4RF4A

Crystal structure of ketoreductase from lactobacillus kefir
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
250
structure length
250
Chain Sequence
DRLKGKVAIVTGGTLGIGLAIADKFVEEGAKVVITGRHADVGEKAAKSIGGTDVIRFVQHDASDEAGWTKLFDTTEEAFGPVTTVVNNAGIAVSKSVEDTTTEEWRKLLSVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPTLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLEGAEEMMSQRTKTPMGHIGEPNDIAWICVYLASDESKFATGAEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origins of stereoselectivity in evolved ketoreductases.
pubmed doi rcsb
source organism Lactobacillus kefiri
molecule tags Oxidoreductase
molecule keywords NADPH dependent R-specific alcohol dehydrogenase
total genus 93
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rf4A00
4R68A 3I52A 5EERA 3VZQA 4DLAA 2QYSA 2PWZA 4FC7A 3JYNA 4NH4A 4OMUA 4D44A 1WW8A 3FD8A 3BMQB 4FS3A 2GO1A 1Y6JA 4MP6A 1A7AA 3OF2A 3FNFA 4Q3AA 1AHIA 3B70A 1V8BA 2DC1A 1DBVO 2X0JA 1G0NA 1VC2A 1WZIA 3INRA 1TA4A 3V2HA 3M1LA 4OQYA 1R0LA 3NJ8A 1TEHA 1MUUA 4CR6A 1O94A 2AEMA 1CRWG 3CUKA 1DRVA 1JWAB 2FZWA 3I4CA 3P2YA 3HDYA 4K6CA 4RDIA 3PWKA 2HMTA 3R3SA 2X5JO 4M55A 1P0FA 3A4VA 1HETA 4P8RA 2AG5A 5FFFA 3T4EA 4CUZA 2YV2A 4BVAA 1BTOA 1PWZA 5JXWA 1CJCA 5CDUA 3K8ZA 2NV6A 1EVYA 4Y9DA 1LI4A 2Z1NA 4JJFA 4JXKA 2NTNA 5JNLA 2Y93A 3IKTA 1QYWA 5J23A 5DP1A 2DTEA 4BNJA 3CEAA 5JBIA 3HADA 2Y99A 3ENNA 4BO8A 1W8DA 4KZPA 1HXHA 2XOXA 3KYCB 4R5MA 3O26A 5CPBA 3H65A 2UUOA 2P5YA 3DB2A 1GV1A 1R0SA 3WTBA 4CQLA 3GMDA 1YB1A 3DR3A 1QYVA 3E9NA 3HZZA 5BT9A 2WJPA 3GG9A 1H93A 1N2SA 3I9NA 3MJEA 1ZK1A 1DFHA 4DYDA 4KWIA 2JCXA 1T2EA 3K73O 4B7CA 5FI3A 4IGEA 2BGKA 3BTOA 5CEEA 4CQMA 2PK3A 1TT5B 1ZEJA 3BYZA 2Z1MA 1YQXA 1HDXA 1VJTA 3DFUA 3FNHA 3R3JA 1U3WA 2AQHA 3EC7A 3IAHA 1LUAA 3NJ4A 4NFHA 4E33A 2UV8A 3M2PA 1PS9A 2EHDA 4IUYA 2X8LA 3PHHA 5HS6A 1KEPA 1T25A 4PLGA 3B6ZA 2E49A 4BB5A 1S7CA 1A71A 4IMRA 4IJVA 5THQA 3P7MA 2WD7B 5TX7A 2ZTUA 1D3AA 4P38A 3ST7A 5JDCA 3WJ7A 4NBVA 1UDCA 1UXHA 1AUPA 3DBRB 1YB4A 3OQ1A 4WCFC 3O4RA 3ZNOA 2GSDA 5A5FA 1A4IA 4RVGA 5KTKA 1F12A 3CMMA 1HE5A 1N8KA 1QLHA 3C7CB 2IZ0A 3ONEA 1X13A 2PFGA 5DDIP 2YDYA 4J91A 5HTOA 1D1SA 3VOSA 1SEVA 2ZJ1A 4I9NA 1PZFA 1R4NB 2XAAA 4DREA 3VDRA 5IJZA 1I2ZA 4BNKA 3ZN2A 2NADA 5AXDA 2BRUA 2ZTVA 1WNTA 3GRPA 3DWFA 3I9OA 3QWHA 2A94A 4XZ3A 4BKUA 1BVRA 3RBVA 1DFIA 2X4GA 3GAFA 3SJ7A 2B69A 2PD6A 3WGTA 1WVGA 4YRBA 3H7AA 4R54A 4YPOA 2G82A 2V6GA 4PLYA 1PJ4A 3JYQA 3W6UA 1DDOA 3EVNA 1U5AA 4G81A 1ZSYA 3ANLA 3I9LA 3ETEA 4TRJA 4L76A 3H3JA 3ADPA 3R1IA 2ZQYA 1M67A 3ROMA 4GAEA 1DHTA 4CLOA 3HUDA 3LLSA 4FW8A 4IZHA 3D0OA 4YJFA 1UXGA 2VUTA 3PWSA 2A35A 1N5DA 3QW2A 1MA0A 4YJHB 1HRDA 2ZB7A 2I65A 1ZXBA 4L4SA 4CR7A 3V1YA 1UXKA 1X0VA 1X7HA 4DLBA 3OFSA 1DFGA 1SPXA 5CP8A 4LISA 4J4TA 2FPGA 3W4JA 4D43A 5T67A 1B14A 1DIBA 4E4YA 4NPCA 4RORA 2CVOA 4XYBA 5EESA 1TT7A 1EVZA 1U9JA 5JW6A 4ND5A 3MEQA 4KDEA 4B8ZA 1DLJA 4DUPA 4RDHA 1ARZA 1UP6A 1ADBA 2FP4A 1U8FO 4OSOA 5IZCA 3O38A 1C1DB 1Y7TA 2AMFA 3BHMA 4RF2A 1A4UA 4I08A 3OEYA 1ISFA 3I6IA 3GK3A 1Q2XA 3U3XA 1GADO 5DF1A 3KLMX 2YZ7A 4EUHA 3GMSA 2EWMA 2EGHA 4PLHA 5F21A 3GVXA 2GRAA 2Y0CA 3N74A 2G76A 3O8QA 4MVJM 4YEDA 4MVJF 1DEHA 3JQ9C 2HLPA 4MKZA 4ZJUA 4CLHA 4CODB 4RZIA 4YQZA 2WWRA 3MOGA 3RD5A 1E5LA 2DBZA 1DJQA 3ZWBA 2BELA 1TT5A 2HDHA 2OORA 2OP1A 3GF4A 4MVJH 2J3JA 4XQGA 2Q2QA 2RIRA 4A2CA 4ALNA 2VTEA 1VJ1A 1VL8A 4FOSA 1Z7EA 4E32A 1QV7A 4ZQHA 1U3TA 1YONA 4ALMA 1ENYA 1ML3A 1QLJA 1D7OA 4AJJA 1Z6ZA 1NX6A 1ZMOA 2VWPA 4QQRA 3GHYA 2O4UX 2YY7A 2JD0A 1PJTA 3WBFA 4CMIB 4NI5A 5TSDA 1CQIA 1DIGA 2Y1EA 5L4NA 1DRUA 1T4DA 4MVJI 4X54A 4M86A 4O59O 1C3VA 3JQ6A 4J1NA 3I23A 4QTZA 2F00A 5U9CA 2NTJA 4S3MA 4B7XA 1EBUA 1W4ZA 1YB5A 2IODA 4LMRA 3QIVA 3UKOA 3W1VA 1MC5A 3U4DA 4Q3BA 2CFCA 4C7JA 2E48A 2NVBA 2EW2A 1GFSA 4IQGA 3DBHB 2RBEA 4BO7A 2X7HA 3RUCA 1PJ2A 4HFMA 2YYYA 3IP3A 4FOOA 1XDWA 3QV1A 4OO3A 3EGOA 5TJ9A 5BSHA 4HKTA 1GY8A 1ISJA 2P4HX 4CMIA 4OXKA 1H6AA 2AA3A 4LN1A 1P74A 3RASA 4J2HA 4D3SA 3ZWAA 4YT2A 4B8WA 4JLWA 2VWQA 2CF5A 3FSRA 2PD4A 4EITA 2I3GA 3EZYA 3SVTA 1CETA 1T24A 2A4KA 4EEZA 3ENKA 3PJDA 1GL3A 4RVSA 3ZV6A 2VHVA 5JSFA 4IXWA 4NG5A 5TT1A 4BNWA 4BV9A 1R6DA 5A05A 3PGJA 4UVIA 1NFRA 4WLOA 3OJOA 5FEUA 4IY1A 1E6UA 2DPGA 5IDWA 2Q45A 1CYDA 4WEOA 1H9BA 4UUMA 3TZQA 4FFRA 4XQEA 1T26A 4IDDA 3ZNPA 4P4GA 1DC4A 4RLSA 4E2WA 1M2WA 1K3TA 1UAYA 4IS2A 4ZICA 4YBZA 3AM3A 3KEOA 1PU2A 3JQBC 3DFZA 1LDBA 1DO8A 3OJ0A 4P4NA 2DTXA 3Q3CA 5L9AA 3AJRA 2I66A 2PGDA 4FJ0A 1LRLA 3UGKA 4NJMA 1CERA 4PVDA 4RLHA 1EUZA 4NZ9A 2O48X 3GNQA 3RAJA 3Q1LA 1HE2A 4IJWA 5HA5A 2ZB8A 1K6JA 4MIEA 3TFOA 2GN6A 3AY6A 4MO2A 3NTRA 1YL5A 3K31A 1C1XB 4OXNA 3K30A 4ONEA 1R4MB 1DC6A 3DMYA 3VTZA 1DLIA 1VKOA 5JY6A 1FXSA 4XX0A 2OXIA 3FNGA 4WEQA 3ZZNA 4YT8A 4A03A 1LDEA 2PTGA 1YL7A 3PJEA 1LLUA 4O5OA 2DAPA 4YJGB 3RBZA 5IAAA 1J49A 1G0OA 3V1TC 4Z0TA 3AI3A 1U7TA 5T6BA 2P2SA 5EQFA 2C20A 3WGOA 4L9RA 1YDEA 4OH1A 3OHSX 3NGLA 1ULSA 4GX5A 3C1AA 1DHRA 3DDNA 1V3TA 1ZBQA 3ZH2A 3GZNA 5L3ZA 3GG2A 1E0DA 2AEFA 3GH3A 3AI2A 5HWSA 3SJUA 3ZU4A 5CEFA 4RQUA 4BO0A 3PHJA 1WDKA 2PKQP 3HNPA 2BI8A 5I9MA 5HBRA 3VC7A 4E13A 2IRWA 2AW5A 5KVVA 4ND1A 1QKIA 4QO7A 5THKA 1HDCA 2EP5A 3KYDB 4DPLA 4RPHA 5IN5A 1IHYA 3VVBA 1YJ8A 2B4RO 3BIOA 1N7GA 3IP1A 4KP7A 1UDBA 1U4SA 4N54A 4YRAA 5HS4A 2ZJ0A 4FGWA 5EQDA 2P9GA 3T4XA 3BMNB 3KB6A 1DIHA 5IF3A 2JCVA 5IFLA 4J9UE 4AICA 1B8UA 4XGKA 2H6EA 1KY4A 1Y8QA 2QZZA 4E12A 4MJLA 2Z5LA 1GU7A 4Z3DA 1YXMA 1H6DA 1E7RA 5BSGA 3PDUA 3ICPA 1WXDA 3CSDA 4I5DA 3TZHA 1XEAA 3AY7A 2XF8A 4EI2A 1JVBA 1CQJA 4UAGA 2FHSA 2HQ1A 1ENPA 1PQUA 4G65A 3H5AA 4NDNE 4FJ2A 4MVJA 3KSDO 3D3WB 4YJDA 5I9NA 5IG2A 4GSKA 4CLDA 1I2BA 3HDJA 4HBGA 4A26A 2R00A 1U2GA 3FTNA 3GHHA 3NYWA 4FFNA 4RCVA 5JDIA 1F0YA 4RQTA 1P1JA 1Y81A 5DCUA 1MX3A 4XIYA 3PFWO 3VKVA 5G0TA 4FJ1A 2W2KB 3CXRA 3GGOA 2D5AA 3GZ4A 3KYBA 4BNYA 5I8WA 4IQ0A 4IJKA 5KIAA 4IIVA 1NPYA 1B3RA 2BHLA 4JK3A 5ENVA 3ZWWA 3S2EA 2A9FA 4JBHA 1KETA 1CF2O 3WDSA 3H6KA 4TRMA 3G79A 3JQAB 5EINA 5MGBA 4BNNA 3TZKA 3PHLA 5G4KA 4BB6A 3KHUA 4G5HA 1HLPA 2DUUA 1X14A 5G0SA 3WS7A 1O89A 2H5LA 4L74A 4OKIA 3C1OA 1IOLA 5TC4A 3PHIA 1V6AA 1VPDA 1G1AA 3I83A 1R37A 4GX0A 3BTVA 2VCYA 4RGBA 3WB9A 2PH3A 5BNIA 4DQUA 3SLGA 1NQTA 4H15A 1DB3A 2W2KA 1LSJA 2WM3A 5TF4A 4F6LA 2O23A 1TB4A 3SC4A 4XRGA 3JD4A 4Z3KA 3FHLA 5JC1A 3OH8A 3LF1A 1RM4A 1XLTA 2YDXA 1IZ9A 1XHLA 3OJLA 1L1FA 3ZU3A 4BGIA 4XYLA 5IN4A 3OICA 4MP8A 2HRBA 2GZ3A 1FDUA 4UUNA 5A9RA 1H5QA 1L7EA 1VJ0A 2VHYA 3D1LA 1B0AA 2OP0A 3WNQA 2C54A 3JV7A 2CUKA 4YWJA 1WMBA 2HK9A 3GVIA 5C7OO 4GWGA 1IL0A 1UP4A 2YHIA 1I3KA 1ZO8A 3QJ5A 2ZIZA 5COQA 2Q49A 3WIEA 2WYVA 1U8XX 3OM9A 2RH8A 1EK6A 1KVRA 4XB2A 1MB4A 1GD1O 5G0UA 2VWHA 1OC4A 3UXYA 1DAPA 3AU9A 4UVEA 4JQCA 2EP7A 1ULUA 4LVCA 1ENOA 2VWGA 1H6BA 5B4UA 3KBOA 4M1QA 4IBOA 4J7XA 2CVQA 2J5QA 1NR7A 3E9QA 3ICCA 4RVFA 4FSHA 3TRIA 1VL0A 3GDOA 3KUXA 3PJGA 3ZGYA 2H1SA 4CJXA 1K0UA 2W2LA 5ER6A 2W8ZA 3E9MA 1CDOA 2HCTA 3V2UA 3JQGA 1FK8A 3MWEB 3BTSA 2V7PA 2X9VA 1FJHA 1L7DA 1NFFA 1UUFA 2C5AA 2X6TA 2WE7A 2Q2WA 2W98A 2D59A 2YFQA 1YBVA 3ITDA 3ZV4A 1QYDA 2CVZA 4GLLA 5A3JA 3EK2A 4C4OA 5JO0A 1R15A 4HX5A 3PDJA 2CDAA 2G5CA 2VYND 4CMKA 3I9MA 3JQAD 3ZHXA 4YVFA 4WUVA 2O2SA 4ID9A 2NQ8A 2BLLA 4GX1A 4A7PA 2FY8A 3MJTA 5CG1A 4B3HA 4YTEA 5U4QA 4B4OA 5A1TA 4NR0A 1H94A 3ONDA 4XD2A 4D3FA 4D42A 3OJEA 2V6BA 4NBUA 4INAA 4DIFA 1KEWA 5CHEA 1P44A 4AJOA 2GD1O 3K92A 5L7TA 3E5RA 1RM5A 2VNAA 1LLDA 2JCYA 4CV0A 5L53A 4ESOA 1QV6A 1HYEA 3GNTA 1LA2A 4NNJA 3RUIA 3ZWVA 3GVPA 3T7EA 1ZNQO 1HT0A 4AJIA 1BSVA 4TVBA 4R1SA 2FZEA 2VUSA 4YDRA 3DQPA 3MZ0A 3WICA 4B3IA 4Y98A 5KJ6A 4OYRA 3VPHA 4PIVA 3OETA 4KUHA 4PZCA 2WD8A 4QO8A 4W9NC 1YWGO 2IZ1A 2VYNA 3FWZA 5KKCA 1NPDA 1M6HA 4F6CA 4TZKA 1EUCA 1DXYA 3BMQA 2EXXA 4K28A 2PZLA 4LRTB 3GEGA 1UR5A 1KYQA 1HYHA 4MDHA 4TRRA 5H82A 4Q3EA 1GUZA 4AL4A 4DMLA 2UUPA 4NK4A 4ZN6A 3L07A 1GAEO 2OZPA 4XA8A 3NTOA 4ILKA 2O3SA 6ADHA 5BR7A 1RYDA 1JA9A 3GZNB 3WYCA 4OIMA 3GR6A 5A5EA 3AUAA 1HE4A 3HB4X 2WDZA 2CSUA 3L4BA 4CLRA 1LRJA 1V3VA 4DLLA 3WMWA 4NK5A 1F06A 3EDMA 3ZW9A 1AGNA 4RPLA 2VT2A 3WGYA 1P33A 1GCOA 1E3EA 1QYCA 1Y8RB 1BMDA 5A04A 3A9WA 4YJGA 3WQQA 1C1DA 1N9GB 2C2XA 1PJBA 1C0KA 2OO5A 2OHXA 4JP3A 3DTYA 2DBVO 1C0IA 4DYVA 1P1HA 3PK0A 2PZMA 4RL6A 4CMEC 4NBWA 5EPOA 1ISHA 4U0JA 2PKRA 5ILOA 1SB9A 1V9LA 3Q2KA 4U5QA 3WTCA 4MOWA 3H4VA 4RV9A 3DOJA 2O3UA 4WGGA 3TOXA 5JLAA 3W8DA 4J9VA 3LDHA 3PZRA 3JYLA 4FN4A 1BXGA 5BQFA 3DBRA 4PCVA 4Q39A 1PSDA 4CUKA 3KM0A 1MC4A 3KVOA 2C2YA 4BGUA 4YAEA 1MGOA 3RVDA 1F8GA 1SOVA 2DT5A 1XQ1A 4J0FA 4WNIA 3W4IA 2DFDA 5AQ1A 3VH4A 1X1EA 2WTBA 3ZNNA 1XWFA 3HHPA 2VZ0A 2GR9A 3S2GA 2C07A 4YYZA 1JWBB 2IEDA 3TL3A 2RH4A 3ZHYA 3JQFC 3ZHZA 4PZEA 3ZWXA 3F5QA 1U7HA 3GN2A 2ZB3A 4B4VA 4BGEA 4CV3A 3ZDFA 1NBOA 1PIWA 4WLFA 3KEQA 4HFNA 2O50A 4FC6A 5KJFA 3OECA 5DP2A 3NGXA 1H0KA 2Q2VA 2BGLA 4YXFA 2OUIA 2ZTLA 5DBGA 3VPXA 2X22A 4MIYA 2D4AA 3NDRA 4DBZA 1E7MA 3DONA 1SEPA 3D4PA 3GOHA 1FDVA 2IXBA 5DCWA 1ZSVA 1G6KA 3OQ6A 3VZSA 1JKIA 1SB8A 1T4BA 3ASVA 2B0JA 1KVQA 4HWKA 4MP3A 3BHJA 1PJQA 7MDHA 4KTTE 4CM4B 3E5MA 3UFXA 3ZWMA 1OAAA 2VZ8A 4XIJA 3WFIA 5IXYA 4U6SA 3ASUA 5DOVA 5EN4A 4AJPA 4C7KA 3ZW8A 1PJCA 2AQ8A 5TS3A 3C85A 3BTUA 3QVXA 4H7PA 4AJLA 5JAMA 3PWZA 4R1NA 2DVMA 4IDCA 2H9IA 1CWUA 4M8SA 1I3MA 4WOKA 2G17A 3RUHA 4PG5A 4D79A 2GYYA 3ETDA 4LSWA 2Q4EA 3PPIA 4BNIA 1E1NA 3DOCA 1YBMA 4RF5A 4WPGA 1I36A 3F46A 5ICSA 2Y0DA 2RHCA 5I7SA 4JP2A 3EMKA 2OOSA 3HG7A 4W6ZA 4D0SA 2VRBA 5EMHA 4I5GA 3QWFA 4BNMA 3GUYA 2VNSA 3F4LA 1NVMB 4RJTA 2YFHA 3W8FA 4BQRA 4F3YA 1XELA 2DTDA 4NFSA 3CZRA 2ZB4A 4TRNA 3GQVA 4Y6RA 2EJVA 3UF0A 5BSFA 3OIGA 3FBGA 4J90A 2EJWA 1A9YA 2GF2A 4DXHA 3AK4A 2P68A 1PL8A 3KLPX 3NEPX 4BMNA 4IPTA 2QQ5A 1P1RA 3TSCA 1NFQA 2AG8A 5ILGA 2Y1FA 4CM9A 2OMEA 5TT0A 3RC2A 4XKJA 1IE3A 1RM0A 3RBXA 4ZRNA 3ABIA 3CMCO 2HK7A 4JGBA 1P0CA 2P9EA 1LLCA 1H2HA 3PHGA 1PS8A 1PL6A 3AOEA 3I3OA 1PGJA 2NU9A 2YHIB 2JHFA 3OP4A 1A7KA 3E48A 2B4QA 4E6PA 1BG6A 4W4TA 5K9ZA 1KC3A 2E4AA 7ADHA 2BMAA 2WYUA 1HEUA 1HSOA 5L7YA 5JC8A 2ZTMA 1GZ6A 4K1LA 4WOJA 4UUOA 1J5PA 3GA0A 4OSPA 3DOOA 3W6ZA 1JW9B 4L75A 4I5EA 2Q1TA 3GC6A 4ND2A 1AXEA 4S1VA 1OI7A 4G2NA 3WYEA 1E92A 1NHWA 4AJ4A 5I9LA 2O7SA 4ALLA 4J1TA 4KUGA 5KCZA 3CINA 3QSGA 1I10A 2HK8A 3HJAA 3VZPA 2Z95A 4L8VA 4LMPA 3R6DA 3TN7A 1YJQA 3R0IA 3LT0A 3NRCA 4N5MA 3H2ZA 4TROA 1LLQA 1O5IA 4OXYA 2YQ4A 4GSLA 3U9LA 4L0QA 1LDYA 3BHIA 3I1JA 4WLVA 4NJOA 4D3DA 4PLCA 5AXBA 5JMWA 1GEEA 2YUTA 1H6CA 3MJCA 1J6UA 1HDYA 5JAIA 4RVHA 4ZHSA 4A0SA 2EERA 4RPKA 2Q50A 3E18A 1DIAA 1P31A 4JJIA 4XDYA 4PVCA 3FPLA 3LT1A 3U4CA 3LK7A 1PZGA 1ZZEA 3EAGA 5GZ6A 2GZ1A 1JU9A 2P4QA 4DIOA 3F4BA 4JBGA 4OQZA 2JD2A 3I9KA 3U49A 3PQFA 4R1UA 1NR1A 5DCYA 2AQIA 2I67A 3V8BA 4EDFA 3PYMA 4YT4A 5HRUA 1LNQA 1XA0A 3UH1A 2PR2A 2OBYA 2Q4BA 1GUFA 3TPCA 4URFA 1EK5A 3DMTA 3GPDG 1PL7A 4OOFA 3FR8A 1ZK3A 4GKVA 4LVUA 4WCDA 3G17A 1BGVA 1LXCA 4W7HA 4ZA2A 3AFNA 3DAFA 4GKBA 4CQLB 4DWVA 5JCJD 3Q2IA 3FRJA 4GH5A 3D3WA 4GL4A 4B79A 4EUFA 4BO6A 3LC7O 4E5MA 3QVWA 1YH3A 2HRZA 3VKUA 1ZJYA 3M6IA 3GUCA 2Y66A 1YE3A 5T5QA 3UW3A 4UVHA 3JQAA 3FPCA 5TRTA 1LSOA 1I2CA 8LDHA 3LYLA 3L9XA 4CL3A 3BAZA 1LDMA 4ND3A 3WBBA 1XR3A 4IDEA 1E77A 2HO5A 5FWNA 1N92A 4HFRA 1H9AA 3QE3A 1AHHA 2B83A 2VT3A 3ANMA 3KV3O 4MINA 1NPTO 2CF6A 3K6JA 3QHAA 3TQHA 2GGSA 2PKQO 3LC1O 4O6VA 3B1JA 3ROQA 1EE9A 3OIDA 4PZDA 1N9GA 1BW9A 4AVYA 4PLWA 3D4NA 3FBTA 4F46A 1T2DA 4OGWA 4BNTA 2VYVA 5B37A 1UJMA 2HMSA 1Y8RA 3QWBA 1SNYA 3F1KA 4IS3A 4R01A 3K9QO 2Y68A 3RJ5A 1RWBA 5ITVA 1D1TA 1GPJA 1KVUA 4WASA 1UZLA 5LDGA 1DJNA 4IDBA 4UEKA 2HJSA 5TNXA 3RCBA 3WR5A 1NP3A 1DOHA 1GYPA 1N1GA 3MJ4A 1FF9A 1KEVA 3GNSA 1NM5A 4LCJA 4J16A 1Z7BA 1CIVA 1DRWA 3WQRA 4CM8B 1WP4A 3E8XA 4XCVA 2DKNA 2JAHA 3CZMA 5JAQA 4QSMA 4TQGA 4LW8A 3UCFA 1WAMA 1M76A 5C37A 2JAPA 2VUUA 3BMNA 5C7LO 5JYEA 1KIFA 4BNLA 2FRDA 3AM5A 2JHGA 1Z73A 1IULA 4OKNA 4A73A 2DUWA 4UEJA 4R9SA 4F45A 3PRJA 1GQYA 1A27A 2B37A 4N5NA 4IGFA 2Y67A 4K9DA 1OFGA 4FBGA 1UDAA 4LK3A 3EY4A 1Y8QB 3HDQA 4BUCA 5GMOA 4R51A 4P22A 2TMDA 1E5QA 3O8QB 2QX7A 1NQAO 3JQEA 5DZSA 4RVUA 2HSDA 4FR5A 3QLJA 2I99A 3NDIA 1YDWA 2EGGA 2NQTA 2POQX 4Y6SA 4E30A 4JCOA 4O0LA 1P1FA 4YAJA 4B3JA 4E2ZA 1R16A 3E1KA 1LDGA 1BDMA 5CAEA 3RFXA 1DC3A 2JFHA 3PLRA 3GEMA 2QHXA 1MXHA 3AY3A 1FDTA 2HU2A 4B4UA 1HSZA 4OL9A 4PG6A 4QUKA 5B4VA 2EF1A 3INGA 2FR8A 5KVQA 1DPGA 3IJPA 4CM7A 2JD1A 3QVTA 3PYXA 4PG7A 4U7WA 1E6EA 3N7UA 2Q3EA 4GVXA 3WGQA 2J3HA 3PEFA 3F9IA 4NHEA 4YRDA 3OA2A 3ZU2A 4U6QA 4CL8A 5LDHA 1HF3A 1SAYA 3PI7A 1C0LA 4TVOA 4MIOA 2NTVA 5CDYA 2C59A 5A9TA 2A92A 1K6IA 1X7DA 3DHEA 1GQ2A 2BFMA 1EE2A 3GPIA 4FFOA 1E3JA 4Z0HO 3Q9UA 2YW9A 2PZJA 2I76A 4YAGA 4IDFA 5TGDA 3WQSB 2NLOA 3AW9A 1BXKA 3UUWA 3ZWPA 3JQ9A 1D4FA 1LSUA 4ALKA 3F47A 3NTQA 1VSVA 1I30A 1T1SA 1I8TA 1PS0A 5CPFA 3JQ8B 3ZV3A 3H9QA 1XU7A 4Z9XA 4EEXA 3KOUA 4UREA 2G0TA 4UUPA 5TQVA 5KJCA 1E7SA 3LF2A 6LDHA 4CMGA 3QY9A 5JMPA 1E3IA 1SC6A 4EZBA 3QP9A 1E6WA 1QR6A 1FDWA 1R66A 3OBBA 3BXXA 3V5NA 2Y1CA 3L6DA 3P2OA 4JJGA 4P4LA 3HQ4O 3DZJA 2VOJA 1VLLA 3SEFA 3WGZA 1YBAA 1M66A 3COSA 1NQ5A 3JTMA 3VZRA 4JNKA 3SC6A 5F5NA 5H81A 4CLRB 1KC1A 5ER9A 5TJHA 1EMDA 4FCCA 3VH1A 3LZ6A 2B35A 4PN3A 1HKUA 2OL4A 3CIFA 1X15A 1ORRA 5T8KC 4CM8A 4O1MA 1NYTA 3E82A 2VZ9A 2EV9A 3DZIA 1R0KA 3PGXA 4RPJA 4XWYA 1ONOA 3TL2A 1PGQA 1TXGA 1VKNA 1QRRA 3NT5A 3AM4A 4Z6KA 5DN9A 1I5RA 1VM6A 1HDGO 2BI7A 4XGIA 1E3LA 2NNLD 4CM4A 2YQ5A 5L7WA 3DMTC 1U1IA 1RKXA 3HN7A 4DGSA 1F8FA 3ZV5A 4YAIA 3Q6IA 5I7EA 4ZQFA 1Y1PA 5IDYA 2GASA 1K6XA 2R00C 2SCUA 3PJFA 3QWIA 3HN2A 5JS6A 3AUUA 3MTJA 5T64A 3DBLB 1I3NA 4Z9FA 2FOIA 2WSBA 3F5SA 3LQFA 3ROKA 4YQYA 4E5NA 1Q0LA 5A9SA 4MKXA 1UH5A 3HDHA 3B20A 4NJMB 4BKOA 3Q0EA 1NWHA 1XSEA 4KQXA 5IZ4A 3D4OA 4HNGA 1ZFNA 3Q9NA 4GPD1 4A5OA 1WDLA 1U28A 2LDBA 2GNAA 4CLOB 3EHEA 5I8ZA 1I32A 2LDXA 5F5LA 2CDCA 2PD3A 5F3RA 1AXGA 3S2FA 1B2LA 1Q1NA 4BQPA 3NKLA 2QYTA 1MV8A 4W7IA 5F1PA 4CM3A 4BOYA 2CNBA 4GVLA 3HB5X 4DC0A 1ADFA 1LQUA 1VL6A 3PQDA 1NASA 4XEHA 4DTIA 5C3MA 3DZKA 2GERA 4XYGA 5DOZA 3Q11A 4OAQA 2D5CA 4FB5A 2Y1DA 3TOZA 4FPXA 1BDBA 4RF4A 4EUEA 4OJNA 4HP8A 2C7GA 3DL2A 2Q1SA 4CPDA 3C8MA 1QXSA 4EYEA 3H2SA 3H5NA 1PR9A 4GLOA 4R3NA 4NBTA 1R4NA 1NHGA 3GAZA 4ITUA 3G1UA 1HYGA 5FI5A 1GUYA 2DLDA 1OZAA 4Y67A 1EZ4A 3L77A 4L4RA 2JKVA 4II3A 4PG8A 3C7DB 4CMJA 5L4SA 3MJSA 1E7YA 4IIUA 4O63O 4KWHA 4BHTA 3UAGA 4YB8A 2BKAA 2DM6A 1B26A 1PJ3A 2NU7A 3JSAA 3MWDB 4GMFA 4E2YA 4J49A 4WK6A 4BNVA 2G1UA 1B8VA 2DU8A 3D3EA 4BL5A 4D7AA 4CMHA 4I1IA 3KZVA 1ISGA 2FWMX 1XKQA 4TKLA 1VSUA 1P77A 4EJMA 1EQ2A 4CM5A 5ICMA 3VHRA 2QRLA 3IUSA 1MXFA 1WMAA 1UAGA 1PZEA 4GMGA 3UICA 3WLEA 4FFMA 4BV8A 1ENZA 1V35A 3CE6A 4TMFA 4MVJP 1ONPA 2IYOA 5G2OA 1P45A 2ILTA 2PA3A 5KWEA 4NBRA 2PNFA 1MG0A 4BNXA 1KS9A 3MOIA 2EKLA 3L9WA 2O3QA 4IJUA 3RC9A 4L4XA 4ZGWA 3B1KA 3G0OA 3SX2A 3DAPA 2J3IA 1YQGA 3LC2O 3S8MA 4KMSA 1NQOA 3FTPA 3GLQA 3AFMA 3IDSA 4OOEA 3K5PA 5IDQA 4J7UA 2R2GA 2OFPA 3OIFA 2YV1A 4Q3CA 4DPKA 1VRWA 4ZQEA 1BRMA 1LEHA 4XR9A 4R3WA 4BO5A 1SBYA 1ZXLA 2E82A 2QZ9A 1E3SA 4E2XA 1E7QA 3A06A 3GFBA 4J0EA 2BFOA 2J5RA 1KVSA 1AN9A 3FR7A 3UCXA 4J4BA 2O4CA 4JX8A 1XGKA 2OGUA 3WOHA 5DULA 4I8XA 1PX0A 4DBVO 2W90A 3F3SA 4TSKA 1Q0HA 1HZJA 1QG6A 3NV9A 2D2IA 5FYDA 2E37A 4MPDA 4WNCA 1LSSA 1U3VA 1T2FA 2X23A 2QW8A 3WMXA 1W6UA 3ROPA 3U62A 5A02A 2P91A 2VHWA 3LU1A 4WCFA 3RIHA 4M87A 2ZQZA 3ZCXA 4D46A 2ZKLA 1IUKA 4AJ2A 4WLUA 5F1KA 4BO9A 5B12A 4TZTA 4ZU3A 1XQ6A 3K96A 3MCVA 4OM8A 4KQWA 2RHRA 3H9GA 4K6FA 2C7VA 4NQZA 2GCGA 2X9GA 1TLTA 4Y8VA 1LC3A 3D5TA 5A4DA 3PVZA 1P9LA 2NVWA 4JN6B 4MVJG 3SLKA 2Q1UA 4GGOA 2X0NA 4A27A 3GEDA 3H8VA 5ENDA 5CEJA 4MVJE 2FSSA 5C5IA 5ITWA 3DZBA 2BFPA 4R4JA 1LTHR 3ZWNA 2YHUA 4HV4A 1GZ3A 1JAYA 4CUJA 2H63A 3P19A 1IHXA 4E5KA 4AJEA 4RF3A 1MFPA 1LX6A 2NM0A 3AUSA 4UEOA 4XYMA 4R69A 1UP7A 3CTMA 2DBQA 4JBIA 3TF5A 3A28A 4CLEA 4GI2A 1DIRA 1HDOA 2I5PO 4L73A 2FPIA 1XIVA 1B7GO 1YOVB 4J1QA 4N5LA 3DC2A 4DPMA 5AOVA 3EW7A 4GWKA 3TNLA 1H2BA 5COBA 4IQ8A 1SMKA 2HMVA 4B7UA 3M1AA 1GYRA 1AE1A 1HDRA 1XCBA 2HUNA 2JL1A 1V0JA 4CMBA 2NACA 3WYBA 4D41A 3JQBA 3KYCA 4XYEA 2ZYAA 2UVDA 3EVTA 1ZH8A 3X2FA 3E03A 4BKQA 3PQEA 1BW9B 1JN0A 3M2TA 1LU9A 4LGVA 1QORA 1C0PA 3C7AA 3JD0A 2AXQA 3RKRA 3CKYA 4CM6A 3H9EO 1RPNA 2AE1A 2AEJA 1U4OA 1YS4A 5JCXA 2JFGA 2IXAA 1GPDG 2PY6A 4XRRA 3RC7A 3ZWCA 3K2EA 5BNFA 1GR0A 2EW8A 4NFYA 3MJVA 1TVEA 3I6QA 1UXJA 1UXIA 3TDKA 3GN1A 3RKUA 1JDJA 4UVDA 1W73A 3NUGA 4BO2A 3H5RA 4IMPA 4DQXA 3VAZA 3RFTA 2VRCD 3BA1A 3VVCA 3GVCA 2UAGA 4XGNA 3WG9A 2GLXA 4QEDA 4XJSA 2I6TA 5JY1A 2UDPA 4BGVA 3D7LA 3BMOB 4BIIA 3WX0A 2B36A 1S6YA 5G4LA 3V2GA 4PRLA 1R4MA 4DRYA 3W4KA 2NUAA 3WFJA 5CFZA 1HE3A 3E6AA 1A5ZA 3A1NA 4IM7A 1T1RA 4YR9A 3MTGA 4IDGA 3ANNA 1IYZA 2X5KO 1WWKA 1ZK0A 2FSVA 5DBFA 3ADOA 3ZHBA 2FPPA 4K26A 4HADA 3VTFA 3IOYA 3GGGA 2NU6A 4BO3A 2C82A 4LRSB 5JFOA 3N58A 1NAIA 1X7GA 3SBOA 2FN7A 2VOEA 3BMOA 1ADCA 3WJAA 1T2AA 4PG4A 1LJ8A 1LRKA 2DFVA 5K6AA 4XDZA 3HE3A 5DT9A 3PTZA 1C1XA 5DBIA 1B16A 2VN8A 3U4HA 4U0KA 3A14A 3HSKA 1JQBA 1EEHA 3DTTA 3FNEA 2VHXA 2XPCA 3JQ8A 3UN1A 3W8EA 1GEGA 3JQ7B 1Q0QA 5KNLA 2HMWA 3KRTA 3ZU5A 1SZJG 3RJ9A 3VPSA 4H3VA 3I9JA 2O2YA 4HY3A 4TWRA 4DL9A 1KVTA 3WGHA 3QQPA 4XR4A 4ALIA 3K2BA 3L4SO 2NVUB 1EUDA 4JROA 5JPIA 2X9NA 3OQBA 4Q9NA 1VI2A 4BS9A 1X1TA 1IZ0A 3IJRA 3WSWA 5LC1A 3VPGA 2X5OA 5BNTA 2VTDA 1MFZA 2Q1WA 4W82A 4DVJA 5A03A 1Y9AA 1ZCJA 5JDIC 4PLPA 1Y5MA 1O9BA 1YVEI 4N18A 1EFLA 1NAHA 3AOEC 3NAQA 3NX4A 1DC5A 4RPGA 3B1FA 2JFFA 1YOVA 2BD0A 4HFJA 4R9RA 4DMMA 4FDAA 5AXAA 5IXSA 4ZQGA 1ISMA 2AHRA 3RROA 1DAOA 3JYOA 3IC5A 4CM1A 3U09A 2QG4A 2Q46A 5T57A 2B5VA 2F1KA 1PZHA 3WLFA 5GZ3A 2BGMA 3C24A 2CZCA 5KVCA 4UVGA 1YQDA 3CH6A 5G0VA 4XB1A 1PGPA 3U0BA 3PFFA 3JQCA 4GX2A 5AVOA 3UCEA 1J0XO 3ONFA 4CLXA 2CMDA 1U3UA 2Y1GA 3PIIA 4PLVA 2R6JA 1A72A 4QXMA 2RCYA 4FIZA 4J4HA 3IMFA 4IINA 3H9JA 3ZI0A 2TMGA 5GZ1A 1N7HA 3PP8A 1P3DA 2I3AA 4I5FA 5IDXA 4QT0A 1K5HA 4H16A 3O03A 2Y1OA 4GBJA 5F1OA 1EBFA 1Z82A 2HMUA 3FCOA 3KSUA 1NVGA 1PQPA 4PLZA 2NWQA 5B1YA 4EW6A 4YACA 4EJ6A 4ND4A 4RO0A 3GVHA 1TI7A 1PGNA 4J1SA 2FR0A 5K6AC 1O0SA 1YL6A 4FFPA 4WE3A 4GGPA 1EDOA 1IB6A 3IL2A 4HNHA 2J8ZA 3C1TA 1ISIA 1F14A 3RUEA 5G0WA 3TJRA 5BSEA 3QA9A 3WNVA 3DO5A 4II2A 5U1PA 3U5TA 1N1EA 4WKGA 4CMAA 1WLYA 3IUPA 3RUAA 3LSYA 5I7VA 1R12A 1Q7GA 5DNAA 2PV7A 2WEKA 3ETGA 3IKVA 1UZMA 1ZSNA 4FGSA 1HWYA 1F17A 9LDTA 4IXTA 4R16A 4M49A 3WGGA 3EUWA 3OMLA 1E7WA 1VE9A 2JJYA 4WCFB 3WWYA 2D0IA 5AXCA 1FDSA 2EKQA 1EVIA 1NWCA 3OJFA 3QVOA 5CDGA 5KOIA 1EQUA 3JD2A 3DBLA 3OEWA 2VYVD 3ORFA 3VDQA 2E6UX 1E3WA 1OOEA 4J7CA 3KO8A 1KBZA 1HDZA 5JAZA 1ZW1A 1SO8A 4DC1A 8ADHA 1ZK4A 5L40A 5A9SB 1WZEA 4AJ1A 2HKIA 2QRKA 3FN4A 1NTOA 3IQDB 4YT5A 4J3FA 4EBFA 1OMOA 3AUTA 4XJTA 3F6YA 4U8GA 5I7FA 4I9UA 3JD1A 3TWOA 2IDZA 3ZWOA 4BNZA 2X86A 2I9PA 4J6FA 1QP8A 1EDZA 4IDAA 2X0RA 4MKRA 3TFQA 4BKRA 1D8AA 2GDZA 2EG9A 4YJFB 4Z0PA 3GFGA 4E3ZA 3RI3A 4YJHA 4QX6A 4DQVA 1PQWA 4CR8A 2WMDA 4BNFA 1YO6A 1KEUA 4ROSA 2IYPA 3WIDA 5MDHA 3L6OO 1ADGA 1GQQA 4KUEA 4ZRMA 1M6WA 1WPQA 2J5KA 3G49A 3VH3A 4BMVA 4CQMD 4E0BA 2BF7A 4WLNA 4KOAA 1FMCA 4XQ9A 5JCJA 1PTJA 1JAXA 1CEQA 1BXZA 2C0CA 5EJ2A 4TKMA 4NIMA 3PIDA 4FD3A 4AFNA 1J4AA 3ITKA 4OHUA 3RC1A 4BKPA 4KTVE 2ZK7A 4PGFA 3WXBA 1PWXA 1OC2A 3RSHA 1YGYA 3UHAA 3X2EA 1BVUA 5LCXA 2GN4A 4E31A 4HXYA 2QIOA 1NNUA 3EYWA 1JLLA 4N7RA 3RU9A 3LT4A 2XXBA 4FQ8A 2DBRA 3C3XA 1M75A 3JQDA 4W99A 4BO4A 1EFKA 1U2DA 4PRKA 1ZIDA 3G1TA 3G3EA 5L95A 4BNUA 1XU9A 3GDFA 3JD3A 5GY7A 4QFDA 3KSZO 2VRCA 2PZKA 3UOGA 4A10A 3NT4A 1ZUD1 5L4LA 5A06A 3L0DA 4RZHA 4PLFA 5TLSA 2YV3A 2HJRA 1RJWA 1ZK2A 3VPFA 2QRJA 3STHA 2V65A 3INTA 1JKFA 1BWSA 2WD7A 5JE8A 3RUFA 3UVEA 9LDBA 3AU8A 1HL3A 3O9ZA 5B4TA 1B3BA 1Q7CA 1LC0A 1Z45A 3S2IA 1PEDA 3BZUA 1U5CA 4BNHA 1P1KA 5L51A 3I5MA 2X0IA 2PGLA 2GUGA 1PGOA 1RYEA 4GQAA 4MVJD 3OA0A 4CQMB 1PJLA 3PXXA 1JVSA 4UULA 1Y5RA 2PLAA 1YRLA 1WDMA 4AJHA 3DEYX 2CD9A 2FMUA 5KJ1A 1V3UA 1X0XA 3QRWA 4KDFA 3D5QA 4J43A 3QVSA 2O3JA 5AYVA 1NVTA 2NVUA 3FWNA 3GRKA 1ZJZA 4Q3NA 4ALJA 3FF4A 4ZQBA 2WYWA 4E5YA 2ZCVA 4Z9YA 5FF9A 3S55A 1BXGB 1LQTA 1JTVA 4QECA 1P1IA 1GTMA 3WWZA 1I01A 2YJZA 2J3KA 3DHNA 3RU7A 2EKPA 1QMGA 5C7IO 5TIIA 3JQ7A 3D64A 3KXDA 2ET6A 5A3VA 1LDNA 3DBVO 3F1LA 3H9UA 3DBHA 5COAA 2P9CA 3SXPA 5JYDA 2WE8A 2ZATA 2D3TA 2D1YA 5EL0A 2XXJA 2CY0A 2O3RA 2P5UA 4XQCA 3HFGA 3JYPA 1IPFA 4FFLA 4LCEA 1I33A 4M54A 1I24A 1KY5A 1RM3A 3PYLA 2EIHA 3GGPA 4IZIA 1QYXA 5EIOA 4CV2A 5L45A 4AG3A 5CG2A 1ZEMA 4AJKA 4WECA 3V1UA 2D8AA 2IEBA 2ZYGA 1I0ZA 3KETA 2NSDA 4DIBA 3GDGA 4E21A 1MLDA 5H83A 4WJZA 2GN9A 1Z74A 3IIEA 2ZCUA 1Z75A 3VH2A 4EJ0A 1YKFA 3LLVA 2B5WA 3KTDA 3U4IA 3T7CA 4BMSA 5CDTA 3RQSA 4NU5A 2DPHA 1GDHA 5T8KA 1ONNA 3DXFA 3ON5A 5G4KB 3BMCA 1E1KA 3DZHA 3RFVA 3RUDA 1O6ZA 3CPSA 4CV1A 3EZLA 5ES3A 5KKAA 1NXQA 3P5SA 5CDSA 2ZYDA 3GT0A 1KERA 1MG5A 4W9NA 1QSGA 3AWDA 4CMCA 1MP0A 3PZBA 2UYYA 4AJNA 2IE0A 4M89A 2O3TA 1SOWA 5JO9A 4Y6PA 5ADHA 3GY0A 2IZZA 1GZ4A 3HFSA 5KJEA 4R5HA 3S1LA 4DA9A 4Q3DA 5HM8A 3ZNQA 3PLNA 4R1TA 4WLEA 3LT2A 2C5EA 2Y05A 4JIGA 4ZVVA 3HWRA 1T2CA 3QWAA 3WGIA 2GN8A 3FI9A 2FR1A 1B8PA 3OSUA 1PR3A 4EGFA 4ZD6A 5KVSA 3L4BC 3RWBA 3BMCB 4I9HA 4QFCA 5IZCC 4YAKA 3H3FA 3DZGA 3JCZA 2O7QA 2C29D 2X1HA 3TZ6A 2VQ3A 2V6FA 4D0RA 1K89A 1HZZA 1KOLA 2VHZA 4PFJA 3L6EA 4HUJA 4BNGA 3ULKA 1Q7BA 3IS3A 4PLTA 1B15A 2B4TO 3I4FA 1JKJA 1DSSG 1PJSA 1LBEA 2RAFA 4E5PA 2HAEA 4CMEA 2W4QA 2GZ2A 1OBFO 1HLDA 2PH5A 1ZMTA 2BH9A 2PGJA 1A9ZA 1UZNA 1EVJA 1GV0A 3AOGA 3DHYA 2AQKA 1GYQA 3LVFO 4J2OA 3ZWYA 4B4WA 2Y0EA 1ZVMA 1XYGA 1W0CA 2NU8A 4RVDA 3JQGB 2OBNA 2EEZA 3AI1A 3TZCA 1HTBA 1ID1A 1Y9EA 2W2LD 1ZKMA 1BHSA 1K2WA 3NT2A 4CM9D 1SCUA 4D45A 1O95A 4YA6A 1IPEA 2DQ4A 3DZFA 1E1MA 4YCAA 2V6MA 2CDBA 1E3WB 4LSMA 4R41A 4NMHA 2J6IA 2Q99A 2GPTA 3KYDA 1GCUA 1O8CA 1XG5A 5K0ZA 1C14A 1E1LA 3DAGA 3NDJA 3JQFA 2AE2A 1IY8A 5JDCC 2X58A 4BO1A 4NU6A 2BFAA 1I3LA 3WSVA
chains in the Genus database with same CATH superfamily
3E58A 3QEJA 1TYBE 5HEKA 4H9GA 3VZQA 4DLAA 2DCUA 5CB4A 2P11A 1ZU5A 5IH7A 2DWPA 3P32A 2PWZA 3JYNA 3N0WA 1TCVA 4HX9A 4NEHB 1W85A 1WW8A 4XM2A 5CB6A 3CNNA 4DA8A 1DKPA 3SQOA 2GO1A 4IH1A 4MP6A 3TQQA 5FOQA 2D7JA 1N2HA 4Q3AA 2ZI9A 3IGFA 4LY9A 5AO9A 3B70A 2HHCA 3KYIB 2X0JA 1OB5A 2A9JA 3HBLA 3JQRA 3M1LA 5AVKA 5BW5A 4OQYA 1N2GA 1KQPA 5HQJA 3TSAA 3R77A 5JNVA 4J03A 4NXMB 1OBCA 1MUUA 1X3LA 1N5RA 1G2OA 2QSUA 2GWRA 2ZE5A 1HE8B 1W35A 2QE7D 1IOZA 3FFBA 3HDYA 3P9YA 1GSIA 3QENA 3IR6A 3PWKA 2VT6A 2X5JO 1MPXA 3MCTA 1I9GA 4JBYA 5JZMA 1P0FA 2QPOA 1R10A 3UAOA 2A0WA 4EK9A 4GLFA 1YFJA 1BQ3A 2FP3A 3DWIA 3KAPA 4I4TA 3ESYA 5IUNC 5LUAA 2OBFA 1QDEA 4AJPA 4HPWA 4LXTA 4C29A 1T9GS 1Z62A 2P9YA 3MFYA 4JJFA 2NTNA 3IKTA 3CKLA 4TWZA 1OZGA 9ATCA 3KVRA 1HFEL 4G0XA 4BNJA 1EUYA 3DV2A 2HBQA 5D01A 4DDWA 1QG0A 3O26A 3H65A 3WA6A 2Q6KA 4B75A 1UKCA 1DO2A 2WZDA 5CYOA 2HY7A 1P4RA 2QN2A 3L43A 3GMDA 3RVOA 1I4EB 1UZUA 1YA6A 4DNXA 2HQRA 1PDWA 3DR3A 2VDLB 3E15A 3OZEA 4B73A 2QJFA 1XRJA 3E9NA 5JSHA 1Q11A 5BV1A 3C3KA 1B2RA 1WUHS 2GUWA 2P4UA 2R6GA 1YT5A 1Z4IA 4ZU1X 4DYDA 4Q9JA 3P0RA 3M9WA 4JI2B 2JVKA 4HDMA 1F4LA 2ATIA 4IGEA 4LZZA 5FCDA 3HVHA 1QAMA 3EJ6A 1PBTA 1YQXA 1HDXA 1VJTA 3AJ9A 1AUVA 3EQ6A 4MH0R 4W5NA 2KLBA 4L9AA 3EC7A 1LUAA 1DDGA 2CJWA 1KMHA 3EA5A 3IAUA 3M2PA 1E9BA 1S01A 3HYTA 2X8LA 1R8XA 1UDXA 1WB6A 2ON6A 1KEPA 2QTHA 3MS2A 1T25A 2R3SA 1S3IA 3PU6A 4PLGA 3IOMA 1S1MA 1X9HA 4W1SA 5B6PA 1S7CA 4IMRA 3JAKA 1KYXA 1P2GA 5HKLA 3WKDA 2WD7B 1KZYC 3OLWA 4F9TA 2FKAA 5TX7A 1AS0A 1XYVA 1FFEA 3ELBA 5JDCA 1FTYA 4PN7A 2ZWVA 2G7MC 3Q87B 4ZVMA 1AUPA 1C9DB 3NHPA 1YB4A 1CUDA 1NUPA 2DR0A 3MRSA 5F52A 4YCLA 1N0HA 3O4RA 2BYTA 1A9RA 5HIJA 3AESA 3ZCSA 3GEPA 2P0EA 3B5IA 3H2KA 5A5FA 4HZGA 1KQFA 1IY0A 1ODSA 1FRFS 1RFLA 2WG1A 4YFVA 3RGGA 1ACMA 3I58A 4BUZA 3QOFA 1XXHE 2PFSA 1E1RA 3Q40A 3CMMA 4IRXA 4PNHA 2J6CA 2IZ0A 1F2UA 4JKOA 2C4NA 3ONEA 1U9YA 3KDAA 3SR4A 4PHFA 1M73E 5D1NA 4JWTA 1SKQA 2FUG1 2YV5A 3CX4A 4LBWA 4LNAA 1R4NB 5EUQB 4JJEA 1BMQA 3CWCA 3KSRA 4YRSA 4MEJA 3N6XA 3QNMA 4TS9A 3GLGA 3QWHA 4XZ3A 4ZRDA 1P9OA 3S2ZA 5JS7A 5TQ0B 1DFIA 1DZ3A 1KEKA 1N8TA 1XRPA 5DYGA 2OQ2A 1ZH4A 3OZVA 4ED9A 2ZJ7A 5KQSA 4DCPA 1WVGA 4JYAB 3H7AA 3O4HA 2G82A 1VMEA 1PJ4A 1AGYA 2QGFA 2VSOA 1MAVA 3PGA1 3NNNA 2V7BA 3L7CA 2OAP1 2CL5A 2AR9A 5K45A 2NO9A 3ETEA 3NHSA 4HB4A 4HXGA 3HYRA 4R9VA 4ZCPA 5LA6F 4L76A 2H54A 4EO4A 1CR4A 1MENA 4W1QA 3A2MA 1M67A 1XL1A 3L1KA 3N9IA 3I5YA 1I51A 3SJCA 1E9EA 3D0OA 5IVIA 2ZB2A 2VUTA 1JPNA 1NVVR 4EHFA 4LQ4A 1MV5A 4HDSB 2YJ6A 5C8ZA 4UE6A 2GFQA 4DR2B 2Y3IA 3AR2A 3OFSA 3AVOA 3OKPA 1HURA 4DILA 1GGEA 1ZGJA 4Z4IA 5CP8A 2FPGA 4D9FA 1T9KA 1CJBA 5FFNA 5T67A 3P0FA 4JP5A 1JF8A 4X94A 1SVLA 4NPCA 1Z88A 4XYBA 5EESA 3DF7A 5AKKA 3TDMA 3QYJA 1X7WB 1B76A 1PL0A 3T7DA 4DUPA 1QV9A 1XLVA 5K0TA 2QJTA 1CQPA 3X43A 2FP4A 3EF3A 3FZEA 4UU1A 4MPRA 5DYNA 1TGYA 3O38A 3MBIA 2QUIA 3P9CA 4AZVA 4RF2A 5DNCA 1BKYA 1JAHA 3PB3A 2XXAB 3VKHA 2FUCA 2GRJA 2GTPA 3RRJA 1J06A 2XGSA 3GK3A 1Q2XA 2F1IA 3MS7A 1BFDA 1GADO 3QUTA 2E7ZA 3E3MA 1KK2A 2NP7A 3BSFA 3B89A 1ZRMA 1JHZA 3AEKB 3KR2A 3DT8A 3NNDA 3D4IA 3LPLA 4WH0A 2Y0CA 1J2JA 3O8QA 2BE7A 1I6WA 4XB6B 1DEHA 3JQ9C 3E4CA 1FVHA 5ULLA 2O7VA 4IV0A 2A9VA 2I78A 2V7EA 3L0BA 1L1EA 1RS0A 3MOGA 4PHGA 2Q0HA 1F20A 1TX4B 3GXBA 2BC9A 2BELA 2H1RA 2HDHA 2C4UA 2NT4A 3HS3A 3W2IA 1G8KA 4KN8A 3G2KA 4IOLA 1Q7RA 3ICQB 2CJWB 1VL8A 4FOSA 1KSFX 1PYGA 1QV7A 4ZQHA 1R5BA 2WJYA 3DB1A 3RS7A 3UK7A 5HKKA 1Z6ZA 1Y8ZA 1QKJA 2BR3A 3NG1A 1NX6A 3CB4A 4EDHA 1QNFA 4GFDA 3IRUA 5H4HA 3VYUB 1UBJS 5ESDA 3CPJB 3WL6A 1NI4B 1T2VA 3R7LA 1PJTA 3BN3A 4HQRA 4AYTA 1Z38A 4BBZA 1M7GA 1N1MA 1VMAA 1DAIA 3V4RA 5L4NA 2I22A 4RSHA 1SXPA 2LIVA 4CI0B 5IAGA 4M86A 1NJ6A 1C3VA 5DNUA 5EJ7A 5J1SB 3JQ6A 2HO4A 2WTXA 2J7KA 3I23A 1WIWA 1Z3CA 4S24A 3AVQA 3RM3A 1EBUA 1NRIA 1W4ZA 2IODA 2FQYA 2OK7A 3MHPA 5AW3A 1JE1A 1Y1TA 4C7JA 4LA4A 4JFAA 4OHZA 1KF0A 3RGWS 3TLJA 4HVLA 2C8KA 2PRIA 3OQNA 3MB5A 4NEQA 4EA8A 2I54A 2WWVD 2HCJB 1WXEA 4BO7A 4RJKA 1C3OA 1P2DA 4LQDA 2PZAA 1Q57A 3RUCA 1AO0A 2AOTB 3K9GA 2V03A 4HFMA 1OU4A 1HE1C 3IP3A 5AUPB 2PU5A 5IJAA 1AU9A 5TJ9A 4EG6A 1DT3A 4MSUA 2UYHA 1WQ4A 1Z35A 3V4PB 4FXOA 3E7WA 3MAJA 4HH1A 1H6AA 1OFVA 3PFHA 2A0XA 2M6KA 4MZDA 3B9RA 4J2HA 4M60A 4XB2A 4UM9D 4D3SA 4IKOA 4B8WA 3QKUA 4WDRA 3ZD7A 2YN4A 1EM8A 1WSAA 4MW6A 1CU1A 1GVHA 2RGGA 3EZYA 3F3MA 1LBSA 3OZDA 3KKPA 4FKMA 4TKVB 5EZYF 1MQ8B 2C3UA 2IA5A 1Z8FA 1QMPA 2XYHA 3PJDA 1O4WA 1U0JA 1S4MA 2C9OA 3LDUA 3D0QA 3GEHA 1DV1A 2C58A 3TLGA 2JW5A 3LG2A 1QIDA 2EQ5A 3W78A 5M7EA 4CEIB 3T1QA 5HJ5A 2BEWA 2IUFA 3P52A 4EYKA 4WLOA 3PX2A 1WDTA 4KGXA 3OJOA 4KFUA 5EHZA 3HJHA 1UIRA 2Y77A 4AX8A 2G80A 4OHRA 5IDWA 3RVRA 3LZCA 1JLMA 3BGIA 2DQYA 8OHMA 1H9BA 4B6QA 3BGWA 2WQ7A 3TZQA 2KBEA 3G2OA 1DC4A 2FN8A 4IS2A 1ZI9A 4UBMA 1DS6A 2I4NA 1GFZA 1Q1GA 4EG1A 4K86A 1FRQA 3JQBC 1HT2E 1A97A 1OAOC 5ICFA 4Y2PA 3T34A 3SY8A 4M8KA 4Z7NB 5L9AA 4DKJA 2XMZA 4GQIA 2I66A 2XZOA 1AGXA 2CHQA 3UJNA 5CVJA 1MAWA 4ZJPA 3MT9A 1CERA 1CZUA 4NJMA 4RLHA 4L7VA 2FWNA 3WO1A 1INLA 4J0JA 2BUCA 2KB0A 2XJ9A 4NZ9A 3Q1LA 2RD2A 5DM4A 5F3WB 5HA5A 3CPEA 3TB4A 4PU0A 1FCJA 3AVPA 3KKNA 3ZJTA 5DTRA 4KPYA 1I1HA 3AY6A 3D1VA 2JIOA 3NTRA 1YL5A 4I2VA 1D2AA 4LX8A 1RD4A 1QK4A 2WJ4A 1X86B 2RGUA 5DSZA 4ONEA 5DB4A 1DC6A 2FDCA 1QC5B 2Q3LA 3FPSA 4QM7A 1THGA 4A91A 1NYQA 3E8SA 5IJ0B 3OFJA 2VXBA 4Q7LA 5IT0A 2P2DA 2EC5A 4N49A 3IDFA 3FNGA 1U8EA 2HRRA 3EVEA 4WEQA 3LXMA 2F8TA 1G63A 3MUFA 3R5KA 3ZZNA 5FQOA 4UUAA 4BECA 3IEMA 4YXWA 1QFSA 1HYQA 2CDRA 2OQVA 1DEXA 1LLUA 4G1MB 3CG0A 3G7SA 4M99A 2WBLC 2TYSB 5IAAA 1CRPA 1FUKA 3K70B 3I0ZA 1CUXA 1N0VC 3K4QA 1ULTA 3HO6A 4QBKA 2DGDA 2GWHA 2P2SA 5T6BA 3H2YA 3VUEA 4A0FA 2C20A 4EPWA 5A2QA 2JFZA 3NWEA 2M98A 5BVHB 2IT1A 2P0YA 4LJ6A 4W7SA 3S8EA 5DM1A 5KNBH 4LI0A 5DX1A 2WUFA 4NCJA 1TUGA 1SHUX 1DHRA 1WR8A 3CLKA 3EWSA 1ZBQA 1MO5A 3BH6A 3BT7A 3OU6A 3PR3A 1QR2A 4RWZA 5L3ZA 3DYVA 5FADA 1F8XA 1UDRA 1IXZA 3ZKWB 2OKGA 3ZU4A 2OVBA 1TIPA 5IHPA 2FSVC 4QPZA 4RS3A 4RXTA 4GQBA 4O2BA 4NAVA 2QROA 4F2WA 1M6VA 3QEMA 2G72A 4N8EA 3UPUA 3WGMA 2EP5A 2WHYA 4R8MA 5ITSA 2JPDA 2QQ0A 3W6PA 3DBOB 3RADC 4GOLD 4N54A 2PU7A 4YRAA 5HS4A 2FI1A 1GNPA 1K8XB 2ZPAA 2G71A 4NBNA 1M1NA 1AKMA 1SIOA 1WD7A 3E4DA 4HGQA 3KB6A 5IF3A 2ZIUB 2AN9A 1C9EA 3H3XA 4OHWA 3RJZA 3UAZA 1O9HA 3FLBA 3R7FA 4XGKA 4AMZA 1KY4A 5C53B 3IUJA 2YMPA 2GOYA 3AO0B 4OYYA 1NUHA 2RGCA 2Z09A 4DQKA 4E12A 1EESA 3KQTA 1W4CA 2O2EA 1SBNE 1H4SA 4MRSA 3N87A 2G07A 4Z3DA 1Q91A 2QU7A 1H6DA 1E7RA 3BEDA 3C8HA 1M0TA 3LZDA 4KQGA 4NECA 3PDUA 1Z39A 4NU0A 4EG8A 1TIKA 3BA6A 2ZUTA 2QMOA 3ECSA 4US1R 5EKDA 1XEAA 1ZINA 2IWRA 2B61A 3T0FA 4EI2A 2QLNA 1K8QA 1H4TA 4IZOA 1KYYA 4G4GA 4UAGA 5HF6A 4EPYA 4RKFA 3LUPA 1YULA 1C3LA 3ORYA 3OX1A 1IWOA 3P8ZA 1RHKA 5FDFA 2P6MA 4H1TA 4JU8A 1TJ4A 5E38A 4MVJA 4DSOA 5DXFA 3D3WB 4YJDA 4C2TA 3F7OA 1I2BA 3HDJA 3KKKA 2QJRA 4A26A 1E6MA 1E4YA 2OECA 1DTEA 4GP7A 5LBUA 3NIWA 5JDIA 1ZXXA 1PR1A 1L4LA 5EA2A 4RQTA 2JAXA 3C97A 4ERNA 3T9AA 1XN4A 2R6R1 3KLOA 3VR2D 2AFIA 3ZQ4A 1MRZA 1Y81A 2B1IA 3OOHA 4HJRA 3BB4A 4P7FA 3SKVA 4B4DA 1W75A 2WSMA 3THWB 1TCUA 4V2UA 5DCUA 2ZRGA 4AS1A 1E2IA 2A9RA 1ICIA 1J56A 4XIYA 4F7WA 1QH9A 2ECQA 3D0RA 3MWYW 5G0TA 2BCGY 4FWBA 4DA6A 3S6JA 4F5DA 4MS1B 2HSJA 1PT9A 2ZVDA 2ZAMA 1KDYA 5B7NA 2ZR7A 1WXXA 3KQOA 2ZAIA 5ENVA 3LQ2A 5FNVA 2D62A 2A9FA 5GWXA 4GPAA 3EQ2A 1CF2O 1X8LA 4KHPB 3NQ41 1FYXA 4OM7A 4MEAA 1XK7A 4ITRC 4RCZA 3TUIC 1V4VA 4F1JA 1SQ5A 4WZBB 2BHSA 2CNOA 4EKYA 5MGBA 3PHLA 1EAMA 1G9XA 2L69A 3N3BC 5G4KA 2C57A 4RJLA 9MHTA 1HLPA 1XUOA 1X14A 2VJBA 2WUVA 3BWVA 3O73A 3OCUA 4GM1A 4R05A 3RS0A 2CHGA 4OAOA 2C4TA 4L74A 4R2XA 3RS2A 1OLOA 3WGUA 3KVVA 3PHIA 4GHWA 4ZCLA 4RJIA 5IBRA 1SD5A 1OYYA 4DMRA 1G1AA 4KE8A 5G40A 2F4VB 1P18A 2WUEA 2Z6UA 2AG0A 2PL9A 4UZEA 1XPRA 2IHYA 5IM5A 2A33A 4RGBA 3GJXC 2PH3A 1YNSA 3K53A 2F3SA 4UNSA 4H15A 3PNPA 2W2KA 5I7RA 4Q7EA 4QDXA 4ZMSA 1P7CA 3Q8MA 1NP6A 3OTGA 3JVIA 3JAKB 4DCGA 2R8EA 2BFDA 3RYHA 3WLNA 4R83A 3SSAA 4P7KA 5LMZA 3R3ZA 2YDXA 4H4EA 3RAPR 1L1FA 5DTJA 1P17A 2QP9X 1UL1X 3ONWA 1BE6A 1QU3A 5G1NA 5A9RA 4U7PB 1V4BA 4XVHA 2WA2A 4B74A 1GDDA 1UJ5A 1B0AA 3B38A 1GTJ1 1XDGA 1BZYA 4EB0A 4FS8A 4Q3OA 2VG8A 4MUXA 2Q2OA 4ARBA 1CUEA 2B1GA 3AZQA 3HNOA 3M6LA 3B9QA 5ARDA 1IL0A 1UP4A 4KRXA 2ZTSA 1ZO8A 4K2HA 4LOAA 5COQA 1YAJA 4ZAVA 1F2UB 4GE0A 3IQHX 3TG2A 1TQDA 3A3KA 1VMKA 4MYRA 4AW9A 1U8XX 3KT0A 4YI3A 1CY0A 3OF5A 4A4DA 1EA7A 1KVRA 3CPHA 1MB4A 1GD1O 3F7NA 1N2ZA 2HWYA 1RP1A 1VSBA 3F2VA 3I6MA 1PEKE 4GBED 1DAPA 4L5AA 1WXWA 1OHHA 2V4ZA 1V39A 4X6LA 3HKCA 1ZD1A 3IKMB 5ADUS 1H6BA 2RC5A 1CQJB 4XDHA 2LPMA 4J7XA 4RVFA 4FSHA 4KQKA 1YR8A 1E89A 2Q0QA 3FSGA 3KUXA 3DEHA 3HL0A 4F93B 1K7XB 5ISMA 3TYXA 1SKYE 2H1SA 4FHEA 1KK1A 3T1HB 1KFEB 3EGDB 1IOWA 2HCTA 1JDPA 1VCMA 3NAZA 1ZX1A 3CZCA 3V55A 4IQFA 5HUQA 1UQRA 2V7PA 3RTCA 3QEBZ 3OD1A 5A4DA 3Q10A 1NFFA 1RZRA 1QIIA 3BGVA 1IATA 4X8MA 3SS7X 4LHXA 1A9XB 1OYOA 1UBKS 2MR5A 5A3JA 4C4OA 2QSJA 1COWA 4EVQA 3MF4A 2DZDA 2JIRA 5LYYA 4M9RA 3L7YA 3FFWA 3I9MA 4WUVA 3GDHA 2PLFA 3SJZA 3ZVNA 1GPUA 4OD0A 4JP1A 3OG9A 4GX1A 4D8VA 1JJBA 4LJ8A 4C0HA 1WOMA 1C41A 2G5TA 2OXRA 4HEJA 3NOVA 4B3HA 5C1OA 3QY0A 1Q0RA 1Y33E 2H06A 2AC7A 2ZI7A 2FG5A 3FCXA 2M1ZA 3ONDA 3UB3A 5A1TA 5I4KA 1OV6A 3RYCB 2V6BA 4NBUA 4U39A 4HDKA 1KEWA 2QAGA 3GLGE 5EXEA 5L7TA 3E5RA 2VNAA 5EIBC 2JCYA 2QRVA 1G6HA 3MCWA 3AL3A 4B5KA 4CCYA 3NHRA 3RUIA 3RS4A 4IZ6A 3T7EA 4FE7A 1H0HA 3VTAA 1D6MA 4AJIA 3AEQB 3P9PA 2VUSA 3VSBA 3LXRA 3RNOA 3DQPA 4RX1A 5AJWA 4Q00A 4OYRA 1WMEA 4WFJA 1OPRA 2CLDX 1GPBA 1X6VA 2OHJA 2UZ1B 3TCNA 2IZ1A 4LJYA 2GKSA 1TKBA 4F6CA 3QXXA 5HG0A 1D5CA 2INGX 3TE7A 2W37A 2FPXA 5K0FA 2GHTA 3Q8XB 4ZAGA 5KOHA 1KJQA 1KYQA 3W8RA 4TRRA 2CJPA 1DAFA 1XTQA 2COKA 4AL4A 4DMLA 1L7AA 4NK4A 1PP4A 2AI3A 2CFIA 1O96B 1YSCA 4IMIB 2V96A 2A0YA 2OZPA 3AR9A 4LV5B 4R84A 1S02A 1UKAA 2JS7A 3WYCA 2E87A 5MHTA 1DBSA 3GR6A 1FUIA 3IOCA 3VV3A 5A5EA 2COUA 3GP5A 1J25A 1FNSA 4L0CA 2DFKB 2H0AA 3LUGA 2CSUA 4HN4B 1HTWA 2EKBA 3B8EA 1EM6A 1RYZA 3HCBA 4HDQB 4LUCA 4NK5A 4R40A 3EDMA 4ZYWA 1XCJA 3MK31 3L7AA 1OTXA 2VT2A 3WGYA 2ZRFA 2WRZA 1P33A 3S70A 3SS9X 3R09A 1QYCA 3SXUA 2YHSA 1LTQA 3OZGA 1BMDA 1W4BA 3AETA 5C5CA 3IRVA 4YJGA 1O6FA 1O1YA 1GUBA 2C2XA 3AONB 1WB4A 1WSBA 3QYPA 3TD2A 1FPMA 3DTYA 1YVUA 3OX3A 2DBVO 2UZ4A 4BVEA 4G1UC 4DYVA 1ULBA 2D5IA 4HWPA 5C3UA 2AF3C 3LX6A 2BVNA 3PK0A 2PZMA 4PWZA 4RL6A 1ISHA 1KJZA 5DXAA 2XXAA 4URYR 2AOUB 3QX9A 4P5DA 1I4WA 1V9LA 3BD8A 3PNVA 3DAYA 2C4KA 3DOJA 4WGGA 5J5AA 3UUGA 5DHPA 4BAGA 4E4TA 5JZOA 1DQSA 2ZSJA 4K46A 4KWCA 4N01A 2BM0A 3LDHA 8ATCA 2D7CA 5HRCA 4OCZA 2QW1A 5IJ9B 4DV4B 4F9FA 2XB2A 2D2EA 3BL6A 1AB6A 4KPUB 4GZMA 5TV2A 3RB8A 1XZCA 1QBKC 2C2YA 4DSZA 5AJUA 4RK7A 1P5HA 1JZSA 3Q9SA 2F90A 1MJHA 1Y6FA 4WNIA 1XQ1A 4J0FA 2FJ0A 1GQSA 3LYAA 3VR3A 3W4IA 5AQ1A 1E8DA 1X1EA 4BIMA 3RE1A 1SC9A 3OD5A 5A4AA 2QMHA 1O8BA 3AIKA 2ENWA 3O8DA 1QGUB 4H0CA 3ZZUA 4BU1A 1AMNA 1JWBB 2RGXA 3NH6A 2RH4A 3TL3A 3ZHYA 4BEBA 4PZEA 2FU5C 2V98A 1U7HA 3F5QA 2ZB3A 2HA5A 5J2TF 4BGEA 4IJMA 3ZDFA 1P0MA 4FN5A 2ATXA 2BCJQ 1PIWA 3V4OA 3A6JA 2O50A 4FC6A 4QODA 5KJFA 3F97A 4BJHB 4HNTA 3FOWA 1H0KA 1P4HA 2QL5A 3BFVA 4YXFA 4EKGA 3A10A 5CM2Z 4LDJA 5B1IA 5TMDA 1MOZA 4D9HA 3BB3A 2B2CA 2G1AA 2FX5A 4HAXA 2D4AA 4MCJA 4YIHA 5AW6A 3HJNA 4DBZA 3W2EA 2GM4A 2WTNA 2DSTA 5BOSA 1M1XB 3D4PA 4R1MA 4Z7OB 3TVTA 5AVUA 1FDVA 3VOBA 1FTGA 2IXBA 5CX4A 2BF4A 1H23A 1YIOA 2A3RA 1QTNA 1JKIA 3ZWKA 1QZUA 3T3GA 3VJRA 4PPNA 3OI7A 2PRYA 2AX4A 4HWKA 4J1TC 4KIFA 4MP3A 3BHJA 1WETA 1E79D 3MWLA 1M2FA 4UOQA 4O4HF 3FPJA 3ND6A 3E53A 2VZ8A 1ND6A 2F8SA 4LPKA 3ASUA 4HLDA 5DOVA 3WDMA 2XUQA 4NZPA 5EN4A 2QRVB 4MW5A 3DD5A 1UXOA 3ZW8A 2AQ8A 3E61A 5EJIA 5I47A 4LYEA 2WWTA 3C85A 3SWWA 2H92A 4H7PA 3V3KA 4R1NA 2XQJA 3QVGB 1U5BB 1SC1A 4IDCA 4AJLA 2H5EA 1QRTA 5K0NA 1YC2A 3DE5X 4PM4A 1DMRA 2H9IA 1EFRA 2JHAA 2XZTA 4GR5A 4P54A 4P93A 4JLNA 1I3MA 2LZ0A 1BJKA 3ETCA 4WOKA 3RUHA 1XQXA 4X5OA 3W77A 4D5GA 1KJWA 4HDNA 4PG5A 4V3CA 3CVVA 3PNOA 2DB3A 4LSWA 1T2UA 2B20A 1YACA 3ZX5A 5EJMA 5IK2A 4D6XA 4EVIA 3QKSA 3ADCA 4BNIA 2X5NA 2UZ1A 4RETA 2F1JA 3NPMA 2C0PA 1YBMA 3DOCA 4RF5A 4WPGA 5GV8A 5ICSA 5JHHB 3SF8B 4ZMRA 2RHCA 4M4SA 2ZXUA 4RMIA 3EMKA 4L22A 4D0SA 1SG0A 2VRBA 3CH7A 3DR5A 2ATVA 5CLLA 2BMEA 3QWFA 3MB8A 2DMRA 2QT0A 4BNMA 3PUXA 1USKA 3GUYA 1JYSA 4JB3A 2J4CA 4XOIA 1XMPA 3I2YX 2YFHA 1RKUA 4F3YA 4CCSA 1XELA 2REQA 1QNLA 1TMOA 3CZRA 3LL4A 3RF7A 4DY6A 5C52B 1T5IA 4ZVTA 5BSFA 3OIGA 2FPIB 4FLEA 3IT0A 4DXHA 4WFQA 1L5SA 3NEPX 1PFVA 2JIMA 1MQSA 4IPTA 3BOSA 4B3XA 3A3YA 3A9TA 3FPFA 2VUIB 1NFQA 2V58A 2Z0MA 3OT5A 2H16A 5ILGA 4ZYVA 3MTBA 4PPGA 1SD1A 3RHSA 4KR7A 4CM9A 2OMEA 3RC2A 4XKJA 2SKEA 2GX6A 4JOQA 1IE3A 2KW5A 4MKGA 4Y1GA 5FOTA 4GPIB 1ZNZA 4ZRNA 2VPZA 4EECA 4TL8A 5KYWA 3Q7IA 2HK7A 1P0CA 2A7XA 2H52A 1ONSA 3ORSA 4JC8A 3C3DA 2JRLA 3RV4A 2YHIB 2NU9A 2JHFA 5MN5A 5EEGA 4E6PA 1BG6A 5K9ZA 3ISJA 1QDLB 3KQLA 3QV2A 4NZMA 2E4AA 3CUVA 1IC6A 2WYUA 4TS3A 3IXQA 4RFSA 2YQZA 4K1LA 1M2OB 3P4XA 4DR1B 2R8RA 1WPRA 1NRJB 4OSPA 3DOOA 4GYWA 4Q34A 1JW9B 3LBAA 1FZTA 2Q1TA 4H4CA 2GBLA 1LKZA 2CNDA 4FZRA 3NHAA 1AXEA 1EX6A 1OI7A 1UJBA 2DFNA 4S1VA 1FVOA 1R5JA 1WCIB 2YCLA 2O7SA 3GCXA 2PVCA 4J1TA 3MWDA 4KUGA 2VDKB 3QSGA 3O2JA 4I50F 5JWHA 4R2LA 5I9IA 4BCDA 2P6UA 2BFFA 2NZYA 2PPVA 4M0FA 5FTJA 1Z3IX 2PXCA 3V8QA 1N2EA 2QMYA 4M22A 3H2ZA 5A5GA 3V7YA 5LIPA 3U9LA 1ISPA 2CEKA 4JBXA 3NOXA 3I1JA 2RHLA 5ALXA 1CKEA 3DUFA 4D3DA 1DZIA 4N6OA 1ZUHA 3HUTA 5IMBA 4IXMA 1QTQA 1YZGA 3X1WA 2GDJA 2OGWA 3D9QX 3PQ6A 3WLLA 1F2TA 4YMTA 3L6RA 1KH1A 1VZ3A 3HZOA 4RPKA 4OQMA 2W48A 1MIOB 4X1IB 1P31A 4EMUA 1Q7TA 3GPLA 4DR7B 5GZ6A 1ZZEA 5E1OA 3EZ7A 1BU5A 3ANXA 3LLMA 1JU9A 2OLKA 5B6JA 2PWAA 3FDXA 3JALB 3REGA 2GTHA 4FNMA 4QJ3A 5I6DA 2VJYA 4JSTA 5J1TB 3RNLA 1QIMA 3JW8A 5TPZD 4Q4AB 2AQIA 5D3QA 5D87A 1B43A 1XTIA 1TKCA 4MRMB 5JZSA 1ZVVA 2OUKA 2W2QA 3WP0A 4XQ0A 1LNQA 1XA0A 1ZGAA 1OHHD 5GP1A 5GIOE 1A5BB 3CF0A 3K1AB 4BJ1A 1IHDA 5JQGB 4QPPA 2O2CA 4URFA 1EK5A 5EQTA 4BAUA 4I4NA 3EPJA 2WYHA 2CV1A 2C2BA 2W0MA 4MR7B 4OOFA 5C4MA 2JAUA 5HDQA 5BR8B 2PSSA 1U0EA 3BJEA 2CNNA 1CJVC 1LXCA 1DG1G 1RCUA 1U3DA 3QLVC 1WBDA 2V0CA 1JJ7A 3BGDA 3D3QA 5JCJD 1BFKA 3FG9A 2HCRA 3HDGA 4G8BA 4GL4A 3ZI7A 3F6SA 3PNQA 4KPEC 2A4MA 2P1DA 4OJTA 2R8YA 2IV7A 2IZ6A 5JXJA 1EWKA 1TO2E 4E5MA 1E9RA 1QVAA 3RSGA 1E4EA 1N3IA 1RI1A 1ZP6A 1YH3A 2HRZA 3WIVA 4QBFA 3M6IA 3GUCA 3FDZA 2O1EA 2JFBA 3P2JA 1YE3A 2IYNA 3E9YA 2B6HA 3IALA 4UVHA 5DBEX 5T5QA 2AUTA 3C39A 1LSOA 3L7LA 4HRAA 3LYLA 3U16A 4QOSA 3LUJA 3EG5A 1OI4A 7ABPA 2IHTA 2LWIA 3LKVA 1E77A 3SN6A 4CDRA 4PTYA 5IP5A 3EA0A 2YIDA 3IKLA 3KQQA 4PGHA 4AF7A 1KOJA 1H2WA 4HFRA 1ATZA 4NU8X 3J81k 5DTIA 2Z58A 3DOIA 3ANMA 2OFXA 3TS1A 1F0PA 1NPTO 2CF6A 1CUUA 2O7RA 3BH7A 3OTWA 1XEXA 3RIYA 4AO6A 3L06A 2Q5CA 4O6VA 6CHYA 2Q4OA 3BKXA 5F1YA 2I3BA 4WV3A 3ROQA 4HGNA 4O4JF 5IKOA 2CXPA 4DMFA 2NN3C 2XCOA 1N9GA 1BW9A 3UT6A 1CP3A 4BLUA 2CFRA 1YE8A 2K5UA 2VPYA 3TAXA 4AVYA 2GPSA 5EZYA 4LJRA 3FBTA 1C7QA 1XPOA 4J94A 2FZ4A 4REOA 3HZHA 4U2EA 3F71A 5EMKA 3UG6A 2AIRA 3PPXA 4UKDA 2GVZC 3WRYC 5C2JB 1M2JA 3QWBA 3QUSA 2X1VA 2XA9A 3HKCB 3O8RA 3PJRA 1RQ2A 2Y68A 3AQIA 5HCUA 2L0XA 4KE7A 2NAFA 2WFAA 2Y9PB 3BC1A 3HUUA 3M9XA 5IANA 1YZFA 1RWBA 5ITVA 1GPJA 5K5EA 1AQNA 2FYTA 4I3GA 4QDJA 1OWPA 3CRW1 5LDGA 5HRAA 4HMQA 5C8XA 5HSGA 1DBWA 1EXWA 2GJKA 1DOHA 1IEQA 2FMKA 1FF9A 1L8OA 1RAIA 2VJMB 1VYVA 3DE0X 1XCPA 5LQSA 2I6QA 3DLHA 4J16A 3CLHA 1NU6A 4BQNA 1X8JA 1CIVA 2OZKA 3D8HA 4CM8B 2RGEA 4HDRA 3U3ZA 4E2FA 3E8XA 2BTQA 2WM2A 3QF4B 2JAHA 4EGJA 2E89A 3RODA 3CZMA 4QSMA 5H80A 3NASA 1YHZA 2JF0A 1AC5A 2YJ5A 1M76A 3UCFA 2ZBUA 2BFFB 4PGMA 1XP5A 1UANA 2JHGA 2VPIA 4D4MA 1Z73A 1ZMBA 1AS2A 2XUAA 2YWEA 4LXYA 2R79A 4UEJA 1OTYA 4WNAB 2EG5A 1GQYA 2FQXA 3PRJA 4PAQA 2HA7A 2B37A 4F45A 4IGFA 2VPQA 1L5MA 1OVGA 3DE1X 1OFGA 4ESHA 1RXUA 4FBGA 2I29A 3Q7RA 5A7HA 3WAJA 3HCRA 2WNIA 4DMKA 1S4QA 3S5JA 1ECGA 1QFXA 1ZH2A 2IHVA 3KZ1E 1DTWA 3RDPA 2ZE6A 3UB4A 1H2RS 2MSEB 4R51A 1R0BA 4YUVA 4P22A 3D8TA 2EZTA 4CCYB 2I91A 4XDGA 5JYCA 5FHQA 3EBLA 3L82B 4UCQA 3A4TA 3GGJA 4X7RA 1XZJA 3G1WA 3OY7A 2XV1A 3JQEA 5DZSA 4A9AA 3R0XA 1JTFA 2SHKA 4BNDB 5IC4A 1NURA 4C0WA 2OFWA 2ODNA 3NDIA 1S96A 2POQX 1II8A 2NQTA 5DBHX 1TE2A 4O0LA 1P1FA 3E1KA 4Q4AA 1NBME 1VI5A 3UGQA 1DC3A 5IM4A 1GIAA 3LQQA 1EVQA 3DE4X 4DCTA 2PMWB 3UFXB 4EB6B 3LNCA 1FTNA 3SQNA 1CZOA 3GRAA 4PG6A 4QUKA 3THWA 4FCWA 2BIFA 4G0OA 2EF1A 4MW9A 1S2LA 4IKPA 1ZIOA 3DOUA 2WIKA 3DTNA 3KR1A 3WC4A 4AJ9A 1Y34E 2WNSA 2IF0A 5BNWA 5AW8A 4KH0A 3U4AA 1D1PA 2ZBDA 3FVQA 4U7WA 1IM5A 3PEYA 2Q3EA 1NVUQ 1VIVA 5F73A 3PEFA 4KGZA 3F9IA 4NHEA 1SHZA 1T8SA 3AFOA 3CHYA 2JBAA 3E5NA 3U9SA 3WKEA 3ZZ0A 1G20A 4CE6A 1N2CA 5KYUB 4F3KA 1ODIA 1VP9A 2F55A 1D4OA 1SAYA 2W43A 3TTWA 5L3VA 3ET4A 4B0OA 2JK1A 3I2IA 3IDZA 1FFGA 3FDZB 2C59A 4J75A 5A9TA 4U3JA 1K6IA 4FNGA 1GQ2A 3HC7A 1EE2A 3U17A 3IP8A 4EL5A 4PCAA 2UYCA 2YZNA 3SXUB 2YW9A 2PZJA 3KQMA 2I76A 2ANBA 1U6KA 2O6HA 3CNOA 3FF1A 1SVWA 3HYCA 4YAGA 4MLDA 2WUDA 5C1PA 2J9YB 3CLVA 4EVSA 2FCAA 3AW9A 5TPWA 1FP7A 1GPYA 3IIIA 1U2QA 2PBZA 3FGZA 3UUWA 3M89A 3UT5A 1LSUA 4XD7A 3VO2A 3IP9A 3NTQA 2QYOA 2JGEA 4XIIA 1NM5C 3VVLA 5J2TB 2XT9A 3WTBA 3PUWA 4WZBE 1YS1X 4Q9IA 1KEZA 1SCDA 2WJ6A 2AOUA 2ZRDA 3KOUA 1H1LB 4MEBA 4A8PA 5IKMA 2JDIA 2WOJA 2I7TA 3T94A 3IV9A 3KJQA 3ND7A 4ZHQA 5TQVA 5KJCA 2BDUA 3HVUA 4DA0A 1CNMA 2Q6OA 3NHYA 3QY9A 1K6EA 1SC6A 4M8IA 4EZBA 3QP9A 1Q12A 4J0GA 1BH6A 1ZONA 3QVKA 5JG7A 2DH5A 4YRRA 4ZVKA 2QVCA 3L7OA 1O94C 5ANRB 3S29A 2Y1CA 3QE4A 5BQ5A 1QZ3A 1WCWA 4JJGA 4DA7A 3HQ4O 5DX0A 4BB0A 3WGZA 5I5GA 1YBAA 3TECE 4QBTA 3COSA 3D6JA 3F78A 2DPMA 3WAKA 3V1KA 1YGPA 1Q3HA 5H81A 3MVEA 4CLRB 4W5QA 1DKOA 5B57C 2QZJA 2VDOB 5A0TA 4O02B 1RLTA 2EBFX 5TJHA 1LNSA 3VH1A 2F64A 3IHKA 2EBWA 3R3YA 1S8NA 2OC9A 4LDQA 4NYIR 4LZAA 3CRRA 1TUBA 3FCEA 3HH8A 5T8KC 4XVUA 4CM8A 1Y1SA 4O1MA 2XMSA 4M36A 1NYTA 1Q1QA 3C74A 2K2QB 2VZ9A 4PQRA 1KKLA 3EVCA 2PX8A 3OU2A 2ADOA 3KQUA 1ORDA 4EAAA 1UBTS 5FRDA 1KY3A 2HIMA 4AY2A 1PGQA 3VFDA 1TXGA 2WJGA 1VKNA 2ONCA 3H5TA 1L5VA 3LQ1A 2VQEB 1QRRA 2IQ5A 3NT5A 2PUDA 1DAKA 1W30A 2V7XA 3ICOA 1XZFA 1FU4A 1FRNA 3VU3A 1I5RA 4L8FA 1NW7A 1NGSA 4K8RB 1SUCA 4A0RA 2PRKA 3GUZA 1E3LA 2NNLD 4M9QA 2W58A 3FWYA 2YQ5A 4B6PA 5LWHA 2UU9B 3VHQA 3IELA 1T5HX 2Q41A 1G7RA 1RADA 3FBWA 4CU5A 4D4KA 3FNQA 2VLBA 3C3AA 1E1DA 2GEVA 3A1WA 1KOFA 4TZ0A 4N48A 5I7EA 1EZZA 5IDYA 2OC4A 3CR8A 4MQBA 2D74A 2J1LA 4JY7A 3PJFA 3R74A 5HKBA 3HN2A 5JS6A 3I09A 5K0CA 5LBTA 2XBMA 1JT9A 4TV9B 1PZMA 1ACJA 2LXNA 2AJBA 3NBMA 3A31A 1YZ3A 3QUBA 4KQ9A 1VYHA 4N40A 2FOIA 2WSBA 4OEHA 4YDSA 3F5SA 3MJFA 3LQFA 1K9VF 3ROKA 1I4LD 3LUKA 4XWOA 4E5NA 1Q74A 2D8MA 1BEZA 3DGFC 5FBHA 5KKNB 2JK0A 5A9SA 4MKXA 4BKOA 3A1CA 1J42A 4NATA 3EIOA 3H2JA 5K1ZA 2ZWOA 2G6TA 1EWRA 1QGED 3Q9NA 1K7CA 3EUEA 4RADA 4RV4A 4A5OA 4ECAA 5HW0A 5I7UA 2UYQA 1W1UA 2GNAA 4IKEA 1N5KA 1RHMA 1ZGHA 4HPJB 2FN3A 3SPXA 3RS9A 2PD3A 4RM2A 5F3RA 1W96A 2VDUE 3I2KA 4BDTA 4IUDS 4BQPA 1L5WA 1QONA 1DI0A 3V46A 4OLJA 1RC8A 2HMYB 5MFPA 2Z6QA 5F1PA 1SCKA 4CHGA 3I01A 5DGTA 4D8YA 2QVYX 3HB5X 3PQDA 4KR9A 3A3PA 3NV7A 1NASA 3R9KA 5CXQA 2HHHB 5H59A 2WWXA 4UMEA 4AKEA 4N6NA 2GERA 4PYMA 3RTEA 3OX4A 4X8OA 4LQCA 4OAQA 2D5CA 3B1VA 2Y1DA 4NH0A 3LUDA 3KR0A 3SIPA 4FB5A 1E18A 1L7NA 3EGXB 4FPXA 4LF9B 4V0SA 3DW3X 3U7QA 4WXYB 4P08A 1IRXA 2J3EA 3AWIA 5E7IA 5B2EA 3VYTB 4R1QA 3KEMA 4TXHA 4PIPA 5JH7A 1PR9A 1XHFA 1Z4PX 2RGNC 2ZRHA 2NSJA 4NBTA 3ITEA 1K92A 4G5GA 1R4NA 4Y2YA 5EHNA 4EELA 2JFUA 2AZ4A 4P32A 2ZAOA 4FTWA 1LPSA 1KJ9A 5EJ4A