4RF3A

Crystal structure of ketoreductase from lactobacillus kefir, mutant a94f
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
251
structure length
251
Chain Sequence
TDRLKGKVAIVTGGTLGIGLAIADKFVEEGAKVVITGRHADVGEKAAKSIGGTDVIRFVQHDASDEAGWTKLFDTTEEAFGPVTTVVNNAGIFVSKSVEDTTTEEWRKLLSVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPTLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLEGAEEMMSQRTKTPMGHIGEPNDIAWICVYLASDESKFATGAEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dependent R-specific alcohol dehydrogenase
publication title Origins of stereoselectivity in evolved ketoreductases.
pubmed doi rcsb
source organism Lactobacillus kefiri
molecule tags Oxidoreductase
total genus 95
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rf3A00
3I9MA 2NLOA 4BNMA 2EEZA 3ADPA 5IF3A 3Q9NA 1P0FA 1MLDA 4J16A 3OIGA 4O6VA 5BSEA 4Q3DA 1HDRA 4CR7A 4IDAA 3AUSA 4GGPA 4J2HA 1XGKA 2C54A 1EVJA 3GF4A 4NFHA 4CMAA 4RVGA 2I65A 3O38A 2Q3EA 1IZ9A 4AJNA 4PCVA 3FBTA 4YVFA 3IL2A 3EAGA 2OO5A 4O59O 4IJKA 1U9JA 2WM3A 2PKQO 2NQTA 4ZHSA 2ILTA 3DO5A 2FR8A 2FPPA 3PIIA 4PRKA 2X1HA 2X8LA 4CLRB 1P1HA 1U7HA 1ONOA 3JQ6A 3JD2A 5AOVA 1LNQA 4GGOA 1KBZA 4QT0A 2ZB7A 1R0LA 2J5KA 3NT2A 2Y0EA 1KOLA 1PJTA 1YQXA 1LLDA 2O3QA 2F1KA 1RKXA 4URFA 3PQEA 1BG6A 3HDJA 5I7VA 1Z7EA 3NT4A 1R16A 3OP4A 4H15A 4RVDA 4GX1A 3H9EO 2IRWA 4NNJA 1NQ5A 3QVOA 2X0RA 4D42A 2BFPA 1FK8A 2CDBA 3OIFA 4L0QA 3QY9A 3BMOB 4HFJA 2ZJ0A 3RC9A 4FW8A 1T25A 1Z75A 2NQ8A 3GRPA 2VYVA 1GV1A 1R0KA 1R6DA 2Y05A 3OECA 1E6EA 2FRDA 3K30A 2DU8A 4PLTA 3RSHA 4E2ZA 1PX0A 1VJ1A 1ZSVA 3ETGA 3OJFA 1GUZA 3PDJA 1M66A 2D5AA 2W98A 3ZWMA 1P3DA 5B37A 4UUPA 1MA0A 3QVXA 4TWRA 3DFUA 2HSDA 1VJ0A 5AXAA 2CD9A 2O7SA 4BS9A 4IQ8A 1EZ4A 5T8KA 1UR5A 1GADO 4DA9A 2D3TA 3E1KA 3KV3O 3K2EA 4W7IA 1HDYA 1R4MA 2BI8A 2J3HA 4A10A 2X58A 1ARZA 4FGWA 2QZZA 3EW7A 1K6JA 4Z6KA 3AI3A 1IE3A 1WDMA 2DKNA 4Y98A 1IZ0A 3ZHZA 2W2KA 3B6ZA 1Q7CA 3LC2O 4J3FA 1T2DA 1HETA 2VT2A 2PLAA 2C82A 4ND1A 1J49A 4BGIA 4NIMA 5DNAA 4XYLA 4LGVA 4ZGWA 4W9NA 3KHUA 4FFMA 3VVBA 2Y1GA 5G0VA 1HZJA 1UAYA 2OP1A 2VYND 3C85A 1GTMA 4BO6A 1Y8QA 3CEAA 3HFSA 4RLHA 4RPKA 1P44A 3B1FA 4XB1A 3TOZA 4XYBA 1R66A 4YAKA 1EUZA 4OMUA 5A04A 4FFNA 4PLYA 2EWMA 3DAPA 1VL6A 4BKQA 2D4AA 3X2FA 2DUWA 2IODA 3MJCA 4TRMA 5JDIC 3GPDG 1ZIDA 4YT2A 3ZDFA 2VNSA 2GN4A 3UOGA 5A3JA 3WGOA 1F8FA 1E77A 1ULUA 2Y1CA 1F8GA 4NJOA 4LN1A 5TGDA 1Y9AA 4ESOA 1TB4A 5I7SA 1W4ZA 2D5CA 5A02A 4RF3A 1OAAA 2OORA 1M75A 3TSCA 4A5OA 1IUKA 1E1LA 1HWYA 1IY8A 1WLYA 3FWNA 4K26A 3WMWA 1U2DA 3TFOA 3KVOA 4I5FA 3K73O 1G0NA 1N1EA 3IMFA 4PLHA 4EBFA 4RQUA 4TKMA 4YJGA 4XIYA 2J5RA 1UZMA 3C1AA 5BNTA 3AU8A 2O3UA 1DAPA 3CKYA 5TJHA 1H2HA 1E3EA 2AQ8A 3GZNA 4IGFA 1QYXA 2IYPA 3GMDA 4WK6A 2IZZA 1ZFNA 3WX0A 4TRJA 1C14A 5ENVA 2DTXA 3WB9A 5IXYA 4S3MA 3R3SA 4XYEA 2CSUA 3ETDA 5LDHA 3LF1A 4QFCA 4IMRA 3OJLA 3I83A 2LDXA 3RROA 5J23A 3GN1A 2WTBA 3PLNA 3UFXA 4DVJA 1PGOA 2ZQZA 3JD3A 4FGSA 4FD3A 4CM5A 3WGTA 1PS0A 2GASA 4HNGA 4YT8A 4RF5A 5JAQA 3X2EA 4E5PA 2JFFA 5EMHA 4D45A 2ZTVA 1MXFA 7MDHA 4B3JA 4UAGA 5U1PA 4GMGA 1GQYA 2B4TO 1Q7BA 3AI1A 4IQ0A 1QSGA 2ET6A 1ADBA 4CM6A 2HKIA 1HE4A 1SEVA 2UAGA 1EE2A 1S7CA 2VQ3A 1U28A 1B16A 2R2GA 1R12A 3EUWA 1B2LA 2YV3A 4QQRA 5JYDA 2RCYA 1L7EA 4D0SA 4CL3A 3NDJA 2JHFA 3DBVO 1GEGA 4CLDA 3DXFA 4EI2A 3RUFA 3IC5A 3UUWA 3ULKA 4X54A 1DHRA 3DC2A 5FI5A 5A05A 2GDZA 4MINA 2NACA 4R1TA 4F46A 3VKUA 3WGIA 5JBIA 1X13A 4D43A 4XQGA 1Z82A 1EUCA 2DC1A 4II3A 1NBOA 4RCVA 1CQIA 1NFFA 1VM6A 3AOGA 5GZ6A 1ZMOA 1ZSYA 4CLRA 2OBYA 4YYZA 1MC5A 3OM9A 1K0UA 1A9YA 1KVQA 4WCFC 4WJZA 1GUFA 3FCOA 3FNEA 3BMCB 1GV0A 2P5YA 3AWDA 4OKNA 1LX6A 5CFZA 2PZKA 3PEFA 3EMKA 4TVBA 1NAIA 4B4UA 2VHVA 2XPCA 2C7GA 5L4NA 4CMEC 4L4SA 3ONFA 3LC7O 5L51A 3AM4A 4ITUA 3I4CA 4OH1A 1HLDA 4MVJE 4XCVA 4PG4A 4WNIA 2QRJA 3QP9A 4BO7A 3ZU3A 5CPBA 2Q1UA 2OGUA 1X0VA 5JLAA 3HUDA 3DBHB 3VOSA 2C0CA 4TZTA 2P2SA 3BMOA 2HU2A 1JAXA 2X6TA 1BSVA 1I2BA 5KNLA 2IE0A 4R4JA 3VAZA 3PHIA 4E6PA 1D7OA 1HT0A 4F6CA 1K89A 1SOWA 2QIOA 4R54A 3WWYA 5K0ZA 3BMNB 1ENYA 1WZEA 1U7TA 1QORA 3DZGA 2NSDA 4AJKA 3U3XA 1JW9B 2A4KA 1SB8A 1WDLA 3PJEA 4MVJP 4P4GA 3ZHBA 5CG2A 2O3JA 4XJSA 3V2UA 4CR6A 1T26A 4JROA 3UH1A 4CUJA 5IN4A 3P2OA 4YRDA 1PSDA 3IJRA 4WE3A 3GC6A 3K31A 3WJAA 2VZ0A 3BHJA 1Q0LA 5L45A 3VPXA 5THKA 4IJWA 1T4BA 4BO5A 5JY1A 3AUAA 5EESA 2VHWA 1RYDA 3ABIA 2P5UA 4XGIA 5JMPA 3ZN2A 4QSMA 4BNHA 1B7GO 4Z0TA 3QSGA 1Y81A 4GH5A 1AN9A 5B1YA 1I2ZA 5GY7A 4BO3A 5GZ3A 2BKAA 3PGJA 3UICA 3K6JA 4RPGA 3GNSA 4IIUA 4QX6A 4WASA 3RUCA 3TZKA 4CUKA 4EYEA 4GKVA 1EVIA 5F1KA 5IDXA 2EERA 2EKQA 2ZYGA 3AK4A 2Q45A 4ZRMA 4CMHA 5JAMA 1W6UA 3DAFA 4BB5A 4P22A 2VRBA 3IJPA 4NPCA 2HRBA 2AQHA 4Z0HO 1ISMA 2W90A 4HKTA 3TF5A 4E30A 4M87A 5JSFA 2RH4A 3PI7A 3LDHA 2A9FA 1GL3A 3R1IA 2DTDA 5CP8A 3PGXA 4IJVA 4CM8B 9LDTA 1HZZA 1SBYA 1WMBA 2Q1SA 1ZK1A 3RFXA 1U4SA 1UDCA 1HTBA 1H5QA 3ONDA 2OHXA 4PGFA 3JQEA 4R3WA 1E3SA 3OETA 1ML3A 1EQ2A 3E9MA 3JD1A 3V1TC 4G81A 4NI5A 3TPCA 4BIIA 1LSJA 2J3JA 1ZSNA 3UN1A 3GHHA 2WSBA 3ZWBA 4IZIA 3QW2A 4WUVA 1LC0A 3DZJA 4RZIA 4D0RA 5U4QA 4U6QA 1N2SA 4L74A 3I23A 5AYVA 3PZBA 1UJMA 1I8TA 1YQDA 3ASUA 3WQQA 4KDFA 3UW3A 1NFQA 1XDWA 4FJ2A 2OP0A 3H3JA 3OSUA 4KTVE 2G5CA 1SC6A 4JLWA 2OBNA 2PKQP 4D46A 3SLGA 4YXFA 4Z3KA 3FWZA 3H2ZA 3VZQA 4NH4A 2O4UX 1LA2A 5F3RA 1N92A 3JCZA 2VHXA 3H3FA 1H94A 1LSUA 4J7XA 3AUTA 1C1DB 3ONEA 3GVPA 4XR4A 3ZNQA 2I3AA 1I10A 4LVCA 4PVCA 4U8GA 3N58A 3TWOA 1GFSA 2H63A 3CMMA 4OQZA 2VWGA 4A7PA 1YBMA 1JN0A 4HFMA 2Y66A 2ZYDA 3SX2A 1PS8A 4YCAA 4BNLA 3HADA 5I8ZA 5I7EA 3VPFA 2H1SA 3I3OA 1J5PA 2YHUA 4JX8A 2PD4A 1LRJA 1LLQA 4XQ9A 1GZ6A 3KM0A 4ZN6A 3Q3CA 2AE2A 3OF2A 4ROSA 1IULA 1EUDA 4EDFA 3C3XA 4CQMB 9LDBA 3T4EA 2NTVA 3CTMA 4HFNA 2QYSA 3NTRA 2GCGA 2Y68A 1WDKA 1ZH8A 2AQIA 2NUAA 4AG3A 4WCFB 4P4LA 4XEHA 1ZK3A 5CDTA 1VSUA 3H5NA 1Z73A 4NDNE 4FB5A 3ZV4A 4ND3A 1PJSA 2EG9A 3PWKA 4TRNA 1JA9A 3A14A 2Y1FA 1LDMA 4Q3EA 2I5PO 1AXGA 3D4OA 1NTOA 4B8ZA 3PFFA 2CVQA 4ZD6A 1K2WA 3DR3A 4F3YA 1DC5A 3RD5A 2YJZA 1R15A 2FR0A 1T4DA 4D3FA 1V6AA 4ALLA 1YO6A 3PHJA 3BMCA 2JCVA 2VUTA 3QWAA 4NJMB 3V5NA 2X9NA 2Y0DA 4AFNA 5IFLA 3DB2A 1HEUA 2AE1A 4JNKA 2ZIZA 1CRWG 4IQGA 4ALKA 3S2FA 4LK3A 1QP8A 1DRWA 3RC1A 2Q1TA 1IPFA 5L40A 2Y93A 4FSHA 1KEUA 4DLAA 3GGPA 4PRLA 3AFNA 4PLFA 2FSSA 4H16A 2XAAA 4DMMA 3M2TA 3UCEA 3ZHYA 1OC4A 2YV2A 2D0IA 5CAEA 5THQA 4E5NA 3W8DA 5TX7A 4C4OA 4BNIA 4IZHA 1G1AA 1MGOA 1WXDA 1PQPA 3BMNA 2G0TA 2VYVD 5AXDA 1L1FA 1O94A 1WPQA 2GZ3A 4TROA 1ISHA 4WKGA 2WEKA 1XSEA 5KJCA 1ULSA 3G49A 5IG2A 2DT5A 1VE9A 1QMGA 1BVRA 3JQGB 1ADCA 3CXRA 2GR9A 4LCJA 3GFGA 4KOAA 1O95A 2TMGA 3EZLA 3CSDA 1NWHA 4BMSA 4EJ0A 3D4PA 4PLZA 2DBQA 1DIRA 2QHXA 2W2KB 1U8FO 3ZU5A 3U4HA 6LDHA 4GBJA 4J91A 3RBVA 1V35A 4LRSB 1DAOA 4RPHA 1VPDA 5KJ1A 4Q3AA 3F4LA 3KLMX 4J6FA 3K9QO 3RI3A 1LC3A 3B1JA 2YDYA 1HLPA 4C7JA 3WWZA 2JCXA 4J7UA 1HE3A 3GQVA 5B4VA 5A3VA 2QZ9A 2CNBA 3I9LA 4ONEA 3FTNA 5MDHA 1IHXA 1V0JA 3LT2A 3DWFA 4MO2A 4ALNA 5G0WA 1IL0A 3KSDO 4PLCA 1ISFA 1DC3A 4K9DA 3VDRA 1PJ3A 4BGEA 2DQ4A 4QXMA 3D5QA 3ITDA 4UVIA 1DFGA 1DFHA 2FR1A 2ZCUA 3N74A 4R5HA 3ST7A 5KJFA 4PIVA 4CM8A 1E92A 4ZRNA 3PVZA 5IDQA 1UDAA 2BMAA 2EXXA 2Y1OA 1GAEO 1S6YA 4MVJA 5JCXA 3RBXA 2NWQA 4E5MA 2JFHA 3UAGA 2EGGA 4XX0A 4ZQBA 3ASVA 3Q6IA 1ZNQO 2IEDA 1LTHR 1I2CA 1EDOA 3I5MA 5JC8A 4M55A 1N8KA 4K1LA 2VNAA 1NVGA 1U2GA 3KZVA 4UUMA 5EERA 3AY6A 4D3SA 5DCUA 2XOXA 3R6DA 4EJ6A 2X23A 5EQDA 3GPIA 1H6CA 1YH3A 2FMUA 3VKVA 4BO8A 1LQTA 3IQDB 3I6IA 1TA4A 3TOXA 2X9GA 3UXYA 4EW6A 1O89A 4JJGA 3NV9A 1PQUA 2JAHA 4OIMA 4WECA 3GG2A 1E3JA 1BGVA 3I9NA 5JS6A 2NM0A 5IDWA 1OI7A 5EIOA 2E4AA 1RWBA 5DZSA 3ROQA 4B79A 2ZTLA 3KSZO 5LC1A 2IZ0A 2E49A 4OGWA 4XRRA 4QFDA 1X14A 3Q9UA 4Y9DA 3WSWA 2YDXA 4Z9FA 5TQVA 4BNKA 5FEUA 4GSKA 3QWIA 4HWKA 3SC6A 4O5OA 3ICPA 3VH2A 1V9LA 5L7YA 2PNFA 1C1DA 2WWRA 1EMDA 1NHGA 3HDYA 1DHTA 4NZ9A 1UXIA 1ZK0A 4RZHA 2P9CA 5DF1A 4ZU3A 1O0SA 2VN8A 1JLLA 3QRWA 1BDBA 3RASA 3PQFA 2AEJA 3UCFA 1GUYA 1UDBA 1LDBA 4PLGA 5I8WA 4CQMA 2X7HA 2YV1A 2O3TA 3D3WB 3I9JA 2HUNA 1ZK2A 5A5EA 1H9BA 1WNTA 2UUOA 3BTVA 1ZVMA 1YVEI 1YBAA 4WCFA 3C7CB 3W1VA 4LRTB 4WLUA 3DEYX 2CFCA 1OBFO 3TZCA 1ENOA 3D5TA 2JKVA 4RDHA 1J0XO 2GGSA 4CMBA 1LLUA 4CMEA 1IOLA 3QE3A 5JPIA 2GPTA 1PS9A 2BFMA 1ISJA 3AFMA 1XG5A 3LYLA 3K92A 3ZWWA 2ZB3A 3UCXA 4HBGA 3IUSA 4YACA 4PG6A 4J43A 1DLIA 4NJMA 1R0SA 3U0BA 5C7IO 4R5MA 3GEGA 4M8SA 3AM5A 3JYNA 3KTDA 2VHYA 1E5QA 1KEVA 1BDMA 2HK9A 3L6EA 4JP2A 3VDQA 1P1KA 2YHIB 1AE1A 5IZCA 3O03A 3UVEA 3CMCO 4DQVA 3IP1A 3MOGA 4F6LA 1B14A 1BTOA 1UAGA 2B5VA 2BF7A 3VZRA 3LU1A 1CERA 1A4UA 2I76A 3ENNA 4AJ1A 2Q46A 4UUOA 1SB9A 3PZRA 1JWBB 1XYGA 2IYOA 3MWEB 1QXSA 1P45A 3KOUA 4GX5A 2NVBA 3W8FA 3OQBA 2V6BA 3JSAA 3TL3A 3ZWYA 5TT0A 4DBVO 3I9OA 1UXHA 3A9WA 5KOIA 2PV7A 4YB8A 2O2SA 4GLLA 3K8ZA 3GR6A 3JQGA 4PZCA 4BNGA 4FPXA 3EVNA 4UEJA 4JXKA 4AL4A 1UUFA 4YT5A 4XJTA 4BO2A 2V6FA 2JD2A 3WXBA 3WMXA 4BQRA 5HRUA 3JQBC 2FZEA 3EHEA 4JBGA 5LCXA 4DGSA 5ILOA 4IBOA 3WJ7A 3F1LA 1AHIA 4GPD1 4IPTA 4NFYA 1HE2A 1SNYA 2HMSA 3HZZA 3JQ9C 4ZA2A 3ZZNA 1V3TA 1KVUA 5AVOA 3Q2KA 2B0JA 2WJPA 4Y6SA 1LBEA 2WE7A 1DEHA 1NP3A 4YA6A 2D1YA 1JTVA 4W7HA 4N5LA 3W8EA 3ZGYA 5C7OO 2X9VA 2GNAA 4BOYA 1V8BA 4B3HA 3WQSB 3H9QA 4EJMA 5JXWA 4R68A 1LDYA 2NU9A 2VCYA 5FYDA 2O3RA 4BNXA 1BWSA 1BVUA 1JVBA 1DIGA 4PLVA 3OA0A 4YBZA 5DP1A 1U8XX 4AJEA 3PXXA 3HQ4O 4RVUA 1Y7TA 1E1MA 3DOJA 4R41A 4P8RA 5A9RA 3V1YA 2V6MA 4R9SA 1PR9A 4GSLA 3U5TA 4E33A 3V1UA 4UEOA 5KVSA 3CE6A 1Z74A 2CZCA 3GNQA 4XA8A 3U62A 1Y9EA 4Z0PA 3WYCA 1YB5A 4IY1A 1H0KA 3FPLA 4MVJI 2A35A 3PWSA 4JK3A 1ZMTA 2P4QA 3HDQA 1UP7A 3ZNNA 4IDCA 3T7CA 1G0OA 3LLVA 3PJFA 5CEFA 1J6UA 3AU9A 3DOOA 1EK6A 2IDZA 3JQDA 4WLFA 4FFPA 4DIFA 3GUCA 3N7UA 4N5MA 5DP2A 5ILGA 1LSSA 1Q0QA 2RHRA 1YJ8A 3BMQB 4GVLA 3SC4A 1ZK4A 1YKFA 4XQCA 2FHSA 1PGNA 5DDIP 1NHWA 5TJ9A 4AJJA 3C8MA 2GN8A 3MWDB 1QRRA 4B7UA 3FPCA 2O48X 1O6ZA 3ICCA 4TKLA 5DOZA 1T2EA 2VOJA 4YJDA 2Q4EA 3FBGA 2QX7A 3GRKA 4JBIA 2VUUA 4ID9A 4JCOA 4E4YA 3OJOA 4NK5A 1GU7A 3L77A 5F21A 3DL2A 3RC2A 2EW2A 4OJNA 3NDIA 1PGQA 2HDHA 3GDGA 5JDCC 1X7GA 2DBZA 1I32A 4K28A 3ZNOA 1FDTA 1CIVA 3D3WA 1LEHA 4INAA 1D3AA 1VL0A 1X0XA 2VZ9A 4I9NA 5AXBA 4JBHA 5JYEA 1NNUA 3BA1A 3K2BA 1GEEA 1PU2A 2GO1A 3G3EA 1QLJA 2CUKA 5T6BA 4I9HA 4WNCA 1IPEA 1X7DA 1B3BA 1NPTO 3WS7A 4C7KA 1DBVO 3FHLA 3PYXA 5B4UA 4QUKA 4FJ1A 5T57A 2VOEA 4L73A 3DHEA 4MP8A 3U4DA 1ZKMA 3NJ4A 5A9TA 2HMVA 4BVAA 3F47A 5JMWA 1KC1A 2YYYA 5I9MA 4FJ0A 3SBOA 4E13A 3O4RA 1IB6A 1F12A 3RKRA 4CMIB 1H6DA 3NEPX 4RVHA 3RU7A 4RVSA 5H82A 3DBLB 2FP4A 1P1JA 5IJZA 2H6EA 2Z1MA 5KVQA 5FI3A 4EUEA 2PGJA 2YHIA 3P7MA 3H9GA 4Z9XA 5BSFA 3E82A 1I3NA 3GVHA 3ZWOA 2Z95A 2X5KO 3F5QA 4I9UA 1C1XB 3DHYA 4RQTA 1E6WA 4UEKA 4AVYA 5IDYA 4WLOA 1E5LA 3WGHA 2NTNA 2RHCA 3ZW8A 2VZ8A 2GERA 4R1SA 4IDDA 3AY3A 5DCYA 1HSZA 4R1UA 5IZCC 4DIOA 1DFIA 5CDUA 3TDKA 4H3VA 3RFTA 3ZWCA 1E3WB 1MUUA 1N7HA 3A1NA 1GZ4A 5KJEA 2C7VA 3MJEA 5K6AC 1MC4A 3OQ6A 4RPLA 4Y6RA 5T67A 2C20A 2E6UX 1DIBA 1N7GA 2EKLA 2HO5A 2ZTMA 4J0EA 3UKOA 2BFAA 4GX0A 1RYEA 2J3IA 4BMVA 4PFJA 1DRVA 3HB4X 3G79A 3WNQA 4Q39A 3DTTA 3MZ0A 3RC7A 1FDWA 4L75A 4FN4A 1PL8A 4DPLA 4E2WA 4FFRA 4BUCA 4CUZA 2V65A 1LRLA 2Z5LA 2D8AA 3K5PA 4R01A 3FTPA 1GD1O 4Y67A 5TNXA 4MP3A 4IDFA 4BNTA 2IXBA 4EGFA 4U0JA 5CDGA 1B8UA 3LF2A 3NTOA 4NK4A 1F06A 3ZCXA 1XCBA 4E31A 1GQ2A 4RORA 4YWJA 5F5NA 1VI2A 1ZXLA 4BNVA 1SZJG 3BTSA 2WD8A 4ZQEA 2HJSA 2YQ5A 1E6UA 1VLLA 2BGMA 4WOKA 5L4LA 2RH8A 4GQAA 4N7RA 1MX3A 4UULA 3W6UA 2Y1DA 3GNTA 3SXPA 3BIOA 3JYPA 5HTOA 1GY8A 2ZATA 3OQ1A 4MVJD 4R51A 7ADHA 1NX6A 2GYYA 4AICA 5HWSA 5G4KB 1NYTA 3GN2A 3IIEA 2HJRA 4MOWA 1KY5A 3A28A 1Y5RA 4MVJH 1ENPA 2EKPA 1RM0A 1M2WA 5C37A 3GZ4A 5A4DA 2DAPA 2C2YA 1LSOA 5ITWA 5JC1A 3H7AA 2PTGA 2HMUA 1R37A 1T1RA 4Q3BA 1DB3A 3WDSA 1DC6A 1JQBA 2Q2QA 3P2YA 4BMNA 3QVWA 1N1GA 1YDWA 3M2PA 4GX2A 1DRUA 1LDNA 4BNJA 3E18A 3QIVA 3BMQA 1OFGA 2X4GA 4LMPA 5DCWA 1QYWA 1RM4A 1H93A 2GLXA 4JN6B 1MXHA 2WMDA 4WLVA 3S8MA 5TT1A 3MJTA 4U6SA 5COQA 1LXCA 2NU7A 1ONNA 4J2OA 2PWZA 4NBRA 2D59A 4FDAA 4CV1A 2YQ4A 3JQAB 2BI7A 4RF4A 4DL9A 1I33A 2G82A 3SVTA 3G1TA 1YQGA 3GY0A 3FR7A 1ZW1A 5JAIA 4BNFA 1KIFA 5U9CA 4ND5A 1HRDA 3RQSA 2VHZA 3F9IA 1KS9A 1FDVA 4FQ8A 4CJXA 4W82A 1C3VA 3T7EA 3DHNA 4L9RA 1YXMA 4ZQFA 3GHYA 4K6FA 4R69A 2XXBA 1DIAA 1Y8RB 1AHHA 5I7FA 4CMKA 2BD0A 2GZ2A 3WNVA 4KDEA 2GN6A 4CQMD 2YFQA 5L95A 1F0YA 4L76A 4RPJA 4D3DA 8LDHA 4J1QA 4E2YA 1B0AA 4UREA 4GKBA 4J4HA 3L9WA 5BT9A 1VC2A 2HK8A 4MPDA 2YZ7A 4IIVA 5G0UA 1EDZA 3INRA 1U4OA 5G0TA 2B5WA 3NUGA 5ENDA 1YL5A 1HDOA 3IOYA 1XQ6A 4IJUA 4TSKA 3DZIA 5BR7A 2FWMX 1U3TA 2Y67A 3VZSA 4CM3A 1NVMB 1C0KA 2NNLD 2J5QA 1PZFA 4DQXA 4CMIA 1WW8A 4GLOA 3DFZA 1FXSA 1SEPA 3IKVA 3K96A 4HXYA 1XKQA 4NR0A 3NKLA 4EITA 1E7MA 4RLSA 3DBLA 3F6YA 1KVRA 3F3SA 5KVVA 3RUDA 3Q1LA 5DT9A 1XQ1A 3G0OA 4CMCA 1E1KA 3H5AA 1UXKA 2JD0A 2UDPA 3VH4A 2P9EA 1HKUA 1C1XA 2VT3A 1MV8A 2CY0A 3UF0A 2Q49A 4QTZA 3ON5A 5H83A 4BV9A 1NASA 1WVGA 1DJNA 2H9IA 3JQBA 3OICA 5FWNA 4S1VA 4IDEA 3IAHA 4XYGA 4DUPA 2QYTA 3JQFC 4BNNA 3JQ9A 4IINA 4LISA 4DBZA 1GCOA 4YJHB 1E3WA 2EW8A 1RJWA 3H5RA 1EK5A 3GT0A 4NHEA 5ADHA 5GMOA 4MKZA 4E2XA 1M6WA 3MJ4A 1PZEA 4KUEA 3FRJA 3TFQA 4EUHA 3D3EA 3A4VA 1XEAA 1B3RA 2NTJA 5BSGA 5DOVA 2QRLA 3ROPA 5K9ZA 4LMRA 4B4VA 2IEBA 2OZPA 3HN7A 3IP3A 3JD0A 1RPNA 3GUYA 4FOOA 5CHEA 3R3JA 3P19A 5EN4A 4XZ3A 3HWRA 1BMDA 2FN7A 4M1QA 4CV3A 3QLJA 1LJ8A 4UUNA 3W4IA 1UP4A 3WIEA 1YS4A 3BTOA 4I1IA 3DAGA 3KUXA 5KKCA 5EPOA 2ZB4A 1Z7BA 4OXYA 2V7PA 3W4JA 4GVXA 1QG6A 4MKRA 5TC4A 3AOEC 4HV4A 3E48A 2ZB8A 1ZXBA 3NJ8A 4I5DA 1XHLA 2OUIA 5CPFA 1ZEJA 4HNHA 4I08A 3ZI0A 1E3IA 1WZIA 3RAJA 5EINA 1A7AA 4JGBA 4QECA 3BYZA 3PJDA 1EE9A 4Z9YA 1NAHA 3H2SA 5G2OA 2CVZA 3U4IA 4J0FA 2BGLA 5C7LO 3ANNA 3RUHA 1YL7A 4P4NA 2J6IA 1A72A 5TS3A 2AG8A 3ZU4A 1HDGO 3F4BA 5ER9A 1GCUA 4WOJA 4MIOA 5G4KA 5KJ6A 2X5OA 2DBRA 3C24A 3H4VA 2NU8A 5MGBA 1NPYA 1KY4A 4GMFA 4WEOA 1GYQA 3RJ9A 3ORFA 2P9GA 1V3VA 3RUEA 3WGYA 2HLPA 3ZWPA 2EJWA 3HHPA 3LZ6A 1UH5A 1W73A 3GGOA 1YB1A 5TRTA 1NFRA 1ORRA 3QV1A 4NG5A 1U5AA 4RO0A 4UVGA 4YT4A 4D79A 1KC3A 1X7HA 3WICA 3V8BA 3CH6A 1F17A 4QEDA 1LU9A 1UXGA 4R9RA 4XWYA 3D7LA 1WP4A 3E03A 1HL3A 4BNYA 5EJ2A 5ES3A 5CDYA 3LC1O 1ISGA 1M67A 3AUUA 3L4SO 3KBOA 2CF5A 5JDCA 1I3KA 1PWXA 4DMLA 4A03A 4L4XA 5CEJA 3CZRA 1T24A 2Q99A 3KEQA 3STHA 4BO0A 2AW5A 3MJSA 3PWZA 2I66A 2PD3A 3JQAA 3FD8A 5JNLA 1AXEA 3VHRA 1N5DA 3UGKA 3DZBA 1VL8A 2NVWA 3ZNPA 3TZHA 3INGA 3QJ5A 1DIHA 2NV6A 4DYDA 2CDAA 1W0CA 3VPGA 4A2CA 3VPHA 1U3UA 1KVSA 1JKIA 2P68A 3GDOA 5BQFA 4J49A 4TZKA 3FR8A 3RUIA 1TVEA 1ID1A 5EL0A 5CEEA 2X0JA 1Y8RA 1QV7A 4KTTE 4WPGA 4MDHA 4MIEA 3OHSX 4M89A 3PFWO 2O3SA 3H9UA 5HS6A 4BKPA 4FFLA 4TQGA 2X0IA 2P91A 3EYWA 4XQEA 1A7KA 1CEQA 3V2HA 3RVDA 3MEQA 1MB4A 1R4NB 1W8DA 3JD4A 3SJ7A 1QR6A 1C0IA 1PJ4A 1IHYA 2PA3A 2PFGA 1HYEA 4BGVA 3WOHA 4XKJA 1JU9A 1E1NA 2GSDA 3D1LA 2C5EA 3W4KA 4BKRA 1NQAO 1YDEA 2NADA 3TN7A 1FF9A 2C2XA 2P4HX 4JJIA 2DPHA 2D2IA 5CG1A 2X22A 2BELA 2OMEA 4MKXA 3WGZA 4J9VA 4RJTA 1DPGA 3F5SA 3D0OA 3GOHA 1LDEA 4IS2A 1V3UA 1L7DA 2IXAA 2Z1NA 3WQRA 4CLHA 1I30A 4IXWA 1M6HA 4CM1A 2CF6A 4PLWA 1LI4A 3C7DB 4KUHA 1UZLA 3DDNA 4IM7A 5AQ1A 5COAA 4DWVA 5F1PA 3KYCB 1Y6JA 2JJYA 1E3LA 4ZQGA 3S55A 1ZUD1 4CMJA 2Y0CA 5A06A 3NGLA 3QWHA 5K6AA 2ZCVA 1ZJYA 4KQXA 2PZLA 3PHLA 4OL9A 3TNLA 4N18A 5C3MA 5C5IA 2W4QA 1OOEA 4PG7A 3KYBA 4JJFA 4AJHA 2AHRA 1TT7A 4R3NA 4DTIA 3GG9A 4CQLB 4NMHA 3WFJA 3F46A 2DBVO 1QKIA 2O4CA 1X15A 2EP7A 3BAZA 4YJHA 3KXDA 4ALJA 3C1TA 1VJTA 2EGHA 3FN4A 3R0IA 4IGEA 4XR9A 4B3IA 1XELA 1DLJA 3WBBA 5KCZA 1P1IA 2A92A 3L9XA 2DFDA 4WLEA 5H81A 3PK0A 3MOIA 1ZO8A 3BXXA 4JQCA 4GI2A 2PKRA 1EVYA 4FC6A 1D1TA 1SO8A 3SEFA 1F14A 3JQ8B 4XDZA 5ICMA 5BSHA 1TT5B 3O8QB 4PVDA 4B7CA 5JO0A 1I5RA 1AGNA 3DMTC 4M86A 4DREA 1ZBQA 2R00C 4DLBA 1NWCA 3FI9A 4XRGA 4Y8VA 3GAFA 2JCYA 4O0LA 1T1SA 1CDOA 2B4QA 3TRIA 2Y1EA 3H65A 2B36A 2UVDA 1O5IA 1P1RA 4GWGA 2QQ5A 4Z3DA 4EEXA 1YL6A 2WD7A 4YPOA 1YRLA 4E5KA 2O7QA 1BXZA 1HDXA 2PZMA 4U7WA 4DPKA 1OZAA 1T2CA 2BRUA 3WYEA 3ZWAA 3HDHA 4MJLA 5BNFA 3PP8A 4ALMA 5TLSA 2PY6A 4A27A 3OH8A 4BO9A 1SPXA 2VWQA 4IDBA 2FPGA 1YWGO 4OYRA 3HN2A 3WR5A 5L7WA 1I3MA 2PK3A 1H6BA 4XGKA 4MIYA 4ZQHA 4WEQA 1ADGA 3IDSA 3DONA 1GYPA 5COBA 5DBFA 5F5LA 1FMCA 2RBEA 4CLEA 4HP8A 4OXKA 1MG5A 4J90A 4WLNA 1PZGA 3TZQA 3GH3A 3VC7A 4ND4A 2GD1O 4XIJA 3L0DA 4KUGA 1Q0HA 1BW9B 4CM9D 1PTJA 2B37A 1BXGB 2ZYAA 3MCVA 4O1MA 2FOIA 2WE8A 2YY7A 3Q0EA 4FCCA 4ZVVA 3KRTA 1JWAB 4I8XA 2RIRA 3D64A 4WCDA 3ZV3A 3PPIA 4XB2A 1I3LA 1DC4A 2GRAA 5I9NA 5HBRA 3Q11A 3M1LA 1SCUA 1XIVA 3PTZA 2ZQYA 4EUFA 4ILKA 3OA2A 3WFIA 4PZDA 4OAQA 2CDCA 3LLSA 2WYVA 2JL1A 1T2FA 2PGLA 5G4LA 1YOVB 2UYYA 3UHAA 4CLOB 1YB4A 1VRWA 4JP3A 3KETA 4PLPA 2AEMA 3RBZA 4BNWA 1NQOA 2VTDA 2XXJA 3FNHA 3GVXA 2VWHA 3RKUA 1WAMA 3ZHXA 4YJFB 3L4BA 4UVDA 5TF4A 4EEZA 3B20A 2Q2WA 1A5ZA 1BRMA 1AUPA 1H9AA 4HUJA 5JFOA 4FS3A 2OXIA 3DZKA 2HQ1A 3ZWVA 4BO4A 1FJHA 1U3WA 8ADHA 1T2AA 3GVIA 5JO9A 1DXYA 4NBUA 3DBRB 1PJLA 3WTBA 4CPDA 2ZTUA 4IMPA 3RJ5A 3PYMA 3H6KA 3L07A 2VTEA 3LVFO 4M54A 3VTZA 1YBVA 5ITVA 4E0BA 2QG4A 3CZMA 3OEYA 4L8VA 2VRCA 2BGKA 1E7SA 1KERA 4A0SA 1UP6A 2ZK7A 4EZBA 3H9JA 3VVCA 2YW9A 3ZV5A 1E0DA 4AJPA 4W6ZA 4J4BA 4XGNA 1Q2XA 3VPSA 1MP0A 2JFGA 3HNPA 1E7YA 1CETA 4YQYA 3RIHA 4XD2A 1Q7GA 1HSOA 1SAYA 4Y6PA 4Q3CA 4LSMA 3RCBA 1ONPA 3GFBA 3E5RA 4G65A 4GL4A 1PWZA 4U5QA 2G17A 1R4NA 1P0CA 3NAQA 2WYWA 5KIAA 4HY3A 1P31A 2VUSA 3ZWNA 5A9SB 4YAIA 3KSUA 3EZYA 3LQFA 2NVUB 1YONA 1B15A 4IUYA 4OOEA 4D7AA 3DZFA 5DN9A 2O2YA 1KEWA 3EY4A 4GWKA 4RF2A 3QVTA 4DXHA 3JYQA 4YAEA 4NU6A 4FC7A 3FNFA 2EIHA 2Q4BA 3JQFA 1EBUA 2I3GA 4WGGA 4AJOA 1WMAA 4R1NA 5BNIA 3ADOA 1BHSA 3WYBA 3KYCA 3AJRA 4A26A 2R6JA 3RU9A 5JY6A 1YGYA 3ROKA 3DMYA 4DC0A 1U3VA 4JIGA 3ZH2A 4I5EA 1EFKA 1M76A 2W2LD 2FY8A 4DC1A 1A71A 2EHDA 4NQZA 1KETA 1X1EA 2X0NA 1XLTA 3ITKA 3PRJA 4IS3A 3RFVA 4A73A 3WGGA 1GZ3A 2UUPA 3MJVA 1ZEMA 4CQLA 3PLRA 2G76A 3NRCA 4NBTA 4J7CA 1HE5A 3NDRA 1QV6A 1NPDA 4CMGA 4XDYA 4BB6A 1EBFA 3NYWA 3Q2IA 3D4NA 3OEWA 3EVTA 3KO8A 3COSA 3FSRA 5ER6A 4NBVA 2OL4A 3TL2A 2AMFA 2I9PA 3JQ8A 3QWBA 1XU7A 5L9AA 3GEDA 4QO8A 1TT5A 3O8QA 3AOEA 3U9LA 4B8WA 4DQUA 5LDGA 1HDCA 2FPIA 1P74A 3WLFA 2YFHA 4IXTA 2DFVA 3LSYA 1LDGA 2CMDA 4MP6A 4NU5A 5GZ1A 5IZ4A 2POQX 3L6OO 1PJBA 2PGDA 2V6GA 3M6IA 3O26A 3FF4A 3ANLA 4K6CA 4MVJM 3AY7A 1ENZA 3OBBA 2YUTA 2O23A 4BGUA 1TEHA 1XU9A 4DYVA 2C07A 1IYZA 2BFOA 2PZJA 2BH9A 3W6ZA 1HDZA 1Y1PA 2FSVA 1E7RA 3KYDB 2VYNA 1PJCA 5T8KC 1Z45A 5JW6A 1CWUA 5JCJD 4I5GA 3DTYA 4UVHA 1WWKA 1VSVA 2J8ZA 3HE3A 3VH3A 1LQUA 2GZ1A 1N9GB 1GR0A 4OOFA 4CM9A 1ADFA 3LT1A 4L4RA 1J4AA 1TI7A 2Q2VA 2DVMA 4RVFA 3VH1A 4IDGA 3U4CA 1DJQA 1MFZA 2OFPA 4O63O 4UVEA 3S1LA 5L53A 1XWFA 2I67A 5ICSA 1BW9A 4W99A 1BXGA 2JHGA 4OQYA 4KMSA 2X5JO 1HF3A 4W9NC 5L4SA 1MG0A 2B35A 3OJEA 2HCTA 1QLHA 2WDZA 3IKTA 4BO1A 1NR1A 2XF8A 4HFRA 1YJQA 4J1NA 4CLXA 2GUGA 3PIDA 3U49A 1RM5A 4FBGA 3GVCA 1LUAA 1D8AA 2JAPA 4OSPA 2Y99A 3WTCA 1PR3A 1Y5MA 4OSOA 5B12A 3B1KA 1YOVA 1C0PA 1K5HA 3E6AA 2AQKA 1JKFA 2DUUA 3GA0A 4CLOA 4DLLA 2DPGA 2TMDA 4E12A 3EK2A 4E3ZA 3V2GA 3OFSA 1QYDA 3JQ7B 3HSKA 3PDUA 4YJFA 2NU6A 3CUKA 5B4TA 4MVJG 3E5MA 4YR9A 3AM3A 2HRZA 4LSWA 4OO3A 5FFFA 3B70A 2RAFA 2W8ZA 4J4TA 4CL8A 1PEDA 1D1SA 5FF9A 4CM4B 2OOSA 3JQAD 3EC7A 1EFLA 3E9NA 3DBRA 3RUAA 5I9LA 3BTUA 3L4BC 1JVSA 4II2A 1PL6A 1DDOA 1FDUA 5DBGA 4BL5A 1X1TA 3NX4A 3QQPA 3HB5X 1TXGA 1TLTA 3LK7A 3I52A 4AJIA 3S2IA 3HG7A 5HM8A 3GDFA 5L3ZA 2Q50A 3GMSA 5HS4A 3NGXA 5HA5A 1EVZA 1XR3A 3GGGA 2EF1A 1U5CA 2EJVA 3INTA 4M49A 2IZ1A 5A03A 4PZEA 1I0ZA 1JKJA 4PN3A 5F1OA 3C7AA 1HXHA 4BV8A 2LDBA 4RDIA 1K6IA 3C1OA 4RV9A 3O9ZA 3A06A 1B8VA 5A9SA 3WBFA 1QYCA 4BNUA 3OIDA 4YRAA 4FR5A 2NVUA 3EDMA 1D4FA 3G1UA 2AG5A 2DTEA 3AW9A 3ZU2A 3E8XA 3GK3A 3GLQA 1PJ2A 5KTKA 1PZHA 1DO8A 3WIDA 3I1JA 2E37A 1P9LA 2GN9A 2I6TA 3M1AA 1VKOA 3WG9A 2W2LA 1LRKA 3JYOA 1LLCA 2I99A 1U1IA 4OM8A 3HJAA 5G0SA 4AJ2A 5L7TA 4MVJF 1I01A 1B26A 2BLLA 2B83A 4YTEA 5A1TA 3GEMA 3ETEA 3QA9A 1I24A 3F1KA 3PYLA 4Q3NA 2PH5A 4XYMA 4YRBA 3SLKA 4NBWA 1A9ZA 1C0LA 3TQHA 1KVTA 1SOVA 4PG5A 4N54A 3DMTA 2HMWA 3JQCA 3DBHA 2R00A 5A5FA 1GYRA 2AA3A 1GDHA 2QW8A 4YEDA 4CM7A 2H5LA 2AXQA 4D44A 1BXKA 3JV7A 1MFPA 1RM3A 1ZJZA 4P38A 2BHLA 4Q9NA 3BZUA 3PJGA 2CVOA 4J9UE 2C5AA 5IN5A 2X86A 4W4TA 5AXCA 1PJQA 4YAJA 2ZKLA 3QVSA 1I36A 1P1FA 2B4RO 1VKNA 3DOCA 4LCEA 4KWIA 4AJ4A 1PL7A 3I4FA 1O9BA 4KZPA 5KVCA 1NVTA 1K6XA 1OMOA 1Z6ZA 1R4MB 3S2EA 3KEOA 1JDJA 3EGOA 4G5HA 1CQJA 2WD7B 4AJLA 3P5SA 4QO7A 4YDRA 4R16A 3FNGA 4CV2A 2E82A 4U0KA 3WLEA 4YAGA 4NFSA 1P33A 2B69A 3MTGA 4CR8A 4HX5A 4ZICA 3ZW9A 4BKOA 1KEPA 2HMTA 3G17A 5T64A 4CV0A 3JTMA 4HADA 5JCJA 4B4WA 5JDIA 2DM6A 1PGJA 1DSSG 2HK7A 2WYUA 3KYDA 4BHTA 4N5NA 3WSVA 1FDSA 3DZHA 5JE8A 3TZ6A 3CIFA 3BHMA 2PR2A 2EP5A 1Y8QB 2PD6A 1H2BA 3ROMA 5TSDA 4B4OA 3OJ0A 1N9GA 4E32A 1EQUA 1CJCA 1HYHA 1GQQA 1A4IA 4F45A 2Q1WA 4PG8A 4DRYA 1EEHA 3QWFA 3ZV6A 3PHHA 4DPMA 1E7QA 1UXJA 1E7WA 1JAYA 2SCUA 4LVUA 4BNZA 4B7XA 2EV9A 2FZWA 1NQTA 4YQZA 1PIWA 3SJUA 3IS3A 5IXSA 3VZPA 2C59A 2JD1A 3L6DA 3S2GA 3ANMA 3NT5A 4FFOA 3JYLA 3T4XA 2VWPA 4TMFA 2J3KA 1CF2O 2HAEA 4YJGB 5DBIA 4FIZA 4ZJUA 2ZJ1A 4D41A 3GZNB 3H8VA 3IUPA 4DIBA 2F00A 5DULA 4OKIA 3I6QA 5EQFA 5TIIA 1NXQA 3WGQA 1NR7A 1ISIA 3U09A 4H7PA 2GF2A 4RGBA 2DLDA 1O8CA 4KP7A 2C29D 2G1UA 1G6KA 2E48A 3JQ7A 1A27A 3LT4A 1CYDA 3NTQA 4RL6A 1OC2A 1QYVA 1Q1NA 1NM5A 1GPDG 3VTFA 3KB6A 1HYGA 1UZNA 6ADHA 5CDSA 1DOHA 2AEFA 1PQWA 3KLPX 3OMLA 4ND2A 1PGPA 1K3TA 4BKUA 1SMKA 1XA0A 1ZCJA 4CM4A 2QRKA 4ALIA 1GPJA 4GAEA 1H6AA 3I9KA 1ZZEA 3LT0A 3TJRA 3PHGA 4BQPA 3CINA 2A94A 1B8PA 2O50A 3E9QA 3GAZA 3MTJA 5T5QA 3RWBA 4OHUA 4CODB 1P77A 4TVOA 2UV8A 4LW8A 5KKAA 4J1SA 3CPSA 4KQWA 4FOSA 5IAAA 3HFGA 4KWHA 1KYQA 3ZWXA 4G2NA 4J1TA 4TRRA 5KWEA 4OXNA 3AI2A 3QHAA 1YE3A 2VRCD 4E21A 3PQDA 3BHIA 2PH3A 5JAZA 3DQPA 3ENKA 4E5YA
chains in the Genus database with same CATH superfamily
1XFAA 4KMOA 4BNMA 1LH0A 5HQ3B 3Q9NA 1P0FA 4BVBA 1MLDA 1VKZA 3ASYA 4J16A 1H42A 5BSEA 1P60A 3NCHA 1H2EA 2SBTA 3BXGA 1WE2A 3LX5A 3O8DA 3R0ZA 4GGPA 4B43A 4CR7A 2J0EA 4ZO4A 1V5GA 3GUVA 1U04A 4NFHA 2X4LA 4CMAA 3NVAA 3WIUA 1QGUB 2JI9A 2I62A 4GT1A 2Q3EA 3MUEA 4M22A 3T99A 4E7PA 1UBEA 4AJNA 1DZ3A 1OT3A 3TW4A 1KJNA 3P0EA 4B7AA 3PPVA 4CQJA 3IL2A 1XNQB 4O4JA 4KPYA 1K3FA 2VDWA 4IJKA 4P3YA 5KO2A 1N7IA 2NQTA 2ILTA 2QQEA 1SG0A 1EZ1A 4X7PA 1WHSB 4JKIA 4C3OB 4C88A 3LCMA 1GKYA 3NPMA 3RJZA 1KBQA 1YZVA 1DDGA 1P1HA 2YWHA 1ONOA 2ODNA 5FYQA 3P9NA 3WDMA 2BGWA 5AOVA 1LNQA 1B4DA 5KDOA 4HAZA 4MDEA 2DHEA 1FVOA 1R0LA 1TAHA 3H6GA 1KOLA 1PJTA 1ZH0A 2O3QA 3B1VA 2QAGA 5F9FA 4M76B 3V48A 1T43A 2PJZA 3D8RA 2NT3A 4PTYA 1Z3IX 1JEDA 3KTAB 2ZVDA 2JDID 1CZNA 1KI6A 1QIDA 1G3QA 3OKAA 3PQEA 3Q3EA 3AMVA 3HDTA 4PAMA 2G07A 3TRKA 3RADC 4YP1A 4QBIA 5BP7A 4PZ0A 5JASA 3PGMA 3UA4A 5SY6A 1U94A 2WZBA 2EARA 3MYRA 3IODA 3TE7A 1VG8A 1Z36A 4D42A 2VRNA 5TMDA 2BFPA 1FK8A 1OH5A 1SQFA 2ZUBA 3OIFA 4L0QA 5ISMA 3RWOA 3HTXA 1R6VA 2QLTA 5C4IA 3L0BA 4HFJA 3RC9A 2H4WA 2GEKA 1Z75A 3ESAA 3RB8A 2WVJA 2PXAA 1UMBA 3O95A 4OHRA 4WN3A 1R6DA 1RZVA 1YFZA 1DTEA 1X9HA 1GT91 3B8EA 3GU3A 4X84A 1UT6A 1CEXA 3NZEA 2PUJA 1FIUA 2ATEA 3BRQA 3RVOA 4NX2A 5JQGB 1ZLYA 1ZSVA 4CKEB 4A6EA 3AEUA 4ARIA 1YCHA 1LW6E 3MGKA 5JLJA 2D5AA 4JJAA 2UZ1B 1BN6A 2YN2A 3ZWMA 3SS7X 1NBME 4UUPA 4TWRA 3KJIA 1NLYA 2DHRA 1BA2A 1II8A 1V9CA 3DWIA 2XD9A 1EZ4A 3HI4A 1XXLA 4UZEA 4BS9A 5I45A 1KARA 1CUWA 2ANBA 5AW2A 5DYTA 6GPBA 4QTTB 3E1KA 5ALZA 2J30A 5ARCA 1PWYE 1IHUA 2P11A 3W0LB 5B7PA 4XWKA 3K1AB 1Y7PA 2X58A 4MJ7A 5EWLA 4FGWA 4O08A 3QVGB 1XQXA 4ADSG 2O8DB 3UIEA 1WOMA 2KQUA 3K09A 1O94C 4FDUA 3FNIA 4KPUA 1PFUA 2DULA 1IZ0A 2RK3A 4FX2A 2HBQA 2MR6A 4B40A 4QHYA 5AW3A 3JRWA 2FG5A 3ESDA 3WK9A 1Q7CA 4ZDJA 3GT4A 2XWPA 4RH0A 1HETA 1I14A 3EF0A 3IUQA 3IR5A 1A50B 1V8PA 3NBYC 4BGIA 4CG1A 4F8EA 4YV0A 4LGVA 2VF4X 4JVSB 3VVBA 1FRFS 1GA1A 3RSZA 5G0VA 2ASEA 1HZJA 3A7DA 1WQ4A 5EMMA 4DBLE 2R2AA 3N0RA 4V0MA 1GTMA 3S5UA 1Y8QA 4PHGA 3A31A 3UBTA 1E6KA 1P44A 4JWTA 3TOZA 3QU2A 5CD1A 3U7HB 1EUZA 4X41A 1NP7A 4PLYA 3DAPA 5DRTA 3OVMA 3ZLVA 1HC7A 3GPDG 3KHTA 3HCDA 4MVXA 4MICA 3WGOA 4QOHA 1MIHA 1F8GA 2NO6A 2FXVA 2XNCA 4LN1A 1JLSA 3GUHA 2V8BA 4MV9A 3ES9A 1EH5A 2VK4A 3K53A 1LBSA 1W4ZA 2D5CA 3OM0A 5I4IA 4LV6A 4RF3A 1L8QA 4R7TA 4Q7LA 4IIEA 2H1CA 3V34A 1IY8A 2YXPX 1B41A 4I7EA 1BFKA 2G5GX 3K73O 1N1EA 3D7KA 3FHCB 3IMFA 4P93A 3R7FA 1M2OB 2WSSA 1PG0A 4RXUA 4YJGA 3SXUB 5BNTA 3A26A 1ZRMA 2O3UA 4C6TA 5CA1F 4IGFA 2AQ8A 3K71B 1ICEA 2G9VA 2QAJA 1QYXA 2IL1A 3HYRA 2GBFA 5IBQA 3GMDA 1OPXA 1S4QA 2RI0A 3MXTA 1UMKA 3T5GA 1Q19A 4KH1A 1ZFNA 1WX1A 1T9BA 3L6RA 4LJ6A 3D8BA 3R3SA 4XYEA 2CSUA 3G6WA 4TZ0A 3KALA 3ETDA 1OZ0A 5LDHA 3LF1A 4A91A 4AULA 3I83A 3ZZTA 3ONVA 4O2LA 2BFEB 2KI5A 3PLNA 1U2GC 1YS9A 4URHA 5GTDA 5DM70 2ZQZA 1SD5A 4FGSA 4MUXA 4UBNA 1U80A 1Q7TA 3DO6A 4CEJB 3F74A 1PS0A 1S89A 4NFLA 5KREA 2CL7X 2FQWA 2VPXA 4RF5A 3CQ9A 1GQSA 4F7DA 2JFFA 5FTMA 1NLZA 1WP9A 1GL6A 3T54A 2C7PA 2ZKIA 4YLYA 2Z2XA 2V7QD 1E94E 3KFLA 3HKEA 3K2QA 1NM5C 4NCHA 3L7CA 4Q1VA 1RXIA 1I1QB 3HO6A 4S1NA 4B3JA 2OCPA 3WKCA 2C2OA 2IZ6A 2B4TO 3E58A 4I1VA 2VK1A 5B3KA 5DHQA 3K16A 4CM6A 1N78A 1SEVA 2MTBA 4RD1A 3VYTB 1WD7A 5B64A 2G1KA 4I1SA 3HSSA 2VQ3A 1U28A 1B16A 2R2GA 1R12A 4X0EA 4JV5B 3GA7A 1B2LA 2BJWA 4WIAA 4DLUA 1SXQA 2A9RA 4PF1A 3CVJA 3ND7A 4B9EA 1L7EA 4DHWA 2E85A 2AK2A 4CL3A 3NDJA 4EA8A 4XCQA 4ZHQA 3COJA 5EP4A 1AKEA 4CLDA 2ZRMA 2OO3A 3QTBA 1RI4A 4PZPA 4RTLA 1V47A 3HCRA 3PQ5A 4LYHA 3QEMA 4DMKA 4JMPA 2NZ8A 4INPA 1DQZA 2OWDA 2W2XA 3DC2A 2A7QA 3PB3A 3ZIDA 4URXR 1SKBA 2RHBA 4AYTA 4GBED 4X65B 1ZNXA 2YXEA 4FN5A 2DQZA 4D43A 2E4XA 1N6PA 1J2JA 1Z7GA 1KS2A 3CYFA 4II3A 3OWOA 5LOVA 1CQIA 2BMDA 3EWAA 4P86A 2DPYA 3AEKB 2O0JA 3IA7A 1ZMOA 1VBMA 3HXLA 5FPHA 3RS2A 4XTCS 3TTSA 4GKKB 4B34A 3HMQA 2JDIA 5H7XA 1MRNA 3UXMA 1D1QA 3TAXA 4K6MA 1RQ2A 3EMVA 2IPLA 4WJZA 3WA7A 4DGQA 2AN3A 3A6PC 1GV0A 2OHHA 1MOPA 3C39A 3NWBA 4I36A 5CYOA 4UARA 1ZD9A 4HGOA 3F7OA 3ZK9A 2D2FA 4YCCA 1R8YA 1NAIA 1ZICA 1QB8A 2VHVA 3L92A 1F8UA 2G1AA 4TTPA 5FBZA 5L4NA 2R1UA 1Z4PX 2I0FA 1Z35A 3ELDA 3ONFA 2Y76A 4ITUA 1XWIA 1HLDA 2WIJA 4QZVA 1Y7HA 4OYHA 4WNIA 1RYBA 4LMAA 5HMMA 1YHNA 3ZU3A 3C15C 5CPBA 5AHRA 4BVLA 2Q4DA 1X0VA 2HSJA 2WJ3A 3HUDA 4RK5A 5JLAA 3ZDXB 2PUAA 1OWPA 3O3CA 5J59A 1BEEA 3ER9A 3ZJUA 2A4MA 2HU2A 1JAXA 5CAEB 1GZ5A 5KNLA 2WF6A 1K7CA 1HT0A 4Q4AB 5AR1A 1GSOA 4PHTA 4F6CA 1U0EA 1M5TA 4R54A 1LBQA 2ZJ4A 1AKTA 3BMNB 1WZEA 3DZGA 4YO8A 3UJ6A 1KO1A 1BKSB 1FQJA 2B2CA 2VK2A 1PJAA 1M6NA 2EFCB 1JW9B 2A4KA 3E2MA 4PZLA 1SB8A 3JVVA 4KO8A 1L5GB 4BQOA 3IQEA 3KOXA 3KQHA 3V2UA 3EQZA 3MVEA 2IP4A 4KN6A 2PT6A 5IM4F 1T26A 5F52A 3UH1A 4CUJA 5IN4A 4YRDA 2A5FA 4AKSA 3K6RA 4Q4DA 3GC6A 3HNOA 3LX4A 1EE1A 3GUZA 3KUKA 3K31A 3IMEA 4KYTA 2W2TA 2F9FA 1XZPA 4PS0A 3ZGVA 4I19A 4AZ0A 4BXOB 3TSYA 4G0MA 5L45A 2PFKA 3VPXA 3DLBA 3OPQA 2QTVB 3R74A 3ENWA 3GFRA 4DB2A 4TKUA 3RODA 3ENQA 5DYIA 2COUA 2VHWA 1VGQA 1WUKS 4BNHA 1X9IA 3AJ8A 1YR8A 4KAFA 2PWYA 3H84A 4QSMA 3R8XA 4JJ6A 3RR2A 4AZWA 4GH5A 5IXJA 1JI3A 2DPXA 4BO3A 4EB6A 3ZCQA 5GZ3A 2BKAA 3PGJA 3UICA 5EJGA 3ESYA 5CLFA 3K6JA 3ICEA 4RPGA 3LV8A 4WASA 4JI4B 3A0UA 1P3Y1 1QVAA 1QFYA 1L7XA 1VB3A 2FVXA 2G9UA 5LQMA 4MDFA 1A8QA 3HRKA 2DPMA 2EERA 2EKQA 2BCGY 2P1ZA 2Q45A 3N87A 2PO5A 4K81B 1M2KA 4MQMA 3L7AA 5CXUA 3C5EA 2VH1A 3DAFA 1QOQB 2WF7A 3K09C 4J3JA 2H59A 3G1WA 2IIPA 3HCEA 5DNDA 2OV4A 5PNTA 2Q7OE 1A97A 4NPCA 1THZA 3GQBA 4M9UA 3B6MA 3IP9A 4Q4HB 4Z0HO 3BILA 4P58A 2VPTA 4E30A 4MVYA 4CTNA 5CB4B 4F97A 5JSFA 2RH4A 5AM4A 3BKXA 4GDMA 5AM5A 5FPQA 1T4GA 3GRYA 1BCRB 5J63A 3URMA 1U1EA 2QROA 3E9YA 1HPLA 3H4MA 1WMBA 1ZK1A 3SVZA 5DBEX 4IUCS 1U4SA 2GAOA 5C80A 5JXHA 1T6XA 4IF4A 1SG6A 2ATVA 3ONDA 3ZS8A 3NRJA 2OHXA 4PGFA 1MNQA 4NENA 5JWHA 2YJNA 2JK1A 4F4IA 1N3YA 2AFHE 4RK1A 2WSLA 1W30A 4TL6A 4PM4A 4MWTA 1IK4A 3JD1A 3ZGLA 2GPJA 3Q5GA 3L46A 1PNOA 1VHTA 4HL6A 4NI5A 4NJEB 4K0RA 4BIIA 1C0EA 3A6LA 4QVGA 3P8ZA 4UU7A 1V1JA 4QDKA 4Y2QA 4L27A 3SHWA 8ABPA 1AQIA 3GJ3A 4ZXFA 5KUTA 2IY7A 4B82A 3FUVA 1LC0A 1EAMA 1SQSA 1TM5E 3TR0A 5U4QA 1OB5A 1DBQA 1QHHA 1YMVA 4L74A 3I23A 3FMOB 5AVKA 4AO7A 4K6HA 1RHQA 4KDFA 1NFQA 1XDWA 3DE4X 3OU6A 4FJ2A 3BKWA 3OSUA 5I4CA 4ECEA 2C3YA 4U6NA 4CKCA 1ORHA 3V7FA 1WDWB 2OBNA 2Q0HA 3CRW1 4FGUA 2YY5A 4YXFA 1Y8AA 2XOKD 2V7QA 5EVCA 1LA2A 5EAIA 4ISBA 3T7EA 4LXIA 4Q6BA 3JCZA 2OECA 4HJXA 2J7PD 1H94A 1L5FA 1SZCA 2ZJ5A 2XITA 3AUTA 4DUZB 4HTFB 1TC1A 3T1OA 4D4LA 5BVGB 1ABBA 1X1RA 4F5YA 4JITA 3GVPA 4NTZA 3B48A 4HDAA 4ZU1X 1GNRA 3I2JA 2YMPA 4PVCA 4H9GA 2F67A 4Y9UA 1XMVA 4HYEA 1YS6A 1YBMA 2QGZA 3BGVA 3WAKA 5F3WB 4MWBA 1J5PA 1W9MA 2YHUA 4ZT3A 2PD4A 4NPHA 3W5SA 1GGJA 2RI6A 2XE7A 3TPZA 1Q22A 4JI8B 5ALWA 3SQXA 3E27A 3Q3CA 4ROSA 1VRVA 1WXIA 2FFAA 3NWPA 4GYYA 4ZAWA 1U98A 5ALIA 4P0QB 5AIBA 2QYSA 3NC0C 5JNTA 2E6KA 3TW8A 1RAIA 3OJWA 1KAEA 1UFOA 1QS0A 3CH7A 1WDKA 1ZH8A 2F4VB 2NUAA 3T1VA 4AG3A 1ZK3A 5CDTA 2PU7A 2ZYHA 1NDUA 3IO3A 3RU3A 4D9JA 3LDUA 2ODWA 1JEYA 4PC7A 1U28C 4LF9B 4YRNA 4FYVA 2IHZA 4KDCA 4P81A 1DJOA 3A14A 3DDHA 2Y1FA 3LNCA 1D09A 2CEKA 3TZBA 3ESZA 4KACA 2I5PO 1AXGA 1HMYA 4QFMA 5CJ2A 4MVCA 1I5EA 2QS9A 5K8TA 3TPFA 4ZD6A 2XQIA 5DISB 1JS1X 1K2WA 5C5CA 2QSZA 6REQA 5DT2A 3EZ2A 3I1YA 4QNRA 5FORA 2CLDX 1T4DA 2ZAYA 2GAAA 1JTEA 1IRXA 3C48A 5FA8A 1YO6A 3PQ3A 3T41A 2VUTA 3V5NA 1OT5A 1G291 1N0VC 3DVQX 2KYRA 2R8RA 1NONA 4IIJA 1BJRE 1VA5A 3KQVA 2Z2ZA 4FR2A 4W5NA 4KK4A 1ECPA 3DCNA 2HWUA 1QX3A 1EI9A 1CRWG 1Z2AA 4N7JA 4FE7A 4NLLA 3T7AA 4LK3A 3IPLA 1G5FA 5SY9A 8AT1A 3VA7A 2Q1TA 1KEUA 1PNVA 2ZIFA 4GOJA 4UUBA 1H0SA 3EUAA 3RDPA 5K6TA 2RGAA 5HF6A 1QYRA 1X74A 3MA0A 3ZHYA 1X86B 3O4IA 2JLQA 2YV2A 4HNAA 3DYBA 5AM1A 4MGHA 2ZRAA 5CGQB 4PZAA 1C3OA 4G56A 5TX7A 3VC2A 4FDTA 3WE7A 4IZHA 3PU6A 3SYNA 4BNIA 3AKDA 5JSQA 1AU9A 1IAQA 4ERXA 3LXUX 3LUPA 4TLEA 1ST2A 1USUA 1U7XA 3KUCA 1RXYA 3HY3A 3HPRA 3P2JA 3LVBA 1KEZA 3WBKA 4N7BA 1P2TA 4N1AA 2O5RA 4TROA 4TLMB 4PQEA 5E0OA 4WKGA 3AESA 2R8PA 1TMYA 2WEKA 4MW1A 4HRAA 1L7AA 4G0YA 4Y6LA 1VIVA 1A9XA 1VE9A 1O5OA 1QP4A 4ZO7A 4MAMA 4LCJA 4Y2YA 3ZHOA 2A33A 2Y1KA 4KOAA 4BV2A 4UTPA 3Q8XB 4XGRA 2X2FA 2C8LA 3LFHA 1SXJB 1M1XB 2IHTA 2TMKA 4ODIA 3KT0A 4JYCA 2PANA 3EZLA 1Y1LA 3PX3A 1NWHA 3UAZA 4BMSA 4BN5A 4DA4A 3T8YA 5IHXA 3C1UA 3D4PA 4PLZA 1ZC4A 2C78A 4EW3A 1TAGA 2QHXA 2OXEA 1WKVA 5IP5A 3KXKA 3FDZB 5TVGA 3L7BA 4PU0A 1TDJA 2SICE 2HIHA 2CDRA 2JEZA 2QTAA 4IJ6A 4P36A 4Q3AA 4J6FA 3UATA 4BBJA 4K6OA 4I2NA 3RHZA 4C7JA 2WZQA 1G6Q1 2JCXA 4FHDA 1SBNE 2I71A 3RV4A 1EIWA 1HE3A 3GQVA 2GK6A 3BCHA 3PRKE 2QZ9A 3A4YA 2CNBA 1P5RA 3I9LA 3JASB 4FYHA 4NZNA 4ONEA 4UHHA 4XM1A 1IHXA 1V0JA 2GS9A 3DWFA 4ALNA 3AVYA 2Y4OA 1ZM4A 4PLCA 3KSDO 5DGIA 3VDRA 3BC1A 1V4BA 3HV0A 4Z9BA 1MJ5A 4QXMA 5DTMA 1SXIA 3WRXC 2GFQA 4PFQA 2MR5A 2ZYRA 3N74A 1ZUNB 2C3PA 1A7UA 1E92A 3PVZA 2OE2A 2YBDA 3ANTA 1KZHA 1RCUA 2EXXA 1AQJA 4FI3F 2D2VA 4EQ6B 2FWPA 1P72A 4HHEA 3W2EA 4YJKA 3KQMA 2G67A 3V42A 4A0RA 1GAJA 4BJ3A 3VXKA 5KNCH 3UAGA 4OHYA 4XX0A 3EVZA 4ZQBA 3WQHA 3HJBA 5AVZA 3Q6IA 3M4YA 1ZNQO 1B6GA 4DW8A 3PICA 4BCDA 1LTHR 4EGQA 2IYXA 5JC8A 3TJMA 4WFQA 2C9MA 1XZGA 1IK6A 1YZLA 3L1VA 2XQKA 2FUCA 1ORIA 3FROA 1NVGA 1GKKA 1PT6A 3LX6A 1E3MA 5BMOA 2X14A 2XOXA 2P4EA 4EJ6A 4JLOA 4UFOA 1H6CA 1L4HA 4KJZA 2V7VA 3E23A 3VKVA 4NVRA 3IQDB 1W19A 3I6IA 4JT9A 3T35A 3ADCA 3OZSA 3VZDA 1P7WA 4EW6A 4BPRA 4K88A 1DVRA 5CGZA 1M8FA 2VDPB 1OXVA 4E70A 1OZGA 1NXWA 4OIMA 4HRVA 4WECA 1TECE 3AJDA 1GO2A 3ZCTA 1HOXA 2WVAA 3AHEA 4C30A 2XMBA 1BGVA 3I9NA 4IJQA 4JA0A 4ENSA 4YRSA 4DNOA 5IDWA 3UT5A 5JS6A 4GGMX 3OPYI 4ZT6A 1JIIA 1OUMA 1WW2A 2ZTLA 1ZBDA 2E49A 2J32A 3R3HA 4REOA 1Z4KA 2V58A 2ZFUA 5EI5A 3WSWA 2X0DA 3FCSB 1VCNA 1EWVA 3F7NA 3ZXSA 2V4MA 1Y4UA 5FEUA 1KZ9A 4RTOA 3BAFA 4QJ3A 2BIFA 3MHTA 2GK3A 3GJ6A 4HWKA 3SC6A 4ENVA 1V9LA 5ECDA 2C61A 5L7YA 2PNFA 3ZDQA 2O5CA 4KYUA 1JHOA 2I2BA 4DR6B 4ZCMA 1ST3A 4YMSA 4URVR 1U0HC 2ZSDA 4IIFA 1J8QA 3WK7A 1HFWA 1KSJA 1NSFA 2B8WA 3ZGXA 3OMXA 1VG1A 3QRWA 4I81A 4QPNA 1HTWA 1Y63A 2Y0PA 2AG0A 4RELA 4DLWA 2K4MA 2Z8YM 3PGVA 2YVLA 3UCFA 2W6NA 1GUYA 4QNNA 1UDBA 1LDBA 4Z3OA 4M1WA 2HMAA 4FK8A 2O3TA 1J0CA 3D3WB 4XI9A 2O2EA 4FNMA 2IYNA 3GFPA 1UPAA 2BV3A 1ZVMA 2O0MA 2XKJE 1JI0A 3BTVA 3OT1A 1D2HA 2WJAA 4MA4A 3UWOA 3A25A 2G06A 4KR3A 3HGTA 3RRYA 5A5VA 3VKWA 4HLDA 2I22A 5BN4B 2QE6A 4NS4A 1JXAA 1OW3B 3FRHA 4DNQA 1M2EA 4ENQA 1SK9A 3PSAA 5LOVB 3PGKA 5HFNA 4E1BA 3QE3A 3A7EA 1P8JA 4KN9S 1PS9A 2HFKA 1G42A 1SRRA 1ISJA 2GA8A 4KLNA 4O4LF 5KZMB 5LYJA 4FQ7A 1CUYA 3K92A 4ZRDA 5HE8A 3UJHA 2A57A 3FPEA 4CWAA 4RTPA 2ZB3A 2GDJA 4RWZA 5GZ6A 5HKLA 5HFAA 1JEQA 3H1FA 2O7NA 2XTNA 4J43A 3HXTA 4PG6A 1C3JA 5K3AA 3HA5A 3PS9A 2QMZA 4OIFA 4Q1BA 2P2CA 3JSXA 4HQ0A 3VJMA 4NJMA 2Y9PB 5L3QA 5FI0B 1GPWB 2QR5A 4PXYA 3AM5A 3QU9A 4WKOA 5CIQA 1BDMA 2ZETA 1Z2DA 2GEVA 3L6EA 1FJ2A 1TZKA 1P1KA 3RVLA 3DLHA 1CNMA 2FX5A 2R11A 3O03A 3QVUA 3MOGA 2HSWA 2P5TB 2PRZA 3BL5A 3WI7A 3HYSA 2IYTA 3AEQB 1BTOA 3GW8A 4P3XA 1V8FA 4OB7A 1NMSA 5BR1A 3NM6B 2AUNA 1T0HB 3D0KA 3LMKA 3HGQA 3RVBA 1UBTS 1CERA 1YI0A 3FIUA 1A4UA 5J1SB 3QEAZ 2I76A 4AJ1A 4Y1RA 5IAOA 3K9BA 2Q46A 3BXFA 1Q77A 1RAHA 2MSKA 1E62A 5KQSA 3EVBA 4OQNA 2IYOA 2GTPA 1F2UA 1SUEA 3DFKA 1YD7A 5DNCA 1GRRA 2RHWA 4DM7A 3GLGE 2ZSIA 1M1YA 4C4AA 2QA5A 4DIDA 1RXCA 1NV9A 1U3GA 3CBQA 1Y34E 2XTMA 1BD3A 2HA0A 1BGXT 3J80A 4ENTA 2PX3A 1G8PA 3FOBA 3GELA 3OX4A 4KIFA 2O2SA 3MT0A 3GR6A 3JQGA 4FZ3A 4KFSA 4AZ0B 5AW8A 2CFSA 4FGKA 5I01A 4DKJA 2WT9A 3NHYA 3NNNA 4GYWA 4XJTA 5CW1A 2V6FA 3OPMA 4G1BA 5EP2A 3WMXA 2G04A 1K6EA 3T3NA 2P9BA 3JQBC 3DV9A 2FZEA 1W1IA 4JBGA 5LCXA 4DGSA 4BRWA 4KVZA 5JS7A 1AHIA 2I6FA 3PNSA 4FNOA 1F4PA 4IPTA 4NFYA 4OCZA 5AW5A 2R96A 5LBIA 1IZZA 1JG4A 3V4LA 2HMSA 3HZZA 3W5VA 4AMVA 4CTJA 1KWGA 4MXDA 5AVOA 2I1QA 2W2VA 2X7XA 3Q2KA 2DHQA 1GSAA 2OZVA 5B55A 2CLFB 3EXG1 3KD2A 1MAUA 4PHCA 1UIRA 2H2AA 4NHOA 2VNIA 4Q05A 4YA6A 1VLZA 2F3QA 4H7KA 2PFSA 4NBLA 1T5OA 4MYRA 4GZ3A 1WRBA 2QRGA 2Q21A 2FW9A 4FBMA 4P2GA 2YKGA 2ZTSA 4I4TA 3SNHA 4B3HA 2VPQA 2FUG6 3QEBZ 2QL5A 3ITNA 3OTGA 2EHJA 3QI7A 4R68A 1D1PA 4MHOA 2O3RA 3NHPA 1UT5A 1ZDMA 4KWTA 1UCFA 2ECPA 2I80A 2ZI3A 3BUSA 1SOAA 2HA6A 3P0JA 4WDQA 3TO5A 1QRAA 2HDWA 3DV0B 1L7BA 4OQDA 4YBZA 1P8AA 2OLKA 3JARA 4AJEA 1OI3A 3FYHA 1VE6A 4L6IA 4X8OA 5DM2A 5G41A 1YDGA 4NY1A 4P8RA 1FP4B 3V1YA 4F7WA 4HXEB 1EWQA 1PR9A 1U02A 3B9QA 1B8NA 2PA0A 4C6HA 1OH6A 2RHHA 3MILA 1O97C 2DCMA 3HKBA 1EM6A 1YA4A 1ZXXA 5L3RA 5KVSA 1L7PA 5EKDA 3ZXIA 1NI4B 1Z74A 1TYDE 2DT8A 2W8BA 4PCLA 1D6JA 2N3ZA 2C9YA 1X8LA 3OAAA 5FOTA 5K8IA 1ZWLA 1QBGA 2CZCA 4M7OA 2O59A 3DJFA 2HA7A 1GG8A 3A10A 1Y6QA 3NXSA 3U62A 3FUUA 3INNA 1E96A 1HLFA 3MWLA 2OCXA 4Q37A 4KSBA 1ADJA 1V37A 3WYCA 2P7HA 4MVJI 3R20A 2AMVA 5KYNA 4CI9A 5LIRA 1WDTA 3NIGB 3ZNNA 3T7CA 5AO9A 4AI6A 4YUYA 3LLVA 3O4GA 2FMKA 1J6UA 4DDTA 5HIAA 3U7QB 4TL9A 3DOOA 2FEPA 1EK6A 2IDZA 3UMJA 2CHUA 3NDPA 4YUZA 2DERA 2P9YA 4WLFA 1QQAA 2IHVA 5EJ5A 1R8SA 3HEAA 3IDZA 3N7UA 3ND8A 4FKMA 3D43A 1LSSA 3RV3A 5AW6A 5DTJA 1YJ8A 3BMQB 4BX2A 4GVLA 3SC4A 1Z13A 3GNLA 2AK3A 3LKZA 3QXGA 4OM7A 5DV9A 4Z4CA 3ZCPA 1NHWA 5JT1A 4ZT4A 5TJ9A 1S01A 2QRHA 1D9ZA 1SCIA 1FE8A 2RGBA 1QRRA 2PDAA 4B2YA 4TKVA 2QNBA 3ZPXA 3L5OA 1V5EA 2PKXA 4UDYX 2C5LA 4IFIA 4MEAA 5CFLA 5I5EA 3WOVA 2OGTA 4YFYA 1ODLA 4E46A 1T2EA 1WABA 1UXOA 2P27A 1YTUA 3FBGA 1QZZA 2QX7A 2P6OA 4ID9A 4JCOA 2ON6A 3OJOA 3UJ7A 4NK5A 4DFDA 5K0CA 1CF9A 4H3KB 1JILA 1O9GA 2BGJA 3NHZA 4WY2A 3ZJ4A 5F21A 4Z1MD 3TLMA 1E4YA 2JGAA 2R6GA 2P69A 3C3AA 4MQ5A 4ZWNA 2EW2A 3RC2A 3NDIA 2ZWAA 5IT4A 2Z2KA 1EJ2A 1W581 3P4YA 2BF4A 3P94A 5GADl 3AERB 1X7GA 1ISRA 4PNZA 1GRNA 3JALA 3N7TA 4A6DA 4NXNB 1NRXA 2JIPA 4X97A 3HCCA 2PYDA 1X0XA 2AHOA 4H7FA 3IMCA 1FSSA 5JS8A 4UMDA 3PPXA 1BIFA 4EUNA 1NNUA 1PU2A 2GO1A 1QDUA 5BN1A 3G3EA 5LUBA 1JLKA 3WWOA 2CUKA 2H5EA 3EXG2 4I9HA 1X7DA 5IHPA 5JJCA 3L4KA 5C34B 4JUFA 4ZV7A 1YSCA 3DLCA 1A9OA 1TUIA 1KDYA 2HMVA 2ZSJA 3O2SB 4UOZA 3AHIA 3T5DA 2DH5A 3MWKA 2YYYA 3GYBA 4K2AA 4L5BA 4M0PA 1FFWA 4BVAA 5T4HA 2Q5OA 4LJ7A 4Q9AA 4R05A 2CVPA 3SBOA 1NLFA 3GZJA 3A6KA 3GT7A 3H99A 4UNNA 4WZAA 1CUXA 2E2WA 4OFBA 1W96A 3ZBPA 4JL8A 1R6XA 4CMIB 2VF8A 1E8DA 1JU3A 3L8FA 3NEPX 4L4UA 1QIEA 2NZJA 2VHTA 3E1GA 3E7FA 3LW7A 5EZYF 1H4VB 1WCWA 4KAJA 4QD3A 1BROA 2JIZD 3NP9A 3RT1A 2WG0A 3F7MA 2FP4A 5IJZA 2H6EA 1WV1A 4UUAA 2F8TA 5FI3A 2PGJA 4FINA 3VHXA 4HXFB 1GPNA 2GAIA 3O73A 1B73A 1UT8A 7ABPA 1WCYA 2P0AA 1I3NA 3WWPA 1MIOB 2HV9A 4QDUA 2D74A 3O7WA 3SIXA 4RQTA 2JHAA 4R0VA 1Z4LA 3AF6A 1JKXA 3I64A 3NTLA 2EIXA 4XJXA 1ONSA 2ISSD 4MDYA 3CNNA 3I2KA 3ZW8A 1USKA 4R1SA 4N0QA 3EZ7A 2K6GA 4M98A 3OX2A 3AY3A 4LKRA 4X1KB 2F9MA 3IBTA 1KIAA 1QH8B 2GZRA 3SEAA 1OJLA 1Z8FA 1QIJA 4GBGA 2OTCA 3WYGA 3H1TA 1SWWA 2CMGA 4ZVTA 1E3WB 4NCKA 5AJHA 1MUUA 4UTOA 2DFPA 1K7EB 3CGWA 4RKEA 3A1NA 1GZ4A 1E63A 5KJEA 3KBBA 5HSGA 4JOBA 6PFKA 4XSVA 1DIBA 2CLOB 4RAOA 1CRPA 1L5OA 2C1EA 4J0EA 4JLVA 1KFCB 3O7MA 2X6RA 3G6KA 3UKOA 1JHXA 1KORA 2OGSA 3OQPA 1EJ6A 2J3IA 1G3IA 1MORA 4PFJA 3PC7A 4K7JA 2ZI4A 3HB4X 1QU3A 3IIMA 2VP2A 3ZY3A 3RC7A 1LY1A 4HDSB 4Q16A 5IU6A 3O8OA 3BXZA 4FFRA 3ESCA 2BSQA 5LXTA 1E0SA 1LPSA 4K9RA 3FWKA 2AOWA 1IDN1 3C0KA 2Z5LA 1SH7A 4RLQA 4AS2A 2D8AA 2K5UA 3C5CA 3PGA1 2GBLC 4DA0A 4W9MC 3FTPA 3I28A 2C1XA 4BE9A 3H13A 1T34A 1ZISA 1BOFA 1XRMA 1AV7A 3I8SA 5FT9A 5IRCD 4LJ5A 4MAFA 2ZIXA 1GP2A 3JU3A 5GOZA 4C0LA 2VAVA 5DNYB 4BNTA 3PVCA 4OBBA 2ZBGA 2WB4A 5DWVA 4TGLA 2OCGA 1SCBA 4ZDWA 5CDGA 4I0WB 1HK7A 1IWPB 1M9NA 2PZEA 3FCCA 3AP3A 3NTOA 3QBDA 3EXEB 4NK4A 2P9JA 3R3ZA 4F3RA 1CUBA 4U2CA 5IT5A 1XCBA 4E31A 5B3AA 1R74A 3M6FA 3SC2A 1VI2A 1ZGJA 2VP4A 3KWLA 3LY9A 4EHLA 1WO8A 1ZCFA 3BTSA 3PG5A 1W36C 3E9RA 2YQ5A 4AN4A 1FVHA 1VJDA 1VLLA 1H2ZA 1N2BA 1NJ2A 1WR8A 3OTIA 3QOWA 4ACAA 3H2BA 1QVRA 3GNTA 5HHTA 1KK2A 1YQWA 5HTOA 1GY8A 4MR7B 4JJ4A 4MVJD 4JLMA 1XC7A 2BRUC 2W6ID 4FXPA 3RWMB 3P4XA 3VSCA 4F3TA 2YNMD 3RG8A 5G4KB 4K9OA 1E9VA 1K8RA 1NYTA 3Q5DA 1QUEA 3IIEA 2HJRA 4DA6A 5HJ5A 5CDFA 2NU8B 5C8YF 2HGZA 5IFKA 2XB8A 4Q4JB 1I94B 3A28A 3E2PA 1C41A 5J47A 1V1RA 1ENPA 1QQ7A 1RM0A 4NNOA 2PYIA 3OPYA 4XWTA 1GGHA 3LOUA 3OCXA 4Q9KA 5C37A 2CJPA 1G41A 1LK0A 1CUSA 1LSOA 1DRKA 2CLLB 2YYZA 4EG1A 1OYWA 5JC1A 4MGKR 2FWAA 3NJRA 4NDZA 5E6SB 4D4GA 4AY2A 2BDUA 1DKQA 2AOUA 4WCVA 3O8CA 1YDWA 3D4LA 3EXIA 3IQFA 3M0EA 4QT4A 4FILA 3M2PA 1P1BA 5BXYA 3DOIA 4R1MA 1IIBA 3EGXA 3NXKA 3UFBA 2G71A 2H1RA 4D8VA 5DCWA 3MGCA 4S0XA 1YRAA 1RPJA 2JJQA 3D6VA 3T9DA 1AK2A 4MKIA 2JI7A 4KW7A 3H2YA 3KJQA 3GLFA 4LF4B 3UUEA 4U6SA 3ZQUA 1P9WA 2HT6A 2JGEA 3MWDA 3QKWA 5BMVB 5HRCA 4DJ5X 1IJBA 4C4XA 1J99A 1EXMA 1ZI8A 3B1YA 3STVA 3AEZA 3F67A 3JQAB 3KZXA 3SIRA 3BFPA 2QSYA 1I33A 3MIIA 2P4SA 3N2GB 3N5CA 4U9UA 4C14A 2I4IA 3Q7RA 2Z1DA 4NOKA 3F98A 3LPNA 1GZHB 4ND5A 5JIBA 1FYVA 2JJ2D 3VVMA 2VHZA 1X87A 1KS9A 1OBHA 2UVQA 2XCUA 3BXOA 3EIWA 4FQ8A 2H0AA 4MYCA 3IVXA 5BV7A 1PWHA 4K6KA 3W1EA 3U56A 3V00A 2VQSA 5K8VA 3OKPA 2QM7A 2Q6VA 3GHYA 4NU8X 3UYLA 2VSFA 5G02A 1XA3A 5CFOA 3GLIE 3TLCA 1PK7A 1K4YA 1PTKA 5L95A 3PI6A 2GN6A 4KDEA 3OE1A 3PC8C 2Q3HA 4MJ3A 4TV9A 3FVTA 4U5XA 5IKXA 1XRLA 4MV6A 4J4HA 5I6DA 2OG1A 1EFPA 4Q00A 3RTAA 5K0LA 4M3NA 1ESEA 4ZJPA 3QX8A 4R84A 2DETA 4J03A 3NUQA 4MPDA 1JR3D 4CF7A 3I0MA 2JBWA 3Q12A 4BP9A 1OFIA 2GPYA 2YZ7A 2CWDA 4EAAA 1EFHA 3INRA 3UC5A 4RULA 5GIOE 4X93A 4ZFNA 1COWA 3UMRA 3UTDA 1HDOA 1Q74A 1Z5PA 2EDAA 4IJUA 2JIZA 3AF4A 3KV1A 4WACA 5JISA 2VHQA 3CX3A 1N6HA 3RGWS 1CF4A 1NVMB 1IXRC 2WPDA 2B3TA 5E8RA 1G7SA 4GLOA 1DRJA 3G0DA 3T9EA 2BFCA 1D2MA 3DFZA 2LR0A 3HZOA 1K4MA 2BM8A 2QSUA 1CX9B 2C2MA 3K96A 3P9CA 1XKQA 2OPHA 3TJZA 2V0GA 3NKLA 4EITA 3PJRA 2NSLA 3C3PA 2X9QA 4E07A 3DBLA 1O0BA 1E2HA 1P6UA 4XPIA 1NG9A 1WY7A 3RUDA 3IT1A 4D82A 1RHKA 3ODGA 5KHOC 3NAGA 2GPWA 3R3UA 4QYIB 4CMCA 5BWMA 4B71A 4DXDA 3DDZX 4XLTA 4F06A 1Q0TA 2GZMA 3OT4A 3VH4A 1HKUA 3LPCA 4RZUA 4N40A 4RFVA 1GFIA 2QP9X 1EGMB 4X6LA 5JTUA 2QT9A 3UF0A 4B6PA 4B31A 3GRAA 3KQUA 3LLUA 2CBZA 2JLRA 2H31A 4KHZA 4QTZA 3ETJA 3PUZA 2QUKA 4BV9A 1MABA 4CIYA 4LAFA 1KO5A 1UJNA 2HJHA 1KZ4A 2QQ0A 2RJ3A 1G20E 4IDEA 4OUDB 1YRBA 2A5JA 4Q9HA 3LD9A 4BNNA 2JGMA 4D4MA 4F2GA 1LBTA 2QB5A 3TKAA 1MO2A 1TQ4A 2Z3WA 2VQ6A 5JH7A 2EW8A 5HUHA 3NHUA 4CIAA 1EK5A 1K7XB 3FUWA 4NHEA 4ZVPA 1DWOA 3CVXA 2DP4E 3AR5A 2DYKA 3MJ4A 4KE6A 4KUEA 3LUDA 4EUHA 1JMVA 2XYHA 4R2JA 4EZIA 1MOSA 4TN1A 3VUEA 1RBMA 1B3RA 4H4CA 3W3AH 5BSGA 2Z4RA 2IYLD 3MD0A 4KVFA 5DOVA 5K9ZA 4C4TA 5EWJB 4ZYTA 3VR4D 3C6XA 3U0VA 3UAWA 1SXJD 3FOWA 3JD0A 3HYLA 3ZTWA 3IRVA 3GUYA 1M2VA 5CHEA 1SBZA 5EN4A 3HWRA 2FN7A 3IULA 4JB3A 3KNZA 1K08A 3T5BA 3QLJA 4UUNA 4RIHA 1Z25A 4D8UA 1EDEA 5AKXA 1WEKA 1CPYA 4FMDF 5EXPA 1MNAA 3BTOA 3ZC3A 1W36B 1JE0A 1LX7A 2VP0A 2NW6A 2Q4RA 4TLCA 1Z7BA 1ZVKA 3S70A 5C1DA 2HIGA 3VUFA 2BJVA 2V7PA 4G23A 1TD1A 2PVPA 2R7KA 1J1UA 1J9EA 4YUVA 4O4LB 4IILA 5JFGA 3PR3A 1G21B 1J42A 2JLAA 1D04A 3NJ8A 4RKFA 4DCPA 3QE9Y 4EB8A 4F4JA 2FPGB 2OUIA 1V1MB 3MYYA 1ZUIA 3LAWA 3OLZA 3QY0A 4JGBA 3CUWA 4AY5A 3TTWA 1EE9A 4Z9YA 3WHPA 3UPTA 3ZTYA 1VE3A 5DSTA 3EF3A 4YXWD 2L19A 1X7YA 5C7LO 4A0GA 1PR1A 2YNMA 4B73A 3RUHA 1YL7A 3AF3A 3FE2A 2PH1A 4KEAA 1H1DA 3IDQA 3L04A 1MH1A 4KR0A 3LUBA 5BYJA 2A5YB 3DMDA 3EVGA 4KO3S 4LOHA 2DPLA 2QU7A 4MS1A 5DGXA 5A5DA 2VHCA 5ER9A 1GCUA 2WVHA 2ZBFA 1W94A 4MIOA 4TXNA 1VP9A 5EJMA 4AUEA 4TXLA 3OQNA 1V7ZA 3H4VA 4BZXA 2R60A 4C08A 5DCLA 4EGSA 3DOFA 2XV1A 4W1PA 5KCMA 3NHRA 2J9FA 2XBMA 3ORFA 5IH7A 4YUWA 4G6ZA 2IF2A 2QL9A 4QDXA 4GDFA 1Y3BE 3LZ6A 1W73A 2WTNA 3DPUA 2P62A 3N8KA 3BVPA 2FKAA 2DWQA