4RF2A

Crystal structure of nadp+ bound ketoreductase from lactobacillus kefir
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
250
Chain Sequence
DRLKGKVAIVTGGTLGIGLAIADKFVEEGAKVVITGRHADVGEKAAKSIGGTDVIRFVQHDASDEAGWTKLFDTTEEAFGPVTTVVNNAGIAVSKSVEDTTTEEWRKLLSVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPTLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLEGAEEMMSQRTKTPMGHIGEPNDIAWICVYLASDESKFATGAEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dependent R-specific alcohol dehydrogenase
publication title Origins of stereoselectivity in evolved ketoreductases.
pubmed doi rcsb
source organism Lactobacillus kefiri
molecule tags Oxidoreductase
total genus 96
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rf2A00
4I5GA 4KQXA 1Q0LA 4WOKA 5LC1A 1E3EA 4JN6B 2QG4A 3JQ7A 1GV1A 5JDIC 3COSA 3U4HA 2Q46A 1V8BA 1KVTA 4RF4A 4U6SA 3KTDA 3RFTA 1RJWA 5T67A 1H0KA 1I3LA 4NNJA 3UXYA 4QO8A 1WAMA 4PZEA 3OSUA 1V0JA 2DPGA 4DBVO 5CP8A 3Q2IA 2I66A 3QWFA 2BFPA 4OQYA 1U3VA 3ZNOA 1GD1O 2CFCA 3P7MA 1KIFA 3NX4A 4E12A 2WTBA 4CUZA 3QSGA 3H7AA 4PVDA 2C29D 5JDIA 4WLOA 1KS9A 3OJ0A 2DC1A 3U49A 1LRJA 5HWSA 2C20A 4UVGA 4YAGA 1HF3A 1DRVA 1U7HA 1SEPA 3D3WA 4TVOA 4HFJA 3X2FA 3GPIA 4ND1A 3L0DA 3K73O 1BXKA 1KC1A 3U5TA 5HRUA 2VHYA 3PDUA 3IKTA 4PLCA 1UXJA 1K6IA 1CQJA 5LDGA 4QEDA 3TFOA 2UUPA 5IFLA 2C0CA 2PY6A 1J0XO 3G79A 5EL0A 4CQMA 2VRBA 3V8BA 1XQ6A 1R16A 4AFNA 1I2BA 2HDHA 3F3SA 5EQFA 3DHNA 1QXSA 1PTJA 2PZJA 2PTGA 1N7HA 3STHA 3L07A 3CTMA 4DPKA 4BVAA 3QQPA 4B3JA 1SO8A 1NM5A 3PVZA 2Y93A 5TNXA 4PG7A 1YRLA 5EERA 2O2SA 4M54A 3ZU2A 1LSJA 1GZ3A 1O6ZA 4HX5A 3WBBA 4TZKA 5ENVA 4NR0A 2DM6A 1Y6JA 3H2SA 1M2WA 3ROMA 2O7SA 3T7CA 1GYQA 2NV6A 4IJUA 1E3LA 3WNVA 5IDWA 3GGOA 1CETA 1MP0A 4ZQHA 4PRKA 1A9ZA 2V6MA 1YBAA 3KBOA 1DC4A 2EJWA 4KOAA 2E82A 2IZ1A 2ZCVA 3ON5A 1CQIA 5A4DA 1D8AA 4D79A 3NTRA 1W0CA 1P0CA 3M2PA 2GN4A 4O1MA 1ZK0A 4G65A 1FMCA 3C1TA 3JCZA 4WLFA 5EJ2A 2VT3A 3H5RA 4IGFA 5I7FA 5KNLA 3BMOA 1OFGA 5A05A 4YVFA 2I76A 2VCYA 2BELA 2FN7A 2OBYA 4CM5A 3B1KA 1MFZA 1R12A 4WCFB 5AQ1A 3HG7A 4H16A 4DA9A 2CDCA 2WE8A 4PCVA 3WFIA 2V65A 2GERA 3VZQA 1I5RA 5L4LA 5AXDA 2H5LA 1LDNA 2YQ5A 4RQUA 1E1NA 2BKAA 3RU9A 4NBVA 2O4UX 4INAA 1GEEA 1PSDA 1X14A 3LYLA 4UVEA 1EFLA 5AOVA 3RKRA 3QVXA 2Q4EA 2HQ1A 3INTA 4B79A 2FMUA 3TDKA 4AJ4A 4BO8A 1R0SA 2ZTUA 4OJNA 1PU2A 1QYCA 1UXKA 2VN8A 1H2HA 1QYDA 2AQ8A 3VKUA 1ML3A 2DLDA 3KB6A 1Q7CA 2PZKA 1DIBA 2I65A 3PGXA 3JQGB 4M89A 2CZCA 3UICA 1UZNA 4ALIA 4AVYA 2ZYDA 4Z9FA 4LCJA 2PK3A 2DT5A 2H6EA 3ENKA 1LLQA 1ZW1A 3R3JA 3RQSA 5JY1A 3L77A 2GDZA 4FJ2A 4IJVA 3DOOA 5F5NA 4BB6A 5IDXA 3GUCA 1JKJA 3UOGA 3VTFA 3EVNA 3WYEA 1T1RA 3GR6A 4AG3A 2VZ8A 1N9GB 1P1RA 2CVZA 4CMHA 2DQ4A 3D0OA 1WMAA 1TT5B 5KJFA 4BS9A 1DIAA 3KRTA 3F47A 1FDTA 4JROA 3I83A 3KO8A 4XB1A 3IUPA 4XYLA 2YYYA 4YJGA 3WMXA 3WJ7A 1I3KA 4MP6A 3RBXA 3GK3A 3DAPA 3VVBA 3ONDA 4R51A 3WQSB 3WQRA 1I30A 1H6BA 4NG5A 4C7JA 5T5QA 4U0JA 4EITA 3ADPA 4NJMA 1X15A 1E1MA 1ZK4A 4YRBA 5DOVA 3H9UA 2GYYA 4MKXA 4NK5A 4FPXA 3Q2KA 2D59A 2JD1A 2G0TA 4RVGA 3K2BA 5L4SA 4K28A 4AL4A 3WGIA 4FC7A 4KUEA 4XIJA 2VUTA 3MJEA 3S8MA 1GZ6A 4ZRMA 4HFNA 4CLOB 1UXIA 4CMKA 1JVBA 4O63O 3I9MA 3OM9A 3FNGA 4IDBA 4FDAA 3QWHA 3K6JA 4QX6A 5G4KB 1BG6A 2QYTA 3LT4A 4PGFA 2EKQA 4WCDA 3ORFA 3DMYA 4AJ1A 4CODB 1T26A 3BA1A 1V3UA 5IF3A 1H6AA 3AUAA 4IZIA 4JCOA 4UVHA 4DLBA 1Q0QA 5DOZA 1J6UA 5JNLA 3U0BA 4EUHA 4YXFA 3QY9A 3VH4A 4FOOA 2NM0A 3E18A 1SCUA 2X1HA 1DAPA 3F5QA 2RHCA 2OMEA 4B3IA 3ZHZA 4UULA 4ZGWA 4AJJA 1CERA 4WKGA 3CEAA 2GUGA 3FTNA 4HY3A 3V5NA 2VTDA 2FPPA 3EK2A 2ZCUA 2EXXA 4Q3AA 4FIZA 4YA6A 3SLKA 4CM4A 3VZPA 2ZKLA 3S2IA 3ZNPA 1OBFO 1D1SA 1ORRA 3OQ1A 3W1VA 3U62A 2Q2WA 2Y99A 2IODA 2JL1A 4CV1A 3MJCA 4OXKA 2C7GA 1WNTA 3HE3A 4JJFA 1X1TA 3MWDB 4FQ8A 4GMFA 1I24A 1KVRA 2H1SA 1YO6A 4ALLA 2NU7A 3GN2A 1NX6A 4Y6PA 3ZU4A 2YDYA 1SC6A 1RPNA 5GZ3A 4OL9A 1HZZA 4TVBA 1PL8A 4I8XA 3A9WA 3KYDB 2E48A 3AK4A 1C14A 1Y8QA 3AM5A 3DZHA 5HA5A 4QSMA 1R0KA 1MB4A 3E48A 3ROPA 4Z0TA 4OSPA 1SOWA 5CHEA 4ILKA 4GAEA 3PLNA 5GMOA 4J1TA 3JQAA 1NQOA 1B3RA 1PGJA 4NJOA 1ZH8A 3F1LA 1EVYA 1XEAA 5JE8A 3K5PA 5U4QA 4XD2A 2LDXA 4ZHSA 1HZJA 4J7XA 5DDIP 1B3BA 1HRDA 4FD3A 5MDHA 1P0FA 3DXFA 3C7CB 2NU6A 2VHVA 3AU8A 2EERA 6LDHA 4BGVA 5A3JA 3RAJA 2VYVA 4JJGA 3WWYA 4K1LA 4EJ6A 4S3MA 4D0RA 3BMQB 3C1OA 3ZN2A 2O23A 4E2YA 3EDMA 3P19A 3QVTA 4BNXA 3F9IA 2FPGA 1Q7GA 2WEKA 2QYSA 4IXTA 4MIEA 3BMCB 4YJFB 2JCVA 2JD2A 4GGOA 1AE1A 1VPDA 5I9NA 4GSKA 4J9VA 3Q9NA 3GVCA 4H15A 3PDJA 4I5DA 1F8FA 3QVOA 1UDCA 3GFBA 4GVXA 5BR7A 3FI9A 1ENYA 1WDLA 2B4RO 1DLJA 1SEVA 3GPDG 5K9ZA 4L4RA 4RLSA 4NZ9A 1MC5A 4CR7A 5A9RA 4CUKA 4PVCA 4BQRA 2PKRA 3RSHA 5B4UA 4HUJA 3GVPA 4FW8A 4OQZA 2NUAA 3DTTA 3Q3CA 2CMDA 2HMVA 4P22A 4RL6A 2Y1OA 5I7SA 2DU8A 1LBEA 1E3WA 1P77A 1N92A 3AM3A 1EBUA 1WDKA 1VJTA 1UUFA 2YJZA 5KKCA 1WLYA 2B5VA 5L7WA 2HU2A 1XU9A 1BVRA 3PPIA 4TQGA 4DRYA 5L4NA 1RM0A 1Q1NA 4URFA 1UR5A 4CMCA 3V2HA 3BHJA 2OBNA 1XG5A 3GHYA 4HP8A 3I9KA 1NFRA 4L73A 4CJXA 2W90A 4MKZA 2CVOA 2X6TA 5K6AA 4F6CA 1T24A 3IUSA 2D3TA 3VPGA 2DBVO 4OKIA 5DBFA 4CV3A 3HFSA 3WIDA 4E2WA 1M76A 3LC1O 1F0YA 4R9RA 2HMTA 3VH2A 4IS3A 4D41A 4M55A 2GN9A 3AW9A 1KOLA 1UJMA 3H9QA 1ONOA 4FJ0A 4DVJA 1MFPA 4J4HA 3IAHA 2CDAA 2H63A 1ENOA 1ONNA 1AGNA 5B37A 3D1LA 1CWUA 5A1TA 3G1TA 4KUHA 5THKA 2G76A 3A14A 3NRCA 4N7RA 3BTSA 1WP4A 3AU9A 2HAEA 1G0OA 4P4NA 1A7KA 1C1DA 2E4AA 1M6WA 1F14A 3HADA 4GLOA 4D44A 5JC8A 1VJ1A 6ADHA 3BAZA 1G6KA 1W6UA 2XPCA 3E1KA 3IP3A 2DUWA 4IDFA 4ZD6A 3U3XA 2GN6A 4FN4A 5MGBA 1T4DA 4XJSA 1XLTA 4WK6A 3EYWA 3E6AA 4JBIA 3V1TC 2NVWA 2VNAA 2P5UA 4K9DA 4EUEA 5I7EA 1TI7A 2OGUA 3AWDA 1BRMA 1H6CA 2RAFA 3L6DA 5ES3A 3VH1A 1LJ8A 4P4LA 1U3UA 3DAGA 4MP8A 3HB4X 2NWQA 4UAGA 3KSZO 2HMUA 3VPHA 3FNHA 1HSOA 2PKQO 1B8UA 1OOEA 3WDSA 5DBGA 2ZK7A 2GZ2A 4DC1A 1PIWA 2DTXA 2Q2VA 4JGBA 3UCFA 5A9SB 1GV0A 1ZJYA 5TIIA 4FOSA 4OH1A 1HL3A 5KVCA 1Y5MA 2VHWA 4BQPA 2Y0DA 4P8RA 2JHGA 4Z6KA 3NT4A 4B7CA 4WCFA 7MDHA 1Z45A 3RC2A 4XQCA 4YQZA 4DPMA 3R1IA 1CEQA 1VE9A 1ISHA 1UP4A 4WASA 3PI7A 5JPIA 2FZEA 1WXDA 1ZBQA 3WYBA 3JD3A 3PHJA 3DZBA 3IQDB 4XQ9A 5F1KA 1HXHA 1XA0A 4CMBA 3KYCA 5HBRA 3FNEA 1X1EA 4PZDA 2O3JA 3GG2A 1EVJA 3EZYA 3IC5A 5JAQA 4MVJI 1V3VA 5FWNA 4TKLA 3T4XA 4L8VA 4PLHA 1YOVB 4DQVA 5IG2A 3AY7A 3OJLA 2I6TA 2FR8A 1W73A 2YZ7A 1K3TA 3TZQA 2P91A 2VUSA 4HADA 3GDOA 1XCBA 2O7QA 4OKNA 5JO0A 4R4JA 3ST7A 1E1KA 3F6YA 1E7MA 2YHIB 3HB5X 2D4AA 4AJKA 4PRLA 4Z3DA 1Z73A 3DBLB 3MWEB 2UVDA 2BI8A 4Q3DA 3TZKA 1NQ5A 3ZDFA 3ZV5A 2FR1A 1DAOA 4QXMA 3VTZA 1YB1A 1QSGA 3WYCA 2B0JA 1XR3A 1DXYA 2IZZA 2NU8A 3CH6A 2I67A 5IJZA 1YE3A 4MINA 2EP7A 4PLFA 4YRAA 1T2EA 1I10A 2PZMA 1TT5A 4HKTA 3L4SO 3SVTA 4DLLA 4BNUA 4L0QA 2WD8A 1GR0A 4MVJG 4HXYA 4OAQA 4YJDA 4GI2A 3ZGYA 3O8QB 1AHHA 4QECA 3QLJA 5KJEA 3UGKA 4N5MA 4YJHB 4D0SA 4CM9D 4WNCA 1EDOA 3AY6A 4BNVA 3KEQA 1J4AA 4PFJA 4X54A 3ZWXA 4BV8A 3PIDA 3JQDA 5H83A 1HWYA 2VZ9A 2C7VA 1LDMA 1HYHA 1YBVA 3GEMA 3PFWO 4C4OA 1QLJA 3LSYA 1KVQA 3B20A 3BIOA 2YV2A 4J90A 4YAIA 3GHHA 1BVUA 5A5EA 1GCUA 1QV7A 1U8FO 3ITDA 4WUVA 1NTOA 4CLOA 2NSDA 4NBWA 1NFFA 4FSHA 5EPOA 3OIDA 3CE6A 3WLFA 3JD2A 2HRBA 1E6WA 4LISA 3I9OA 1ZK3A 4E32A 5G4KA 1E7WA 3PWKA 3WOHA 3QWAA 1FK8A 1P33A 5A04A 2X5JO 1JN0A 1M67A 2RH4A 3D4OA 1ZUD1 2X0JA 4CV0A 5L45A 3FWZA 5F21A 1CRWG 1FDWA 4MVJF 4XB2A 3VKVA 1LSSA 5JFOA 3IJRA 1ISMA 3G49A 1B8VA 3GA0A 5B12A 1CDOA 4E5KA 3FHLA 5JCXA 1I2ZA 2VRCD 2Z1NA 3DDNA 3JQ9A 4BMVA 1SMKA 4QUKA 1GYPA 3IMFA 1GZ4A 5KKAA 1LDGA 3JD0A 1E5LA 1KERA 1XSEA 5KJCA 2RHRA 3E8XA 4I9UA 3QA9A 1L1FA 1G1AA 1GEGA 3FR7A 4XGKA 3SEFA 4AJHA 4CM3A 3LT0A 3NKLA 4Q9NA 3KETA 1NFQA 3VPXA 3D5QA 5TC4A 4PLWA 1JLLA 2HMSA 3HNPA 3G0OA 4J6FA 4NHEA 1WMBA 3RBZA 1SBYA 5L3ZA 5EINA 2QZ9A 2VOJA 1IUKA 4J1SA 3DOJA 3I9JA 4DL9A 5ILOA 3FNFA 3KYDA 1IL0A 3KOUA 1HDYA 4XRGA 4MVJD 2O3UA 1Z6ZA 4R1UA 1LXCA 3GNQA 1LI4A 4JNKA 1BSVA 3HN7A 3NDIA 4Y6RA 1LX6A 3PLRA 3GUYA 4IQGA 3SJ7A 2ZB4A 2AEMA 4LK3A 1XKQA 4G81A 1JU9A 4YEDA 4RJTA 3MJSA 1EE9A 3AM4A 4R3WA 3DHEA 1R4NB 4Z9XA 5AXCA 3PWSA 3DOCA 1NPDA 2XXBA 5FF9A 1ZVMA 4G2NA 3DO5A 3ZV6A 3WGHA 2GZ3A 4D42A 1BMDA 1ZMOA 3GAZA 4MIYA 1G0NA 4BV9A 1VL0A 4CMAA 4E30A 2AEJA 3T4EA 3I5MA 2RBEA 2EF1A 4J2HA 1VKOA 2VYND 1PEDA 4KDFA 3PJDA 4FFMA 4NFHA 4RPJA 4IQ8A 2Y67A 4R41A 4BNTA 3GRPA 3W6UA 3MEQA 1F12A 2Y1GA 1PJTA 4C7KA 1FDSA 3OQBA 1Y81A 3U9LA 4BO7A 1NVMB 1Y8RB 4CM7A 1GQ2A 3H2ZA 1MG5A 3C3XA 3UFXA 2HLPA 2D2IA 4ALJA 1GUFA 3A1NA 4YJFA 3ONFA 3KLMX 1P1KA 4TMFA 3Q11A 2DUUA 1EQ2A 5L7TA 1ZK1A 2HCTA 1KC3A 3M6IA 3OETA 4MVJH 3L6EA 3H3FA 5EN4A 4Z0HO 4BNYA 4IDAA 4LVUA 1U1IA 4N54A 1DEHA 1X7DA 2C54A 1NPYA 4J16A 1ADFA 1K89A 5JW6A 4E5NA 2XF8A 3O26A 2NVUB 3OA2A 1AXGA 1EDZA 4J7UA 2E37A 1A72A 1AUPA 1HDZA 1XGKA 2X86A 4DIOA 4CMEC 2X5KO 3H9GA 1PZHA 3QRWA 1SB9A 1GQYA 4J1NA 5HTOA 3RJ5A 1OAAA 1PZGA 1YDWA 4H7PA 4DTIA 3FR8A 4BKQA 1GU7A 1VI2A 2HMWA 4E2XA 1DB3A 3QVSA 3I1JA 5C7LO 5TS3A 4WLEA 2VQ3A 3BMNB 3U4DA 1DBVO 1MV8A 3ENNA 1V35A 2IEBA 3RD5A 4DXHA 1LU9A 4CMEA 2W2LA 4LMRA 1TA4A 1LNQA 1Z82A 2I3GA 1EE2A 2I9PA 2PD4A 1T1SA 1E77A 1DDOA 3RC7A 4W7HA 4YDRA 1HEUA 3LQFA 2J3KA 3ZU3A 1RYEA 4MDHA 1GPDG 4DMLA 2B4QA 3GH3A 1KVSA 2PD3A 3TWOA 1ARZA 3PYMA 1S6YA 4CLEA 2FSVA 3X2EA 1P3DA 2CD9A 5CG1A 5BSGA 2PGLA 4OOEA 1ZO8A 1H94A 3ZWPA 5ICSA 3RIHA 3ZCXA 2X4GA 5JLAA 3S1LA 3MTGA 2D0IA 1Q0HA 3AOGA 1M6HA 5A3VA 2VWGA 4TRRA 3IL2A 3A28A 4M8SA 1EZ4A 2J5KA 3WBFA 4HWKA 5TSDA 3ZW9A 3F4BA 3B6ZA 3ICCA 1Z7EA 5KVSA 3TRIA 4U6QA 4KMSA 2CDBA 1E7SA 1YL6A 1N7GA 5L7YA 1O9BA 1XU7A 2V6BA 4B4OA 8LDHA 3UVEA 2ZJ1A 3GNTA 4UEKA 3WQQA 4D3FA 5L51A 1TVEA 4GX2A 1NASA 3O03A 3MOGA 3NGLA 1YQDA 3BTUA 3H8VA 2Z95A 1U9JA 4DREA 4RV9A 2WMDA 3C24A 1Z7BA 1BW9A 2CNBA 3FN4A 3TN7A 2NNLD 2Z5LA 3ASUA 1B7GO 1IYZA 3B70A 5G2OA 1UP6A 4AICA 3ZWCA 9LDTA 5JYEA 2D5AA 2D8AA 2RH8A 4CMIB 3ONEA 3PZRA 1LQTA 3GVHA 1N1GA 2JKVA 5GZ6A 3KSDO 2EKLA 2GN8A 4DPLA 4XJTA 3CINA 4D43A 3K2EA 4YAJA 4FFLA 3N74A 2DBRA 4BNFA 2VHZA 3I9NA 3RUAA 4HBGA 3QW2A 1EQUA 3UH1A 5IZ4A 2Y1DA 7ADHA 2X9NA 1MX3A 2P9EA 1YKFA 1LC3A 2J8ZA 1Y5RA 3JQ8A 4RVHA 1IPEA 3PIIA 5TX7A 4BKUA 3DAFA 1HDXA 1YJ8A 3OJFA 4N5NA 3DFZA 5DCWA 5T57A 1K0UA 3RASA 4IMPA 3A06A 3AOEC 2J3HA 1YOVA 3JYPA 4OMUA 3NDRA 4WNIA 2AG8A 3IOYA 1DFHA 1FDUA 3CMCO 4XQEA 5DBIA 4YAKA 4YCAA 1CIVA 3VVCA 5DULA 5DZSA 2PR2A 4YYZA 2YHIA 1J5PA 4YT8A 1A9YA 3DBHB 3DBLA 2DBZA 4II3A 4J49A 1LRLA 3JQ7B 3WGZA 3G17A 4CM6A 5KTKA 3BTOA 4IDGA 2POQX 2YQ4A 1ZNQO 1SAYA 3A4VA 4BO5A 4R9SA 3AOEA 4IMRA 1I0ZA 4NH4A 1VL8A 3KM0A 4JBGA 2Y1FA 3K8ZA 4EEXA 1HLPA 2Y0CA 4RGBA 1H9BA 1LUAA 3EW7A 3RCBA 5COQA 5H82A 1O95A 3WGTA 2TMGA 5C7IO 4U0KA 3NEPX 3EZLA 3IP1A 5FYDA 1RM5A 4E21A 2HK7A 3LC7O 3GZNB 5J23A 1BXGA 5ER9A 2B69A 4A27A 1MUUA 2AEFA 2B4TO 4DWVA 3O8QA 3DMTC 1HDOA 1MXFA 4OGWA 4A7PA 1Q2XA 3DONA 3GRKA 3D7LA 1PR9A 3D3EA 3EHEA 2QRLA 5KWEA 2BGLA 3EGOA 4PLYA 5CFZA 3TL3A 3ADOA 4WJZA 2DFDA 3ZV3A 3BHIA 4GWKA 4I9NA 1ZIDA 1IE3A 2P4HX 1HYEA 4A2CA 2XXJA 4JJIA 4AJEA 4YR9A 3RUHA 3EC7A 2X9GA 2BF7A 3WXBA 1BTOA 4Q3CA 3F46A 1IB6A 4GKVA 1ENZA 4W7IA 2ZB3A 4Q3EA 5BNIA 1NNUA 2A35A 5A03A 2JAHA 4BO6A 1E7QA 3DMTA 2HSDA 3DBRB 3INGA 3TSCA 1HT0A 3CZRA 3GAFA 4UUOA 2GR9A 2ILTA 4NQZA 1NQTA 5C5IA 2A9FA 2GLXA 3DZGA 1RM3A 4O59O 4PIVA 5DP2A 2EW8A 4Z9YA 4HV4A 4BO3A 4FC6A 2GRAA 1WZEA 4W4TA 4A26A 1NAHA 2BI7A 5A5FA 1BGVA 4XX0A 1TLTA 2Q99A 3ETDA 5BSFA 1ZZEA 1TB4A 4E5YA 1ID1A 5A02A 2O3RA 4BNKA 5JS6A 3FRJA 1U4SA 3TZ6A 5K6AC 4OOFA 3TZHA 5KJ1A 1VL6A 3VC7A 2FY8A 2O3SA 2ZQYA 3GNSA 2EG9A 3GDGA 4H3VA 1ENPA 1D1TA 1EMDA 1QYWA 4J4TA 3OHSX 3LDHA 4PN3A 2QIOA 1F17A 3NYWA 5JMPA 1HSZA 4KDEA 3G1UA 2TMDA 4BGIA 2BHLA 2FRDA 4FR5A 4UVIA 5JO9A 1QYVA 5AVOA 1UXGA 4JX8A 4JLWA 3L6OO 4CLRB 5I8ZA 3ZWNA 2DPHA 4RQTA 5KCZA 3NUGA 1P44A 5I9MA 1KEUA 1DOHA 3FWNA 4M87A 3WNQA 3KXDA 4CQLB 3RBVA 2C5AA 2Y1CA 3QWIA 2HK8A 2DKNA 3GEDA 1DJQA 1M66A 4RVUA 2FR0A 2PA3A 3FSRA 4YTEA 3VDQA 3GMSA 3RFVA 4ALMA 1T25A 4E0BA 1EK5A 3KLPX 4EW6A 4WLVA 5HM8A 2QZZA 3GEGA 5JCJD 2BFOA 5F5LA 3DZFA 3WWZA 3ZV4A 2PZLA 4ZQFA 2VWHA 1T2DA 4NK4A 1WWKA 5IDQA 1NHGA 1KEPA 1ZSYA 4U7WA 1LC0A 5KIAA 1CJCA 4AJ2A 1KEWA 4XR9A 1DSSG 5TLSA 4DIFA 1ISGA 2Q49A 2UUOA 1JKIA 3R3SA 2W8ZA 5ICMA 4KWHA 4NBTA 1OMOA 1HKUA 2G5CA 3PHLA 4R5HA 3VHRA 2E6UX 1B8PA 1HDGO 4MVJP 3WICA 1Y8RA 4WCFC 4U5QA 4W9NC 5CDSA 3HQ4O 4E6PA 3JQEA 3TZCA 3VDRA 4Y8VA 2YDXA 1SZJG 3JYQA 2B36A 5EQDA 3U4CA 2YUTA 1I32A 4PLZA 5KVQA 3JQAD 4R1SA 2DTDA 3WGYA 1A4IA 3GMDA 3H5AA 3I4FA 5CEEA 4UREA 1H9AA 1EEHA 1EUDA 2ZYGA 3M1LA 4IUYA 2BD0A 4G5HA 1D7OA 3QVWA 1IHXA 2NVUA 4BMSA 4ZICA 2EW2A 3F4LA 1EUCA 1DLIA 3INRA 1QLHA 1YL5A 1NAIA 1PJSA 4ND3A 3OJEA 4W9NA 3FPLA 4PLPA 2V7PA 4CLHA 4DQXA 4PLVA 2X5OA 4IGEA 5JAMA 3PYLA 3JYOA 1SOVA 3CIFA 5DP1A 2W98A 3OF2A 4YT5A 5CG2A 1R37A 3RUDA 1JAXA 4R3NA 4RCVA 2X8LA 3C7AA 1MXHA 3P2YA 2Y1EA 4KQWA 1PJBA 2G82A 2P68A 1BHSA 1DC6A 3GF4A 1DRUA 4B8WA 4DQUA 4OIMA 1X0VA 2VZ0A 3S55A 1P9LA 4O6VA 1A7AA 4YT4A 3BMNA 4IJKA 4XKJA 3OA0A 5IDYA 4OYRA 2RIRA 3NAQA 4TZTA 1C1XB 2WYWA 4KWIA 1HE5A 2JFGA 4CQMD 4DYDA 4HNGA 3ABIA 4B7UA 3IJPA 3JYNA 2PH5A 1PZFA 2B37A 3JD1A 4QTZA 3JQGA 3R0IA 3MZ0A 1QYXA 3ASVA 4Z0PA 4ZN6A 3GY0A 2VHXA 3Q1LA 4CM4B 4XGNA 4LSMA 1WW8A 2YY7A 5AXBA 1QP8A 2EGHA 4LGVA 4ROSA 4RF5A 3PJEA 4Q3NA 3M1AA 4NBUA 4RPLA 2AW5A 4BHTA 5IXYA 4F3YA 1H5QA 4I5FA 5IZCC 4AJOA 4Y9DA 4BNNA 1YXMA 4UUPA 1XQ1A 1N9GA 3CZMA 3FF4A 5ER6A 3UUWA 4WPGA 1DFGA 1PL6A 1U2DA 3C85A 3I9LA 4WECA 5C37A 3Q9UA 4R5MA 1ZMTA 2FOIA 2P9CA 1YWGO 3C7DB 4ZQEA 4RLHA 3UAGA 2O3QA 1BDBA 1Y8QB 1F06A 2C2XA 5DCYA 4RORA 3PHGA 3VPSA 2JHFA 2YFQA 2NQ8A 1PJ4A 2UDPA 1RKXA 5ITVA 2GSDA 4F46A 1DC3A 3KHUA 5IZCA 2GASA 3LZ6A 1T2CA 5AXAA 1W8DA 1Y1PA 4GKBA 4JBHA 1DIRA 4XYGA 2I3AA 2JAPA 3QE3A 1LDBA 2GD1O 4A0SA 2IYOA 1VSVA 3WFJA 3GT0A 2IE0A 4EYEA 4WE3A 1DPGA 1MLDA 3OFSA 2YHUA 4L4SA 3TQHA 3ZW8A 1GQQA 3RKUA 4YBZA 1X13A 1E0DA 3GLQA 4J7CA 4GSLA 4K6CA 4OM8A 4CR8A 2R2GA 3JQ9C 3LK7A 2X7HA 4CMIA 1MC4A 1NWHA 1I8TA 2PKQP 1EFKA 1PQUA 2Q1UA 1UZMA 2WE7A 4FCCA 3RC1A 3DWFA 2BFMA 4MO2A 2PD6A 3QJ5A 4Y98A 4CMJA 4CUJA 1NPTO 4CV2A 1K5HA 1LRKA 1U3WA 4CM8B 2O3TA 3WR5A 2CVQA 2QRKA 3PGJA 4DYVA 2AHRA 2C59A 3EAGA 3K9QO 3OECA 3LVFO 4ALKA 3L4BA 1EK6A 2AQIA 4L4XA 1XHLA 4UVDA 4KTVE 1NVGA 3V2GA 4NDNE 2EHDA 1UAGA 4XQGA 3ULKA 4ZVVA 3TL2A 4RPGA 4O5OA 5ENDA 2JD0A 3W8FA 4ZRNA 5DT9A 3W8DA 2OP0A 4J2OA 3I23A 4ZQGA 5DNAA 5BSEA 1P74A 2QRJA 3ITKA 4GPD1 4BNGA 5HS4A 2E49A 1R4MB 2PGJA 4L9RA 2LDBA 1K2WA 4BIIA 3UHAA 1LQUA 3QP9A 4FB5A 2IRWA 4E5PA 2QHXA 4MVJM 2OOSA 5TJHA 2YV1A 2A94A 1ZSNA 4RPKA 4XEHA 3KUXA 4ZQBA 3ETEA 1ZXBA 4E4YA 1NBOA 1TT7A 3JV7A 4ESOA 3AI2A 5G0UA 1B16A 3VH3A 3DBHA 1LSUA 1YONA 2YV3A 3PTZA 3Q6IA 2GGSA 5T8KC 5TF4A 3ZWAA 4YWJA 1R66A 3O4RA 2AA3A 2J3JA 1KVUA 1O89A 3NTOA 1E1LA 3I4CA 4LSWA 5A9TA 3JQCA 1HLDA 4IIVA 1IY8A 1H93A 1MG0A 2EP5A 3BHMA 4XIYA 3GC6A 2AE1A 5JAZA 2B35A 2CY0A 1ISFA 1KEVA 3JTMA 1NP3A 4B3HA 2HRZA 3MCVA 2X0NA 4B4UA 3WLEA 1GFSA 1UDBA 3ZU5A 2Q3EA 1WVGA 3WG9A 4FFNA 3GZNA 2JCXA 1E7YA 1U7TA 1SNYA 1B26A 5T8KA 2W2KB 5TT0A 2DBQA 4AJNA 1RWBA 3ZNQA 4YT2A 3ANMA 3PHIA 5G4LA 4R69A 3E82A 1AHIA 3HUDA 3H3JA 4EZBA 3VZSA 3RUIA 1E6EA 4MJLA 1YL7A 1R15A 1UAYA 4Z3KA 2X58A 3WTCA 3PK0A 2ZTLA 2GNAA 2GPTA 3ZWMA 3ICPA 3MJ4A 4D3DA 4OO3A 1DHRA 4IDCA 3BMQA 2HJSA 3LT2A 3O9ZA 1JA9A 1OC4A 1C1DB 1U2GA 4KP7A 2V6FA 3IDSA 1ZSVA 1C0LA 3ZHBA 2OXIA 3BMCA 1QRRA 1DIHA 3DBRA 3OBBA 3EMKA 2VNSA 1P1JA 2PWZA 2R6JA 2ZATA 5IN4A 5LDHA 1IZ9A 3K96A 4J1QA 2FP4A 5TGDA 4MIOA 4E33A 4BGEA 3RUFA 2ZTMA 4YRDA 1E6UA 1NQAO 2HO5A 3WSWA 3ZI0A 1U5CA 3NJ4A 5B4VA 2Q45A 1GUYA 5BSHA 3E9MA 1QORA 3FD8A 2I5PO 1TXGA 2EIHA 2AG5A 1A5ZA 1VJ0A 1S7CA 4XZ3A 3ANLA 3OJOA 4UEJA 1LDYA 4LN1A 4RO0A 1DO8A 1Y9EA 1PJLA 4CM9A 4ID9A 3MJVA 4NU6A 1ZXLA 4XR4A 1N8KA 1U4OA 4RF2A 3HDHA 1JAYA 2AE2A 3DZIA 1WZIA 1QV6A 1D3AA 4R16A 4UEOA 5U9CA 3W4JA 4CLRA 1E3JA 1NYTA 4FGWA 1JWBB 3H65A 3HJAA 3RVDA 1O94A 2VT2A 1TEHA 2NTVA 1C3VA 1H2BA 5JY6A 2X23A 1UH5A 1N2SA 4DGSA 4CQLA 1DJNA 3KYCB 1YB5A 2WD7B 1BXZA 3OIFA 5CDUA 1XWFA 1CF2O 3R6DA 5CPBA 3ZWYA 3CUKA 3CSDA 4IXWA 4MP3A 1P1HA 3E9NA 4TKMA 3I6IA 4UUNA 2OP1A 4RF3A 4Y6SA 4J91A 2HKIA 1UZLA 2VYVD 1LEHA 4XDZA 4EJ0A 4JQCA 3PQFA 4BO2A 2P9GA 3MJTA 5CPFA 1ADBA 1YDEA 4XWYA 3ANNA 3JQFC 2ZB8A 5CDTA 4R01A 5KOIA 4B7XA 4RVSA 3GGPA 1PJCA 1LLCA 5ADHA 1WDMA 1KYQA 2VRCA 3HWRA 2VUUA 3JQBC 4HNHA 2BGKA 1YGYA 2JJYA 3JD4A 3UKOA 2PGDA 1L7EA 4HFMA 1VC2A 2O50A 5HS6A 4PLGA 3QV1A 3ZZNA 4AJPA 4B8ZA 4MKRA 3K92A 4TRNA 2JFFA 4RDIA 2A92A 4NU5A 3UCXA 2EJVA 1T2AA 2FZWA 3GG9A 1HE3A 3LF2A 1DFIA 3NGXA 4J4BA 4A03A 1NHWA 3M2TA 5IN5A 3JQFA 2GZ1A 3RWBA 2VOEA 1OC2A 4BKRA 3H5NA 4II2A 2IDZA 1YQGA 2IZ0A 2OORA 3TPCA 4GWGA 2HK9A 5G0TA 1B0AA 3JQBA 5GZ1A 4CLDA 5FI3A 4JK3A 2EEZA 2Y66A 3ROQA 5CAEA 3H9JA 5L40A 3I52A 2XAAA 3RUCA 4MVJA 3FPCA 4BOYA 1XELA 2X0RA 1A71A 5A9SA 2WJPA 3HHPA 1NWCA 1QG6A 2OFPA 4CPDA 4DUPA 4MOWA 2C5EA 3WIEA 3SJUA 2P2SA 3JSAA 3V2UA 3W6ZA 4JP2A 4ZA2A 5DCUA 3ZWWA 4ND4A 1GCOA 3L9WA 5H81A 4A10A 2QW8A 2GCGA 4BO4A 1B15A 3QWBA 4CL3A 2XOXA 5G0WA 1XIVA 4GVLA 2VYNA 1BWSA 5EMHA 3E9QA 1FF9A 3H4VA 1V3TA 2HUNA 2F1KA 1GTMA 1QKIA 3GFGA 4GH5A 4FFPA 3CXRA 1H6DA 2R00C 4PG4A 4EGFA 2EWMA 4IBOA 4CM1A 5JAIA 3E03A 3F1KA 1UDAA 1JDJA 4EEZA 1JKFA 2J5QA 3QIVA 1C1XA 4A5OA 2NLOA 2O2YA 1PJQA 1OZAA 4F6LA 4EJMA 1VLLA 3AFMA 3EY4A 5CEJA 2BH9A 4N18A 1B2LA 5COAA 3VPFA 3WGOA 1PS8A 3JQAB 3AFNA 4GLLA 4BUCA 3OP4A 4E2ZA 5BQFA 1GAEO 3P5SA 4IY1A 1UP7A 3DC2A 1PJ3A 4TWRA 4WLUA 3SC6A 4GX5A 4GX0A 3SX2A 4P4GA 5I9LA 4IDEA 1PS0A 3CMMA 1T4BA 5I8WA 1ADGA 3OQ6A 2R00A 5IXSA 1AXEA 5AYVA 4QFDA 1EBFA 4XCVA 4YACA 1I01A 4UUMA 3GN1A 5COBA 3S2GA 4MVJE 2NACA 2Q50A 3AUTA 3ZHXA 4EUFA 3IS3A 4XYMA 3W4IA 8ADHA 3ZWOA 2A4KA 2NTNA 3HDJA 3FBGA 2RCYA 3OH8A 4U8GA 1JW9B 2WWRA 1PGNA 3E5MA 1YB4A 2PNFA 1EVZA 3LC2O 1HE4A 1KBZA 2SCUA 4J43A 4LRSB 4DLAA 4F45A 3VZRA 1K6JA 4IDDA 2FPIA 5JC1A 1E3IA 4YJHA 1DIGA 3CPSA 1KY5A 1ZCJA 2P5YA 3GGGA 3NT2A 4R68A 5CEFA 3L9XA 4NIMA 3DBVO 3D3WB 4RZIA 1ISJA 1QMGA 3HSKA 4IM7A 1X0XA 4QT0A 5L9AA 2IEDA 1ULUA 5K0ZA 3KVOA 3QHAA 4Q3BA 1PGPA 4L75A 1PWZA 1WPQA 4W82A 2DFVA 3UW3A 3W4KA 3WS7A 2Q4BA 2BFAA 5BT9A 3RFXA 1ZJZA 1VRWA 1X7GA 5F1PA 3W8EA 4CQMB 4NPCA 2PFGA 1V9LA 2AXQA 5A06A 1C0KA 1JWAB 4NMHA 2X9VA 3PWZA 1YJQA 2ZJ0A 2WM3A 1PQWA 3SXPA 3D4NA 4GX1A 3B1FA 4WEQA 2Y68A 3WGQA 4B4VA 1HETA 4FFOA 4E3ZA 1L7DA 1X7HA 1YQXA 3TOXA 1O5IA 3DEYX 3NJ8A 1PQPA 5I7VA 1ADCA 1PL7A 3DL2A 3TNLA 4ALNA 4CM8A 1NVTA 1MGOA 4LMPA 3FTPA 3OIGA 1R0LA 1I33A 3TJRA 1ZEMA 4PZCA 2W4QA 2PH3A 2ZIZA 3F5SA 4J0EA 1YH3A 4R1TA 3SLGA 5KJ6A 2BRUA 4TROA 3GOHA 4YQYA 1C0PA 2ZTVA 4XA8A 5FFFA 3ZWBA 4R54A 3PZBA 3DB2A 3DR3A 4JXKA 4M49A 4NBRA 4ND2A 3S2EA 3LLVA 3WGGA 3ZNNA 1DC5A 3PJGA 2CF6A 1I3NA 3BMOB 1NR1A 4E31A 2G17A 3PP8A 1R4MA 3IKVA 5JSFA 3UF0A 2CUKA 3FBTA 3AUUA 4JP3A 4E13A 1GADO 2IYPA 2NTJA 4J0FA 1GL3A 4BMNA 5U1PA 5BNFA 3RC9A 3GZ4A 1R6DA 1FJHA 4IINA 3WSVA 3PJFA 5FEUA 4LW8A 3C1AA 1HYGA 5F3RA 4DIBA 1XYGA 5ILGA 2Q2QA 2VWQA 4ONEA 1BDMA 2UYYA 3RUEA 2Q1SA 4BO0A 5C3MA 1GPJA 1I2CA 1HDCA 4MPDA 5ITWA 4HFRA 1XDWA 4M86A 3WMWA 5T64A 4A73A 2UV8A 3BTVA 1F8GA 4RZHA 5JDCC 2C07A 3JQ6A 3LF1A 4RVFA 3U09A 1A27A 4JIGA 3G3EA 3GVIA 1DRWA 1Z75A 4N5LA 1R4NA 1E7RA 2YFHA 3RROA 1D4FA 4FS3A 2W2KA 4FBGA 2IXBA 4XYEA 5IAAA 4XYBA 5B1YA 1O8CA 2OUIA 1RM4A 3WTBA 5L53A 1N1EA 4FGSA 1GY8A 4IJWA 4CLXA 1HDRA 4OXYA 3HDYA 1Y7TA 4IZHA 3ROKA 4LRTB 5JXWA 1N5DA 4I5EA 1UXHA 3AY3A 4GGPA 4NI5A 1K6XA 4PG5A 4RVDA 1JVSA 1Z74A 4ZJUA 4EDFA 4XDYA 4GQAA 5JDCA 3O38A 1V6AA 1YVEI 3RI3A 1IZ0A 5THQA 1P31A 1MA0A 2FHSA 2Q1TA 3H6KA 3V1UA 1GDHA 4QQRA 4D7AA 2C2YA 1ZFNA 2QQ5A 1ZKMA 3KYBA 2EV9A 5JMWA 1YS4A 3RU7A 4YJGB 3DZKA 9LDBA 4BNHA 5F1OA 3DZJA 3PYXA 4P38A 4YAEA 1ZEJA 2ET6A 4OSOA 3PQDA 1ONPA 2WSBA 3OEWA 4DMMA 2D5CA 2ZYAA 3AJRA 3HZZA 5KVVA 4WLNA 4NJMB 4J9UE 1E5QA 5GY7A 2ZQZA 2X0IA 4BGUA 2HJRA 3ZWVA 2C82A 4E5MA 1Q7BA 1DHTA 2JFHA 5DN9A 4RDHA 2O4CA 3HFGA 5EIOA 1BW9B 4RPHA 3NV9A 3NT5A 4B4WA 4BNLA 1LSOA 3KV3O 3Q0EA 3CKYA 4LVCA 3SC4A 3EUWA 3TFQA 1IOLA 4IPTA 3HN2A 1O0SA 4TSKA 3DQPA 2WYVA 4EBFA 2NU9A 4ND5A 4YB8A 3VAZA 4W99A 4GBJA 1VSUA 1PWXA 4S1VA 5G0VA 4TRMA 5L95A 2OZPA 3UCEA 4BO9A 3UN1A 2EKPA 1PZEA 2F00A 3PRJA 1KY4A 1P1IA 1IULA 3I3OA 3OMLA 4PG6A 2BLLA 4J3FA 1OI7A 5G0SA 4D3SA 1NR7A 1FDVA 2D1YA 1J49A 3WX0A 4KTTE 4GL4A 3PHHA 4K6FA 1Y9AA 4R1NA 2WYUA 3JQ8B 5LCXA 4FFRA 3BZUA 5TJ9A 4K26A 4CMGA 2WD7A 1IPFA 3BYZA 3SBOA 3ZHYA 1A4UA 1E3SA 2V6GA 3EVTA 4W6ZA 2Y0EA 2J6IA 1YBMA 3N7UA 3FCOA 4XRRA 4BKOA 5TRTA 4BO1A 2GO1A 4O0LA 3D64A 4M1QA 1ZK2A 2NQTA 3NTQA 2DVMA 5JYDA 4DBZA 4DC0A 2AMFA 3JYLA 2NVBA 3K31A 2DTEA 4WGGA 4Y67A 1U3TA 1SB8A 2AQHA 1B14A 3MTJA 4ZU3A 4I1IA 1PGOA 1W4ZA 1EUZA 4BB5A 3PQEA 4I08A 4EI2A 4D45A 4XGIA 3K30A 1VM6A 4AJLA 3C8MA 5TQVA 2UAGA 3IIEA 4WOJA 4BNMA 2OL4A 2Q1WA 3T7EA 2B83A 1LLUA 4AJIA 3D5TA 3NDJA 3HDQA 3OICA 4L74A 4QFCA 3P2OA 1LA2A 5T6BA 1JTVA 1T2FA 3RJ9A 4KUGA 1CYDA 4CL8A 1LTHR 4WEOA 4IIUA 2IXAA 2CF5A 4KZPA 2YW9A 3ETGA 1U5AA 2H9IA 4BL5A 5C7OO 4BNZA 1LLDA 1BXGB 3S2FA 2PLAA 1PX0A 2FWMX 3DTYA 5BNTA 5B4TA 3PFFA 3L4BC 1ULSA 1P1FA 1E92A 1FXSA 1U8XX 2B5WA 2DAPA 3GDFA 3H9EO 3I6QA 3MOIA 4BNIA 5CDGA 4FJ1A 3AI3A 1RYDA 3LT1A 4OHUA 2CSUA 4IQ0A 4BNWA 3KEOA 2J5RA 4OXNA 2EGGA 3B1JA 3N58A 3VOSA 1AN9A 3KSUA 4QO7A 1SPXA 2GF2A 4PLTA 4D46A 1M75A 2AQKA 5JCJA 3KZVA 4LCEA 3DFUA 1GYRA 2ZB7A 2NADA 3AUSA 3D4PA 3BXXA 3DHYA 3LU1A 2G1UA 2VTEA 4PG8A 5CDYA 4YPOA 3PEFA 4IS2A 1HTBA 1HE2A 1PGQA 2W2LD 2Z1MA 2VWPA 3V1YA 3E5RA 2X22A 3ZH2A 4CR6A 3U4IA 5EESA 1ISIA 1NXQA 5JBIA 2FSSA 3GQVA 5TT1A 4GMGA 2OO5A 2BGMA 1U28A 1VKNA 5FI5A 3GVXA 4I9HA 3WJAA 1PS9A 2Y05A 1PJ2A 4TRJA 1IHYA 1I36A 3TF5A 4NFSA 2J3IA 1PR3A 3PXXA 1EVIA 1I3MA 3AI1A 2OHXA 4L76A 4Q39A 1QR6A 2BMAA 5DF1A 1GUZA 3TOZA 1P45A 4NFYA 3WB9A 4ITUA 1JQBA 1E3WB 2I99A 2O48X 2QX7A 2P4QA 2WDZA 2JCYA 2PV7A 4BNJA 3LLSA 4BKPA 1KETA 3OEYA 1C0IA 1LDEA
chains in the Genus database with same CATH superfamily
4I5GA 3GXOA 1D07A 1YB2A 2QG4A 3U7IA 1GV1A 3HYTA 5IKPA 3U4HA 4WWHA 4QUDA 1UT5A 4OGFA 5JNTA 1XLVA 4EVQA 2PBFA 2IYQA 1E9VA 1UANA 1LQ2A 4J07A 2O0HA 3UJ9A 5JSKA 1NIJA 3GJ8A 4BCDA 3K53A 2ZS8A 1UC5B 3QOYA 1RYYA 2XWSA 5FTMA 3B7GA 4PZEA 4CKYA 5JECA 1V0JA 1N34B 3LQYA 2DPGA 3UOWA 2HXSA 3ZBTA 4TXJA 2X0FA 3QKSB 3KE8A 2BFPA 1KTVA 3QVJA 2P2LA 4QYXA 1CUFA 3P7MA 1B42A 5I7UA 5F9HA 2HLDD 1G21A 3CUVA 3H7AA 3PGLA 5REQA 4G5SA 4D80A 1PTJC 4WLOA 3ECSA 3RRZA 1KOGA 3R4CA 2MINA 4PF1A 4OB6A 3CGGA 1VLHA 3SX0A 4AQDA 3UUFA 3WGQA 5HWSA 2RI6A 2RCNA 3HLTA 1HF3A 1P2BA 2C58A 4Q37A 4RANA 1U7HA 1SEPA 1ZGGA 4ARCA 3NU1A 4JP5A 2Y76A 4TVOA 3UJPA 3T7IA 3TSZA 4F60A 3K73O 1G1MA 1IM8A 4G41A 3TLYA 5HRUA 3UWOA 3IKTA 1QZ3A 2A9KA 3FMFA 1UXJA 4PLCA 3TSWA 4US0R 3TFOA 1E4VA 4MUYA 1XTPA 2QUBA 4BZPA 5K51A 5EL0A 4LMAA 4CQMA 5F1YA 1XQ6A 3DW1X 2HR1A 4MGYR 2Q0QA 4OHZA 1UMDB 2X13A 4BCCA 1I2BA 2HDHA 3IP9A 5C81A 2AJDA 4UCFA 1HH4A 1I4DD 5EQFA 2PT5A 3LBNA 1KYTA 4KNYA 4JJZA 2VHCA 2PTGA 4R8RA 1RRFA 5DKFA 4QVKA 1K7XB 5B6PA 1LV8A 3CTMA 4UU0A 5C7YA 4B3JA 1J00A 1SO8A 3W04A 4ZYUA 4D9GA 2Q29A 3KLOA 1WTAA 3E3LA 3IRVA 1KI6B 4DDMA 1EKXA 1YRLA 2C4UA 3VR2A 4M3NA 3E61A 3LT5A 4M54A 1LSJA 3IR5A 1OY1A 3I2YX 2XR1A 5BV2P 3A3KA 2ANCA 3PIRA 4TZKA 4L8YA 1RR6A 3HN6A 2DM6A 1Y6JA 1M7GA 1M2WA 2VZEA 3H2SA 3PG5A 3UT5A 3NETA 3SR4A 1E3LA 2OZKA 3QENA 1C9JA 2CLOB 5C53B 1A95A 3STUA 1A9ZA 2JIDA 1YBAA 3AYXB 1E66A 4KOAA 4DSNA 1A8HA 2ZCVA 1JIKA 5B3AA 4D79A 4B81A 1ZUIA 4BFLA 1K3UB 3II6X 3M2PA 1FU8A 4O1MA 2G8LA 4QG3A 3FWHA 1TL7C 1FMCA 1PFYA 2BSQA 5I5GA 5FV4A 2P8SA 5KNLA 1IN7A 3T3DA 3BGVA 2A0YA 3KKZA 4X84A 5ALQA 1NG9A 2J45A 2FN7A 4LF7B 1Z0ZA 4EPVA 5JZBA 1A69A 1OILA 1KARA 4M1YA 5EZ6B 1E4OA 4IIXA 1MFZA 3CURA 1U0LA 3UMBA 1AXRA 1ESDA 3B6KA 4H16A 4WXEA 2WE8A 2P6MA 5C0OE 1G5HA 3WFIA 2GJAA 2FPSA 4Q9HA 1XAJA 3FDIA 3R7FA 5LP6B 1KO7A 1IY2A 1XVIA 5DLYA 1U7DA 4NZZA 1JTEA 3KTAB 3D6TB 5AXDA 1L5GB 1XPUA 2HCRA 1ITZA 2FCRA 1DCTA 1Y9ZA 2YQ5A 3HUEA 3AVPA 4DIDA 2W6MA 1E1NA 4Y9TA 2TMYA 1WUYA 3KEFA 3ANSA 2WTAA 4INAA 1GEEA 1JZSA 3V97A 4P4SB 5ED4A 3OU6A 1VGQA 1ORHA 3CFYA 3DR5A 3LYLA 2E55A 4PZ9A 4XIFA 4D4JA 3GA5A 4REOA 3R3XA 4H3HB 3QVXA 4UBJA 1P73A 2Q4EA 4BP8A 2G07A 3H83A 4AROA 2UYOA 4XJXA 3INTA 4MAFA 5TVKA 2IELA 4L3VA 1NVDA 4AJ4A 1TCVA 2Y3IA 3U1TA 4BO8A 1R0SA 3VBCA 3O3CA 1WCYA 4IDOA 4ENUA 1ESMA 1OWMA 3MMSA 2PLFA 2XVYA 1LVGA 2GKOA 1H2HA 1QYDA 2CMHA 5AW0A 4MHSA 2AQ8A 3VKUA 1ML3A 3KB6A 2J3MA 2IWHA 1DO0A 1DIBA 1WXWA 2I65A 2VDWA 3JQGB 1T8YA 1Y1TA 4M89A 5EJFA 1X8KA 2NT3A 3RG8A 1M6EX 3KR1A 3H8SA 1XJWA 2I7CA 3GEHA 1G3RA 3ENKA 1NQWA 4FGJA 4QDJA 3AR5A 3RQSA 3PNLA 2AVNA 5DYNA 2G28A 3FMPB 2LP4Y 1T9ZA 1ZLYA 1QQBA 4IJVA 1EXMA 2VSYA 1F8XA 4LVOA 4ARUA 1KAHA 1T3SA 1E4YA 2KPOA 3WBJA 2L17A 3GUCA 3VTFA 4BB6A 3WYEA 1T1RA 3H13A 4NONA 3SDZA 4C1NA 4N7BA 4ZJPA 1J8FA 1Z6TA 2BMJA 2UUCB 1FYDA 5LWQA 5B1IA 2DHQA 4PTLA 1WMAA 1HA3A 1XJ0A 4P4TA 1G63A 1H22A 1PNVA 1T9HA 4GLFA 4JROA 2Q6IA 3EXHB 3KO8A 1S9HA 3V8VA 3IUPA 3LHFA 5GTDA 3QVLA 4G1CA 4YJGA 3AEYA 2JS7A 5ALNA 1KDVA 2CHFA 2JLSA 3RLFA 3WJ7A 1PWEA 3BS4A 2TYSB 4GQIA 3GK3A 3OCZA 1NX9A 1OPRA 4BJHB 4KXUA 4QRDA 4RULA 1OIVA 1KP9A 4I1RA 1Z17A 1UFKA 2QTCA 4IH4A 1UPCA 2GBCA 3R3HA 4I0WB 4HDKB 5T5QA 4DCCA 1GO2A 1NRJB 4UPEA 2ZETA 4M99A 4EITA 3JX9A 3I6BA 4DV0B 1ZK4A 4G56A 2QDXA 4BIMA 4YRBA 2IEIA 4C05A 3TL6A 4Z9BA 3WLSA 3L6BA 3Q2KA 1KJ9A 2NZJA 3JRXA 2IP2A 3M4XA 4K28A 4OYLA 4PV7A 4B71A 1P2DA 2I34A 2UYQA 3MJEA 4XIJA 3THWA 1HFWA 1HUQA 1KAGA 4HFNA 4TWBA 4XVQA 2ZAIA 2YINC 2JJQA 4M9XA 5IJWA 1KFEB 1O0CA 4RA9A 3A4IA 1OX4A 3HNRA 5DJ5A 3G8DA 2BWJA 1EFRA 4LRQA 3D8HA 1KOFA 2NP6A 5EXPA 5L3VA 2DXIA 1CC1S 4TMXA 3DKKA 2H57A 2WP8J 4WCDA 3PE4A 721PA 2VBFA 1T26A 5AHOA 3LPAA 5IF3A 3AUAA 3K0BA 2WU8A 4UVHA 2TSYB 3DKVA 2H2DA 1OGJA 4JYBA 4FEAA 2ZR8A 4WT7A 4YGXB 1J6UA 5H1YA 5ELXA 1HNZB 3U0BA 4YXFA 1KZ6A 3QY9A 2RG7A 2I2AA 2NM0A 4P3KA 3LIPA 2O5EA 3E18A 1X7ZA 2PKCA 2RHCA 3B5EA 5HR5A 5JZ9A 3V7NA 1DJMA 3PC3A 3F74A 2F1OA 1CERA 3CEAA 3G5TA 2GUGA 1RYNA 2VTDA 1IDOA 3EK2A 3EEQA 5HKAA 2Z5VA 1WKVA 2ZS9A 5HF6A 3E3AA 4G4SP 3CGWA 1QX3A 3G9QA 4P5DA 4YA6A 1WSDA 3VZPA 3DD1A 5TVGA 3S2IA 4W5NA 2EOAA 2ZYUX 2W42A 3GDWA 1OBFO 3GDHA 2P79A 4WUTA 1RPZA 1BGXT 1UKYA 1JHVA 2IDKA 1DIOB 2Y99A 5LA6B 2JL1A 5SY4A 5EHZA 1W7AA 2BM8A 4DRXA 3W5UA 1E1QD 3E22A 3B5IA 1PLKA 3KKLA 3TKLA 1MO6A 4LOJA 2V0GA 4FQ8A 3L7CA 1I24A 2OILA 1V1RA 1TFUA 3M4ZA 1EJ0A 1PR0A 4I2NA 2Y1XA 1KDTA 4WZBA 3CVVA 3PFHA 4LZWA 2QT0A 5EP2A 4RD1A 1NG1A 1QIMA 3R3UA 1AS0A 1GSHA 2IGTA 2NAFA 2ZUSA 3DLPX 3L7YA 4V0ME 1HZZA 4FZRA 1PDVA 3A9WA 4I8XA 1P29A 1DEAA 1G17A 2JGLA 1TM4E 3B6IA 4JA0A 4PPNA 3TSYA 2UYGA 3AK4A 1KGDA 1Y8QA 3FPJA 4BX3A 5ICEA 3LUFA 1VKJA 1N4DA 1Q7EA 1R0KA 3ROPA 2WAYA 4DLVA 3GLSA 4OSPA 4D96A 1TJ5A 4EQ6A 5HKKD 4G9BA 1K6MA 4PPYA 3MB8A 5CHEA 3SYLA 8ABPA 5FO1A 3I61A 3R74A 4NJOA 4LZAA 3MINB 4M37A 5CT5A 3ZZ1A 5U4QA 1ZI9A 1ZRNA 4N3GA 1IZ7A 1T15A 1KZGB 1JEJA 1EG7A 4GE0A 5DDIP 4IWYA 2HWWA 1TKBA 4M0MA 3HZRA 3UWSA 5EMLA 3R7LA 1YQEA 4X6LA 5J5VA 4QGSA 3C7CB 3GUZA 3MUFA 2NU6A 2RKOA 1Y5NA 4HSGA 4FSXA 1WZNA 3KDSE 5FA5A 3SYTA 5ERYA 3UG7A 4BGVA 1RACA 3X1DA 4QPJC 1MJGA 4F4UA 4F71A 5A3JA 3W5BA 2B1RA 2VYVA 2KLHA 1X77A 1RQ2A 4S3MA 4D0RA 2QMEA 4N8EA 1E79D 2ZCJA 2CV2A 1D2GA 2OBLA 2VDVE 1FFBA 2WM8A 4B6GA 1W4AA 4E2YA 5L3SB 1Q0RA 1PHRA 4XW2A 1SURA 1ODLA 2FPGA 3A37A 4WVLA 1KJQA 2WEKA 3AMVA 1RCTE 2F62A 1NMXA 4GRIA 5LZ9A 4GM0A 3BMCB 3GRCA 4Q1FA 5F2OA 4ZVMA 2W2MA 2YASA 5K6RA 4ZODA 5I9NA 3I5XA 4GSKA 3DVQX 2CWWA 5JVDB 3ZLBA 1U1CA 2WU0A 4ZDWA 3UIEA 4LV5B 2I6QA 4JB2A 5DVZA 2V7EA 4Y0VA 2FDCA 4DR6B 4GVXA 1GLGA 3QVOA 2M32A 4QDKA 4DDUA 2II6A 1SEVA 1YA6A 4L4RA 4RLSA 5A0FA 1MC5A 5A9RA 2RHDA 3B3QA 4CUKA 4PVCA 4BQRA 5HUQA 5CB4F 8OHMA 4M9RA 2PKRA 2IUSA 4TUYA 3RSHA 1I3CA 1IQUA 1NT4A 1WCV1 2QAIA 3BZBA 2ZBVA 3R0ZA 3QGMA 4HUJA 3GVPA 4OQZA 3Q3CA 1NOIA 5SYNA 2NYAA 2QX6A 5D86A 1RBZA 1QP0A 2Y1OA 3LV8A 3QPAA 4H7DA 3I76A 5AJVB 1QFXA 2Q5JA 3R6GA 1WOMA 2HWUA 4QDXA 1GZHB 3ZZ0A 1UUFA 4QGFA 2CEKA 2HU2A 1XU9A 1Y1QA 1V6CA 1YTLA 1H8HA 2IYWA 1M1UA 2HTFA 3LCVB 4U7TB 3VYRB 1ONSA 4TQGA 4DRYA 5I4KA 3UKJA 2XGOA 3RC8A 4LZLA 3MLEA 3BL5A 5HGJA 1FVXA 3DEJA 4BVLA 5DYIA 4ZCTA 6YASA 3X1JA 1QWSA 2OHVA 2ENWA 3DLTA 3EDOA 3NP9A 1B1CA 3GHYA 4L4UA 4B3TB 3HEBA 4MWGA 4CJXA 2EBWA 3VI3B 2Z2XA 3V3TA 5JUWA 5TMPA 3U7GA 3L8ZA 1Y34E 3TFWA 4OQEA 3IUSA 1O03A 1CUHA 2DBVO 2GYWA 3WB1A 5KNCA 2JLAA 4KK4A 5FNVF 4JFAA 3IIMA 4M1SA 1NGSA 1F0YA 5I3ZA 1OX6A 2HMTA 1B2RA 3QVGB 4QOGA 4P7KA 3VH2A 3K8OE 4IXMA 4IS3A 4D41A 3EGDA 4OHYA 4NMMA 1RXYA 1SUBA 3IULA 4BJ6A 3MXOA 1DBSA 3OFVA 3WZLA 3QX8A 4FGUA 4DVJA 3ZGXA 1AKRA 1EZ1A 1KIAA 3ZIAA 3F67A 1ONNA 2P1RA 4QG7A 3JZFA 4MPJA 1ORDA 4FMDF 3TI7A 4DN6A 3H5TA 1CWUA 2C2ZA 3G1TA 3BFXA 2QV0A 3I53A 3EPHA 3K0CC 4FEYA 4DLKA 3A14A 3GFTA 1EFTA 4I46A 4N3AA 2V7BA 3FVVA 1L7XA 3MWLA 2HAEA 4ZK2A 1G0OA 3L0OA 2JCBA 4LZNA 1A7KA 3V7FA 2FU5C 1MX9A 3VISA 2E4AA 1M6WA 1VJ1A 4YAWA 3RTDA 5BOSA 6ADHA 1W8IA 2AOWA 3G0HA 5IMSA 1W6UA 3SC2A 1EWQA 3IP3A 3RS2A 4H6WA 1ECGA 1M2KA 3SM3A 4RD3A 1OB2A 2GN6A 2ZREA 4FN4A 3Q8KA 2IE8A 4U02A 5KYXA 2YTZA 1N6OA 1XLTA 4MEAA 3EYWA 3E6AA 3R0QA 4LGMA 2G72A 4D9MA 3ZY4A 2P5UA 3DO8A 4FNAA 4EUEA 1QCCA 2VJOA 3UC5A 4MB0A 4Q3OA 5KINB 3EOBI 3VH1A 4M98A 2AX4A 3STXA 2BJHA 3TRJA 2WMOB 3F6EX 1GN8A 1TZJA 1ZJ4A 2XB9A 3G2MA 4F06A 3AEZA 1X9GA 3HB4X 4J3NA 1WSAA 1KE1A 4URWR 2JHAA 4EYSA 3AUFA 2JZOA 4UAGA 3U17A 2J9FB 2QTFA 4MQ5A 1U63A 2VPYA 1DX9A 1HSOA 5ALRA 3WKEA 3HWSA 3N6RA 1J0AA 1X39A 1C4XA 5DBGA 2ZK7A 5AQEA 2GZ2A 2VYFA 1BH6A 1PIWA 1G9TA 1ST2A 3C8HA 2DTXA 3W78A 2Q2VA 5G1PA 5DX1A 5EIFA 3QMMA 3EW9A 4QDZA 1B4DA 2XHZA 4KIFA 3FSGA 4GPAA 4QPZA 4RK5A 4QEZA 2JLUA 1SBZA 1AJEA 1GT91 1Y8CA 4P8RA 3C3KA 1BA3A 1Q92A 5MGNA 4B7CA 2DR3A 1WV0A 4WCFA 3CEPB 4DPMA 1U1FA 3PF8A 4NE9A 1ISHA 1FS6A 1S8OA 3PI7A 4LNUB 1QHSA 4YROA 4Z8YA 1WXDA 4D8TA 3WYBA 3PHJA 4MYDA 2WSSA 1HXHA 1XA0A 2IHUA 3DJFA 3KJEA 5CLHA 3RYIA 3SSOA 3KYCA 4HDNA 4QE3A 4M0CA 2ZR0A 5HBRA 2XUHA 3GG2A 3KVRA 1UPUA 1EVJA 4JS0A 5JAQA 4EUKA 4MS1B 5FWNA 3U3KA 2WPNA 3OCXA 2Q6LA 4TKLA 1M8GA 3MPUA 3T9AA 3ACCA 5EZYF 5JNWA 4L8VA 4ZZ2A 4S1TA 3D8RA 5I48A 3U56A 1YOVB 4DQVA 3ER8A 4W1SA 3AY7A 1L3BA 2I6TA 1W73A 1WLSA 1FDRA 1K3TA 1NBEA 2B99A 2XY4A 2P91A 3DQQA 4R2LA 3TZQA 1NMSA 1YZVA 1Z15A 2PMDA 3S29A 3PQ2A 5A5GA 4R4JA 1H1LB 4QGHA 3PNYA 4H7KA 2RJNA 1HNXB 3ST7A 1IATA 3ETCA 5CH8A 4KOEC 4GW3A 2UKDA 2QP3A 3HB5X 3ROZA 2WJJA 3C3MA 1V26A 3G59A 2HIMA 3MELA 4PRLA 3MWEB 1I6KA 3W3AH 4AJKA 4X8OA 4ZIRB 4S24A 1CPYA 4Q3DA 2JLCA 1FX0B 3OOJA 4XTRA 3TZKA 4S35A 1PBNA 4KQFA 3TAXA 3ZD9A 3EDCA 1PVOA 5D85A 1YZ3A 4QXMA 2Q3HA 3KUKA 1EJ6A 4R8KA 1NONA 1QSGA 3VTZA 4ECAA 1X9IA 5ADWA 2X9LA 2XHEA 3LUPA 4E03A 2OXRA 3VR2D 1ID8A 1SHLA 1YT5A 1XRRA 1B74A 2I67A 4MINA 5SZHB 3EVBA 2HJGA 1LTQA 3ASYA 3IIIA 3NEYA 1T5HX 1X7YA 1L7AA 1E89A 3JQQA 2HV8A 4LFAB 4GLBA 5JD5A 3RYHA 4DLLA 3FFXA 4L0QA 1VIDA 2WD8A 1GR0A 1ZVKA 3GOQA 4DZRA 2RGGA 4HZUA 2SCUB 5GINE 1CXZA 3LWZA 4GI2A 4S1OA 2XCLA 3O8QB 5BRNA 1ORWA 2J59A 4TN1A 2BFFB 5SY9A 4YJHB 4ZOLF 5JJ5A 1U0BB 1CRPA 3FBWA 1EDOA 4X93A 1DBIA 1H2FA 1KRXA 2ZSDA 1SCKA 1UMCA 3DM5A 5H5JA 3KEQA 1SUIA 2R8RA 2B94A 1V37A 1KJIA 3MLAA 4Z54A 1CUCA 3NMUF 3OF5A 2GAFA 3PIDA 5CGQB 3KOOA 1EIZA 3QPWA 2MDTA 1HWYA 3ROTA 3ZDBA 3DWGA 2F43A 1HYHA 2B82A 1BRTA 2B8WA 3GEMA 1XF9A 3GJYA 3HCNA 2WG0A 3PNMA 2BZSA 1Q0ZA 4OH7A 4C0SA 5JS8A 1UAAA 3N2KA 3QKIA 1BVUA 2N9UA 3TR0A 2OM2A 1GCUA 1QV7A 3AJAA 1U8FO 4JI6B 3ITDA 3MIZA 4WUVA 1SVKA 2XA9A 2PZAA 3GLHA 4BMYA 1UWKA 1V3QE 2QMUA 1E6WA 4LISA 3VVMA 3I9OA 4NXNB 3AFHA 1U9ZA 3M9XA 3FETA 3GFFA 4WFJA 4HH4A 1M6VB 3GCWA 1JR2A 4UBKA 4X85A 3ZX4A 1G42A 5JFTA 2JFPA 4QVIA 3QWAA 4ZCSA 1FK8A 1P33A 1U5BB 4M83A 1HDEA 3E7XA 2WTNA 4R1MA 4YMSA 3H4TA 1T9CA 2PR7A 4EHKA 1R0XA 4X20A 2BR5A 3D4OA 2BP7A 2R5FA 5GONA 2EJUA 3WVNA 4CV0A 3WLRA 1MIOB 4DUGA 4YRSA 3OF3A 3RVMA 1YD7A 5F21A 5L45A 4IF4A 1VTKA 4A23A 3IMCA 4XB2A 4TQ9A 5FQNA 4C3VA 2VO1A 4YBRA 5C32A 5JFOA 3KAJA 2ZSKA 3G49A 4FR2A 3TD6A 5B12A 1NXXA 2V6IA 3G2QA 4R81A 3FYUA 3TIXB 3JQ9A 4LAFA 3ZLVA 4BMVA 4IZOA 1E62A 1GM5A 1FYWA 1GZ4A 2OBBA 5BN4B 4DV2B 3CC8A 4KAJA 3F6PA 1NR5A 1RAFA 3QA9A 1J8DA 3G9TA 3PDHA 5JRJA 1G1AA 2HA0A 3K6SA 1GEGA 4EZIA 3JXEA 1C9MA 4GPZA 2BZ0A 2EFHB 2C5FA 3QXJA 4DLUA 4JZKA 4KIUA 5ALWA 5CEFA 2WVAA 1T9BA 2QV7A 4JDPA 3EGWA 3NKLA 4Q9NA 2GUWA 4EA9A 1NFQA 3H2GA 2FW0A 2GD6A 3D5QA 4L07A 5C1IA 3VPXA 1T4CA 4TTAA 3ZKWB 1VSTA 3OJWA 4EKNB 3G0OA 1GFZA 2XMCA 4HAIA 1NXOA 4J6FA 1NUHA 4JD5A 5EZQA 2GTPA 3RBZA 1SQFA 2O07A 5ALGA 5CH3A 4Z49A 1C7JA 2JF0A 2QZ9A 3UJHA 1IUKA 4J1SA 4K3UA 1SVLA 1UBCA 2GM9A 3I9JA 3WJ2A 3ZXSA 4B2LA 4EPYA 4OATA 2AR9A 3FNFA 4JHXA 2B8JA 2QTMA 4KQIA 2JK1A 2XITA 2H1LA 2O3UA 4E4RA 4XRGA 3D6HA 3WGLA 1VMEA 2PL9A 3W6NA 5G1NA 3ZCVA 1BSVA 2WU3A 1JBKA 4QU0A 3VGPA 4Y6RA 1DAEA 1AB5A 1NBMA 3PLRA 5AI8A 4TXLA 3AEKA 1QFYA 4OK3A 3R7SA 3IDQA 5CGZA 1KK2A 1ZD2P 5HJ5A 1G9XA 4G81A 4CWAA 2C4WA 1AIPA 4CF6A 2GEKA 3RFUA 3WL4A 4R3WA 3IEKA 3DHEA 4GDFA 3MJRA 2VYCA 4Z9XA 3TLAA 2WKSA 1T36B 3MMPA 3H7IA 2XXBA 4TKUB 4R8VA 5FF9A 1EM8A 1EVQA 4Y30A 2DUNA 3SJZA 1D8TA 3WGHA 2GZ3A 4LYAA 3WK6A 1OD6A 3SJBA 1OZGA 1ZMOA 2XTAA 1G0NA 3M70A 1VL0A 4RK6A 4E30A 3OEHD 4KO8A 2SKDA 5BYAA 1MR3F 1V5FA 3I64A 3BH0A 4H7EA 5I9TA 3WC4A 2I03A 1DU4A 2VYND 1NBHA 2JH3A 1R6AA 5GPBA 4FFMA 1FLNA 1TQ8A 1CR0A 1N5MA 1X70A 2G25A 2XUFA 3AHGA 2ID8A 1L7QA 4IQ8A 4R41A 2Z30A 5MN4A 2GXAA 3W6UA 1RHKA 4J16C 3WIVA 2AHOA 3CUSA 4KIGA 3FRHA 2IX3A 1FDSA 3BCUA 1QVVA 1T3TA 1Y81A 1SPBS 2IF0A 2P9HA 2O1EA 2WJ4A 4AF7A 1NVMB 3REQB 4CM7A 1GQ2A 4IFBA 5AJUA 3UA3A 3DVSX 2DLCX 1MG5A 4D3ZA 1MPXA 4ALJA 5BVGA 2FX3A 4YJFA 1YHNA 3ONFA 3KLMX 2HNBA 3NANA 2WMYA 4KREA 4GPTA 1CUGA 5AKKA 4FT2A 1L9KA 1T1IA 2XA1A 2HCTA 1XZPA 2P2CA 3EASA 4MWZA 4EFNA 3M6IA 2JA2A 4NU0A 5DFAA 5EN4A 4BNYA 4Z0HO 1JR3A 4YRRA 3T5CA 1ZPDA 5A7FA 4Q9KA 1U1IA 3IBCA 3LX8A 3B82A 4MRPA 1DEHA 3F6CA 2IZ5A 1YR8A 3GGSA 4CIAA 1ADFA 4AZVA 2O1WA 4E5NA 1E2DA 2XF8A 5GWXA 5JW6A 3BCSA 4M9UA 3OA2A 1GGVA 3C97A 2C2BA 4FOLA 2XNCA 4P54A 4EJ2A 1GPWB 2GPAA 5JQGF 1A72A 1CNFA 3KWMA 5K0LA 4E94A 3MSCA 1RHQA 4MUAA 3VUEA 1ZMXA 4CMEC 1XEXB 3R5FA 2X5KO 3DZCA 1JI0A 2GCOA 3U0VA 5ALFA 2AYXA 1GQYA 3I0MA 3WLQA 2Z5GA 2B9EA 1Z63A 3AFOA 5HF8A 3OLZA 4HN4B 1Z26A 4R84A 1AKTA 3DOFA 1SIUA 4N76A 1J25A 2IPXA 1C3OA 4F9EA 3GJQA 5JYBA 3PDIB 1JEDA 2HMWA 1ZNXA 1QIFA 2OHIA 2VP6A 3IO3A 3N0TA 4JWTA 4MB6A 5DXJA 5E6RA 3RJZA 4EA6A 3QVSA 2WUWE 5C7LO 2WU1A 4NPHA 2WR8A 3PPXA 4P4UA 2VP9A 3FXAA 5FT9A 1DBVO 2EZUA 3LQ4A 1OV6A 1PG2A 2VXYA 3ROFA 3TQRA 3ENNA 5CDFA 3BC1A 1KDRA 1THTA 1V35A 2IEBA 1HI9A 4P98A 3RD5A 5JBQA 4YXWA 5JALA 5BMVA 1TA4A 1QH1A 4URVR 1UZUA 2RMKA 1SM4A 1EE2A 1ECJA 3C6XA 1LKZA 1V8ZA 4TLEA 5T41A 4UM9B 1DDOA 4DQLA 3RC7A 4AWAA 4US1R 4W7HA 4E5UA 4CVNA 1MOPA 1MPTA 2DMRA 1O3YA 1A97A 1RYEA 1GPDG 2DQKA 2OFOA 4DMLA 1AV6A 1SHUX 2Q9UA 3STVA 5F4BA 3WK7A 4YRMA 1L5QA 1USGA 1DOZA 2FSVA 1RI2A 3P27A 1R8JA 4JAVC 3KU4A 1UK8A 2CD9A 3U40A 1K3FA 5IXJA 2C94A 5E0KB 1VXRA 4HNSA 3MMXA 2RGUA 4L8FA 2PGLA 3CJRA 4RIHA 1ZO8A 3T12A 1RDFA 4IOMA 2GPBA 4S12A 1XO1A 3DOIA 3OVMA 4WERA 3MTGA 2D0IA 4EJFA 1M6HA 4RFVA 2HPAA 3ER6A 2VPPA 2PHZA 5EVCA 5CIYA 1XDGA 1SR8A 4UM9D 2XUGA 1SCAA 4DB4A 3M1YA 2QTAA 4KMSA 1ZVVA 4UAUA 1XZBA 3DVAB 1BEZA 1IEXA 4AX4A 1M5TA 1NP7A 3B12A 3LI2A 5WRFA 3BWCA 4B4OA 2V6BA 1H66A 2A33A 3EDYA 3BQMB 3UVEA 5C5EA 2PMKA 3QJGA 1YZHA 4M9QA 4C9BA 1M33A 4MUEA 3O03A 2YXNA 3G0CA 2Z95A 2HHHB 2NMVA 3TS1A 4IHKA 3INYA 4RV9A 4BVHA 4JBYA 2O14A 3C24A 3FN4A 2CNBA 4H0CA 4V03A 1J99A 1PG5A 1W5FA 2Z5LA 3L6CA 4KJZA 1B7GO 4O2AB 4PZLA 4ZDJA 1CDEA 1H2XA 1IYZA 3QVMA 5G2OA 1PT8A 4AICA 2X2EA 4DR1B 1EGQA 2N1MA 2QVZX 2A78A 1HMYA 2D5AA 2D8AA 2ZRCA 3N8KA 5BSMA 2JLXA 3QELB 2ZPUA 2NO1A 1Z8FA 3PZRA 1LQTA 1VBNA 5KI6A 1RRPA 1XTVA 1N1GA 1YQUA 2H16A 1V96A 2W00A 3CG0A 3KSDO 3PGVA 1YZFA 1DG1G 4WBSA 1IEQA 5DYGA 4D43A 4DBLC 4Q4DA 3QM1A 3HJGA 1GU0A 2D00A 1I2DA 2NZYA 2ZAGA 3HYSA 3VVLA 1ZMBA 2VHZA 4NESA 4N9QA 4DMHA 3L4EA 4DOMA 4MH0R 4O1IA 1U7UA 2JGMA 2XTZA 3SNKA 2V58A 4MQ6A 3MJFA 3QUTA 3TTYA 2Y1DA 7ADHA 1WZCA 2PGOA 4Q05A 1E2FA 1DBRA 1QGUB 2GCPA 1D09A 2WTMA 3MMZA 4G37A 4YCBA 3JQ8A 4IFIA 1MHPA 1L4FA 1PP4A 1MH1A 2UVPB 1DS6A 3EA0A 2RGNC 1EB8A 3T1TA 5BN3A 4EW1A 2QQ0A 1HDXA 5IJ0B 3USCS 2CLCX 1VLMA 1UBOS 1Q22A 4N5NA 5DCWA 5T57A 1K0UA 3RASA 1ZJJA 3SVZA 3VR4H 3HI4A 2R9VA 5AVQA 5GADl 4OMUA 4LJLA 3CUTA 3IKMB 1EWRA 4KQMA 2VJPA 1BXRA 3E9YA 3KDAA 4N8SA 3LUGA 2F8MA 1MNAA 4WH0A 1QB8A 1Z4JA 5CCDA 4YAKA 1IBKB 4HDSA 4A2QA 5L3RA 2EX4A 1FFAA 4KL8S 2PR2A 4YYZA 4N0DA 2YHIA 1GZDA 1J5PA 2J09A 2RHBA 3V4PB 1YQ9A 2DUJA 2H1WA 2YJ4A 3ZVLA 1LRLA 5AM1A 3WGZA 3ERCA 4Y18A 1DUIA 1QB7A 1T3ZA 4YO8A 5EWLB 5HFJA 1DQRA 5J4HA 1T13A 2GMWA 2W7TA 1YKSA 2YQ4A 4GOKA 1ZNQO 1SAYA 4IEFB 2FFBA 2XUOA 4BO5A 4R9SA 3K6KA 4NH4A 1VL8A 3O83A 1P9OA 3PQ7A 3QU5A 1UINA 4FLFA 5B7PA 5IYZB 1BMQA 1HLPA 1WU7A 2Y0CA 4RKWA 2QY9A 3RCBA 3B8HA 3UUGA 5BNZA 3V9PA 3FOCA 4LRUA 5JAOA 1ICIA 3MERA 4M1MA 1VPWA 1HQKA 1Q1QA 3PSAA 1W0KD 3BQNB 3LC7O 1S4QA 3GZNB 1BXGA 4V02A 5ER9A 5J23A 4Y3UA 4AG6A 3LFUA 3ZS9A 4Z7OB 1G21B 2GAJA 4XUEA 4OGWA 3DONA 5EA2A 2PXCA 4QTTB 2ZRDA 3BBPA 3ITNA 2W22A 3UV7A 2A5JA 5LB2A 3ZBUA 4N0EA 3TL3A 1UF9A 2CK3D 4WJZA 4TS4A 2W2NA 3DF9A 4HPXB 1R88A 3HJRA 2XNJA 2YXLA 4KMMA 3HU3A 1HYEA 1IE3A 3O8CA 3LOPA 3NNDA 3UQYS 1OV4A 2NIPA 1PD1A 4P80A 3WXBA 2BF7A 4BP1A 1RT9A 4YR9A 5CB6A 3DLHA 1BTOA 2AKYA 4GKVA 3SHVA 1C7FA 2BFBA 4D4LA 5KYYB 2JI7A 3VR3A 3I1YA 3DMTA 4N47A 4YC7A 3DBRB 5KX5F 3ICWA 1XMXA 4LFBB 2O0JA 2VHQA 1N6NA 2YYSA 3P94A 1QOZA 2RGYA 4ETMA 1AC5A 3ND8A 4WW0A 4PIVA 4Z9YA 5DP2A 3WRXA 4HV4A 3L8HA 4N0QA 2QTHA 2A3RA 2B8TA 2AXEA 5CLJA 1PT6A 4A6PA 4FFVA 4HWOA 4MUBA 5KSOA 1ODCA 4JYMA 4YUAA 5IT9A 5A5FA 1NAHA 2BI7A 1BGVA 2H29A 2ZJZA 2P11A 2I1LA 1ZZEA 3VC3A 1SG6A 2HLNA 4E5YA 4B1FA 4K0RA 4LJ7A 4Y6QA 3VNQA 1JNXX 5A02A 2C61A 6NULA 5HX7A 4A0QA 2FEOA 5K6AC 1JFTA 2NW6A 4INZA 3TZHA 4B6QA 4NCKA 1VL6A 3T52A 1KGSA 1M2VA 3VC7A 3ZE0B 2O3SA 2HWXA 4O4JB 2ZQYA 3GNSA 4BVKA 5INTA 1ZNWA 1EMDA 4N41A 4H6VA 3LCRA 1YQQA 4BQEA 3LDHA 4PN3A 5T4BA 1CHNA 3ISJA 3UTDA 3GLIA 1FQJA 1AHNA 2PA0A 2TMDA 4U9IS 1YVUA 2NG1A 2FRDA 1OLUA 2B5OA 4FR5A 4C89A 3WL3A 4K03A 2MSLA 1UXGA 3VDMA 1JPVA 5ALXA 1Q0SA 3NYQA 4JLWA 4WESB 1F7VA 1Y4SA 1TCUA 4PS1A 2DPHA 4RQTA 1KDZA 3W5HA 1JT9A 3EA4A 4B76A 1MN6A 2XWJI 3FWNA 5CBPB 3KCNA 4NYJR 5KSZA 2W2PA 1JECA 1JEQA 4CQLB 2VZLA 2VVTA 5DSZA 4ZZ0A 4LKRA 1XZAA 2GAOA 4EB8A 1GPUA 2FZKA 1A76A 1ILWA 4GDMA 4CKWA 5I4CA 1M66A 3ADDA 1EXNA 1RI1A 3TNYA 2LBPA 4GF5A 5JH7F 2XH8A 3HKEA 1I7PA 2HU5A 3A4TA 4LGYA 2GBFA 3BJMA 3WLHA 4ZEWA 4ALMA 1T25A 2A14A 2XMGA 4KAXA 1ETHA 4TKVB 3U3OA 4J3JA 1J2JA 2WV7A 3K32A 4V2UA 4EW6A 1QIEA 3BOSA 2FXIA 1G5FA 2JIZA 2X3FA 1XV5A 2CXXA 3GEGA 3P2KA 4P08A 5HFAA 2W71A 3KQKA 3ZLUA 3DZFA 3NFYA 3D6VA 2AWOA 3OFNA 3PQ8A 2AR7A 4LHXA 2VDWB 2ZRKA 1T2DA 4IO0A 3AR7A 4NV1A 4ZVPA 1NHGA 1SHKA 3GPCA 3NBQA 5GOZA 4AU1A 2QDKA 4GZMA 4P1ZA 4P31A 3O9MA 4U7WA 2MHCA 3KALA 3FPAA 3L3BA 3SGLA 5KIAA 2FJUA 1DQZA 1CJCA 1Y4DE 3IT2A 1KEWA 5CB8A 2QTVB 3TDNA 1JJAA 2UUOA 1JIVA 1JWLA 1NI4B 2JFXA 1IWBB 1HKUA 2G5CA 4OLFA 4M8NE 3PHLA 4GYYA 4KBFA 1P62B 4EPTA 1HDGO 1URPA 3I2HA 1Y8RA 4HEHA 1S8FA 4Z7JA 2D8MA 5AHWA 4WFKA 5CT9A 2OOKA 1ECFA 1YVDA 3WK4A 2JFWA 1ZN9A 4O25A 4WD3A 4XWWA 2LUOA 2VBCA 5HUJA 3JYQA 1SZJG 1ZOIA 2YUTA 1I32A 1DP4A 1R9NA 3O92A 4N5DA 2H5EA 1J0EA 1NXSA 5E2IA 4R1SA 4C7OB 1U1DA 2JI6A 3KQNA 1J7KA 3TB4A 5TQJA 1BCSB 3GMDA 3HO6A 4E1BA 1KYZA 2VTVA 1EXDA 2ORED 5CEEA 4UREA 1H9AA 3BXZA 1EEHA 1EUDA 4JLKA 3TUIC 5B1YA 2VLIA 5GAJA 4DR5B 3GPBA 3GRRA 2X1LA 4BMSA 1TDJA 1YIAA 2EW2A 4CIBA 2ZUWA 1DBWA 1MVNA 3AEQA 1FFHA 1XMVA 2VDKB 3F4LA 3I05A 4FGKA 4G01B 5FFMA 4Z1MA 3WYDA 2LE0A 1G8KA 1V43A 3ESYA 1NAIA 4HB4A 4JR0A 4ND3A 3Q8XB 4W9NA 3VR0A 3FPLA 3LVQE 1KSHA 3EOAI 4NYMR 1U8UA 2X5OA 1W85A 2OY0A 4EYQA 5JAMA 3ANTA 2RDMA 4HBZA 2W98A 5CG2A 1SOMA 3FGPA 5EEGA 3RUDA 5BURA 4RNDB 3EVDA 3HGQA 1BX0A 3P2YA 5E2BA 1O1YA 4KQWA 1PJBA 5ECDA 5HM6A 4I1PA 2XGSA 1VMIA 2EJBA 4UHJA 2FMIA 4COOA 4QWMA 1FIUA 3BE4A 1G6OA 3OFJA 1TUBB 4HRYA 4KFSA 4NBKA 4CCSA 1X0VA 4LJ8A 1XTJA 3S55A 5BP7A 3OTIA 4O6VA 2VXOA 1PL0A 4YUVA 5E3HA 3LXMA 4RELA 5IDYA 3VOTA 2RIRA 2VL7A 1W4RA 2XMZA 4IIGA 1WXFA 4EZEA 4E88A 2EIXA 3SEZA 5D7BA 1C1XB 3PUWA 4CL0A 2BPOA 2PXXA 2E4ZA 4DLWA 1Q74A 2YMQA 1RADA 2GXUA 1W1IA 3IBTA 3QEMA 2O6LA 4DCUA 1BX1A 5DM70 5BN1A 3ORSA 3ZK7A 4RJLA 2BMVA 4QTZA 1IXRC 5K45A 4ASUA 5AKHA 1J0CA 3ASVA 4HEJA 1LI5A 2PMFA 2X6RA 3P52A 3DEZA 4ZN6A 2ADFA 1KU0A 4IFEA 3KQMA 2OHJA 4R1LA 4X1OA 4LSMA 1ZIPA 1YRWA 3T9DA 2JASA 4PO9A 1M8JA 2F3TA 1AK2A 3NBFA 1V47A 3L1UA 1BH2A 1QP8A 1NW4A 1VIAA 3KAKA 3G6WA 3O7MA 4LGVA 4RF5A 4JB8A 3FHOA 4NBUA 4RPLA 3EGXA 1UKVY 2ZDGA 2NZWA 4TTPA 1XCPA 1V25A 1QKKA 2JW5A 2XT6A 5IZCC 2WZQA 1LBTA 4RAQA 2PGAA 2GKSA 4BNNA 2C7QA 3BA6A 1M8PA 3NZEA 2ID7A 1N9GA 3HP4A 4Z4EA 1UXOA 2XEDA 3FF4A 4MGHA 1KH3A 5ER6A 5FUVA 5KEIA 1ILEA 4HD8A 2GJ8A 1PSZA 4RJKA 1N6PA 1DDIA 3H8JA 3QZUA 5LBIA 4WECA 4L4YA 1SBCA 4MRVA 3T0IA 4F9FA 5AVWA 4HK4A 3V4LA 4P0PB 2NT4A 3H5WA 1X3LA 3C7DB 4ZQEA 1OZHA 2HF2A 2O3QA 4ITVA 5TMBA 1Y8QB 5ALPA 2GILA 3BZWA 2C2XA 3ZYCA 3DB1A 3PHGA 4RORA 1OW3B 3ZXIA 2YFQA 4GOND 3DTVD 4EQ6B 1XPRA 1DC3A 3DFIA 3FOZA 2HX1A 1PX2A 4L5YA 3LZ6A 2VDQB 5JZMA 4JEMA 2A84A 3DE1X 2VXCA 4JBHA 4S05A 4XYGA 2XYQA 2JAPA 1XHFA 1TRKA 3QE3A 4UDOA 1TMYA 2IYOA 4TMZA 3Q10A 1NBIA 4UXJA 5HEKA 5HF5A 3G9UA 3WFJA 2IE0A 5CB4A 1TLLA 1JEYA 3EQ6A 4DJTA 3KQQA 2DWQA 1WABA 1GQQA