4RF2A

Crystal structure of nadp+ bound ketoreductase from lactobacillus kefir
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
250
Chain Sequence
b'DRLKGKVAIVTGGTLGIGLAIADKFVEEGAKVVITGRHADVGEKAAKSIGGTDVIRFVQHDASDEAGWTKLFDTTEEAFGPVTTVVNNAGIAVSKSVEDTTTEEWRKLLSVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPTLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLEGAEEMMSQRTKTPMGHIGEPNDIAWICVYLASDESKFATGAEFVVDGGYTAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dependent R-specific alcohol dehydrogenase
publication title Origins of stereoselectivity in evolved ketoreductases.
pubmed doi rcsb
source organism Lactobacillus kefiri
molecule tags Oxidoreductase
total genus 96
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rf2A00
1Q1NA 2HMVA 4YYZA 3K2BA 1U8FO 3GC6A 3H9QA 1LX6A 2W2LA 2E6UX 3QE3A 5DCUA 1WZIA 3SLKA 2G76A 3ONEA 1B8PA 4R41A 3UF0A 1XU7A 5EESA 1UZMA 5T8KC 3CSDA 5CHEA 3VH1A 4J91A 2BHLA 1RM3A 3U4DA 2WE7A 4YDRA 4D79A 4IGEA 3H9UA 1R4NB 3E9MA 1RWBA 4RLHA 3E48A 3F6YA 4ZQGA 3QRWA 1OMOA 3W4IA 1LLQA 4U6QA 5CDTA 4HADA 3WQSB 2JD2A 3W6UA 4RF4A 2CNBA 2V6BA 3EMKA 3V1YA 1DJNA 2ZB3A 5A9RA 5DNAA 2NTNA 3WQRA 4JROA 2VYNA 4NBVA 4E2WA 4OXYA 3DHNA 3U5TA 5JY1A 3UICA 4CM9D 3WJAA 2AQKA 3OICA 3DTYA 3V5NA 1O94A 3LT2A 3I9KA 4IZIA 4D0SA 1XELA 1KEUA 3DZBA 3GVPA 4WOJA 4EZBA 3NTQA 4OGWA 1GR0A 3TL3A 3WXBA 1NAIA 1FDSA 4BKRA 4PG6A 1E3JA 1EVZA 2X6TA 1R12A 4LMRA 4Y6SA 4CL3A 3JQ8A 4PLPA 2C2XA 4QT0A 9LDBA 1IB6A 5JYEA 3SC6A 2AG8A 3PEFA 4JK3A 1GUYA 4O59O 3X2EA 4PZCA 4OMUA 2Q99A 4B4UA 3KRTA 1U4OA 4J2OA 4MKZA 4WLFA 1P1RA 1BVUA 2ZQYA 5JPIA 1W73A 1YOVB 1EUCA 5H81A 3ZU3A 3JQ7B 5I7SA 2FSSA 3WGIA 4UVGA 3HDHA 4QXMA 4YXFA 1F12A 2ZCUA 2NV6A 1E6EA 1E7SA 1JW9B 1XDWA 3ANMA 3MCVA 4TQGA 4BGIA 1T1RA 5KJ6A 4CMAA 3COSA 4CQMA 1ZIDA 2EJWA 2WYVA 4B7CA 3M2PA 4B3JA 1OOEA 4YB8A 4IIVA 2CVZA 1E3LA 3OHSX 2FHSA 3BMQA 2X23A 5EN4A 3WGZA 1LRKA 2VYVA 1B2LA 3FF4A 2DFDA 3D3WB 3VH3A 3DBHA 4J16A 3ZNQA 4LCEA 1I10A 4DL9A 4PG4A 4AJKA 2IZ1A 1ZJYA 4AJJA 1U5AA 2JAPA 3VZPA 4TKLA 1Y8RA 4RQTA 4YJHB 3GUYA 1MA0A 1UH5A 2ZJ0A 2VWQA 3PYMA 1DIAA 1P45A 4KWIA 1PJCA 4J1QA 4BVAA 5JAZA 2O3SA 3CMMA 3O26A 5F21A 1DHTA 3B1KA 4NQZA 1YE3A 2W8ZA 2PD4A 1UAYA 1NP3A 1P1HA 1T4BA 5L7WA 2P4QA 3WNQA 3PHGA 1RM0A 4KQWA 1B3BA 2QX7A 3SVTA 1ZKMA 5I9MA 3ANLA 1HSOA 3AI1A 3PK0A 2P5UA 1J6UA 3EUWA 3E5RA 1DLJA 4DPKA 1EK6A 1LNQA 1T2FA 3OJEA 2R6JA 3AWDA 3I6IA 1ZNQO 4CR7A 3QVWA 1H6BA 3M1AA 3I4CA 4XB1A 1XSEA 3Q3CA 4AG3A 3LF1A 2C07A 1JQBA 4Q3AA 3AK4A 1LC3A 5CDYA 2OFPA 4R68A 4ALIA 2F00A 2VHYA 4R1TA 2JJYA 2IRWA 1T2CA 3CTMA 4I5GA 5A1TA 1IZ0A 4R1NA 4P22A 3PFFA 4FQ8A 2IZZA 5IDWA 4HP8A 3F4BA 4L75A 1RYEA 3FTPA 2W90A 5JDIC 5I8WA 4A27A 1D7OA 3AUSA 3W4KA 3SC4A 3WSVA 1ONOA 3DBRB 4FGWA 1BTOA 1CRWG 3N58A 4R3WA 4FJ2A 3GNQA 1ZK4A 3FPCA 4WCFB 3WWZA 3Q6IA 1HYHA 2YFQA 4R3NA 4F6CA 4E21A 1X15A 2HSDA 5TSDA 1VKNA 1PQWA 5ILGA 2JCYA 4UEOA 2CVOA 1O95A 2I3AA 3F9IA 3MTJA 5TJ9A 2WM3A 3W8EA 2FPGA 4Q39A 4WCDA 3RKRA 3PHIA 1DIHA 1O89A 1ZUD1 3JSAA 3KBOA 2JD0A 3KZVA 1YQDA 2B4QA 4S1VA 1HRDA 3TF5A 1FDUA 3VTZA 2FR1A 4MVJE 1DHRA 2VCYA 4HWKA 1ISJA 5TIIA 2Q1UA 4TRRA 4EJ6A 3ZV4A 4O0LA 3HJAA 1MGOA 1PL6A 4B79A 1HE4A 5IN4A 2VHWA 5L45A 1YBAA 5MDHA 3MJVA 2VHXA 5F1OA 4BNUA 1YH3A 1PX0A 3JYOA 3GHYA 5G0VA 2FP4A 4P4GA 1O8CA 1WDKA 1YB1A 4L74A 1LBEA 3RC2A 4PIVA 2WEKA 2D5CA 5GMOA 3RJ9A 1YS4A 4MKRA 1I33A 1M76A 3HNPA 3JQ9C 4ZQBA 1IL0A 4Q3EA 4OIMA 3QVXA 2UUOA 4FBGA 4CM9A 2H5LA 1KYQA 2PKRA 4R1SA 3RFVA 4QO7A 1DBVO 3EAGA 3JQCA 4WLNA 2AEFA 3L0DA 2ZCVA 1GD1O 1ZJZA 5ER6A 3I6QA 1TT5A 1T24A 3W8FA 2X0JA 3INGA 3KSDO 3WJ7A 4U0JA 4RGBA 2HRBA 4I9UA 4C7JA 1MFPA 1PR9A 1E77A 1HF3A 1T1SA 1Y9AA 3VDQA 3GZNB 3VPSA 5TF4A 3S2FA 3EGOA 1XCBA 5F1KA 3WOHA 4ZQEA 2D59A 5B1YA 1N92A 4AJIA 1PQPA 1A71A 1ZMTA 5JDCC 4F45A 5BSEA 5JMWA 1I32A 4B4WA 4YJGB 1G0OA 2BI7A 2OP0A 1A72A 1ISIA 1SEVA 3L4SO 4I9HA 2IXBA 1LA2A 3VZSA 1W0CA 4CM3A 5G0SA 2RAFA 4KWHA 5CAEA 4FB5A 1VL6A 3UOGA 1NYTA 3DOOA 5JO0A 3NYWA 1X7DA 1S6YA 1BW9A 3ZV5A 4WLUA 4ZU3A 2XAAA 4BNZA 1FK8A 4INAA 1R0LA 3GVXA 4IXTA 3JQBA 4JJFA 2WD8A 3W8DA 2PH3A 1DXYA 2FRDA 3NX4A 5TNXA 3K8ZA 5I9LA 2EP5A 3LT0A 3LDHA 3ZU2A 3LC2O 1G6KA 3FNEA 3RBZA 1O9BA 1U2DA 1A5ZA 3FHLA 4II3A 2J3IA 1LDMA 1Y8QB 4MJLA 3UH1A 1QYDA 1NM5A 4N54A 1Y1PA 3HN7A 1DOHA 5I7FA 2O50A 3DMTA 4UAGA 3I5MA 3ENNA 3KLMX 4IQGA 5A5EA 2YV2A 1H6AA 2YDXA 3UVEA 1I3NA 4N5MA 4JN6B 4BGUA 4CV3A 4RL6A 2PY6A 4OKIA 5L7TA 4L4XA 3WGHA 5U9CA 2XOXA 2C82A 2OO5A 2Y1EA 1BVRA 5CEFA 3I9NA 3GMSA 2O3TA 1BDMA 3H6KA 4HNHA 3HB4X 2DC1A 3AY6A 4LVCA 3C7CB 3O9ZA 4K26A 1MC5A 4BMVA 2H6EA 3A14A 1GV1A 5C7LO 2GN8A 1YGYA 2QZ9A 2DUWA 3AUAA 1LSSA 1U5CA 1YB4A 3AOGA 4XEHA 1SB9A 5L4NA 4ALJA 4BIIA 4MIEA 3R3JA 1D8AA 1E0DA 4NFYA 1T2EA 4Z9XA 3LU1A 1NVMB 2B0JA 4XYGA 3ON5A 5EINA 3OSUA 5KNLA 5JSFA 2NU6A 3TQHA 2BGMA 3CH6A 4RVUA 1E1MA 4XYBA 5B12A 5I7EA 3GG2A 3GHHA 4IINA 4J0FA 2YDYA 4H16A 4LRSB 2PZJA 3L77A 4RLSA 4YBZA 4NZ9A 5L4SA 1KY5A 1O0SA 4Q3NA 3R6DA 4JQCA 1IE3A 1QKIA 1Z74A 3WLEA 4PG5A 2HCTA 5AVOA 5BNFA 4BGEA 2XPCA 3AI2A 4O6VA 5FYDA 3ZW9A 2WTBA 1J0XO 1MG5A 3ZWWA 4E33A 4EITA 4G5HA 3OMLA 1U2GA 1LJ8A 4J43A 4BO0A 4W7HA 1GUFA 1P74A 3QSGA 4IDDA 1W8DA 3H2SA 3RWBA 3Q9UA 4BQPA 2O4CA 3ROQA 2DT5A 3ADOA 3E9QA 4RORA 4DYDA 4GLOA 4C4OA 3JCZA 4OM8A 4ZRMA 3AY3A 4BO1A 4BO5A 1NVTA 2ZJ1A 5I9NA 4FJ0A 1LC0A 2Z95A 3OQ6A 4ROSA 2YHIB 1Y5MA 5JO9A 3Q2IA 3L6OO 5GY7A 2C20A 1QLHA 2CDBA 4YAGA 3DR3A 1PWXA 2W4QA 2BD0A 2B5VA 3S2GA 4CM8B 3QQPA 4IXWA 1F06A 3HDQA 3K30A 3UUWA 1H93A 2FR0A 3TNLA 4W6ZA 5CP8A 1YXMA 4YAKA 4KZPA 2NWQA 4AFNA 3V1TC 5JCJD 1E7QA 4PLYA 1N5DA 1B16A 2CZCA 3JV7A 2OXIA 3TOXA 2VRCD 5KVCA 3EZYA 4BV9A 3WFJA 1GCUA 3DEYX 3O38A 3R3SA 3PHJA 4L8VA 3MJSA 4FIZA 1IYZA 2Z1NA 2X22A 1NFQA 3GVCA 4PZEA 3ONDA 1KERA 4PRKA 1AN9A 1NHWA 5G2OA 5DP2A 2HUNA 4NH4A 2Y99A 2Y1CA 3DXFA 3GGOA 2D0IA 5TS3A 3RUIA 3DMYA 2NU9A 4LCJA 2Y0DA 2BKAA 1DFHA 3DAFA 4FR5A 1WDMA 3S55A 2DLDA 3I9MA 1EUZA 1PJLA 3AY7A 4CM4A 3ETGA 3BZUA 3JQAD 1X13A 3ROPA 1K6XA 4OOEA 4BV8A 1BWSA 3C1OA 3F1KA 2HK9A 3LSYA 1DAOA 1N9GA 3AOEA 2GSDA 3VH2A 4IY1A 1Q7BA 4FD3A 5AYVA 1BXGA 2FPPA 4DUPA 3VZQA 2P9GA 1JWAB 3M6IA 1S7CA 4RVGA 5JMPA 4CM6A 4MVJF 2W2KB 4ID9A 4A5OA 1JTVA 2QW8A 3KYDA 5FWNA 2GDZA 1YKFA 4JBGA 3NRCA 3TJRA 3RFTA 2BGKA 4RVDA 1GZ4A 1GQYA 1IUKA 3TZCA 1FDWA 4R54A 4BKUA 2HK7A 1KETA 2EERA 2NTVA 1OC2A 3VVBA 1KVUA 3L6DA 4G2NA 3E6AA 3OH8A 1GQ2A 1MG0A 1QYWA 4ZRNA 5G0TA 3ICCA 1GFSA 2OMEA 2Y68A 4JBIA 1RYDA 4KOAA 1PIWA 1KOLA 2UAGA 4F6LA 2HU2A 3E1KA 4HFNA 1C1XA 2VNAA 5FF9A 2I99A 2YQ5A 1EQUA 2C59A 1R37A 3GOHA 2ZIZA 2NVWA 3BMOB 1X1EA 1U4SA 5KJCA 3AM3A 2QQ5A 1U3WA 3QVSA 5HM8A 4DLLA 1Q0LA 3KOUA 3M2TA 5TRTA 4CMHA 1T4DA 3UN1A 4D46A 3D5QA 2IXAA 5I7VA 5T57A 4W7IA 4ZD6A 3PXXA 2ZB7A 4WECA 4IUYA 3T4XA 4BB5A 1LUAA 2GR9A 4ALKA 4J49A 4OO3A 3ITDA 4AICA 1T25A 2V6GA 4O63O 2GNAA 4IQ8A 3B20A 3TOZA 5JBIA 2EP7A 3F46A 2ZB8A 2DUUA 4OSPA 4FC7A 1LRJA 3VKVA 2X58A 1AXGA 2DVMA 4YVFA 1CQIA 4JCOA 2BGLA 3BMCA 1M67A 4D3FA 4NFSA 3K9QO 4IMRA 4UEJA 2DBQA 3ST7A 5G4LA 3BHIA 4LW8A 2E48A 3BXXA 1WMAA 3JQEA 3C7DB 4BGVA 3EW7A 1AGNA 4E0BA 4Q3BA 3KVOA 3GGPA 3LYLA 1N7HA 1C1DB 3LF2A 3T4EA 1E3EA 1UDAA 2J3HA 4YJFA 1IHYA 4D7AA 3HDYA 1VJ0A 1CIVA 1BRMA 5TLSA 4ZA2A 5TX7A 1LSJA 4QX6A 4BUCA 3K6JA 5DP1A 3FRJA 2QRJA 1MC4A 2BI8A 3NTOA 3IKTA 2IEBA 2G1UA 4GSLA 4LMPA 3SX2A 4M89A 4M49A 2Q4EA 4OL9A 1I3MA 3B70A 4R9RA 1WPQA 5KKCA 4YACA 3FCOA 3WIEA 2I9PA 3QA9A 3JD0A 3P5SA 3HB5X 3PJGA 1N2SA 5FI5A 3UCXA 1SMKA 2C54A 1ZXLA 2Q3EA 1NVGA 1R15A 3TZQA 4HV4A 1Y5RA 1E5QA 3ZGYA 1B3RA 3DBLB 4U7WA 4NU5A 3K31A 1F8FA 1ZEJA 3WMWA 3RSHA 3PGXA 3PWZA 3WGTA 4CLHA 4CMKA 3F47A 4ZQHA 5IDQA 4TRMA 4XYMA 5JFOA 1ENOA 1PZGA 1RKXA 3ZNNA 5JCJA 1VE9A 3HZZA 4JJIA 4LRTB 5CFZA 2YUTA 1LLUA 4AJLA 1E7YA 1PZEA 3GFBA 5MGBA 2GZ1A 1EVYA 3MJCA 3GDOA 3OIGA 3CKYA 5AOVA 2X5KO 1C3VA 3D1LA 4Q3DA 4E13A 1JAYA 1TXGA 1O6ZA 2RH4A 1HE3A 2GCGA 3GN1A 3IUPA 4B8ZA 3GNTA 2FZEA 1F14A 3PHHA 2J8ZA 5KIAA 3AW9A 4CMEC 1P0CA 4R4JA 1UXIA 4MIYA 1ENZA 1GEGA 4CLDA 5KCZA 1GY8A 1H9BA 4PN3A 3TZKA 4TSKA 1VLLA 3EDMA 5IF3A 5T6BA 4CR8A 1M6HA 4J1SA 3PLNA 4CUZA 1N1GA 3PWSA 3JQAA 4KDEA 4WLEA 5JC8A 7ADHA 1PEDA 1V8BA 3NJ4A 1KS9A 3CMCO 1UUFA 3Q11A 4PGFA 5IFLA 2BRUA 1OFGA 2I66A 4NBTA 2FZWA 1JVBA 2VUSA 1ADCA 1C0PA 2O4UX 5TT0A 3WYCA 4ZGWA 1SO8A 1HT0A 5JC1A 4WK6A 1YQXA 2D8AA 4DMMA 1EK5A 5K6AA 1U9JA 1EDOA 5F5LA 3RD5A 3CIFA 4MVJG 5H82A 3AM4A 3Q9NA 4RVHA 1HKUA 2V7PA 3FN4A 3MWDB 1VJ1A 4CMIB 4GWGA 4PLVA 3LVFO 2YJZA 2BF7A 2X5JO 4BNYA 3NDJA 4FFMA 1GADO 4WUVA 3T7CA 1DAPA 4XA8A 2NLOA 3DZHA 3G3EA 4DLBA 4EDFA 4A0SA 1OI7A 2BFAA 3RUEA 4Y6RA 3C1AA 1YBMA 4FFOA 4RF3A 4YRAA 1AXEA 1B8VA 1V6AA 1KVTA 3DZKA 4GGOA 5G0UA 5ENVA 4CODB 4BKQA 1HDXA 4OH1A 5EMHA 3S2IA 3D4OA 4TZTA 3V8BA 2AMFA 3GGGA 3PDUA 1R4NA 3TPCA 1R0KA 2Y66A 3PQFA 4J1TA 3ANNA 4CMGA 4OJNA 2EHDA 3ZWYA 3JD2A 2R00A 3OIDA 1SBYA 3LC7O 1A4IA 1GCOA 5IZCA 3GAFA 1FDVA 4ITUA 2C5EA 5C3MA 3KYCB 2O3QA 5EL0A 4XKJA 3NGXA 3P2OA 1LQUA 2EXXA 2HO5A 2X7HA 3QWFA 4RF2A 4W99A 3RROA 1VSUA 5FI3A 4L4SA 4WNIA 1RM4A 4OKNA 3GDFA 4XWYA 1V3UA 1F8GA 4RF5A 3P19A 3UAGA 3V2GA 3GLQA 4AJ1A 3HG7A 2O48X 3QWHA 1U1IA 1U7TA 4XJTA 4RPKA 3ZWBA 2X5OA 4BNKA 3H2ZA 3EK2A 1ZXBA 1SCUA 2CFCA 3I9JA 3O8QB 3TN7A 2NVUB 2PTGA 5A04A 1JA9A 3HE3A 3KHUA 3HUDA 4M8SA 4MP3A 4R1UA 2HAEA 4XRGA 3QP9A 1ZK0A 4I9NA 1I8TA 2C5AA 2VHVA 1BSVA 2AQ8A 1YOVA 4AJ2A 2PGJA 3JQ7A 3VHRA 2BLLA 3JYPA 5T67A 1Q0HA 3E03A 2OP1A 4FJ1A 3RUHA 4E31A 3IOYA 4W4TA 1CDOA 5F3RA 3TFOA 2AW5A 3IJPA 1ZFNA 3ZV6A 4R69A 1ISFA 1K6JA 1M2WA 1UP4A 3ZWNA 4UUPA 5U4QA 4E2ZA 4J90A 1UZNA 4E2XA 4BNJA 1ZW1A 1KVQA 5JAQA 3RUCA 3HFSA 4CLOB 1Z7BA 4Z0PA 4FOSA 3RUAA 3D3WA 3EC7A 5THKA 1I3KA 3TWOA 4BKPA 2DPGA 4CL8A 1DC5A 2E49A 4YJHA 2A4KA 1K2WA 4DYVA 1D3AA 2VT3A 3RVDA 4HFJA 3JYLA 5ENDA 4DIOA 5EIOA 1UJMA 4GMGA 2VUTA 3BHJA 1NPYA 3L9XA 5IXSA 1FF9A 2Q49A 5G0WA 3JD4A 2NUAA 4QUKA 3S1LA 3QIVA 4D0RA 1ADFA 3LQFA 4W82A 1IPEA 2H63A 3B1FA 1X0XA 4WKGA 2JHGA 5BT9A 4TVOA 1V3VA 2EKLA 3C7AA 3WICA 1QR6A 1CQJA 4L0QA 3ULKA 2X86A 3KLPX 4YR9A 1F0YA 2GZ3A 1WW8A 1ZSNA 4DVJA 1JVSA 2X9GA 3NT4A 4D44A 3TFQA 4UUOA 2PR2A 1YBVA 1HZZA 5T64A 3NDRA 3LT4A 3K96A 4L4RA 4XYEA 4CQLA 3SLGA 2V6FA 3VZRA 3W4JA 3IL2A 4D3SA 3MJ4A 4GVXA 4OQZA 2I5PO 2W98A 3JQ6A 3ENKA 2TMGA 3ZH2A 3G17A 3A06A 3HADA 3OA2A 4L9RA 3PJFA 4GH5A 3DC2A 4YEDA 4E5PA 2VT2A 4RZIA 1TA4A 1X7GA 3IIEA 2PH5A 2FY8A 3DBRA 1DLIA 2POQX 4PG7A 4WCFA 2AEJA 4IDEA 2Q46A 1ISMA 1QP8A 3CEAA 3GG9A 2P68A 4QFDA 4EBFA 3PPIA 4RDIA 4RDHA 4ND2A 4GPD1 3ORFA 2H1SA 3C85A 4Y9DA 4NR0A 1QYCA 1KEPA 4IS2A 4UEKA 2B4RO 1P1IA 2TMDA 1ZH8A 4XGNA 1NASA 4AJOA 4XYLA 2J3KA 3ASUA 4BL5A 3WS7A 5IJZA 2QG4A 3FTNA 4JLWA 5KJ1A 3D3EA 4YAEA 2XF8A 2OOSA 4I5EA 4LVUA 4GI2A 2UDPA 1R4MB 1UXKA 2OGUA 4KTTE 3DONA 2HKIA 1LU9A 4LSWA 1ONNA 4E5YA 4UVEA 4NJMA 3SBOA 3AUTA 3KO8A 3OEYA 1E1KA 1U8XX 4CLRA 5T8KA 4YJDA 1KEWA 1M6WA 5CEEA 4KMSA 3ZWVA 2WSBA 2O2YA 4CLXA 1YONA 1E1NA 1WNTA 2FR8A 2Q2QA 3CXRA 1JKJA 2CF6A 3PI7A 4XJSA 4D3DA 4FFNA 1TEHA 3L4BC 5ER9A 1CYDA 4UVIA 3GRKA 4LK3A 3KSUA 2WDZA 4TRNA 3DO5A 1MP0A 1NR1A 2PGDA 3VDRA 4IDCA 3DAGA 2WJPA 1GYPA 1DC6A 1MXHA 1GYQA 1VC2A 4ALLA 2RHCA 3RC7A 5L7YA 3SEFA 5BSHA 3GY0A 5DT9A 5AXBA 2VRBA 3HQ4O 1Q7CA 3BIOA 4CV1A 3ZNPA 1WDLA 4DPLA 2J5QA 3D7LA 2VNSA 1J4AA 1QRRA 1NNUA 1QYXA 4PLZA 2X1HA 1DEHA 4GAEA 1DC3A 3U9LA 4CMBA 1Z6ZA 3GZNA 4EUHA 2O3RA 1XYGA 1SB8A 2P9CA 3E82A 4CV2A 3RBXA 5CG1A 1UXJA 4FSHA 4DGSA 1I36A 4BNFA 4U8GA 2RIRA 4ZN6A 2F1KA 3H5RA 1R0SA 2AE2A 2JL1A 3DOCA 3FWNA 1NPTO 2X0IA 5F5NA 8ADHA 1B0AA 1NHGA 4YJGA 1I01A 1HSZA 1ZSVA 3GR6A 6ADHA 3FBGA 1XA0A 5EERA 4BS9A 3UW3A 2B37A 1FMCA 3RASA 3RQSA 4BNTA 1HDGO 5A05A 2BFPA 3NT5A 3QHAA 3KXDA 1DPGA 1I2CA 2X9NA 2UVDA 2NNLD 1PL8A 3ZHZA 4BB6A 3WGQA 4FFRA 4H15A 4JNKA 4BO8A 5HRUA 1GEEA 3IP3A 3OETA 4AJNA 4OXNA 1U7HA 3D4NA 4NIMA 1MLDA 1PS0A 4CMCA 2EG9A 3BYZA 1GUZA 3IP1A 1K5HA 4ALMA 3V2HA 1GV0A 5GZ1A 4XRRA 1TB4A 2YV1A 1Y8QA 2RHRA 2ZK7A 5EQFA 1DO8A 1DRVA 2C7GA 2CD9A 4PZDA 3KM0A 4AJPA 3WFIA 3HFGA 4I08A 4TKMA 4BKOA 2GUGA 4P38A 2DBRA 2C2YA 2HRZA 4PVDA 4AL4A 1A27A 4L73A 4PLHA 4YWJA 2WE8A 3PVZA 4ONEA 3F1LA 1ZCJA 1ZK2A 4JP2A 4DC0A 1P77A 3PJDA 4NK5A 4A2CA 4I5FA 1M66A 3FNGA 4DMLA 4XZ3A 5BQFA 4EYEA 1Z7EA 1NQTA 2PZKA 2QIOA 4MINA 2D4AA 1CJCA 4WEOA 3UGKA 2DTXA 4QO8A 3VPXA 3D64A 4URFA 4NJOA 1P31A 3WSWA 4G65A 1NQAO 3PQEA 2HQ1A 3ETDA 1XEAA 1A4UA 1KEVA 2P4HX 1OC4A 4GKBA 1YB5A 4P8RA 4WE3A 3KSZO 4YCAA 3S8MA 2IE0A 3NT2A 4O1MA 3GH3A 1LI4A 4LN1A 5U1PA 1LSUA 5HA5A 4HX5A 4J6FA 4BNGA 2NQ8A 4EJMA 3INRA 1PJTA 1GPDG 5EQDA 4XR9A 3WLFA 2WD7B 4BOYA 4BO2A 1A7AA 1PZFA 2E82A 5K0ZA 2EWMA 3PIDA 3WWYA 3DZFA 3ZV3A 1ADGA 1X7HA 4QEDA 3NGLA 2ZTLA 3ROMA 1CERA 5JDIA 1DB3A 5CDGA 4OAQA 1NX6A 1H9AA 3BTUA 2D5AA 3HSKA 3IUSA 2B83A 1C1XB 3H8VA 4GSKA 1P0FA 4TWRA 1W4ZA 4NI5A 4M1QA 3NKLA 3UXYA 1U28A 1FXSA 3DFZA 3BA1A 4R01A 3NDIA 3WBFA 4K1LA 1G1AA 3Q1LA 2OL4A 2DU8A 2HJSA 1JU9A 2G5CA 4K6FA 4PLWA 5ICMA 2YQ4A 3K2EA 3S2EA 3EVTA 1YQGA 1HETA 4ZJUA 4UUNA 2OBYA 3DAPA 3OQ1A 1HDZA 3TRIA 3GQVA 3IQDB 2YFHA 1NTOA 5JW6A 3BAZA 5AXCA 2FOIA 2X0NA 2NU8A 2A92A 4NFHA 1JKIA 4Z0HO 2B36A 1WLYA 4JGBA 1SOWA 4GGPA 1WP4A 3JYQA 3WB9A 2JCVA 5I8ZA 4UREA 3MOGA 3ONFA 3I9OA 4OHUA 2OUIA 4RZHA 4Z9YA 4MP6A 1E6WA 2VUUA 3JTMA 4A7PA 2GN6A 4FFPA 2WYWA 3GVHA 1SNYA 4M55A 3CPSA 4DWVA 4AJ4A 2G82A 5HTOA 4XR4A 3A9WA 1XGKA 1HWYA 1PGJA 3I9LA 4G81A 4W9NA 3F4LA 5L9AA 4NG5A 2Y1DA 3AJRA 1IHXA 2HLPA 5AQ1A 4QFCA 5A3JA 4MVJI 4R16A 2GRAA 4J4HA 4ND1A 3BTOA 4NDNE 2B35A 4MVJM 1CETA 4TRJA 1E3WA 3L6EA 5IDXA 2OORA 1T2AA 1NFFA 1PGOA 3KEQA 1HE5A 1P44A 2I6TA 2Q1TA 4UULA 3KYBA 4GX0A 4JX8A 1UP7A 3PLRA 3RJ5A 4Y8VA 4K9DA 3VAZA 3JQGB 1ULSA 4Z9FA 5IZ4A 5G4KB 3PYLA 3DHYA 3AFNA 5A9SB 3OJLA 1BGVA 4GQAA 4IM7A 2P91A 4GVLA 1Z75A 3BMNB 4XD2A 2VWHA 1LDYA 1PS8A 4RCVA 4NBWA 4WNCA 4GWKA 4P4LA 4IDBA 4NU6A 4JP3A 5GZ6A 3WTCA 5B4VA 1J5PA 4DRYA 3DOJA 3QVTA 4XIJA 2FMUA 1LQTA 2PNFA 4M87A 4RVFA 5B37A 3ZZNA 3ICPA 3C24A 3WMXA 5JDCA 4BO7A 4E3ZA 1HYGA 2W2KA 2SCUA 1V35A 2AXQA 2ILTA 3U62A 1R6DA 2GZ2A 4E6PA 5JY6A 3VVCA 3I1JA 4XQ9A 4IDGA 2GGSA 3GMDA 1PL7A 1HL3A 1VSVA 1YDEA 1YWGO 4J3FA 4N18A 2XXBA 1KC1A 2J3JA 1QORA 1RM5A 2ZQZA 3E18A 2Q4BA 4CM5A 1PQUA 1IOLA 4MPDA 4PG8A 4J4TA 3EVNA 3RKUA 3DFUA 3L9WA 3DL2A 2IEDA 4ILKA 1XR3A 3A4VA 1GL3A 3MTGA 4TMFA 5KKAA 2O23A 5TGDA 2OBNA 4YTEA 1DJQA 2JD1A 5LDHA 1P1KA 1XKQA 3QWBA 3U3XA 4YT4A 3LK7A 1MUUA 4ND5A 4J9VA 5CG2A 1G0NA 3BMOA 5JNLA 4GMFA 3JQDA 2J6IA 4UVDA 4WEQA 1WMBA 5DCYA 5HBRA 4EW6A 2A94A 2AG5A 5FFFA 5ITWA 2JHFA 3RI3A 4DQXA 3PDJA 4J0EA 2HMSA 4K28A 1ZBQA 3IS3A 1P33A 3GK3A 1XIVA 2UUPA 1ORRA 3P2YA 3KV3O 1V3TA 2Y93A 3GT0A 3JD1A 3ZHYA 4YT8A 3JQ8B 5A4DA 1XLTA 1DDOA 1FDTA 3H9JA 3ZU4A 2C29D 3OA0A 3QLJA 3RIHA 4BO6A 4E12A 3D0OA 5T5QA 2VRCA 4NBRA 4FFLA 4B7XA 1HTBA 1C0LA 4NBUA 1RPNA 1NQ5A 3PGJA 3E9NA 4Q9NA 4ESOA 2RH8A 1DRWA 1SAYA 3FI9A 2Y1FA 2WMDA 5A9TA 1SEPA 1Y9EA 1VI2A 3IAHA 1Z73A 2GLXA 2EW2A 2HMWA 3JQBC 2Z5LA 1C1DA 4U5QA 5DOZA 3RU9A 3ZDFA 2Z1MA 4Z6KA 4TVBA 3GN2A 3FWZA 4CQMB 2QHXA 1AHIA 4IDAA 3RUFA 1E7WA 1L1FA 4CM1A 4C7KA 3X2FA 3BMQB 1X1TA 3EHEA 3WYEA 1V9LA 1JN0A 3R0IA 3ETEA 3VOSA 4J7XA 4BMNA 3DBHB 5A06A 4NPCA 2YHUA 1VL0A 2O3JA 3DMTC 4CJXA 3H5NA 1Y8RB 4XDZA 2WYUA 1WXDA 3JQFA 4BNXA 5HS4A 4A10A 3PYXA 1QXSA 3CZRA 4TZKA 4UUMA 5LC1A 5L40A 2FN7A 3RAJA 1Q7GA 4Z3KA 3GRPA 1K0UA 4CLEA 4QSMA 4FDAA 4BNWA 1UXHA 3GA0A 2GYYA 3OP4A 4HNGA 1EVIA 2VWPA 3F3SA 3I23A 3TZ6A 4CPDA 3DBLA 1EUDA 1PTJA 3H65A 2IYOA 1ZMOA 1FJHA 3DZGA 5ITVA 2YV3A 2Q2VA 2Q1WA 3E5MA 4II2A 1YL6A 4GKVA 4XDYA 4EUFA 2DTEA 1JKFA 1NR7A 2XXJA 1EMDA 1H2BA 3AM5A 3OBBA 3QWIA 4BO9A 2GD1O 2WWRA 2QRKA 1PSDA 3TL2A 2DPHA 2CMDA 4L76A 2Q2WA 1OBFO 4GX2A 2O3UA 4RO0A 1AHHA 3ZWOA 4XGKA 2P5YA 4EJ0A 1K89A 3PP8A 1LEHA 1PJ2A 1DIRA 1AE1A 3F5SA 2RCYA 2V65A 3LC1O 3RCBA 5LDGA 1A9ZA 1LXCA 3O4RA 3DBVO 3WG9A 4BNNA 5A02A 7MDHA 4OQYA 1MFZA 2A9FA 1IPFA 3IMFA 5L51A 1P3DA 2EIHA 3GZ4A 3TDKA 1W6UA 4IGFA 1NXQA 4B4OA 4JJGA 3DHEA 2G17A 5DDIP 2PKQP 3FR8A 1KC3A 1MB4A 4EEZA 1HE2A 2EGHA 5DBIA 2E4AA 4O5OA 1C14A 5GZ3A 5KJEA 2QRLA 2ZYDA 4YQYA 3PRJA 1U3VA 2JFHA 4Y67A 4IQ0A 2YY7A 3RU7A 1ZVMA 3OJFA 5LCXA 4BMSA 3H9GA 4WOKA 4DQVA 4FGSA 1GDHA 1SOVA 3G49A 1Z45A 4CUKA 3NJ8A 4MKXA 5DBFA 5JCXA 4CMIA 4B7UA 2YZ7A 1QMGA 2ZTVA 4RJTA 4GBJA 2Q1SA 3GPDG 3DB2A 3KETA 3CUKA 1BXKA 3OEWA 3UFXA 1JWBB 1EBUA 1B14A 1E3SA 1HDOA 3BHMA 1N8KA 4IS3A 3ASVA 3O03A 3HDJA 2ZKLA 1U3TA 5A3VA 3NV9A 1LDEA 1K6IA 1XQ1A 2D2IA 3R1IA 1X0VA 3QW2A 5IDYA 2JAHA 4PLCA 1RJWA 3L07A 1LDBA 3OECA 5KTKA 1WVGA 4J9UE 1E92A 3DZIA 5ADHA 2ET6A 1KIFA 5AXAA 4CQLB 1Q0QA 3W1VA 1PGQA 1QG6A 3EYWA 2PK3A 3PHLA 3AUUA 1HYEA 4NK4A 4DTIA 1HXHA 2O7QA 3GEDA 5DF1A 2A35A 3A1NA 3FNFA 2VZ8A 3AI3A 4CUJA 4I8XA 1NBOA 1LSOA 3P7MA 4FW8A 1E7RA 1UDCA 3D4PA 4F46A 3KYCA 1TT5B 4BQRA 1N1EA 4Y6PA 3RC9A 1CF2O 1MV8A 1OZAA 1XWFA 2QYTA 4FS3A 4MOWA 4IJVA 3VKUA 5J23A 2PWZA 1BDBA 1VKOA 1YL5A 4LGVA 1YVEI 5TQVA 3AOEC 3ZHBA 3SXPA 1U3UA 1NWHA 1EZ4A 3IJRA 1PU2A 3KUXA 4HKTA 3TZHA 3I4FA 2CDCA 5JAIA 4HUJA 1UP6A 1DC4A 3PZRA 3TSCA 5CEJA 2VTDA 1UDBA 1QSGA 1ONPA 2BFMA 5DBGA 2DTDA 4FOOA 4XIYA 1N7GA 3RUDA 4CV0A 3O8QA 4KUGA 2NVUA 1HLPA 4D43A 4DIBA 2HMUA 5HS6A 5CPFA 3OIFA 1MXFA 2HMTA 3GEGA 5ILOA 1ZZEA 4XQEA 3INTA 3RFXA 2V6MA 3ZCXA 5BNTA 1ISHA 1BW9B 4Y98A 5DZSA 2OHXA 4NMHA 4NJMB 3MJTA 4FN4A 4WPGA 3C1TA 4E5MA 4CLRB 2J5KA 3ROKA 3LT1A 2ZATA 3U49A 3SJ7A 5H83A 1LDNA 3OQBA 4MIOA 5B4UA 2EKPA 2HDHA 4W9NC 1P1JA 3PWKA 4OOFA 3PJEA 1D1TA 4OSOA 3ZHXA 4LISA 2Y05A 3SJUA 4CLOA 1VM6A 2PGLA 3NEPX 2NADA 3D5TA 1IY8A 1X14A 2ZB4A 5COBA 3ZWMA 2YYYA 5THQA 2HJRA 2VZ9A 1ULUA 1XG5A 4UVHA 1DFIA 1NPDA 3KTDA 1A7KA 1VJTA 1LLCA 1AUPA 3VPGA 1BG6A 4E5KA 3DTTA 1EEHA 4J7CA 4PLFA 2FPIA 4JXKA 3B1JA 3JD3A 2DAPA 4GX1A 4RV9A 1YDWA 3G1UA 2AHRA 4QQRA 4PLTA 2UV8A 4OXKA 2X4GA 3EZLA 3U4IA 3GEMA 3WNVA 1CWUA 4N5NA 2G0TA 1UAGA 3WGGA 1M75A 4PFJA 3OJOA 2CY0A 2X8LA 4Q3CA 2DKNA 4I1IA 4K6CA 5TT1A 4ND3A 3NTRA 1QV7A 1ZSYA 3WYBA 2DBVO 3H7AA 4P4NA 1IZ9A 4YRDA 2VZ0A 2PZLA 1HLDA 2RBEA 4IJUA 3HN2A 1P9LA 2Q50A 5L3ZA 1QLJA 4BNHA 2VTEA 1LLDA 3KEOA 2I65A 1IULA 4MP8A 1Y81A 4CMEA 4HY3A 1Z82A 4M86A 1E7MA 4FC6A 4R5MA 5HWSA 2H9IA 1SZJG 4MDHA 5JLAA 4R9SA 4AVYA 4DBZA 2PD6A 4JBHA 1JAXA 3ZW8A 2O7SA 1I2BA 3WR5A 4B4VA 4YRBA 3MJEA 3ZWCA 2GERA 4EI2A 5KOIA 4A26A 1E1LA 3ZNOA 1TI7A 2HK8A 1I30A 3GFGA 3I83A 5JE8A 3K73O 4NNJA 3E8XA 4J4BA 4DLAA 2CVQA 1ADBA 2GN9A 4EGFA 3GDGA 4J7UA 3B6ZA 1R66A 2AQHA 4Z3DA 2B5WA 2DFVA 5A03A 2FWMX 1NFRA 1WWKA 1P1FA 1XU9A 3HWRA 4YT2A 2BH9A 3U4HA 1PWZA 4M54A 2YW9A 3BTVA 4LSMA 4GLLA 4AJHA 1ENPA 3DDNA 3V2UA 1YO6A 2LDBA 1UXGA 4HFRA 3ZI0A 3ZU5A 3PQDA 1ARZA 4YA6A 2PZMA 4D41A 4F3YA 5F1PA 4IBOA 1R4MA 3PFWO 3G1TA 3VTFA 1GQQA 1HDRA 2Y67A 3VH4A 3QJ5A 1GU7A 3F5QA 5IG2A 4PCVA 2GO1A 3A28A 3WBBA 1Y6JA 4MVJD 2PFGA 4OYRA 4RVSA 2B69A 5KVQA 1HEUA 1KBZA 2BELA 4BNMA 1EVJA 3N7UA 1EE2A 1F17A 1T2DA 5KVSA 4BNLA 1GTMA 2C7VA 3GUCA 3CINA 2P9EA 4EEXA 4YAIA 5DN9A 2GF2A 2ZTUA 4WLVA 3PIIA 3WDSA 2EKQA 2ZTMA 1O5IA 3H5AA 5L95A 5AXDA 4RPLA 4ALNA 1E5LA 2NU7A 4ZHSA 2Y1GA 4DREA 2NTJA 4KQXA 4MO2A 1LDGA 4HFMA 2NVBA 2AEMA 4DA9A 2EGGA 1H5QA 6LDHA 1D1SA 5BNIA 4WGGA 2DBZA 4CM4B 1WAMA 1H6CA 4PLGA 1UZLA 5TC4A 5DCWA 4B8WA 4RPGA 4S3MA 1KVRA 4BHTA 1XHLA 1H94A 2JCXA 4IJWA 4N7RA 2VOEA 4ZQFA 5K6AC 2CSUA 2NSDA 1QYVA 1YL7A 3QWAA 5BSFA 5IAAA 1N9GB 2EEZA 3JQFC 4IIUA 1VPDA 3ABIA 2DM6A 3C3XA 1E6UA 1TVEA 3LLSA 1BXGB 1EFKA 2X0RA 2EW8A 5K9ZA 3UCFA 4KP7A 1GAEO 3DWFA 8LDHA 2C0CA 2GPTA 3G0OA 3UHAA 4E5NA 3OM9A 4R51A 2NACA 3LLVA 5KJFA 3KYDB 2Y0EA 1ZK3A 4BO3A 4IZHA 3UKOA 1B26A 1KY4A 2DQ4A 5ES3A 1L7DA 4R5HA 2P2SA 3WTBA 2FSVA 2I76A 5L4LA 5BSGA 1SPXA 1PJSA 1H6DA 1I5RA 1ZK1A 4XQCA 3U0BA 4KUHA 2E37A 5JAMA 3G79A 3FSRA 4A03A 2W2LD 1I24A 2D1YA 3ZWAA 3H4VA 1ZO8A 3ZWPA 3MOIA 4YAJA 3V1UA 1ISGA 1EDZA 2BMAA 3KB6A 3NAQA 3AU9A 4YT5A 1I2ZA 2CDAA 1MX3A 4XCVA 2EJVA 3U09A 3H3FA 3STHA 2I3GA 1PS9A 1PJQA 2OZPA 9LDTA 3QV1A 3OJ0A 3FNHA 4DBVO 2R00C 1TT7A 1HZJA 1D4FA 4CMJA 1E3WB 2AQIA 2NQTA 3OFSA 3Q2KA 1BXZA 2ZYAA 4DPMA 5IZCC 4HBGA 4XGIA 1BMDA 4H7PA 2R2GA 2VQ3A 3MZ0A 5A5FA 4EUEA 3N74A 4J2HA 2J5RA 1PZHA 2O2SA 1DFGA 2B4TO 1YRLA 2VYND 2CF5A 3QVOA 1DSSG 1PR3A 2YHIA 4WLOA 2JKVA 1H0KA 3M1LA 4N5LA 1GZ3A 1E3IA 2D3TA 1I3LA 4CM8A 1TLTA 4ZICA 2QZZA 3NUGA 4A73A 5DULA 3QY9A 5BR7A 5TJHA 4QTZA 4E4YA 1SC6A 3BMCB 5DOVA 4RQUA 4KTVE 3W6ZA 1PJBA 4Z0TA 4CM7A 2IODA 1ID1A 2VN8A 1B15A 4H3VA 2GASA 5COQA 4BNVA 4BO4A 3AFMA 4XX0A 1VRWA 3U4CA 4XB2A 4GL4A 1KVSA 5IN5A 4E2YA 1L7EA 4DC1A 3IKVA 4IDFA 5FEUA 2Y0CA 4D45A 5EJ2A 3CE6A 3FR7A 4YJFB 2JFGA 3JQ9A 3UCEA 2AE1A 3FBTA 1DIBA 4FCCA 2PKQO 2WD7A 4ZVVA 1Y7TA 4ND4A 3VC7A 2NM0A 5C37A 4X54A 5CPBA 1HDCA 3OF2A 1I0ZA 1ML3A 3K92A 3VPFA 3ZN2A 3DQPA 4CQMD 1WZEA 3I52A 3VPHA 3FD8A 3CZMA 4JIGA 1EBFA 2VYVD 2X9VA 3GAZA 4XQGA 2CUKA 1PGPA 3EY4A 1JDJA 4KUEA 1J49A 2IYPA 3AU8A 3HHPA 3I3OA 4PVCA 3RC1A 4TROA 4DXHA 5KVVA 3T7EA 1EE9A 2JFFA 4I5DA 4RPHA 4YQZA 3WIDA 3IDSA 3WGYA 3WGOA 2ZYGA 1DIGA 1K3TA 1Q2XA 5EPOA 1T26A 1NAHA 3H3JA 4DIFA 3JYNA 4E30A 1GPJA 3GPIA 4MVJA 2BFOA 5CDSA 4HXYA 4DQUA 5JS6A 5JYDA 2IZ0A 1OAAA 1UR5A 5C5IA 1H2HA 1EFLA 4B3HA 4YPOA 2VHZA 2I67A 1YJQA 5CDUA 2AA3A 5KWEA 3ITKA 5JXWA 4KDFA 1V0JA 4IMPA 5IXYA 3MEQA 2Y1OA 3GVIA 4BNIA 5COAA 2VWGA 1DRUA 1C0IA 3PTZA 4AJEA 2GN4A 3GNSA 5L53A 3PZBA 1XQ6A 4IJKA 1R16A 1BHSA 4B3IA 5B4TA 1PJ3A 4GX5A 1C0KA 2LDXA 3C8MA 3L4BA 3IC5A 4J1NA 1LRLA 5C7IO 1NQOA 2IDZA 3FPLA 3LZ6A 3ADPA 3BTSA 1CEQA 2PA3A 2VOJA 4FPXA 3MWEB 3JQAB 4E32A 3H9EO 1PJ4A 5ICSA 1GYRA 1VL8A 4CR6A 4MVJP 2PV7A 3K5PA 1NWCA 3GF4A 4WCFC 1EQ2A 3Q0EA 4WASA 2UYYA 1YJ8A 3JQGA 2PLAA 1A9YA 4IPTA 1B7GO 2QYSA 1QV6A 5G4KA 1JLLA 3WX0A 5A9SA 3ZWXA 1PGNA 4MVJH 1LTHR 2Q45A 4D42A 3BMNA 1ENYA 5C7OO 4RPJA 4U0KA 4PRLA 1B8UA 1ZEMA 2EF1A 4NHEA 3RBVA 1HDYA 4U6SA 2EV9A 4QECA 3DZJA 2PD3A 3WQQA 4WJZA 1GZ6A
chains in the Genus database with same CATH superfamily
2A6PA 4XIGS 2HMVA 1KK0A 1OZGA 1SBCA 1U8FO 5CA1A 3GC6A 2DULA 1IB0A 2G9ZA 4IP0A 2BH2A 4QIHA 3QE3A 3CJRA 2BPOA 1A9RA 5AM3A 2G76A 1Z88A 2PL5A 4R41A 3UF0A 1UZMA 1X8XA 5IC4A 4GU5A 4RADA 4BFUA 2ZS7A 3VH1A 1DCFA 3F7MA 3VGPA 4AO8A 1ODKA 3BXZA 1A88A 1RAEA 3U4DA 3ES9A 5LLDA 4EPYA 2KSQA 4WK4B 4LNAA 4G1BA 5BQ3A 1VZ3A 2BFBA 4I1OA 1GNSA 3T5MA 3UM9A 2GAOA 5H5JA 4EP1A 1H0HA 5REQB 1EP9A 3C5EA 3CW9A 3WWEA 1EKXA 2H7VA 2B9EA 1HEYA 3LP5A 1TIBA 5DM60 4FFBB 3F6YA 4MWCA 2LVBA 1OMOA 3ZQ4A 1LLQA 4U6QA 2C57A 2ODNA 3FWKA 1WXEA 3BL6A 1Z37A 2CLFB 2JLQA 3DE4X 3QPCA 4G0QA 1QHSA 3ZIUA 5AVRA 3O83A 2W11A 4FWTA 2VZEA 1D2MA 3RFFA 1G5PA 2GARA 2NTNA 3MERA 3WO1A 3WQRA 1U0RA 5LQSA 1UBGA 3RVMA 1L8LA 4I4NA 1YS9A 4M0CA 1RYYA 3TD9A 1WB4A 3G8DA 3PFHA 3ZVNA 3U5TA 1N3IA 4CM9D 5KQMA 4BNKA 2DR0A 4K6OA 4UEWA 2PKYX 5EHIA 2J32A 2I34A 3OESA 3I9KA 4HVAA 4D0SA 1EWQA 1GQFA 4WNAB 1J5XA 1C7IA 4MAAA 4WOJA 3RGGA 3DYIA 3THYA 1WCWA 4FE3A 1STOA 1P1CA 2DWUA 4OGWA 1QIFA 2HNBA 3MMXA 3ESCA 3FDIA 1S7GA 2W6PA 1E3JA 3G02A 1FIUA 4F3NA 1SKQA 1KGSA 1C2TA 4Q93A 5JS8A 1IB6A 4QDTA 4W9RA 1J97A 1GLGA 1VSTA 4JD5A 4D9HA 1GUYA 4WA7A 1HTTA 2I87A 2W0SA 4N49A 4KMRA 4DR2B 1T9DA 5AQEA 4WLFA 1X7ZB 2IP4A 4K6KA 4WTOA 3RRNA 3T1TA 3K6SA 2QS9A 2VHQA 2X7JA 5FLYA 4JXZA 2OHHA 3KOWA 1T1EA 1DJLA 3JQ7B 2L18A 2FX3A 3QMMA 5H81A 2FSSA 4HPXB 4D98A 2CYAA 2BJVA 2YWFA 1RQ2A 4X1KB 4IKEA 4KQCA 1GXSA 4YXFA 3K70B 4BCDA 2ZCUA 2NV6A 3DMNA 1GKIA 5J5CA 4BGIA 3ZE8A 2Z4TA 3EFBA 1KWKA 1NXOA 4CQMA 3CUWA 4EMSA 3T9EA 1KQOA 2WPDA 3WKBA 2IHVA 2CVZA 2QSYA 3OHSX 4G84A 3BMQA 1X6VA 4UHKA 1M1YE 3WGZA 4WBNB 1Q16A 3MQFA 3FF4A 3KQLA 1CJSA 4YJ2F 3PWTA 4K88A 4OUDA 3DBHA 4J16A 1Z56C 4WK0B 4CKYA 4LCEA 3BSYA 1X87A 3WLKX 4AJKA 1ZJYA 3EDOA 4RLQA 3VZPA 4YUZA 4FEEA 3Q9SA 4YJHB 3C3KA 1MA0A 4AX8A 5SZHB 4UPDA 4OK3A 4PGHA 4ARUA 4J1QA 5H9WA 1EGQA 2D1TA 3D0RA 1DHTA 1PL0A 5B6PA 2W8ZA 1P72A 1AV7A 2NUAB 2PUFA 2Q9UA 4D92A 2PD4A 1FB5A 1MIOA 4M1OA 3ZDQA 3FHCB 3LTEA 4LRUA 1NP3A 4UHJA 5DI9A 2WQ6A 1X80B 5L7WA 2QM7A 2Q6LA 3TLZA 3PHGA 4OEHA 1E64A 1RM0A 5I9IA 1KOFA 3SVTA 3G7SA 1CQJB 1XJ0A 4AQDA 2X2OA 1WSDA 3VHLB 2P5UA 3ENWA 4OD0A 1S3FA 3N9IA 3U7RA 4DPKA 1PKEA 3HUUA 3CEHA 3VPCA 3HXPA 3I6YA 2DECA 3X1DA 1E60A 2O8CA 1CE8A 3QVWA 1GPKA 4B2IA 4U9HS 3UMCA 3O1LA 3DFMA 1E4VA 2FXVA 5AUPB 2J6HA 3BXHA 1XSEA 4N6NA 3AVVA 5IJ0A 4LEIA 1T8YA 2ZS9A 2ZTSA 2ERCA 5FH9A 5ALFA 1J99A 2QVZX 3MILA 2OFPA 4BEVA 1J9ZA 1M5UA 3ELYA 3GEHA 3BK1A 2F00A 2ZRCA 3I2JA 5AKIA 1OFHA 2N42A 3VU0A 2JIDA 3G2KA 2M6KA 2II6A 1AF4A 3PFFA 1GIAA 3WHKA 4FQ8A 4NCNA 2XVZA 3BDVA 3F4BA 3K9NA 3FTPA 3MCUA 1YIDA 5JDIC 4N39A 1P2VA 4ZPXA 1Z5GA 1D7OA 1YRWA 4R1LA 4RD3A 4IDHA 3AUSA 4YO7A 4GRDA 4A27A 1SQGA 3WSVA 2QUKA 1BTOA 2ZIXB 4P5DA 3WWZA 3AJ9A 4EI8A 4EKNB 4WCFB 4WOPA 1HYHA 5TGTA 1SXJA 2ZWOA 1II9A 2G0NA 4BV2A 4JB3A 1L7OA 1YU6A 1V16B 1KFBB 3AQIA 4U2DA 4O4HA 1TU3A 2HSZA 3GD5A 3Q7QA 5JIBA 3PTAA 2HSDA 3KKOA 1QHXA 5TSDA 4A8HA 5ESWA 4F6RB 5KDDA 3RYTC 3H5LA 1PQWA 1E94E 1MV5A 1OWNA 3PEWA 2I3AA 4C6HA 2XTNA 3JRWA 3W8EA 3IUEA 4LNUB 5CB0A 1C5KA 4CGYA 2DUNA 5ARCA 2DCUA 1PDVA 3FMIA 2F62A 3HKBB 4CEJB 3L41A 5JD4A 4O33A 1K6MA 2I7XA 3KZVA 2B4QA 1YIAA 5BN3A 2BUBA 5B36A 5KYNA 1P8JA 1CNFA 1FDUA 4LFAB 2FR1A 3UKJA 2O1WA 4HWKA 3OWXA 1P5ZB 1ABBA 4BVHA 1LI7A 1L7RA 3AKDA 3AR8A 3HNOA 4O0LA 3QNWA 1DAKA 1FUIA 1VBNA 5JECA 3NAZA 1JMYA 2Q21A 1UBSB 3C6MA 1UIRA 3E23A 1YH3A 1PX0A 3H2HA 4BNUA 3GHYA 3SLRA 4XIFA 3VU3A 1ESEA 1F6BA 1GJRA 4P4GA 4YHHB 3OURA 1P8AA 3SC3A 1R3DA 3S8EA 1LBEA 2G63A 3ZGNA 5GADl 4ZVNA 4PIVA 2WEKA 1M1NB 3RJ9A 3QBTA 5LIRA 2H1HA 3HNPA 2HIHA 4B3RB 1IL0A 2EJUA 4U9IS 4ES6A 3F4KA 1YDFA 3GXBA 4Q3EA 4OIMA 5HKAA 4FT2A 2JFZA 2OORC 2UUOA 2W22A 2H5LA 3K0KA 3O7MA 2PKRA 4R1SA 3HKEA 4M0UA 4ZCQA 4EJFA 2JLYA 1XE3A 4MYSA 4LJKA 1XZHA 4NKRA 2ZCVA 1M0EA 5BO5A 2C8VA 1ULHA 1N2EA 1JTFA 3SMQA 1A50B 3VMMA 1TT5A 1T24A 1IEXA 4FHZA 2V97A 2X0JA 4FW9A 1GPUA 3NGMA 1RI5A 4JWTA 4DM7A 1QDUA 3A6FA 3OKCA 1YJBA 4H35A 3UW1A 2ZI3A 3ED5A 1PR9A 1E77A 4IXDA 3NHJA 5B3JA 3WL4A 3L43A 1KIAA 3GZNB 1P4AA 2JJ1D 3VPSA 3MLBA 3EGVA 3PUIA 4YHBA 2AI1A 2WIGA 5HCNA 2V7GA 2YFKA 3UATA 2AZ4A 1D1QA 1L5SA 2D59A 1R18A 2VSXA 2OCBA 3OLQA 4P7JA 4ZQEA 4RHYA 5L40A 2OCLA 1T9KA 1B41A 4X7BA 1YTUA 5M5BA 1LS1A 2VK4A 3DO6A 3QKSB 1P5FA 3BRQA 2WMYA 4YJGB 5EESA 2CWWA 2OP0A 3GFQA 3L4SO 3EEIA 1XA3A 3DDOA 4XJVA 5F23A 1SCKA 1QNLA 4AX4A 2WHEA 4C5CA 4GMKA 3I01M 1L0BA 5G0SA 2F90A 1EM6A 4DY4A 3UOGA 2FI1A 4C0LA 1X7DA 2G25A 3VR6A 2H2GA 5HGJA 4L8YA 2VDNB 2G5GX 1T4CB 2XAAA 3DEFA 1FK8A 2PMDA 1R0LA 1WQ3A 2OZEA 3GVXA 4LE2A 3JQBA 4Q48A 4FOLA 1ATZA 4RXMA 3GROA 2FRDA 3NX4A 1H65A 2H2HA 2CHVA 1BO6A 3MCWA 1NOJA 4GR5A 4HNAB 3ZU2A 5JADA 5KDOA 3EPHA 1MZPA 4KLZA 3L93A 5K2OA 2AZMA 1YQEA 4QRHA 1H1LB 2BL4A 2J3IA 1LDMA 1LBIA 3D6MA 4IIDA 5G1OA 4Q4HA 3WYDA 4YRLA 1Y8QB 5C1OA 2AOXA 4TTSA 5ANRB 2ZUBA 3UH1A 3V6LA 1CPYA 3BWBA 2RD2A 2ZE8A 3PNVA 2HA2A 3Q8XB 4UAGA 4E1AA 5KNDH 2ZE6A 1MIHA 1G8YA 4MWEA 5A5EA 3MWGA 1BE8A 2YDXA 1MOZA 7MHTA 1I3NA 1B0PA 1ZWLA 4JN6B 2NUBA 1M8FA 3PI6A 3IAEA 1E2BA 1GNPA 1PT8A 3A6HA 4RL6A 4D9KA 1JQEA 4QXQA 4EHJA 2PY6A 4OKIA 1N4AA 4H7IA 3B2NA 4Q4CA 5AW5A 2A5JA 4MVYA 2IZ7A 1RE0A 3M9XA 1WE2A 2X5NA 3RHTA 1Y9JA 4OA8A 1CDEA 1Z38A 5KQGA 2ZBFA 1OH8A 2O8DA 2VAVA 5GINE 4HB2A 4INOA 1XLWA 1AKEA 1M2OA 5DTEA 4INZA 3VNBA 5EWJB 5BOVA 2P6OA 1XLTC 3H1BA 2Q4OA 4B71A 5CH3A 5JNSA 2GXSA 4OGKA 3RIMA 2WVAA 3G8BA 2C9YA 2H7XA 2QAGC 3I45A 3R0ZA 4JOQA 1GV1A 4O3FA 2GN8A 4M46A 2FUCA 4RUKA 4YJ3A 3AFHA 3KR2A 3LUCA 4EMTA 4QE3A 3IAM1 5AVSA 4A91A 1NXPA 1LSSA 3AUAA 2GM3A 4WFIA 121PA 3QU5A 1E98A 4ALJA 3GLVA 4WV3A 5AKJA 4K40A 4MW4A 1ZL0A 1E0DA 3C7TA 3ZHOA 3AEKB 3A1SA 3TVYA 4Z9XA 3NORA 4EW2A 1ZM7A 4DMGA 4IG9A 4PW0A 4X6XA 3EIEA 4P4TA 4B3FX 1Z5VA 3ON5A 3BSSA 1KJYA 4YLGA 3QG5A 4JI2B 1P29A 1E9SA 3ISVA 4JVMA 2CGEA 2WJ4A 5ALNA 2HLHA 2XA9A 4LRSB 3FKSD 2PZJA 3L77A 4DV7B 2VAMA 2ZYUX 5DM4A 4AZ3A 1ZCFA 1FUKA 1QH1B 4B3SB 3FPKA 4GOJA 5AHWA 3HUEA 1VMAA 3P71T 4W5JA 3WLEA 5JAHA 4PG5A 1HNWB 8MHTA 3CG4A 3OUTA 4KR7A 3FOZA 2JAUA 4O6VA 2WKRA 4H6VA 4E15A 3UJBA 3UZUA 4EITA 3ZWWA 4AG6A 4E33A 1VYHA 3IEVA 4JX9A 3ZGLA 4CEHA 3GA7A 2XT0A 5LWHA 4FEAA 4KC0A 4W7HA 3EEOA 3QSGA 3FY4A 4KPUA 1HLGA 1QVVA 2JJ8A 3DH0A 3H2SA 3CRMA 3L7BA 1SKYE 3HKDA 3RWBA 3RVNA 3TD6A 4X0EA 1XRSB 3OIWA 1CY7A 2FNAA 4JI6B 3ZCVA 2BSXA 1RPZA 4QYIA 3VYTB 4GLOA 5PNTA 5IM5A 3A3PA 3U7QB 2D7DA 2ZJ1A 1OT5A 4L3VA 4FJ0A 2HB6A 4CDGA 4CKCA 4EA8A 2O0HA 1AS3A 2RDMA 5JO9A 3GLIE 1CUVA 1CY4A 1I7NA 2H4HA 4QPZA 3MGGA 4YAGA 4QDOA 1RPTA 3O8NA 3K0CA 2W4QA 1IN8A 3EZ6A 4LAFA 4BFWA 1IONA 1K75A 5EE3A 4GR9A 1T15A 4JYMA 2B1JA 2MOKA 3S2GA 4CM8B 4Y6OA 3W5DA 1F06A 1PG0A 3SR3A 5C4MA 2ETVA 4BB0A 3KPYA 4L15A 1Y6GA 4W6ZA 5HQTA 3OOJA 4B31A 4UUAA 2O7VA 1Y1RA 1XAGA 1M1YA 4QAJA 4KZPA 2NWQA 1L5MA 3C4JA 1PWEA 4YP0A 5JCJD 1WCIB 2IX3A 2JARA 3L1IA 1OUMA 3JV7A 1JLSA 3KU4A 2OXIA 5E3HA 4KITB 5KVCA 4BP8A 4MLPA 4L8VA 4KXVA 1NOKA 1IYZA 1GTRA 1UWCA 4I66A 5DE3A 4UTPA 1KERA 4MS1B 4YRQA 1KQGA 4Q9DA 1NHWA 4NH4A 3TW4A 5IAJA 1TTPB 3RUIA 3IOMA 2D0IA 2OFWA 1W1UA 5FOTA 4I55F 1JECA 2NU9A 4LCJA 5FWYB 4MA5A 4A23A 2BKAA 3PDWA 4YMIA 4DR5B 2E5FA 2OAP1 3I1IA 3UJPA 1MAWA 2G80A 3G2HA 3I9MA 4C88A 1NDUA 2XE4A 5HQJA 5LJLA 3ID6C 2Z3ZA 3BRWA 3JQAD 1YS7A 2XA2A 1QG4A 1X13A 3WISA 2PIAA 5IYZA 2YXLA 1QUEA 1BWSA 4DW8A 2QTGA 1X1QA 3DNFA 4MAMA 3VOTA 3VH2A 2HWKA 1ZRHA 3ER8A 2CFOA 1Q7BA 1DCMA 1BXGA 4DUPA 4BMCA 1T3HA 2AZDA 4PSAA 1J22A 3VZQA 1E1CA 4W63A 1JWAB 4RVGA 1Z25A 5JMPA 3N1UA 4OHRA 1BWRA 1CR0A 4MVJF 5LNK1 1M2HA 4WFKA 4TN1A 4DQKA 3KYDA 3LXMA 4JOCA 4P84A 3NRCA 1LBTA 3D1VA 4RVNA 2Y2UA 4C30A 2H7CA 2IV7A 2ZSJA 3RFTA 4RVDA 1Z33A 2O1EA 5FORA 3W9SA 4TLCA 3RLFA 4DB2A 4W6QA 1VL1A 3HR8A 4N0EA 1MQAA 2WWWA 1IOVA 2RKOA 1KVUA 2C42A 3L6DA 1AGPA 4OQDA 1JEOA 1GQ2A 3A27A 4MGEA 4OHXA 4RKWA 1RU3A 1R88A 3U3MA 1TD9A 4YUVA 3HXOA 3D6TB 1ZYUA 4JBIA 4OAPA 2H1CA 3KNZA 5D3MA 1EUQA 3UT0A 5MN4A 1YJXA 4LZNA 3EXIB 4JL8A 3ZDAA 2BZGA 4HH0A 5CXUA 3RC8A 4RDIA 4YNBA 2XOEA 1YZHA 4RE5A 4Q9KA 4U2BA 3BK2A 1R37A 3IDZA 3WLQA 1SIUA 3KKMA 3KPUA 3QY0A 3W5HA 1R27A 1HRKA 3BMOB 3EZ2A 2R97A 5GJWC 4QUBA 3AM3A 1U3WA 4NONA 2VDQB 4TLMB 4WT7A 3QJGA 2I7VA 1EVQA 3QVSA 1PR6A 1FDIA 2JFNA 1Q0LA 1WV1A 2AN9A 1AV6A 1EP1B 3M2TA 4AYTA 1H2WA 4M9ZA 5D1NA 4MRNA 2B20A 4D46A 1L5RA 2EIXA 1HDIA 1KK1A 2P3OA 3AT1A 3D5QA 4FLMA 4MW6A 1CUJA 1CNEA 4JHXA 4LSGA 1YULA 5D5QA 5T57A 1TF5A 3D6NB 4HD8A 4HI0E 2NOAA 5A6SA 2XTAA 2ZVPX 4HN4B 3URMA 1A8IA 2A9JA 4J49A 5FR1A 1U80A 4N47A 4DS3A 2EGUA 3ITDA 4QFMA 5AESA 4AICA 4NTZA 1R8JA 1DVRA 3TOZA 3PJRA 3CIOA 4OCZA 4YR7A 3OZAA 4LJAA 1D8TA 4NVRA 1LRJA 5ALKA 2QAGB 3HY6A 4IF6A 1TKCA 3EVBA 4YGYA 4NU8X 1CQIA 1KTIA 1BQ3A 1U9YA 3A6LA 2PG3A 2ZG6A 2VP9A 5BN1A 3K9QO 4IMRA 2EFEB 4UEJA 5JYBA 2XVXA 3V8EA 1M73E 2DBQA 1JPVA 1WMEA 2XUDA 2RB4A 3OEHA 4KIWA 1S8AA 4MQEA 5K51A 3BHIA 5KBYA 1GQOA 2JBHA 4MLZA 3PXBA 2VDKB 3NB0A 1KF0A 1CJKC 3KWMA 1X2BA 4K5QA 2ZAYA 4BU1A 2J3HA 5FX2A 1G8HA 4KDCA 4YJFA 1C9EA 1IHYA 1XT6A 5K20A 2HA5A 4D7AA 5KNBH 1WMDA 3HDYA 1W1WA 4ZI3A 2W93A 1JFFA 2D00A 4ZA2A 2IWRA 4EVQA 1MABA 2RSLA 3U4AA 1WF6A 3PHBE 2WUWE 1T5LA 5CB4F 3K6JA 5DP1A 2QJRA 3IKTA 2I4IA 3AYZB 1O96A 4GSLA 2ERYA 4IF4A 3BF7A 3I3SR 4OXXA 3S8YA 3IEMA 3H4MA 3HDGA 3F49S 2IPAB 1UFOA 3A7EA 4M49A 2Q4EA 5LDDC 2V3CC 3ZQJA 4I19A 1T5IA 3I05A 5KYUA 1N75A 3QTTA 3HM2A 4R9RA 2O8BB 3KV1A 2HMYB 2I80A 2HK6A 3LLMA 1FU8A 3MUEA 3ZDCA 5BT8A 5JXIA 2FW6A 3IURA 4BFLA 4RDCA 3OCJA 5JNUA 3H75A 2IYFA 4YFVA 4C0AC 4K9RA 2YJNA 3PJGA 4MPPA 1N2SA 3K09C 3UCXA 1SMKA 3VYWA 4FMCB 1NVGA 3K53A 3PC7A 3FKJA 2PQMA 3TZQA 3CLSD 4W1PA 3W3AH 3QLUA 4FFWA 4WZAB 1SIBE 1T0BA 4F04A 3W3ZB 5D7BA 4NU5A 4CLHA 1LVHA 4HRYA 3PGXA 3QFTA 1UOQA 3A70A 4MTCA 3ESBA 3M5PA 3H1PA 2NYUA 1HOTA 4XYMA 5JFOA 5H68A 1K7EB 1RKXA 1EDDA 5LZ2A 4A16A 1M1ZA 5E9WA 3WHLA 1KI6A 4MS3B 2UVPB 1DXHA 1KZ4A 2YUTA 1LLUA 3CSUA 3VPAA 1PZEA 3GFBA 3F2VA 1FRQA 1XPJA 4K2HA 2FWJA 1CC1S 3FSGD 2VQFB 1RIFA 3NBFA 5SYMA 2RH4A 1YVRA 4HPJB 3DLTA 4S1NA 4QPDA 4UZSA 3GNTA 4C3ZA 1QIKA 4CT4B 4YXWD 1Q0UA 5KIAA 4OQPA 2J8ZA 2EBWA 3L01A 1RW4A 2KLHA 3EW9A 3T0IA 2ZYRA 3LCMA 1MQSA 4MIYA 5G53C 4CLDA 1GY8A 4PN3A 4TPKA 3DE6X 1G8SA 4U7TB 2V4ZA 2OHGA 2QM0A 3EDMA 4GFDA 1M6HA 2WPNA 4X20A 2RI1A 3M83A 1KXZA 3BX1A 4NF2A 5DLQC 4CUZA 5KYVA 4MR9A 1HDEA 1J90A 3VSBA 3CFYA 1PEDA 1K97A 3NJ4A 3AETB 2HHJA 3Q11A 4X3CA 5AD1A 2NO0A 1G5FA 4NL4H 2OM6A 4HGRA 2XGOA 2RGNC 3UH0A 1S2MA 3L1HA 2VPXA 2E2WA 3JW8A 4B0OA 4E1BA 4E88A 4ZGWA 1L4BA 1P4GA 1R8SA 4RTPA 1B2RA 3V42A 4LJ8A 4WK6A 1UBRS 1Z2OX 3L8DA 1YQXA 4NDZA 5K0FA 2D8AA 1M9NA 1W5BA 1EK5A 3ZWKA 3M82A 1GKKA 2HC9A 1G8JA 3IMCA 5BUCA 1EDOA 1N25A 2QYOA 5F5LA 3VU9A 4CG1A 3RD5A 6CHYA 5KNDD 4QYWA 1R5OA 3KKEA 3A0UA 3QVVA 3MAJA 3AM4A 2O6HA 2JFWA 5H82A 4ZI7A 2I4NA 5D3ZA 3F97A 2EATA 1MVLA 3UTCA 2V7PA 2AEEA 4ZZ3A 5BPHA 3WLJA 3V7NA 4GWGA 4PLVA 3A6GA 5JWHA 2XT6A 2VF4X 4MYUA 2R1VA 2W6CX 3NDJA 3SBDA 3ZE2B 3X1XA 4IKOA 4BNYA 2XWPA 2RG7A 4WUVA 3UFXB 2NLOA 3L1JA 3MT8A 1VFNA 4HF7A 4N5DA 4A0SA 1VE7A 3EARA 4ZALA 4EGSA 4HT3B 5JMTA 2P8JA 1YZLA 4PS1A 2VUIB 3H1GA 3RUEA 1YBMA 4C7OA 4IG4A 4NH0A 4MNTA 1XTIA 4EH1A 1AXEA 3OQPA 4NOKA 3MC1A 3N2KB 4ZV7A 5IF9A 1Z07A 5GM2A 5EJ6A 2AIRA 5ENVA 2XY4A 5LQNA 4KLCA 4BKQA 4QJ3A 1X1DA 1RRVA 1GA1A 3G89A 4MCHA 3S2IA 3D4OA 2A5DA 1NJ1A 4GOLD 2AOUA 2ZRPA 4K8RB 2WHQA 5ALMA 3FFAA 1Y42X 2Y66A 1NSTA 2XYVA 4RTKA 3FTFA 4CMGA 1X3LA 4OJNA 3MT7A 4NARA 3ZWYA 1T0PA 5FR2A 4JGIA 5LXTF 3B2QA 2H2FA 3G2JA 3ITEA 4B35A 4C20A 2IH2A 3WK9A 1KO1A 1CRLA 4RLFA 4X5OA 1QZTA 3MB8A 4RS4A 1UZAA 1R10A 1ZM9A 4ZIRB 4DV3B 3ROEA 5HSGA 2Q3DA 4A2PA 1UQUA 5EL0A 3NGXA 3L0YA 5LQCA 5EXDA 4PC2A 1D07A 1V1RB 2ACEA 3GCWA 3I30X 4RF2A 3ASZA 1RNLA 2IQ5A 4H7EA 4L4SA 3IVMA 1XZDA 1GZUA 1NONA 3BERA 4WNIA 3C14C 3UAGA 4AJ1A 4PO1A 3OJCA 5EJMA 1Z08A 5E1BA 3OOWA 3QWHA 3VU1A 1U7TA 1SHKA 4JJ4A 4RPKA 1JU4A 2X5OA 2MJLA 3F2IA 1UMCA 3LYAA 1KARA 2VP4A 5LBIA 2G06A 3VA7A 1CJBA 3FIUA 3UG6A 4RE6A 2F43B 5BVHA 2ASVA 2YRXA 3I9JA 4CZ2A 1DG3A 3LKVA 4LF5B 3HPQA 1NI3A 3AH8A 1XK7A 4IVPA 4TLEA 3GJSA 1Z16A 1CUCA 3DNMA 3B3AA 3NBUA 5A04A 1R7RA 3HE3A 4QDJA 4MP3A 4R1UA 1NBMD 2HAEA 3EF0A 2ZWPA 1JIXA 1DNPA 3OMWA 1V1MB 3VQTA 4LVOA 3SJCA 2PBZA 2PGJA 4G1CA 2CNDA 3C4QA 2CYCA 5DRTA 2ECPA 4G8BA 5JS1A 2ZU6A 2ANBA 2BDTA 4CIAA 3IOYA 4PX9A 1BYIA 4FE7A 4QBGB 2AW5A 3IHTA 2V74B 1NYRA 1NW4A 1K6JA 4R69A 1SG6A 4UUPA 2AF3C 4E2ZA 2FP4B 3OZBA 4Z4FA 1V2HE 2RK4A 4JBYA 4B85A 4E2XA 1NV8A 3FPHA 1W94A 3ORSA 3R77A 4YAFA 5JAQA 3ZR4B 5KHAA 5K4GA 1IPHA 2YWEA 2XKJE 3K70D 1E0AA 1Z7BA 1MNAA 2H85A 1BRTA 3KHKA 3R3WA 3D3WA 3CBQA 5THKA 1XCLA 2GRUA 4CGZA 1J2UA 3BQ9A 1J20A 1QFXA 1PJ8A 1KDVA 1DC5A 3FAKA 1DX6A 3LUGA 4HTFB 4CF3A 3O8LA 1JQJC 1N0HA 2A4KA 1K8XB 2YWDA 3D3NA 4JQYA 3X1JA 3JAMA 3WOVA 1L9KA 5ENDA 4CWAA 2P1ZA 5CYGA 1QR2A 5BQPA 1G291 2VUTA 1K5DA 5IXSA 3KR9A 2I29A 4TXJA 1UMDA 1BOFA 5G0WA 1RJ9A 2JKZA 3IVRA 2C4VA 1AS2A 1DIOB 3JD4A 3SSMA 1PWHA 3O7WA 1J1ZA 3PXDA 3L3BA 4RHUA 1V39A 4PFKA 3QYJA 1WBJB 5A7HA 1IPEA 2ZBDA 1WUYA 1X0XA 2XUQA 3CY6A 1A96A 3LBHA 3PE4A 4IYRA 4QHSA 5TQ2A 1E5TA 3MRVA 4WDQA 3DKRA 3C3BA 4J94A 5JS7A 5DLDA 4L0QA 5EOVA 3SYTA 1H66A 2X86A 3ULKA 1I2AA 3GRVA 1YNOA 2FW1A 1F0YA 5K5EA 1ZSNA 4NPAA 3G2NA 3MFQA 2WNHA 3TFQA 1KH3A 2CXRA 4HO1X 1HFEL 3NDRA 1ST3A 4NABA 1ZVQA 1FVHA 1J23A 1ADYA 1M2NA 4ZAYA 5AOCA 4W5WA 3A31A 4QOJA 5CAEB 1ECFA 3ACDA 1LJLA 1SKAA 4DV6B 3N2IA 1KO4A 4L4RA 4PPQA 1EX9A 1IUNA 16PKA 4K1XA 2C95A 1P2FA 3OM0A 4GE3A 4HG2A 5B6IA 5C4IA 3W4JA 2HHLA 3W1WA 4Z1OA 3RAEC 3DZ8A 3RT1A 1O1YA 5U4XA 3BKXA 4JHLA 2FEAA 2R8OA 3Q7TA 2IW1A 4RJLA 2IWHA 5B2EA 2TMGA 3L4KA 4WVLA 5EJ9A 2WFMA 1ZUIA 2ATXA 1WX1A 2EYQA 1G7SA 3FNRA 1PD0A 5DGXA 4L9RA 3VC1A 2QXYA 3OA2A 2VTBA 1VMIA 3DC2A 2XYQA 3RYHA 3TS1A 3DBRA 1TAHA 2GZDA 4U8HA 1DLIA 1LFAA 2WIAA 2PGAA 2AEJA 4IDEA 2QLLA 2I62A 3KSMA 5IVDA 1ISMA 3CEAA 4PTZA 4DLVA 3NRJA 1CUXA 3IALA 1M6VB 5FNVA 3OP1A 5EXEA 1H8ED 2H1SA 3IBGA 5DGTA 1QPBA 1KEPA 2J4FA 4LZWA 1P1IA 2A8YA 4Z54A 3V97A 1E6LA 4XGNA 4AJOA 4XYLA 2V58A 2WA2A 4GM4A 5KJ1A 1V9CA 3JVEA 2X4LA 1SIOA 4YAEA 2XF8A 2OBFA 2B78A 1NVBA 4Q7JB 3SIWA 3NCTA 4WZBA 2OOSA 1VBKA 1TCUA 5ECDA 3OT1A 2J7PD 4GI2A 2D6FA 1YRQA 3NMUF 3ELDA 4KTTE 1JQAA 2B4YA 1DKQA 2HKIA 1ZVKA 3CNEA 4FFVA 1FLNA 4CDMA 4E5YA 5K0LA 3QPBA 3D31A 4O4LB 4QYXA 3AUTA 2O5CA 3OEYA 1EG2A 3IOEA 1KI3A 2H1WA 2GH1A 2YVKA 3ZXIA 1M6WA 2GTIA 4OBXA 4RSRA 1NW8A 3M0EA 1TQ8A 2BEWB 2O2YA 1E1NA 4L2IB 1FFWA 4AKIA 1IRXA 2FR8A 2VHEA 5KVAA 1JKJA 3NJRA 2H1RA 3DVAA 4N40A 4GF5A 4D3DA 3B60A 4BMPB 3VR5D 3G8AA 1YCHA 2VUHB 3WMEA 5KTPA 2CJYA 2FYTA 3EN0A 1PUXA 2XZPA 1E0KA 3HU2A 1SBZA 4GNKA 4ESHA 5C9ZA 3ZHTA 5DNCA 2PX6A 5CLLA 4B6FA 2JK1A 2P4UA 3CPJB 4JELA 4LK3A 3KSUA 1XTTA 4JR1A 3C8HA 1NG1A 3RRXA 1ZMRA 3ZIDA 1PR2A 1F2TA 1IFXA 2NZVG 3KU1A 1E1QD 1U94A 4ENRA 5KNBD 1MXHA 1XEFA 1WUJS 4ALLA 2RHCA 3E61A 4XVUA 4JI8B 3ZNPA 1WDLA 2J5QA 1VE1A 2GTHA 3SE0A 3N75A 1CFZA 4GS5A 4EFDA 2L42A 1XRNA 3S40A 1DC3A 1EFRA 1MB2A 2HMAA 1FLVA 4TYQA 4EI7A 3K8OE 4KACA 3W6OA 1SU6A 1XYGA 3C41J 2CLSA 4CV2A 8GPBA 1VGVA 3RBXA 4NZOA 3ND9A 4DGSA 1I36A 4BNFA 2RIRA 3U16A 1OKKA 4ZN6A 1XMQB 3EJ6A 4DWWA 2AE2A 2JK0A 4GC9A 3TG8A 1NPTO 4XOUA 5F5NA 1JKXA 1UKBA 3I12A 4Y2TA 2IU6A 1ZUWA 3I6ZA 4LBVA 4AS3A 1QQAA 2O05A 1HSZA 4TOIA 4HN2A 3GR6A 4L08A 1U9IA 4K3UA 5EERA 1X94A 4EGCB 2MSEB 3O2SB 1E79A 5AJVB 3RQSA 3UA3A 1E9CA 1HDGO 1QHYA 3FVWA 4EZEA 1KI9A 2WIJA 3AWIA 3DDUA 1F60A 2ZPUA 2B4AA 3ZJUA 2YIJA 1UQRA 3NHPA 1H3EA 1YMVA 1PHRA 3HXLA 5ERXA 1PL8A 3EQ7A 2PL3A 5FJIA 5IAKA 2LTAA 4AU1A 1KMHB 4MUNA 3D4NA 3V1NA 1MLDA 3ETCA 1KZGB 3IO5A 1PE0A 5GZ1A 1N2BA 3AUXA 4HGOA 4DHWA 3H04A 2JLAA 3JRNA 5C8ZA 2IYEA 4R83A 1U99A 1NNSA 1TB4A 2EBFX 4JEMA 4ZO7A 3SWWA 2RHRA 4ML3A 4JLVA 1DO8A 4BLUA 2YMMA 3SYMA 1N2JA 1UM9A 3LT5A 2QP3A 3IP8A 2C7GA 4AJPA 4F9TA 2QLJA 3AL2A 1FJXA 4URXR 5CNKA 4BP9A 2Z6UA 5DGIA 2OKCA 3EXFA 2JLXA 3M8KA 2HQRA 1N1DA 2V59A 1JJVA 3I0MA 2E18A 1E59A 3WHPA 2F4NA 4G0NA 2WE8A 3WV5A 2BGIA 1O94C 3OZ7A 5F51A 3HVRA 1BVHA 3ELBA 1CUSA 5IJ9A 2GK7A 2VJPA 2O6LA 4I5FA 4F9EA 1HKHA 4G26A 1PT7A 4XZ3A 5EHQA 1GA4A 3GJ5A 1M8KA 3VAYA 4N01A 4EYEA 4BVGA 1P62B 1CUIA 4N0QA 2QIOA 1IQRA 4LDQA 1CQWA 1TEXA 4N82A 3HRIA 3UJ9A 4EW1A 4LHWA 1IXSB 1E9RA 1KRWA 2A59A 3BAFA 5HCUA 3TSZA 5J4YA 3NV7A 3C5WP 3IQHX 3MFYA 3VPXA 4H27A 4YX9A 4F4UA 5KAPA 1T43A 1P31A 2PSJA 3WSWA 2YJ4A 1NQAO 3NYQA 1UQTA 4JC8A 3HBAA 1A4UA 1KEVA 4KXUA 4GKBA 2N0SA 2Y9PB 3K6RA 1NE2A 3LP6A 3P97A 4YCDA 4WKOA 1CUEA 3OU7A 3ZOKA 4EUNA 2QR3A 3P32A 2IE0A 4NYIQ 4QHTA 1CZUA 1VPLA 1BFDA 2P9BA 1KOJA 3GH3A 1G3RA 4HGQA 4LN1A 2QTVB 2DQYA 3K7EA 4HX5A 5HA5A 3UG7A 5LZ5A 4KRFA 5FTMA 5JBQA 2WAMA 3QOFA 2KS6A 5K3BA 1K8ZB 3GUHA 1U0EA 1MB3A 4BOYA 1JDNA 1X7XB 1PZFA 2ZM6B 3IGFA 4A92A 5K0ZA 1QP7A 5SYNA 5AJTA 1WPGA 3WWYA 3ZV3A 4YDSA 1YDMA 1ADGA 3GA5A 2VCHA 4I55B 3ROMA 1CERA 1JT9A 2O7RA 4FHDA 3R8XA 4OAQA 4HAOA 3RIEA 1H9AA 3I58A 3IUSA 4RSGA 4H4CA 2JRLA 3X2SA 4TWRA 1US8A 5AOBA 1JHZA 3G68A 4N12A 2VHUA 5F9MA 1GFWA 1P39A 2FLWA 5K3OA 1R3UA 1UWLA 3BFPA 2I0FA 2OL4A 4QXRA 4TV8B 5HX7A 1E9BA 2DU8A 3S2SA 1Z15A 2CMKA 5K99A 3HL4A 3K2EA 5NULA 2XKBA 2H08A 1QF7A 3AUJB 1HETA 4ZJUA 4BZXA 4ZVKA 3S4YA 5LQAA 3PQ8A 3PXEA 4KKXB 4PBTA 1ZG3A 2YXDA 3P9XA 4UZFA 1RADA 1Y5LA 2AFIA 2YFHA 3KZKA 3PG5A 4X9XA 2VK1A 2FN8A 3MAAC 1P91A 4AQ7A 5AXCA 2CJWA 2OGTA 3MPOA 1COWA 4JUDX 2A92A 2NU8A 1FMLA 3LHDA 1J5EB 3BEOA 3J81k 2B36A 1WLYA 1X2EA 5EE9A 4JGBA 2JCVA 4F60A 2BGNA 1QFMA 2OUIA 1LS6A 1G9SA 4UEQA 2A0WA 4I4TB 1WP9A 2JGDB 1T2NA 2XDQA 4C4RA 4P3NA 2C1EA 5AKHA 3CPSA 4ZVSA 3D81A 4HZUB 1SOMA 4AJ4A 4ZYXA 5I4KA 5HTOA 4CEJA 3QITA 1PGJA 4G81A 5CB6A 5L9AA 3AJRA 4MB6A 1S2IA 5AQ1A 1S0UA 4LSZA 2J6BA 3MB5A 5E4FA 1Q19A 5AFSA 2G1AA 3IE0A 4N4AA 3ZJ4A 4F56A 1SFRA 2B5OA 2GCIA 2WUEA 4H4DA 4QBIA 5FA6A 5SY6A 4A1FA 4BNDA 1Q1BA 1KAMA 5GJBA 1OYYA 5I4BA 5BN4B 1IDOA 1PGOA 2XB8A 3PCTA 5DIFA 1HE5A 3ZTWA 4P36A 4AP6A 1Q6ZA 1WBDA 3KYBA 1XKLA 1G5RA 4ASUD 4AZ0A 1VMDA 3DZCA 3OQIB 3PLRA 1IOZA 3T9BA 2ODQA 4QELA 3WRXA 4BUJA 4LZZA 3VHXB 5BUZA 2J87A 2JS7A 3PYLA 2FWRA 3DHYA 3U31A 3R3YA 3EXHC 3KD2A 1AZWA 3IBYA 3L8HA 4IH1A 3UHFA 4BQFA 2OXFA 2EZ4A 4IM7A 4F71A 5CFOA 4XD2A 1HE8B 2VWHA 2HDOA 1RYMA 2R86A 4TYPA 1Z2CA 1E2LA 4PGMA 1FW8A 2DR2A 3IE1A 1YE5A 4KPGA 4B6QA 2JW5A 4M0MA 4Z3OA 2WQZA 1NNEA 2HQBA 3CVWA 2H8KA 3BXPA 3K8QA 2B3DA 1BDIA 1NF8A 1Z4OA 5B37A 5B58C 4X85A 3P26A 3ICPA 2SHKA 1BD4A 1ZHHA 1R0WA 1HYGA 2W2KA 4ZVUA 4X61A 5HGXA 3A6PC 5AKXA 3SHOA 2VNKA 5AVQA 5ES4B 2AXQA 2JIRA 4MUJA 3SX4A 4G5GA 4CF5A 4MUYA 2GZ2A 3JZIA 2IPXA 2QZJA 4QASA 4URWR 1C0EA 3I1JA 3KQQA 3VVCA 2UYHA 4X3PA 2JBAB 3RANA 3WO0A 3DL7A 5JWRA 4YI5A 5DXAA 3DC7A 1GARA 3DMGA 5H4HA 1PL7A 4XVCA 3GJ4A 1QX3A 2Q41A 5GGYA 3KYIB 3QEJA 4LDPA 1JFRA 1D09A 5TB5A 4BZZA 5C0OE 2PBLA 2BDEA 1SU7A 2DWQA 5A7FA 5JH7F 5JVDF 4AY2A 1ZA2A 1BYUA 4L07A 2FZCA 2Q4BA 3T7DA 2IFTA 2JEYA 3FOFC 3R5SA 3AP1A 3SFVA 5JG7A 3U44B 3TGPA 5KS2A 5HKKD 2CUNA 4NJEB 2P2NA 4P33A 4IKPA 1P7CA 3U3KA 3HS3A 4TWZA 2D5BA 1G5QA 1XUOA 3ZK7A 1XKQA 4C0BA 4YT4A 3RW9A 4HNRA 5LLTA 1UXOA 2FJPA 5IHPA 4ND5A 5E6UB 3DOUA 3ZIAA 1RWXA 3BGIA 3JQDA 3E15A 4UVDA 3QLVC 1WMBA 1DKUA 4H6XA 4YIKA 3HYSA 1NQXA 2A94A 2AG5A 4EW6A 4AROA 5ITWA 4R8VA 3M49A 4WY8A 1XFDA 2ECFA 5FWXA 2QPOA 2Y1XA 3DV2A 1PCXA 1R8YA 5CT8A 5BOSA 1PD1A 3BWVA 3EF3A 4PRYA 1XIVA 1I4WA 1W6RA 3UGQA 1MH1A 4TTTS 3T9AA 3VC3A 1K7SN 3VYRB 4WESB 2WP0A 4UOZA 3A32A 1IMOA 3JAKB 4UE2A 4AO7A 3GT0A 4YT8A 1JFLA 3D0QA 3JQ8B 4X45A 1VPWA 5IXJA 3MMNA 1L8AA 4KEAA 4KI7A 1LD3A 5EWMA 2VRCA 2G8LA 3UEOA 2ORED