 2DBQA 1Q3TA 2GCOB 4PX9A 2VPTA 1M1XB 1RZ3A 3B6JA 1PR1A 2HA2A 5TQ0B 4WDQA 2DT5A 2QROA 2AC4A 5KCMA 1Z0IA 2FUNB 5LQSA 3CLSC 4IP0A 5CTAA 4AX8A 2HLPA 4FYHA 4GXTA 2RAFA 3TS1A 4FLFA 1CUZA 2RHTA 2BGJA 3ACBA 1TKAA 4C0XA 1OKKA 3VC3A 3PNVA 1SXIA 4R05A 2O19A 5ILGA 3DXZA 3N1UA 2HR1A 1L0BA 5BWMA 3AEQB 2XE4A 5TPWA 2P2DA 2GEUA 3E2MA 3KLNA 4GXQA 1U8TA 5FOUA 5KYGA 3WAJA 4C0KA 4W63A 4Y9RA 5KNCH 4B2LA 1XMIA 1G5TA 4CCYA 1I2DA 3V7YA 2H1CA 1LJUA 4CTKA 4J90A 3CH5A 2FPPB 3FMIA 2E6KA 4KSCA 4X7PA 3VAZA 1IM8A 1MT3A 4X1IA 2LRHA 4B6JA 1GPKA 1ZG3A 4Q24A 2B7CA 4GP9A 3IAFA 3I2HA 4MW6A 2ZBPA 4I5IA 4WZBA 3D7MA 4BECA 2W6CX 3GLSA 1UJ2A 2FSIA 3HRHA 4DHWA 3E1GA 3Q1KA 3I2KA 2YZNA 3JARA 5EUQB 4C2UA 4RQUA 3AVXA 3TLMA 1MCZA 5JCJA 3WMXA 3X2FA 4K03A 3HE3A 2ZDQA 2HV8A 4HG2A 2ZDGA 1GHTA 2OCIA 4LMBA 4RVSA 2HWWA 1D1SA 2YYZA 3PQ7A 5FBKA 4DMKA 2D5LA 1QDLB 3HVUA 3NTXA 3OEED 3C2QA 2PGAA 2VXCA 3E53A 3ZHXA 1O6ZA 2EWVA 2D0IA 2VH1A 1XTSA 3M6MD 4C0HA 1JSRA 4ZVPA 4A2QA 3W06A 1I8TA 4KLRA 4D4LA 1HNWB 3KVOA 1MXFA 1VGQA 4F4CA 3GRKA 1WOYA 2QZZA 2QYHA 4DNFA 2V7GA 5IU6A 1RQ2A 2JEZA 1K98A 3BWXA 1KI4A 5TJ9A 4XPIA 1HMYA 2C1XA 1IY1A 1GNPA 4ZC8A 4IH1A 5IDXA 3B1KA 3IKTA 3CKKA 3FUXA 1RRCA 2GZ3A 3VU1A 4M60A 4OLBA 1YS9A 5I47A 4HFMA 2JJ1A 1DC7A 2ZYHA 4PLYA 3QOXA 1EB8A 1U2GA 3EXHC 2XUKA 3T1HB 2DUNA 1BD3A 1YL5A 2KLBA 2SHKA 3CLKA 5AKZA 1H6AA 4JR1A 5CFQA 2C7BA 5CB4A 4B2PA 3WZLA 1X13A 2G9NA 5FEUA 1HE8B 1S3IA 1N2SA 4R0NA 5EZ5A 4LYHA 1U7WA 2EC5A 3FW1A 4CDGA 2YNMC 5LOVF 4RV4A 4L6CA 2FYTA 1E59A 3KKZA 3EEYA 3FJOA 4MB0A 4KODA 1RXWA 2H7XA 1CK4A 2VFAA 4GWGA 2X8WA 4OO3A 4F2DA 3MQ4A 5DRTA 5LU8A 3T94A 1AA6A 2GA9A 5LC1A 2I6FA 3GVHA 4ICIA 2UUAB 1BWQA 4WZZA 2J3DA 1CY2A 3JVIA 4CKXA 4TWRA 1Y81A 1D2AA 5FWXB 1YJCA 1GTZA 4OAQA 3SICE 4J0JA 4TTQA 1W47A 2PZFA 2VUUA 4HJXA 5B55A 3S2FA 3GLIA 4M8NE 3CVWA 3OIWA 3NBQA 1R6TA 1BA3A 2NQTA 1EJ0A 3KP1A 4Z0TA 3DZ8A 3L0PA 4TUYF 2R2AA 2WYIA 5AW7A 3UK0A 3AF5A 2CE2X 2NZXA 5JEDA 3KSZO 1N4AA 3NV9A 4HEQA 1KARA 2ZB8A 5GJBA 4KN5A 3QFFA 3OHMA 1Z0SA 5B7QA 1U99A 2XDQA 5KEIA 6NULA 5KNDD 3HEMA 3ASYA 4KDFA 1F1BA 4C89A 4EPVA 2A88A 2VPIA 4BCDA 1TT7A 4XI9A 4CIWA 5C8YA 5KPJA 3K9CA 5LKRA 3JQDA 4HXEB 4DZTA 1EWVA 3D7NA 4GLBA 1C0EA 4I4TA 4R8MA 4GH5A 1G7RA 2CNOA 4YNBA 1G21A 5D5QA 4DBZA 1KJNA 3TE6A 3W5HA 2JIRA 4DIFA 5IN4A 1WXGA 2QYSA 2IU4A 3SSNA 1DNPA 1G55A 2PGNA 4X44A 1D2MA 4B48A 5LMNB 3F6SA 4P0TA 2EKZA 3D31A 1SO8A 3L5OA 4F91B 4XR9A 4PBSA 5EYPB 4EFLA 1DKPA 2FCRA 5I7SA 2F4NA 5JT1A 1PJQA 1UQUA 4MRMB 4NSNA 4WJZA 4CMKA 4HLDA 2FOLA 4J9UE 1SMKA 3QX7A 2Y6UA 4M7OA 4F9GA 4ZU3A 4ZTUB 4I9NA 4K6GA 3PR1A 1KRXA 4ZOLF 2JFOA 3I72A 4QUHA 4BRWA 1HR0B 4XASA 2RHCA 4I6GA 3CYFA 4IUBS 3WK6A 1NJFA 4XVRA 4DJ5X 1CZNA 5FDFA 3JATA 3ZDFA 2D5AA 4J1TA 5B4TA 3K0AB 3S8EA 2CLOB 1GAQA 1U0NA 4A6DA 2BPOA 3H2HA 1GPNA 1OT5A 3B38A 2CVPA 1NW8A 2Q3JA 4KQWA 3EB9A 4QUGA 1XLVA 4RAOA 2YJ3A 4BE9A 1RHRA 2CF6A 2EHJA 2QNRA 3MT9A 2C99A 4XRRA 3FHLA 5FTNA 4LTDA 2WAMA 4BJ1A 2G06A 2V55B 4OFZA 1E9EA 2R2GA 3R7LA 2DQZA 3FCOA 4G8JA 4AKEA 5TS3A 6PFKA 2R87A 1Q17A 4EW3A 4X3CA 1B14A 3OKCA 4LA4A 3LYLA 2XCRB 2CMKA 1JLLA 1H94A 4KAFA 2NZUG 3BIOA 1JYSA 4FC6A 5DIFA 5FHRA 3W5CA 1N3YA 4JJ7A 5K51A 2XSZA 3URKA 2JNWA 3KYCB 2O8CB 2W6ID 1TLTA 1CIPA 4G1UC 5DNYB 3T7KA 2X8JB 1O8BA 2AFIE 3AZOA 3FPAA 4XCVA 5HFAA 6ADHA 1GAEO 4QRIA 3DLBA 1J42A 3N2ZB 4C29A 4X00A 3R5SA 4J0EA 4BFSA 4N18A 1C30B 3GIWA 2ZDHA 3SS9X 2OO5C 1YHYA 3SX2A 1HEYA 1UQTA 4LCEA 2JJMA 4DRXB 3G0HA 2QV0A 4GSLA 1AV6A 1TQ8A 2OXEA 4FFRA 2EW2A 1O54A 1T43A 2FLKA 2NSJA 3MF4A 4IDHA 4NAUA 3R1IA 4QQ8A 4RMIA 4U7PB 4WJKB 3JSXA 1J1ZA 3I30X 4MGIR 4QVIA 5D85A 3UGTA 3ZD6A 2FMIA 5CK5A 4C03A 2QTFA 3WFIA 4W9NC 1B8OA 1UK8A 4R3WA 5D1NA 3OQNA 1B00A 3BREA 4LHEA 1GFWA 4J2OA 4OXYA 4QDOA 4XH9B 3LDHA 1E20A 4KH1A 4Y6GB 3LVBA 1SQSA 1NPYA 4NU6A 2E5WA 1IBCA 4LHZA 3CR7A 4MPDA 1E5TA 4RF4A 2FZLA 3CCBA 4ZZIA 4FZVA 1WLSA 4R2KA 1FX0B 3M4XA 4Q02A 5DCLA 1TD9A 3MA0A 2A5LA 1SPXA 1ZITA 2GN1A 5EWMB 4AJEA 1JIIA 5AK5A