4RF4A

Crystal structure of ketoreductase from lactobacillus kefir
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
250
structure length
250
Chain Sequence
DRLKGKVAIVTGGTLGIGLAIADKFVEEGAKVVITGRHADVGEKAAKSIGGTDVIRFVQHDASDEAGWTKLFDTTEEAFGPVTTVVNNAGIAVSKSVEDTTTEEWRKLLSVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPTLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLEGAEEMMSQRTKTPMGHIGEPNDIAWICVYLASDESKFATGAEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origins of stereoselectivity in evolved ketoreductases.
pubmed doi rcsb
source organism Lactobacillus kefiri
molecule tags Oxidoreductase
molecule keywords NADPH dependent R-specific alcohol dehydrogenase
total genus 93
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rf4A00
3SX2A 1ZBQA 1JVBA 1GU7A 2EHDA 3NT4A 5HBRA 3PXXA 3F5SA 4EZBA 2VZ9A 4YJGB 4DREA 1NQTA 2I3GA 4PIVA 2HK7A 5DOVA 1ISIA 1PX0A 1U2GA 3E9NA 1WLYA 1UXHA 2JFFA 1AHIA 3NDRA 3UCFA 2ZJ1A 1R0SA 3ENKA 4J0EA 4I5DA 1H5QA 1Y7TA 3Q6IA 3DMTA 3WSWA 3G1TA 2HDHA 3E9MA 4NBVA 1JA9A 3LZ6A 2J3HA 1PS8A 1NVMB 3CMCO 3I23A 1A71A 4I1IA 3N7UA 4XYBA 1RM0A 2E82A 2X5KO 3H4VA 3TFOA 2O7SA 4F46A 4OSOA 1HYEA 3TF5A 1H6DA 1EUZA 5DP1A 1AXGA 1ENPA 1XR3A 4LSMA 4RLHA 3O8QB 1A9ZA 1DJQA 1R66A 3ICPA 4FJ1A 4IDGA 4Y67A 4BO9A 1PR3A 2Y0CA 1I8TA 4CLEA 3TRIA 3TDKA 3D5QA 3TN7A 3PQFA 3WYEA 4ZJUA 1KC1A 5C7IO 3L4SO 2YZ7A 3GMSA 1I3MA 3L9XA 1B3RA 4HV4A 2AMFA 1LSUA 1YL6A 1NX6A 5JYDA 4YTEA 3TJRA 4BGIA 3E9QA 2P4QA 5L40A 4WLFA 3L6DA 5CEFA 2XXBA 1RM4A 2WD7B 3M1AA 1P45A 3VTFA 2JCYA 4DC0A 3LC7O 4IXWA 3NTQA 5T57A 1BXKA 1I0ZA 1WW8A 3PIIA 5BQFA 3INTA 1Y5RA 3JYPA 4GLOA 2W2KB 4XIYA 5IN4A 1AE1A 1PJTA 3CE6A 4IY1A 3FWZA 4K9DA 3RUHA 1ZXBA 5JNLA 1DOHA 3BHMA 5JDCC 2VOEA 4QXMA 4FDAA 1LA2A 4FFOA 1LSOA 3UH1A 2VWPA 1H9BA 3QQPA 1K0UA 4NU6A 3TWOA 9LDBA 3NTRA 2Y1OA 2VCYA 3AW9A 4O5OA 4BHTA 3WQRA 1WDMA 3DBHB 5A5EA 1I3KA 3IUSA 4RF5A 5ICSA 1GCOA 1W0CA 4IZIA 3QVTA 3IOYA 3W4KA 2IEBA 1FXSA 1VSVA 4JLWA 4Q3CA 5DT9A 3P2OA 3PVZA 4DRYA 7MDHA 1P33A 5JDIC 4YT5A 1B8UA 4DC1A 3VH4A 1E7QA 4XGKA 1FDUA 4YAGA 4BNYA 3E8XA 4MKRA 4K6CA 1VPDA 3A9WA 3C1AA 3LF2A 5H81A 3H6KA 3PFFA 1X7DA 2OL4A 3WGIA 4B7XA 2IZ1A 2VHZA 1PSDA 4ALMA 1RM5A 3K92A 4AJNA 1U4SA 4CPDA 1NPTO 4PVDA 4XYLA 3VZQA 3LT2A 1DC6A 5IF3A 4GVLA 3D1LA 1ISFA 3JQAD 3PDUA 4UAGA 3C1OA 1LI4A 3Q9NA 3UF0A 1Q0LA 4E2WA 4NHEA 3OETA 4CMBA 2WEKA 3AI2A 4E6PA 2J5RA 1O95A 3NDIA 1Q7BA 4M1QA 3ZH2A 2ZB7A 2DU8A 4NFHA 4Q3EA 2QHXA 4FN4A 4HUJA 1Y8RA 4IQ0A 4RF2A 1U4OA 3UUWA 1C3VA 2AG5A 6LDHA 5CDTA 3KM0A 4RVGA 1G6KA 2X9GA 3RUCA 3QRWA 4JP2A 3WFIA 1FDSA 2OP1A 1B26A 1P1JA 1HZJA 1E0DA 2E49A 2X22A 2YFQA 3ZHZA 4JXKA 3AY6A 4YJHA 4BNJA 2VWHA 3VPSA 3VVCA 1HDCA 3FNFA 1IB6A 4XIJA 3NJ8A 3ITKA 1K2WA 3ADPA 3O8QA 3GLQA 1M66A 2JHFA 3WMWA 5JCJD 2EGHA 2OBNA 5G0SA 3WIEA 1MG0A 3QE3A 5A9TA 3C85A 4ZQGA 5G2OA 1GAEO 4W82A 2I3AA 1XA0A 5HA5A 5TJ9A 3LLSA 3PHGA 3DBRA 3GEGA 3WGHA 2AEJA 1B15A 4I5EA 3KEQA 4F6LA 1J6UA 1GEGA 3H65A 3HDJA 5JLAA 2FPPA 3B1KA 1ENZA 3WJ7A 2B5VA 5KKAA 1E7RA 1YB5A 3C7CB 3DTYA 3VDQA 1E3SA 5A1TA 4YA6A 1VM6A 1YVEI 4MVJD 4WUVA 1EBFA 3DAGA 2CNBA 3NJ4A 2ZCUA 4M86A 3ZNOA 3TL2A 3O26A 1HSOA 1OFGA 3GUYA 1MXFA 3AM5A 1ZK4A 2NU9A 2ZB4A 1H9AA 2FZWA 3DAPA 2RHCA 2Y0DA 3OIGA 2BI8A 4YRAA 1QYCA 3WR5A 1JKIA 1IHXA 4GVXA 5HS4A 3SXPA 5DZSA 4B7CA 1H6BA 2Q50A 4PG5A 1ULUA 2VYND 2NLOA 1XDWA 4YYZA 3ZWWA 4HFNA 4Z0HO 2IE0A 4DGSA 3MTGA 4OAQA 3OA2A 1HZZA 4NIMA 4EUHA 4RZHA 4BNWA 4J4HA 4P8RA 5L51A 3DDNA 3SC4A 1EDOA 4WOKA 3OJ0A 3AOEA 2JAHA 3U3XA 3HDYA 5MGBA 1Q7GA 3JD1A 5A06A 2OOSA 5T67A 3E03A 3FHLA 3L6EA 4TKMA 5FYDA 2O23A 3WGOA 2GN4A 4KUEA 5KVQA 4EUEA 1UAGA 3PP8A 2B4RO 3ZWPA 3LQFA 3A4VA 4BKUA 1Z7EA 2VN8A 2O50A 4BQPA 1HYGA 2GN6A 3HJAA 4TRRA 4CM7A 5DN9A 5FFFA 2GN8A 3DZFA 3QLJA 2J3JA 5BNFA 3AM4A 4IIVA 3RFVA 3RROA 1A9YA 3RC9A 1VJ0A 3H3FA 5DBIA 1UDBA 4GGPA 1ZXLA 1ZKMA 4UEKA 1M6WA 3KYDA 3UICA 4EYEA 2Z95A 3AI1A 2AQIA 3RU7A 4CR7A 5GY7A 4YR9A 4H15A 4OXKA 4D79A 3JQ8B 3CINA 4I9UA 1I2CA 4HWKA 1GUYA 3DMYA 1CWUA 3LK7A 3RSHA 1E3WB 3ZU5A 4RO0A 5KKCA 2IYPA 5BNIA 3ZWOA 5JPIA 3Q2IA 3ROKA 4M89A 4R5HA 1GFSA 4C4OA 5T64A 2QYTA 1ZFNA 1HDXA 1AUPA 1P1IA 1DC5A 2BH9A 3ZV6A 1X1TA 4E5MA 3E48A 3LYLA 5JAIA 3FD8A 1NFQA 2CUKA 1G0OA 1N7GA 4OXYA 4DQXA 2C5EA 4AJ1A 4FD3A 2X0JA 2WE8A 1E1NA 2O3SA 4Y98A 2WJPA 2DVMA 3MJEA 2ZYAA 2JJYA 2BFAA 4INAA 3WSVA 4CJXA 4WPGA 3RAJA 3V5NA 1C1XA 1DDOA 3H7AA 3UAGA 5HS6A 3WS7A 1Z45A 3IP1A 2O7QA 3QA9A 4GSKA 4MKZA 4DLAA 4DTIA 5CDGA 1A7AA 2YQ5A 4JCOA 4TROA 3E82A 1VL6A 1PR9A 4FGSA 4NG5A 5BSGA 1EFKA 3DHEA 4FS3A 4FQ8A 3EC7A 4JX8A 3H8VA 3G0OA 1CQJA 4TVBA 4XYMA 4M55A 4YJDA 4AJHA 3G1UA 4BS9A 1I33A 1KYQA 3S8MA 3SJUA 3ZV5A 4BNIA 2QIOA 5C5IA 4OQYA 4DIFA 4LCJA 1NAIA 4BMNA 1UH5A 4XKJA 4DBZA 1NQ5A 4YACA 3TZQA 4CODB 2VT3A 1JKJA 5CHEA 3HADA 1U7TA 3DXFA 5A4DA 4WNIA 5TC4A 4LVUA 3FPCA 3GVXA 2NVBA 3IJRA 1XELA 5KWEA 1ZK0A 3WGQA 5JY6A 2ILTA 4WCFA 3RWBA 2EV9A 3RFXA 1ZW1A 4RJTA 1ARZA 1DC4A 2BLLA 4CMEC 4H3VA 4EUFA 4EW6A 3RUFA 1PJLA 2WD8A 1BMDA 1KY4A 1YDEA 4NQZA 1PJQA 2C07A 2VQ3A 1LLDA 1TVEA 2WTBA 1D4FA 2B69A 1WDLA 2PFGA 3BMNB 2EKLA 3H9QA 4Z0TA 4RDHA 1NP3A 4UVDA 2J3KA 2D5AA 2YQ4A 3AM3A 5TX7A 4MOWA 1YRLA 2VHYA 4ZRNA 3VH3A 2P9GA 2Z1MA 2PY6A 4YJFB 2NTNA 4RLSA 2OGUA 2Z5LA 3V2GA 2Q2QA 1LX6A 1BXZA 1LDYA 1YS4A 5IXSA 3C8MA 2PH5A 3U62A 4Y9DA 2OP0A 3KHUA 3W6UA 2VWQA 5EQFA 1LSSA 5KOIA 1ZNQO 2NV6A 4QEDA 3UW3A 3A28A 3BIOA 3GRPA 1BG6A 1S6YA 4DYVA 3GUCA 1TLTA 1PL7A 1CJCA 1XU9A 4UEJA 1T1SA 1LRLA 1PZGA 3BMNA 4RDIA 1WZIA 4J0FA 3PRJA 2Y99A 1EFLA 4BNTA 1YJ8A 4E2YA 2VYVD 1PJBA 4IDAA 4B3IA 3EZYA 1OZAA 5EJ2A 1T2CA 3U4IA 1HLDA 3PHJA 1JWAB 3A06A 3D64A 2HUNA 1ZO8A 2XXJA 5L4SA 3S1LA 4A0SA 1GQ2A 1BVRA 3D5TA 1JN0A 4NMHA 3RASA 3NT5A 3AOEC 1LRKA 4KQWA 4P4LA 1VRWA 2B83A 1VJ1A 2I6TA 4I9HA 3RUAA 2PK3A 4IDBA 4GSLA 3QWFA 2Z1NA 1VJTA 1GYPA 2PKRA 2D4AA 5L7YA 1K5HA 1Y1PA 2BMAA 3TQHA 3WNVA 4O63O 4TVOA 2ZTLA 3JQGA 4EJMA 3VKUA 1PL6A 1R15A 1YXMA 3WBFA 2DC1A 4K6FA 5BT9A 3VKVA 3GY0A 4XQ9A 3I4CA 4PZDA 3HFSA 2B35A 1AN9A 3JQBA 1U9JA 1VLLA 5C3MA 3VAZA 4YAKA 1R4NA 1NTOA 4ZRMA 2C7VA 4QECA 3QVOA 1TT5A 5JXWA 5TT0A 4IQ8A 3DONA 5JC8A 1BW9B 2D0IA 3GAFA 4Q3BA 3ZCXA 4HFRA 3F5QA 2PH3A 3ZV3A 2CY0A 2NTVA 2PTGA 4XRRA 2FY8A 3BHJA 3CZRA 2BD0A 2D59A 4CUZA 3HE3A 3OJOA 1LDBA 1MC5A 3WGTA 4EGFA 3INRA 1P74A 1XEAA 3LLVA 4BL5A 4YT4A 3PJGA 1RYEA 3NGXA 2C0CA 4TSKA 5F5LA 4FBGA 3HN7A 4IJWA 4URFA 5IXYA 1LLQA 1LLUA 4G2NA 4Q3NA 4L76A 3V1UA 3GC6A 4YJHB 1VKNA 1RJWA 2F1KA 1C1DB 3PYLA 2AQ8A 1ADBA 4J9UE 5L95A 2WDZA 4W9NA 4IINA 5JO0A 5ENDA 3OEYA 4ZQFA 3TNLA 4YJFA 1VL8A 5U1PA 3KZVA 3ZN2A 2J6IA 4DLLA 4MVJA 2Y0EA 1QYXA 4R51A 3BZUA 1QYWA 1FF9A 3UCEA 1C0LA 3KSDO 5T8KA 1L7DA 1XIVA 2OMEA 2W2LA 2PD6A 1EUDA 2EW8A 4MINA 4ND1A 4U0JA 3OFSA 5L7TA 4IJUA 1Y8RB 3NDJA 1SEPA 2AHRA 4IS2A 3U5TA 1NASA 2XOXA 1J49A 5A9SA 4CQMA 4L75A 1EVIA 1CDOA 2WYVA 4PGFA 3CZMA 4GH5A 1N9GA 4CLHA 1UDAA 4E13A 2PWZA 3WJAA 4E30A 4J16A 1UP4A 1YE3A 4JJIA 4J3FA 2FSSA 1Z82A 3W8FA 3K8ZA 3OF2A 1HDRA 3BTOA 3L4BC 1C1DA 3VPHA 4E2XA 2JAPA 4B8WA 1CEQA 3R3JA 2BELA 3CKYA 3CXRA 2YV1A 3F9IA 3MWDB 4R69A 5THKA 3VVBA 2NSDA 2P9CA 4BV9A 2B4TO 4UVGA 2DTDA 3IP3A 2GZ2A 5L45A 1V3VA 1ZJYA 3DFUA 2CF6A 3DZGA 2UV8A 4B4WA 2ZCVA 3HHPA 1BDMA 2HO5A 2ZTVA 4CMEA 3E5MA 4Z6KA 2Q2WA 3GEMA 3IIEA 4P4NA 5KTKA 2C20A 3WTCA 3H5AA 2Q1WA 1TXGA 3KEOA 2EG9A 4GX0A 2OO5A 4W7HA 2GASA 1YB4A 3BAZA 1Z73A 4D43A 4RGBA 3K96A 4R1TA 1AHHA 3L0DA 3LT4A 4J90A 1BRMA 2GD1O 1EUCA 4YQZA 1KEUA 4R9SA 4RZIA 1O8CA 5GMOA 5LC1A 1CIVA 4XGNA 4WGGA 3CEAA 4OL9A 1KVSA 4OOEA 4GAEA 1QSGA 3FF4A 5CFZA 5CPFA 3DBHA 3CIFA 3H2SA 3KVOA 2W98A 2C29D 3D0OA 1FDWA 2Q4EA 1LXCA 4CM9A 1GV0A 1Q0QA 4EJ0A 3DZJA 1T2FA 2YW9A 3JQ8A 2X0NA 3KO8A 4FGWA 2W8ZA 4NPCA 4ND5A 2XAAA 2G17A 3I5MA 3ZWAA 4O59O 2GRAA 5HM8A 1GR0A 4FC6A 4GGOA 2I99A 4S1VA 2DBQA 2RIRA 5F1PA 5JAMA 4I5GA 3BMQB 2HLPA 1U28A 2GZ3A 3D7LA 5DCUA 4I8XA 4DIBA 1GEEA 3V2UA 5KVVA 3PWZA 4PRLA 1PQPA 4W4TA 5JDCA 1IZ0A 2QX7A 1SNYA 4E4YA 4BKOA 1UZMA 3CMMA 4RVFA 1UXJA 3MTJA 3CUKA 4FIZA 2GF2A 1Y6JA 1D7OA 1GADO 1ORRA 1E6EA 3QWBA 1FDVA 3ONEA 4ZQBA 3OIFA 2ZYDA 3W8DA 4UVEA 2GNAA 4R3NA 4CUKA 4D7AA 5KJCA 1PS0A 4RF4A 2UAGA 3WMXA 5DOZA 1HRDA 2UUPA 2AEMA 5G0VA 1ONNA 3FTPA 1MP0A 1N1GA 3EUWA 4WASA 1M75A 1RKXA 3I3OA 5JC1A 2X86A 3ZW9A 2Q1UA 3AK4A 1DFIA 5B4VA 3JQEA 4OH1A 2IYOA 4R4JA 1EZ4A 2DPHA 3DBLB 1G1AA 4WKGA 5F3RA 4ALJA 2NU8A 5TNXA 4RF3A 1ZK2A 1SEVA 4A27A 4OKIA 3JD3A 3T4XA 4YT8A 2XPCA 2O2SA 4J6FA 1XQ6A 2BFPA 2DUWA 3PTZA 3RBVA 4B4VA 3GDOA 2W4QA 1R6DA 3I9MA 3ZWYA 3DMTC 5K6AA 1EVZA 4A5OA 4R1SA 3ZV4A 3IS3A 4AVYA 3DZHA 1VC2A 3KETA 5A04A 1ISHA 1T4BA 1YBVA 1KVTA 1A72A 4NJMA 5G0TA 3MJCA 5DF1A 3MEQA 3GK3A 4CQMD 1E7MA 1DRVA 1NQOA 2EXXA 1PWXA 1PJ4A 4JQCA 5DDIP 1LTHR 3GGOA 5IZ4A 3IUPA 4KUGA 2P9EA 5I7VA 2CD9A 3FBGA 4TWRA 4J91A 1E3WA 2D2IA 4D0RA 1DIBA 1LBEA 1SBYA 2H63A 1DAPA 1NR1A 3KTDA 4MVJF 5DBFA 3LF1A 5EL0A 1EE9A 5TGDA 1GPDG 1CF2O 3FNGA 3GVPA 1DRUA 4JBIA 4CMAA 3KUXA 5TRTA 4WLUA 3L9WA 2YY7A 4IJKA 2ZK7A 4XYGA 3ZHYA 2FOIA 3WWZA 3ZWCA 4XB1A 4B4OA 3KV3O 4J7UA 3NUGA 2V6FA 1EMDA 2EWMA 2PA3A 1HE3A 1N7HA 4MVJH 1YQDA 4OQZA 4CM8B 5C7LO 1LC0A 4AJEA 3H9GA 4OXNA 1HKUA 1J4AA 3CH6A 2IDZA 1QORA 3ETEA 1ADCA 3ADOA 1XHLA 2HSDA 2P4HX 1EVYA 1ZEJA 3MWEB 1DRWA 4L8VA 4ROSA 2OBYA 2Q1TA 1XG5A 4IGFA 1LU9A 1E77A 1YH3A 3DAFA 1IZ9A 3JD4A 3X2FA 4BKPA 2PZMA 1J0XO 1VL0A 4CUJA 4CMCA 2VTDA 3GR6A 3WYBA 3EW7A 3WXBA 1H2HA 3I52A 3JQAA 1I30A 3BTVA 3F3SA 2IEDA 3PK0A 2OHXA 3LU1A 5CG2A 4G65A 1PJ2A 4Q39A 3INGA 2Y05A 2RAFA 3OJFA 3HN2A 1V6AA 4D0SA 2QRKA 1IY8A 3ROQA 1T2DA 3JYQA 5KJ1A 1B0AA 2X58A 1DBVO 1YGYA 4Y6PA 4GWGA 3QWAA 3IAHA 1HLPA 5KVCA 1EBUA 5A5FA 1B8VA 4BGUA 1E7SA 4YT2A 3FNHA 5B12A 3FTNA 2QW8A 3JQCA 2AXQA 5T8KC 3WDSA 3SJ7A 1YB1A 4H16A 2TMGA 5IAAA 3X2EA 2WYUA 2P5YA 4OO3A 3A1NA 1PGQA 1LQUA 3PFWO 4IBOA 2HMWA 5AXBA 3WICA 4MIYA 1B2LA 4CMKA 3O38A 1UXKA 4WEQA 3KBOA 4M54A 4NI5A 5C7OO 5A02A 1N92A 5EINA 1FK8A 1JU9A 1GZ6A 2AE2A 3IJPA 4X54A 3ZNNA 2Y93A 5B4TA 2CDCA 1MFZA 2WD7A 5AQ1A 1V3UA 5I7SA 1T2AA 4RPGA 3HQ4O 1BDBA 2HMSA 2HAEA 4QUKA 1JQBA 1BGVA 1GD1O 4DIOA 4FB5A 4PZEA 2AA3A 3PGJA 5COQA 1IYZA 2YJZA 3HDQA 1DSSG 2BGLA 4DPMA 1C14A 4Q9NA 4S3MA 3WLEA 4AJ4A 1F0YA 2YV2A 1UZLA 2P2SA 1SMKA 3WQSB 4R1NA 5CEJA 3I9JA 1CQIA 4ZQHA 2DTEA 2YUTA 3PJFA 3VDRA 2AEFA 3COSA 1ISGA 3KXDA 3ANNA 3HZZA 1LC3A 4ND3A 4KTVE 5L53A 4AFNA 3UFXA 1W8DA 4E21A 3AWDA 1DIHA 3DFZA 3R6DA 1HDYA 4GKVA 2NVWA 4R01A 9LDTA 4BNHA 5J23A 2FPGA 3DBRB 4R9RA 3JD0A 3VPXA 1SB9A 3RBZA 2CZCA 5JMPA 1GPJA 2AQHA 4CL3A 3QIVA 2UYYA 1JW9B 1L7EA 4XQCA 5ITWA 4YJGA 1WMAA 1I3LA 4JJGA 2B37A 3ZHXA 1VI2A 3ANMA 1IULA 4CM8A 4YCAA 1R16A 3EGOA 4J2OA 5TT1A 5DCYA 4ZN6A 5JDIA 3FPLA 5CEEA 1H6AA 3M2PA 1PJ3A 4BO7A 2E48A 3GH3A 4OYRA 1LDEA 3F6YA 4U6SA 1I2BA 4JBHA 5KJFA 2Y1GA 3GT0A 3V2HA 1PL8A 3MJTA 4E32A 5FWNA 2OUIA 3QWHA 4Z3DA 8ADHA 3OSUA 3Q2KA 1NHWA 3HFGA 3PYMA 2YFHA 2HMUA 4BNZA 1GV1A 1ZJZA 2DFDA 2NU7A 4K1LA 4Z0PA 2PD3A 1E1MA 3NV9A 1KEWA 4UVIA 4BIIA 3ZU4A 1U8FO 4GWKA 1EQ2A 3PGXA 3E18A 5CDUA 1TB4A 2VUUA 3P5SA 4L74A 2VHWA 4QO7A 2W2KA 2RHRA 2BI7A 5DULA 3GVHA 3OM9A 4O1MA 1HDZA 4E3ZA 5EESA 4IGEA 2FMUA 1O89A 4R68A 4YWJA 2E37A 4ZGWA 1EE2A 4WLEA 2V65A 2GCGA 3GVCA 4MVJM 3ICCA 2OZPA 2I65A 3PJEA 3AJRA 1Z75A 1JWBB 1RM3A 1MV8A 3G3EA 2PGJA 1ZZEA 4ILKA 3TOXA 3MJSA 1MG5A 1X13A 3QV1A 1XU7A 1QP8A 3GN2A 3AUTA 2HCTA 1PIWA 1W6UA 3UOGA 2Q46A 4BQRA 3I1JA 2GN9A 3U0BA 1KVUA 4L9RA 1R4MB 4AL4A 2A94A 4GMFA 1W4ZA 3ORFA 1F8FA 1CYDA 3P19A 2D1YA 4CMIA 4J7XA 2C59A 4FJ2A 2O4CA 2HMTA 4MP3A 2BGMA 3VPGA 2Q4BA 4EDFA 1YL7A 2H1SA 3ZI0A 3BTSA 1SC6A 5G0UA 1SO8A 1UJMA 4WEOA 5ILGA 1PQWA 1B7GO 4JN6B 3F4LA 1TA4A 5EIOA 3GAZA 4E33A 4OJNA 3C24A 2PKQP 4OSPA 4PLTA 4D45A 3Q0EA 4FFPA 4IZHA 4G5HA 5JE8A 1QV6A 3K73O 3UN1A 2EP5A 3D4PA 4O6VA 4KDEA 2O3QA 2RH8A 5L9AA 3OMLA 2QRJA 1JKFA 4CM3A 3EAGA 4B4UA 3IKVA 5IG2A 1JVSA 3GRKA 3JQFA 3E1KA 2DLDA 2X4GA 5EN4A 4E2ZA 3OQ1A 3DL2A 1IE3A 3AU8A 4B7UA 1NNUA 2ZJ0A 4N7RA 5DCWA 5A9SB 5JYEA 1V0JA 3UKOA 1Y9EA 1T25A 4LSWA 1X14A 4UUPA 5IZCC 4YVFA 4DUPA 1IUKA 2NADA 2WM3A 3PPIA 3I6QA 3IC5A 3CSDA 3GHYA 3RI3A 5BSHA 4KQXA 3KSUA 4MO2A 3LVFO 2R6JA 3AY3A 3NKLA 2VT2A 3L6OO 4FFRA 5I7EA 2ET6A 2X6TA 2R2GA 1GL3A 3AUUA 3HNPA 3ENNA 4J2HA 3WGGA 3OJLA 3WBBA 1PZFA 1NWCA 6ADHA 5F1OA 2NQ8A 3GGPA 4W7IA 2GUGA 4B3HA 4CLDA 1DJNA 1KETA 2HQ1A 3S2GA 1KIFA 1QYVA 5JAZA 1ZVMA 2EJWA 2EJVA 4ONEA 4NJMB 3GVIA 3D3WA 2EP7A 3AUSA 1QG6A 2WE7A 1K6JA 1PGOA 3RKRA 4ITUA 1LEHA 1HTBA 3DOCA 4DBVO 2FPIA 4EBFA 4P22A 4Y6SA 4NU5A 4DA9A 1EDZA 4LK3A 3UHAA 1AGNA 2Y68A 4DMLA 3MCVA 1U2DA 1Y8QB 3ZWNA 5C37A 1I24A 3ZDFA 5I9LA 5T6BA 1KEVA 3QY9A 4R16A 3KSZO 4J4TA 3GNTA 5FI5A 2P5UA 3GZNB 2GZ1A 3C3XA 5CP8A 4PLVA 3DBLA 2VYVA 5AXCA 1MC4A 2JFGA 4HNGA 4PZCA 4E12A 4MKXA 1I01A 1E1LA 3VZRA 4CLRA 4LVCA 2C5AA 4AJOA 3GPDG 4OIMA 4K28A 2WWRA 1ZUD1 3ZWVA 1HEUA 3U9LA 1P9LA 2ZB8A 3DO5A 5EQDA 1N1EA 4N18A 4L4XA 3ZWMA 2C82A 1ZCJA 1SPXA 1M67A 4NBTA 3OICA 2HJRA 2H9IA 4IM7A 1MLDA 4MIEA 3W8EA 1M76A 1V3TA 4YDRA 3FBTA 3F47A 2DUUA 1NVGA 3AI3A 4J1SA 4R41A 1DFHA 2C2XA 1MXHA 2Q1SA 5KVSA 2X5JO 2V6BA 5FF9A 1KS9A 3MOGA 4EITA 4TKLA 4PLPA 3UVEA 4BNLA 4UVHA 2CVOA 5G4KA 4PLCA 1N9GB 5KNLA 3U09A 1DIGA 2QZ9A 4OKNA 2G76A 3FCOA 4BO6A 3LC1O 4PG8A 3QVXA 4QT0A 3K6JA 2IODA 4RVSA 4F6CA 4PLGA 4I08A 4Q3DA 1ZIDA 4RPHA 3RUIA 4J49A 1UDCA 1BSVA 4PG7A 3MJ4A 2DAPA 1E3JA 3N74A 1E5LA 2EIHA 2SCUA 5EERA 1SOWA 2D5CA 5JCXA 3H9JA 4LMPA 4PG6A 7ADHA 4TQGA 1OC2A 4XQEA 2Y1CA 4XYEA 1XYGA 1QV7A 4D3SA 3I83A 2O3JA 2FR0A 4WCFC 1UXGA 1P31A 3EVNA 2D8AA 5COBA 3ZNQA 1T4DA 3R1IA 5G4LA 3Q3CA 1LRJA 4HADA 2X0RA 4HY3A 3KOUA 3DQPA 5JCJA 1CETA 4WOJA 1G0NA 1IOLA 5F5NA 4NBWA 1QRRA 4CQLB 1ID1A 1R0LA 4Y8VA 4UUNA 3ETDA 3ZWXA 4A03A 5ITVA 1L1FA 2A4KA 3WGYA 1XGKA 3GDFA 4CV1A 3HB4X 3DHNA 4XJTA 2I66A 1ZMTA 3DC2A 4II2A 3TL3A 3WTBA 1BW9A 3RU9A 3ZGYA 5ER6A 3RQSA 3I6IA 3GZNA 5BNTA 2YDYA 2VZ8A 4D3DA 1AXEA 5A3JA 2GDZA 4IS3A 4CM5A 1Z74A 3GA0A 3BMOA 3PYXA 4XQGA 2ZATA 5IFLA 5AXDA 5EPOA 3T7EA 1MFPA 1PU2A 4U6QA 2LDBA 1A27A 3AUAA 4HKTA 1XKQA 2PGDA 1O6ZA 4BO2A 3KB6A 4AICA 4DLBA 2VRBA 2PNFA 4II3A 4XRGA 3JQFC 3ST7A 2QG4A 1W73A 1P44A 1EK5A 1PGPA 2VYNA 4JIGA 1ADGA 2DFVA 2ZTUA 4DWVA 3PZRA 3BA1A 3K30A 1U3VA 3K2BA 3JQDA 5I8WA 2O3RA 1E7WA 4RPLA 2I5PO 3RC1A 1N8KA 4BNGA 1Y81A 1V8BA 4CLXA 4KMSA 2Y66A 5L4LA 3VZSA 3SEFA 2TMDA 2LDXA 4MP6A 3FWNA 4PN3A 1PGNA 3ZU2A 3DOJA 3PQEA 3UCXA 4J9VA 5CPBA 2O48X 1HSZA 3RD5A 1XQ1A 1PGJA 3K31A 2O3UA 4TZKA 5BSEA 1WNTA 3WFJA 4WE3A 1GY8A 4BNUA 3OIDA 1P1FA 3GGGA 4RCVA 5AXAA 4YRBA 4ZQEA 4RPKA 2HK8A 2JL1A 4OGWA 4XCVA 2BF7A 4QO8A 4BMSA 1IPEA 4NK5A 5MDHA 4XR9A 2VNAA 2YHUA 1HXHA 2FP4A 3FRJA 4I5FA 1R4NB 4E5PA 3KRTA 1Y5MA 2O3TA 3GZ4A 4EJ6A 1HDOA 3WLFA 3I9OA 1H2BA 1PTJA 1UP6A 3HB5X 2DM6A 3C7DB 2CDAA 2E6UX 2I76A 3GQVA 4HBGA 1LQTA 5KCZA 4ID9A 4N5MA 1LLCA 3NT2A 3HG7A 5IN5A 2WYWA 1UP7A 4NBUA 2X23A 4YQYA 5JAQA 3O03A 5B1YA 3BMCA 1X7GA 4YEDA 4GI2A 1ZSNA 1HWYA 3ZW8A 1YL5A 3V8BA 3F4BA 1UR5A 4CM6A 3ULKA 5FI3A 3MZ0A 4BKRA 4GQAA 3JYOA 4PG4A 1Y9AA 4OHUA 1ZSYA 5HRUA 2JD2A 5KJ6A 1DHTA 1ZH8A 3G17A 2E4AA 3JQ9C 3QVWA 2G82A 4JP3A 4R54A 1OI7A 3R0IA 3E5RA 5BR7A 1LDMA 4J4BA 4CLOA 4BO8A 4Z9XA 3PIDA 3EDMA 4NDNE 2BRUA 1TT7A 4DQVA 3HSKA 4MVJI 2EF1A 4BNNA 2P68A 2FR8A 1P1KA 2VRCD 4CMGA 2AG8A 2XF8A 4D44A 4N54A 1NXQA 1QXSA 3GHHA 3BHIA 4R3WA 4CV2A 4NFSA 4NR0A 3EMKA 3NEPX 5DBGA 4CQMB 2NTJA 2PKQO 5LCXA 3QJ5A 3NTOA 3GNQA 4CMJA 5CG1A 1NBOA 3ROPA 4J7CA 5H82A 3ZHBA 2IRWA 5ER9A 2P91A 2G0TA 2IZ0A 3P7MA 1EQUA 3F46A 2BHLA 4B8ZA 1CRWG 3LT1A 3DHYA 4N5LA 3PDJA 2F00A 2G5CA 4MVJP 2IZZA 2NU6A 1E5QA 1GQQA 3DBVO 5F21A 5ADHA 5K0ZA 3G79A 4EEZA 5AYVA 1D3AA 1X15A 1PJCA 1UZNA 4RL6A 3I9LA 1JAXA 3LC2O 4BGEA 1LJ8A 2GERA 3SVTA 4PLFA 3IQDB 3WG9A 3N58A 4FCCA 3W6ZA 1DLJA 3H5RA 2J8ZA 4HP8A 3H3JA 3EK2A 1P3DA 1GYRA 1B16A 3PQDA 3TPCA 3VHRA 3K5PA 3TOZA 4UREA 1KC3A 4CV3A 3PHLA 4F3YA 3JTMA 4W99A 2FZEA 2Q2VA 4GKBA 4RORA 4CL8A 2HK9A 3ONFA 2EERA 4YPOA 3RIHA 4BO1A 1MA0A 3E6AA 1U5AA 3AFNA 3T4EA 3JQ9A 3PEFA 3RC7A 1BXGB 3WX0A 1UXIA 1X1EA 3S2FA 3BMQA 2NVUA 2JD1A 5DNAA 3S2EA 1P0CA 1WVGA 4U7WA 1H93A 4WLNA 1HT0A 4ALNA 3VH1A 4U8GA 5I8ZA 4FSHA 4N5NA 3WOHA 1R0KA 4XWYA 1F8GA 3QWIA 2B0JA 1KERA 5A3VA 3GF4A 5B4UA 5TQVA 4TRNA 2G1UA 3O9ZA 3OHSX 1OMOA 5COAA 4CR8A 1HYHA 4BUCA 3IKTA 1IHYA 1EEHA 1NR7A 1DHRA 3G49A 5A03A 4BKQA 3JYNA 3RBXA 4WJZA 2EKQA 4NNJA 4TRMA 4DVJA 3M2TA 1JLLA 4IIUA 1BHSA 5TLSA 3BMOB 2V6GA 1U5CA 3PI7A 2VUSA 4ZA2A 2NVUB 2J3IA 4YAJA 1YKFA 4IUYA 1NPYA 2CVZA 1BWSA 1ONOA 4DYDA 4P38A 1BXGA 1NQAO 2RH4A 1TEHA 4WLVA 3OBBA 1YO6A 2O2YA 3B1JA 1YQXA 1YBMA 1U1IA 4YRDA 1HE4A 4PLWA 4NFYA 1LSJA 1NM5A 4UUMA 1GDHA 1GCUA 1DC3A 3HUDA 2GO1A 3RCBA 4YXFA 1I3NA 2DQ4A 2BGKA 1YDWA 3SLKA 2ZTMA 2FRDA 1PS9A 1M2WA 4KOAA 1XCBA 1WP4A 2R00A 2Y1DA 5CDYA 1F12A 1SOVA 4ZU3A 1BTOA 1PWZA 2PGLA 4BB6A 3ASVA 1DO8A 2UVDA 4GPD1 4FOOA 5K6AC 4OMUA 1ZK1A 3H9UA 1U3WA 1LDNA 4Y6RA 2B4QA 5ENVA 3OECA 4EI2A 4I9NA 1RWBA 1P1HA 4R1UA 1KOLA 3Q9UA 5ICMA 2A92A 4KP7A 2O4UX 3RJ5A 2IXBA 4CR6A 5AOVA 1QLHA 3JQ7B 2HRZA 4G81A 4FR5A 5THQA 3F1KA 3OA0A 3WWYA 3LSYA 1NHGA 4BNVA 3FSRA 1FDTA 2CFCA 2EW2A 2X8LA 3BYZA 4AJJA 5JSFA 1WWKA 1U7HA 2GR9A 1QYDA 5U9CA 2PZLA 2RCYA 2Q99A 4LMRA 1P0FA 2X9VA 4AG3A 1F17A 4UULA 1YQGA 4FFMA 1KBZA 3VTZA 4BNXA 1DB3A 3RFTA 1YOVB 3OEWA 1HE5A 3GEDA 1T26A 3Q1LA 3GG2A 4WECA 1QKIA 4F45A 4GLLA 3U4HA 4BO3A 1J5PA 1GUZA 2DBRA 3PHHA 2PZJA 3JYLA 4RQUA 1ML3A 1D1SA 5CDSA 4WNCA 1K6IA 1N2SA 3OJEA 1DXYA 2A35A 2NACA 5JO9A 3FR8A 2V7PA 3WIDA 2GLXA 1JDJA 5JY1A 1B14A 3PHIA 5KJEA 1YONA 4IMPA 5IJZA 2HMVA 5TIIA 3L07A 3S2IA 4JROA 2JFHA 4AJKA 3F1LA 4CM9D 1K89A 4C7KA 4ALLA 3ABIA 1E6WA 4IDEA 3D3WB 4ALIA 5IDXA 2UUOA 5B37A 1ENOA 4AJPA 2QRLA 4WK6A 2EEZA 4RV9A 3WGZA 4XB2A 4BO0A 2PV7A 4MPDA 4Z9FA 3TZCA 1O9BA 1IPFA 1A5ZA 3P2YA 2OFPA 4U0KA 4CQLA 4PVCA 2NWQA 1OOEA 3DZBA 4NBRA 3AOGA 1UAYA 1EK6A 4ZHSA 5FEUA 2HKIA 3JD2A 3GG9A 3NRCA 4QQRA 2VOJA 3BXXA 5T5QA 4XZ3A 4BO4A 3I4FA 2CDBA 4E31A 5A9RA 1NWHA 3IMFA 2YV3A 4BNKA 1PQUA 4PLYA 2PR2A 4FFNA 4CM1A 1I2ZA 2V6MA 5IDQA 2UDPA 2Y67A 4LN1A 1WPQA 1D1TA 1DAOA 3CPSA 4JGBA 3AU9A 1NFRA 2IXAA 3VPFA 2A9FA 4KTTE 3RC2A 3WQQA 3NGLA 1XWFA 3H5NA 4KDFA 4D42A 3QW2A 1QLJA 3KYDB 4PLZA 1HE2A 4GBJA 1NAHA 3I9NA 3D3EA 3NYWA 3KLPX 1Q2XA 3ONDA 5ILOA 1SAYA 2FR1A 4CLOB 1O94A 2HRBA 2W90A 4XX0A 4ZICA 1UUFA 2Y1FA 1U3TA 3EZLA 3KLMX 3OH8A 3PWSA 5K9ZA 4GX1A 4FW8A 1BVUA 4J1QA 3UXYA 3EVTA 3IL2A 1MX3A 4OOFA 3I9KA 4JNKA 3DR3A 3RJ9A 1Q7CA 4MDHA 3RUDA 3D4OA 4E5KA 1I10A 1LDGA 3FN4A 3M6IA 5CAEA 1T1RA 1E1KA 2POQX 3QHAA 4Z9YA 1MGOA 2AQKA 3JCZA 4XR4A 2GYYA 1RPNA 5IDYA 5JFOA 1D8AA 4QFCA 4IMRA 2GGSA 1XLTA 4JJFA 2DKNA 4E5NA 3GN1A 4L0QA 2GSDA 2VHVA 4ALKA 3ZZNA 2VUTA 4PCVA 4PFJA 5I9NA 1TT5B 3ON5A 3PLRA 4Z3KA 4ZD6A 2D3TA 1RYDA 2J5KA 5IDWA 2JCVA 1JAYA 5H83A 1GZ4A 4H7PA 1A7KA 1NVTA 2DT5A 1ISJA 1I32A 5GZ3A 3VH2A 2EKPA 2Q45A 3R3SA 1EVJA 4CLRB 1P1RA 4IQGA 3FR7A 4HXYA 5GZ6A 4EEXA 1R4MA 4FOSA 1N5DA 3NX4A 3MJVA 2DTXA 1WMBA 2NNLD 1E92A 1Z6ZA 3OQ6A 1IL0A 1Y8QA 3DEYX 4XDZA 5I9MA 4HNHA 2VWGA 1YOVA 2BFOA 1A4UA 3U4CA 2PZKA 1CERA 1H0KA 1Q1NA 1V35A 1T24A 1VSUA 2QYSA 2PLAA 5JW6A 4A26A 1DLIA 2X7HA 3S55A 4XEHA 1X0XA 5U4QA 1MB4A 1H6CA 2YHIB 4DPKA 3O4RA 4OM8A 4YBZA 4BOYA 1PEDA 1WAMA 5IZCA 4BNFA 4J1NA 1OAAA 3RVDA 2HJSA 1SCUA 4NK4A 4L73A 2H5LA 3JQ6A 3B6ZA 4RVDA 5G0WA 3GDGA 4AJIA 3ZWBA 2FN7A 1E3EA 4DXHA 2JHGA 1O5IA 4C7JA 5TF4A 2Y1EA 8LDHA 2CMDA 3ETGA 1PZEA 3CTMA 5LDGA 4MJLA 4YAEA 4HX5A 3H2ZA 2FWMX 3NAQA 4QX6A 3GFGA 4RQTA 3JQ7A 3FI9A 4NZ9A 3GFBA 3IDSA 1GQYA 1KEPA 4CMHA 2H6EA 2CF5A 2DPGA 2WSBA 1GTMA 5F1KA 3HDHA 4GL4A 3DZIA 2ZQZA 4KZPA 1VKOA 1HETA 2C54A 4BVAA 3B1FA 4D3FA 3V1YA 3KYBA 1ZK3A 4KWHA 1NFFA 3B20A 1ZEMA 1T2EA 2ZIZA 2ZQYA 4QTZA 1Q0HA 1ZMOA 3B70A 2YDXA 2C7GA 4BV8A 1C0IA 1FMCA 4J1TA 3FNEA 5GZ1A 4CMIB 3K2EA 4LISA 1GZ3A 2X5OA 1DFGA 3QSGA 4CV0A 4NJOA 1ULSA 4FFLA 3MOIA 1NPDA 1ZSVA 1R12A 1YBAA 4FJ0A 1Z7BA 1K3TA 2VTEA 4JK3A 2AE1A 4XGIA 3DWFA 3BTUA 5HTOA 4B79A 1FJHA 3K9QO 3D4NA 4KUHA 1VE9A 4XD2A 1NYTA 1DEHA 3PWKA 1ADFA 1DIRA 4YB8A 5JMWA 2VNSA 4MP8A 1B8PA 2DBZA 4B3JA 4DMMA 2JD0A 3TZKA 4D46A 3HWRA 4W9NC 3W1VA 1R37A 1TI7A 4WCFB 5TS3A 3OP4A 4BB5A 5I7FA 1C0KA 2VHXA 1OBFO 5AVOA 1B3BA 1HF3A 5L7WA 4MIOA 2I67A 3RKUA 2DBVO 4LCEA 4RPJA 1QR6A 4U5QA 5L3ZA 4E0BA 4L4RA 4ZVVA 4IXTA 4LW8A 2R00C 5TSDA 3ITDA 3C7AA 2VRCA 3WB9A 2QQ5A 1I36A 1A4IA 1MUUA 1F06A 4UEOA 4P4GA 3DZKA 2YHIA 4WCDA 2I9PA 1KY5A 3STHA 1S7CA 3TZHA 2BKAA 3SBOA 2X1HA 1LUAA 4JBGA 2BFMA 1KVQA 4K26A 1YJQA 4CM4A 3GMDA 3AFMA 3BMCB 4MVJE 3SC6A 2W2LD 1ENYA 1F14A 1YWGO 4M8SA 4TRJA 2RBEA 3SLGA 3L4BA 1E7YA 2HU2A 2CVQA 3KYCB 5KIAA 2C2YA 2JKVA 3RUEA 1I5RA 3U49A 4IDCA 2ZB3A 4PLHA 3VC7A 1C1XB 3AY7A 3PZBA 4NH4A 3WNQA 4A7PA 4E5YA 4XA8A 3TZ6A 3ZNPA 1ONPA 3A14A 3LDHA 3WYCA 4DPLA 3M1LA 4IDDA 2B36A 3U4DA 3C1TA 4R5MA 2VZ0A 1C0PA 4IJVA 1OC4A 5BSFA 2X0IA 3EY4A 4XDYA 3W4IA 1V9LA 2NM0A 2NQTA 4J43A 3EHEA 1X7HA 3JQBC 3GOHA 3H9EO 1E6UA 3GPIA 3DB2A 4TMFA 5JS6A 2JCXA 1M6HA 3QVSA 4M49A 3L77A 3JQAB 3OQBA 2ZKLA 4IPTA 3T7CA 3UGKA 4A73A 5EMHA 1XSEA 2Q49A 4RVUA 5JBIA 1WZEA 1X0VA 3TSCA 1SB8A 3ZU3A 2ZYGA 4GX5A 2AW5A 2FHSA 4QFDA 4BMVA 3W4JA 4WLOA 1K6XA 1PZHA 1LNQA 3JSAA 4L4SA 5DP2A 1U3UA 4O0LA 4ESOA 4GMGA 4M87A 4ND2A 4XJSA 4BO5A 1E3LA 2OXIA 4CM4B 3QP9A 4D41A 1ISMA 3ROMA 4LRTB 4GX2A 2YYYA 4TZTA 5LDHA 3PJDA 1U8XX 1PJSA 4BGVA 3JQGB 2GPTA 3ANLA 2Q3EA 4HFMA 1WDKA 4KWIA 5G4KB 3KYCA 3EYWA 1P77A 1DIAA 4A2CA 4FPXA 4DQUA 5TJHA 2WMDA 3GNSA 4UUOA 4ND4A 4YAIA 4FC7A 4PRKA 1JTVA 3ASUA 3Q11A 3JV7A 1E3IA 4MVJG 3TFQA 1QMGA 1GYQA 1HL3A 4A10A 2PD4A 2QZZA 4W6ZA 1HDGO 2FSVA 1WXDA 2J5QA 5ES3A 3PLNA 4AJ2A 4RVHA 1SZJG 1H94A 4QSMA 3V1TC 2NUAA 4Q3AA 3VZPA 2EGGA 4LRSB 1O0SA 4AJLA 1KVRA 4DL9A 2B5WA 3LT0A 4BNMA 4HFJA 4LGVA 1DPGA 2X9NA 2CSUA 3DTTA 5L4NA 3DOOA 5HWSA 5A05A 3VOSA 4IDFA 2OORA 1GUFA
chains in the Genus database with same CATH superfamily
3I61A 3CWCA 1TZ2A 3SX2A 1QQBA 2BTEA 1JVBA 3CV3A 4B3SB 3ZI4A 1L3CA 4REOA 3WWCA 4HNAB 1MA3A 2YCLA 1Q0UA 1C9KA 2OO3A 4AN1A 3H2KA 2GN1A 4O4HF 1NQTA 1OROA 1SUCA 4Z49A 2J85A 2R65A 1OWOA 2EP8A 4O4JF 3TQQA 1PX0A 1U2GA 4EABA 1UXHA 3AFOA 1X1AA 4HQNA 4I50A 1QGUA 3PRHA 3FCYA 5TR9A 4H0NA 1H5QA 1RI1A 1GL6A 2XZTA 3E9MA 3DDUA 3G2QA 3I2FA 4MHSA 4B73A 2BFCA 4JYZA 1SKYB 3K2IA 5HHTA 5JPCA 2JLUA 2CLFB 3I23A 3N7UA 3C97A 3OD5A 3DR5A 3ZE1B 2PJDA 4PZLA 3H4VA 3P1JA 3LPNA 4ZO9A 1JVNA 1X19A 2YUIA 2AKEA 4AI6A 2JJ1A 1RCFA 1SN7A 2BHSA 4KIFA 4X9XA 1DJQA 3ICPA 2Q3CA 4IDGA 4Y67A 1TMGE 3M4JA 2PBFA 1I8TA 4CLEA 1PBTA 2Q0QA 1XX6A 5JQGB 4NNPA 1KAMA 1KC1A 3MS2A 4H7JA 3FDZB 4NEGA 4LBWA 4AM8A 4LF9B 2JA1A 3OLQA 4AN4A 5JYDA 3W5HA 5L3SA 2COUA 4NQRA 3AR7A 4XLZA 3DV0A 2P4QA 3W2IA 1JDBB 5CA1A 4W1QA 5LM3A 3R8FA 3HXOA 1QU2A 4MO9A 3GLSA 3VZBA 4TMXA 1OLXB 5K4HA 3ESCA 3JARA 1UQUA 4G63A 1DQYA 2O8BA 3NTQA 1NJ2A 1BXKA 5T57A 1E0AA 2D0OB 2A0XA 1I0ZA 1JDSA 3LRXA 3PQ6A 5BQFA 1YBFA 4XWGA 3S5UA 4XIYA 1AE1A 1CD5A 2XYPA 5EJIA 2G9QA 1Z88A 3C3JA 5CVEA 2C7BA 4B87A 3EVFA 4QXMA 4DY6A 4ZOQI 3MGCA 2B7BA 2CJFA 3R20A 3R5FA 3IJEB 3BS4A 2VWPA 5A4IS 1K6EA 2XMCA 4PFQA 5E7IA 4O0MA 1TADA 3FYDA 2QTAA 5A0FA 1OREA 2FRXA 3TWOA 3D7RA 4AQDA 1QIEA 5E6RB 3N7TA 2R1TA 2WM8A 4Y9UA 1QZTA 1Y9JA 4B6JA 3L0PA 4Z5XA 4G23A 5BVGA 4YGYA 1ICEA 3AP2A 1EWRA 1FLAA 1DUSA 2XADA 3C5VA 3IUSA 4LWPA 3T7KA 1GCOA 3QVTA 5HF5A 1OXKB 2H17A 3T1TA 1SQGA 3R3VA 4JWTA 3U1TA 4JAVC 5KX5A 2EJCA 2HADA 4G26A 5HKLA 3EZ2A 4UPDA 1TUIA 1YQ9A 4C4XA 1R0WA 4XGKA 3VH4A 3W3AH 4TSFD 3B60A 4M7WA 1A97A 1DBWA 2GFIA 3AZOA 3C1AA 4KFSA 5DRYA 3I58A 5H81A 4YGXB 4Z4HA 4M9XA 2R9VA 2DWPA 1E2LA 3KUDA 1C30A 1PSDA 3VX3A 3K92A 4CPDA 2HNKA 1JP7A 1ZHHA 1NPTO 4GOMD 2WD9A 2EDAA 1NVVR 3F90A 4PVDA 4XYLA 5B7GA 4E5UA 2NUAB 4GLJA 3KUUA 1P73A 1PVVA 4I8IA 2RMKA 2HA2A 4UAGA 1A2BA 1KR5A 4G24A 1LI4A 1OF1A 3NOVA 4KVFA 3UF0A 4PXSA 4F3KA 3ND5A 4M36A 3NBMA 4NHEA 3CEJA 3OETA 2WEKA 5F5XA 3N8GA 3R7NA 2NZWA 4HGOA 3FPEA 1YZYA 1V47A 4NFHA 2Y0BA 1J21A 3MWKA 3OWHA 5IHPA 4TS1A 1MBZA 3HYLA 4OHCA 1BQ3A 1FMLA 3T61A 2JNWA 5JT1A 1C3VA 2I7CA 1W7AA 2VJKA 3EBPA 4MS3B 5IARA 4MRVA 1PR2A 3BGDA 1GCAA 3KM0A 4I3GA 3QG5A 4F2HA 5CDTA 3BSSA 1WKVA 1G6KA 1J0EA 1GZHB 1XRJA 3EOBI 3L93A 4JLNA 1Z7WA 2DWCA 5F2EA 3UYKA 3ZCUA 1HZJA 1E0DA 3UC5A 2X22A 2YFQA 3FDZA 2QBYA 4YMSA 1S2MA 3DPUA 3OPNA 4Q4CA 2XQGA 3HJBA 4YJHA 2AOUA 3AJDA 4COKA 4E6EA 3RVJA 5LXTA 1XNGA 3VVCA 3FNFA 1IB6A 3BF8A 1JHUA 1IMJA 2OCPA 5CVUA 3H8SA 3KSMA 3CRZA 5CBKA 3WMWA 4C87A 3COYA 4RJIA 5LB2A 4QLOA 4WXMA 3WIEA 1MG0A 4KNWA 3ZHOA 3V00A 3K0AA 1L5HB 1I7SB 3BWYA 1HG0A 2NTYC 4F71A 1I4EB 2P6RA 3O73A 1SCUB 2I3AA 3IH5A 2IKQA 1XA0A 5HA5A 4HDCA 4K03A 5ALMA 3DBRA 3GEGA 4YLYA 1SQFA 2W83A 1MQAA 1WBBA 4I5EA 1FU7A 3E05A 3JPYA 5ELMA 1RFGE 2QL7A 4KHPB 3NHJA 5JECA 3BFJA 1JZQA 3VR2A 3EH1A 4JUBA 4RCYA 4UU7A 5H0IA 3K16A 5DGIA 3VNSA 4CXMA 3C8HA 3DTYA 1SXQA 1E3SA 3HUUA 5DVZA 1PN3A 3BFVA 1JR6A 1R9NA 1G2OA 1QAQA 2YJNA 2ZRAA 1FTNA 3NJ4A 4B6RA 3GP8A 3ZNOA 3UMRA 1U99A 4ZT7A 3TL2A 5B7QA 2DYKA 1HSOA 3GUYA 2FP4B 1RPAA 4C2BA 1L5MA 1QIDA 1G7TA 1QGZA 2FZWA 3SX0A 1PR5A 5LNK1 5BQXA 3QTBA 5JRDS 3OIGA 1E2GA 1G4HA 1W4LA 1RSZA 4IXNA 5JNUA 3KPYA 1N6RA 3LGAA 3N0TA 4GVXA 3VYSB 4YHBA 3SXPA 4ZCTA 4EMBA 1H6BA 5AVVA 2Q50A 3OY7A 1ULUA 2M98A 5BR4A 4YYZA 2D2FA 5FD8A 2IE0A 2FWJA 3MTGA 3CNQS 3H97A 4DOMA 3E23A 4DMGA 1VG8A 4MW9A 4IZ6A 1XL1A 4M9RA 5B1IA 4EHNA 2WHQA 2J9YB 4NIMA 4OJMX 3V7FA 3OURA 3H6HA 3C14C 4LZLA 4ME6A 5D3ZA 4BNWA 4J4HA 6REQA 5L51A 3DDNA 2ILVA 4X7PA 2HI0A 2K87A 1P18A 3R7FA 4IMJB 4PZZA 1XRPA 4BJ1A 1ODCA 1L4KA 3HDYA 4GPAA 1DC8A 4F85A 3TUZC 2I4TA 3TGLA 3R0XA 3KKZA 3OKAA 2EYUA 4TKMA 121PA 2X5XA 2DR2A 3QTTA 2BJWA 2O14A 2WVGA 1Z38A 3B6MA 4GOKA 3PIRA 4PINA 4R31A 1KP2A 2PGOA 3FGOA 1QKJA 1NJFA 1W2HA 4BKUA 3LQFA 5T4HA 2P2CA 4KO8A 4NTZA 1BWPA 2VN8A 4KO3S 1C3XA 4Z4QA 2BM1A 2GN6A 5GIPE 4TRRA 3JW8A 1U0OC 2GN8A 4MQMA 3AM4A 4IIVA 4KU4A 3RFVA 1E2KA 5BOSB 1SCIA 1VJ0A 4GGPA 2HHLA 4LJ6A 2ZRPA 1M6WA 1U9YA 1P60A 1FS4A 1L1EA 1YHYA 1IPHA 1C9JA 2GH1A 2N46A 2PT9A 2WJAA 1RQLA 3ASYA 2OLKA 4PWYA 2AI1A 1JU4A 1EFPA 3L43A 4JA0A 2OYRA 1XL0A 3RU7A 4CRWB 2IH4A 1SOUA 2AG0A 4D79A 1EM6A 2PVSA 1A69A 4FFBB 5BVHA 1NBEA 4FD2A 3WRYA 2P0EA 4HWKA 2Y8EA 2X0EA 1YKGA 3LK7A 3ZU5A 2J87A 3W5DA 2CXTA 1E2JA 1T10A 2XYQA 1KSGA 4CF5A 4YV2A 5BNIA 3IESA 2VTBA 4DR6B 4C4OA 3FIUA 3G8DA 4I2VA 3R5TA 2QEQA 3KKQA 1ZFNA 1FRQA 2ZWOA 1HDXA 1TGYA 3D02A 4TXLA 4JI1B 1BMQA 1ETHA 5DX0A 5DE3A 1JILA 4J03A 2BMEA 1DC5A 1M34B 5E3IA 1H8HA 4P4UA 5TPZD 4IEIA 4X3CA 4EGJA 2XSZD 5LU9A 1E1CB 5JD3A 2R6DA 1V7PC 3T5DA 3TLYA 1L7XA 1XI2A 3KKNA 4DQXA 2YS7A 3P0RA 4FMDB 1GLGA 4G97A 2X0JA 1W5TA 2O9JA 4FZVA 1YDHA 1GPMA 1JEDA 3EDCA 4RFVA 4WJLA 2VJAA 3AEQB 2JLAA 4P31A 4Q7MB 1J07A 2NVOA 3KWLA 4KYUA 1X7WB 2CLMB 1D0IA 1JSXA 4HN2A 4PHGA 3RAJA 4DG9A 3BXZA 5ALEA 2BW0A 1CY4A 2GAIA 1CEEA 1B1AA 4FN5A 4PYRA 1Z45A 4GSKA 2O7QA 4HEQA 4JUFA 2XQIA 4DTIA 1A7AA 4TROA 2QVCA 3PFNA 3PKIA 2O2XA 5DW3A 2OZKA 4OQXA 3GP5A 4P84A 4O33A 4ZALA 2HW8A 4PM4A 1W1WA 2V55B 1IY9A 1U8CB 1ORDA 1QANA 1T4GA 3P0JA 3TXYA 3V8QA 4BFVA 3DHEA 3GARA 3OCXA 2H8KA 1JLLB 3L5KA 1CUHA 4FS3A 3BVPA 2E4YA 4RD0A 4ZOAA 5FUXA 2GPWA 3G0OA 4TVBA 1SQ0A 2R0QC 3LWZA 4M55A 2HT6A 1DTWB 1TOAA 4MB6A 4CVNA 1UC9A 1Z28A 3F98A 3DO6A 3KQVA 3SJUA 1GPH1 1QX3A 1ZRMA 2FV8A 3PS9A 1F5NA 4NYIQ 3EMVA 4FQ7A 5ELLA 4DIFA 6REQB 4V2IA 1XPRA 4Q34A 3K1JA 1JA1A 4DBZA 5ERXA 2QAGC 4CODB 2CCJA 4S1TA 2O2IA 2WWTA 1ZD5A 1ECJA 1JKJA 3Q87B 1FLVA 3HADA 1TCAA 2WZDA 4W5OA 2G1AA 1YUMA 3ELBA 1F9AA 3FPCA 2NZUG 1XELA 5KWEA 2JJ8A 1ZK0A 4HDKB 5BW4A 3HHEA 3UK6A 2WF8A 5JY6A 2ILTA 3BSWA 4KVZA 3KLNA 2QRNA 2G9NA 3ESQA 1QE0A 4CKBB 2I8AA 4TTSA 2L42A 1DC4A 1ADYA 1WU8A 2BLLA 1MVLA 2PX8A 3FRIA 4WMLA 1EHCA 2YIVX 3LUPA 4JQYA 2WD8A 2XDYA 1YDEA 3VR0A 2OKGA 2E3JA 3STYA 2P9HA 1LLDA 4M38A 3A6KA 4RMHA 3LXMA 4BPBA 2EKLA 5TMPA 1NP3A 2D5AA 4DZZA 1FNCA 1YK0A 4WINA 3X43A 4I4CA 4RK6A 4ZRNA 1I6WA 4QNRA 1UPXA 2KW5A 2Z1MA 3GW8A 2XNHA 2C9CA 5KS2A 3MT0A 2HLDA 5FPHA 2OGUA 2Z5LA 3V2GA 1P4GA 4DN6A 2HBQA 1YS4A 2GARA 4YUVA 1O1YA 3C8MA 4EAAA 5C5DA 2H18A 5GONB 3TCNA 4BFCA 3WQHA 2NSLA 2Q3MA 2DFLA 3C16C 3V7WA 4QEDA 3GXBA 3PC8A 4PTYA 2QIPA 5GJCA 1XMJA 3KL2A 3LHFA 1BG6A 4EARA 1S6YA 2WMYA 3GGDA 3GUCA 3EPJA 4KPGA 3GRCA 1OIXA 3IOBA 4B9AA 1H9CA 3U3OA 2DH5A 1AX9A 3BIJA 3FA2A 1C3LA 3MCAA 1PZGA 4RE5A 3BMNA 4RZQA 3AW8A 3D6TB 3V42A 2X3YA 2I1LA 2VYVD 3M4NA 1WXEA 3RREA 1Z4LA 3QU4A 3WWOA 1TK9A 4GL2A 3JATB 2ACWA 4WT7A 4EHFA 4C2TA 1O96B 4N48A 3T9FA 1ORHA 3D64A 4RJKA 4UBKA 4U4AA 2I6SA 4BJ6A 1WDTA 3DULA 3RYTC 3COZA 5CX1A 5DGXA 3GFVA 1EVKA 2IYRA 1W0JA 2AN1A 2C2WA 1PEAA 1P1BA 2V74B 4TXJA 5B1HA 1P2BA 1S4QA 3HSYA 4KQWA 1E59A 5REQA 3NEJA 2B83A 5FFMA 2GHTA 4I9HA 2NXJA 3E5NA 4EHHA 4GSLA 1LY1A 3QWFA 1JBQA 4YQEA 4DGQA 2Z1NA 1VJTA 2O8FA 4CEIB 5L7YA 2EARA 3M5CA 2YL2A 4O63O 4NZMA 1FS5A 1OKKA 4Q05A 4IOMA 4EJMA 2BFFB 3QMPA 4DXDA 1R15A 1KYWA 3BG5A 3TD6A 3GY0A 4XQ9A 3PPXA 3G0HA 3G0IA 1MQSA 1QZXA 2PZGA 1F51E 2DH6A 2Y27A 3DVSX 3UK0A 1LK5A 3JQBA 3IGFA 1U11A 3DE2X 4KXWA 3V3KA 3VAZA 3X1JA 4F8YA 3NYRA 2EL9A 1Y8AA 3IEPA 4YAKA 4IIXA 1NTOA 1OA0A 4POAA 3TIGA 4XFJA 3UXHA 2H16A 4EG1A 4TKUB 4L08A 3SEQA 3F2IA 2I34A 4FGJA 1M8PA 2FQ1A 3KDPA 4M60A 4AMBA 1M6NA 1X74A 4KH0A 5LIPA 1ZC3A 2QN1A 2YIDA 4HX2A 3G8BA 5C1DA 3KQSA 4K3VA 3GJ5A 3EEFA 2WSLA 5J5AA 3CZRA 2Z09A 4JLJA 3WK6A 3G82C 1ZGCA 3HE3A 4ARSA 1KDRA 3UWPA 3FNIA 1O9HA 4ZU1X 3WGTA 3W5AA 3BL5A 2FZLA 3MYYA 1DAMA 1WNFA 1KO5A 2RK4A 1WD5A 1RYEA 4TSKA 1Z4JA 3IQHX 1CZNA 4FBGA 5LYJF 3DLHA 4G2NA 4IFTA 4Q3NA 1HC7A 4R6WA 3C2QA 4LS3A 3HR7A 1CY1A 3PBKA 3V1UA 2IXGA 1CQZA 2IL1A 3HR4A 3BWVA 2BEUB 2AQ8A 2G25A 3PYLA 4PGHA 4PSUA 4D9HA 4IO0A 2J6CA 3K0CA 4W9NA 3ZVLA 4N5IX 1M5UA 1O87A 2ZR7A 3DWGA 4A3SA 4M9SA 8GPBA 1YZGA 4ICIA 2PX2A 3O4FA 4YJFA 1FXWF 2GPBA 3KZVA 1NXWA 2J6IA 2VDWA 3FBWA 2PO7A 2Y0EA 2YMLA 1WBJB 4R51A 3ZHSA 1PVOA 4WBXC 3MINA 3KSDO 3F0TA 5T8KA 1FZTA 1WHSB 1SHTX 4LNUA 3OZWA 2VDRB 3MF4A 2ZJOA 4MINA 2R1ZA 4X8MA 1NQVA 3OFSA 3BT7A 1SUFA 2V4MA 3OZDA 4IS2A 4MQFA 3U5TA 1CJVC 2D1SA 1OR8A 3PPYA 4L75A 3AVUA 1CDOA 3FXAA 3O4GA 4PGFA 3VUEA 5F3WB 3OU6A 4HAOA 2ZBPA 2B1QA 2PQMA 2NO5A 3HKBB 3KQMA 5IM4A 4G1BA 1GN9A 4J16A 5J40A 4MWOA 1UFRA 4W8OA 1YE3A 2HWYA 2HLNA 2ODQA 4JJIA 4DJFC 4J3FA 5AK3A 1Z82A 3W8FA 4CTNA 3OF2A 3EVEA 1HDRA 2OGZA 4TLBA 2GD0A 1C1DA 1I4LD 2O5RA 3PEVA 2JAPA 4ZREA 2LZ0A 4DWJA 2E0IA 1NATA 1KI6B 3CKYA 3CXRA 4AS1A 1J9GA 3MWDB 1EP3B 5THKA 3CGWA 3EAFA 3THWA 1OB2A 3EMDA 3VGPA 2P9CA 2OPHA 6PFKA 3LQ1A 1ZD2P 3SYTA 5M3BA 4C1BA 1M83A 1C8KA 3D6FA 2PUFA 1QQ5A 1NJ5A 2H4WA 4B4WA 4K3UA 3WDKA 1W4RA 2MR6A 2PQ0A 1Z3CA 1LPOA 1BDMA 3HHPA 3MTEA 4LJ4A 4FKZA 5ALIA 5EIFA 3RSCA 3QX3A 2OVFA 5BN3A 4E70A 4FCWA 4FDLA 1GILA 1MV5A 3HP4A 2D1FA 2Q1WA 1TXGA 4I1SA 1C8BA 1W46A 1E58A 3E7FA 2PUVA 3KEOA 3B2EA 2VP9A 2IEGA 3A1VA 3ZWDA 4JOSA 1Z73A 2FWNA 3K96A 1AHHA 3L0DA 4J90A 2CLDX 5ALZA 1UMCB 4UQLA 3KT3A 2X13A 4R9SA 4RZIA 5DSXA 1O8CA 2JGJA 4A8HA 1UJNA 3BKWA 4HYQA 5J4VA 3VR4H 2ZSKA 2O05A 3CEAA 2V5UA 4OOEA 2J3EA 1AQLA 3FVWA 1NVBA 4LHXA 3K9NA 4J1TC 2G5GX 2VXOA 3IUBA 3D0OA 4KN8A 2Q4EA 1EIZA 3A10A 1LXCA 5K3SA 3W3ZB 4BJ3A 2OV3A 3DZJA 3CWZA 1UK7A 3TSWA 2AW3A 4P3NA 2YW9A 3JQ8A 5G40A 4HAUA 1WUTA 3HCPA 4I4IA 3KO8A 4Z2YA 5KREA 1GNTA 1QH1A 4MYCA 2UUCB 2HGZA 7REQA 1L2TA 3CE9A 4ND5A 1PJZA 2G17A 3GP3A 2C9OA 5CXXA 4IEEA 4DJDC 4QZVA 1VYTA 1TLFA 3W5BA 3MGGA 2YZ2A 4GLFA 2GRAA 3WYNA 4L6IA 1G21A 1EWQA 1GR0A 4FW9A 4GGOA 3GFFA 2ZS9A 1Q0PA 1E9EA 5KTYA 2DBQA 4OFXA 2C4VA 1C41A 3ANSA 4KYTA 1WU7A 3PL5A 5EXEA 1OD6A 3U9SA 2A67A 3KPJA 4PC2A 2IXEA 4OUKX 4KXFB 4KR2A 4N8SA 2PFKA 4YDSA 3A6PC 2R8PA 1PQPA 3FOAA 1JFRA 2YJTD 3UQYS 4GEGA 4PAMA 2YN0A 2BFEA 5CB6A 3QEBZ 3ZHQA 1XJCA 3IMEA 5L3SB 1E8NA 4FGUA 1YJXA 1TTTA 3L8EA 1Y3IA 2P4UA 4HGYA 4X1YA 3CUKA 4M1ZA 3CVWA 3C8UA 2GF2A 1Y6JA 3UB4A 3WYDA 1ORRA 2ZYSA 1T9BA 3TVTA 5GQSA 1I2AA 2F62A 2HJ9A 3LI2A 3VO9A 1XQVA 4MPJA 1FNNA 3F5DA 3ORQA 3BWBA 3CC8A 3RSZA 3OIFA 1H0HA 1JI0A 1F2DA 1RWMA 1T8SA 4RCZA 3W8DA 3WHPA 2YVLA 2GNAA 4IQFA 4YRMA 2HF9A 5DOZA 1P8AA 2RGNC 5CUQA 5IC6A 5KYVA 5KYWB 5CD1A 3EUWA 4WASA 1M75A 1VCIA 1ZL2A 3INNA 4FYIA 4TTRA 2V7GA 3I3OA 3N8KA 3QX7A 5JC1A 2PLNA 4DUGA 3FJOA 2WU1A 3KJNA 2VP6A 3CR8A 4NESA 1QGYA 4RA9A 1NI4A 3USCS 4KIWA 2IYOA 2CL6X 3CLSC 5DEOA 3UNXA 1K88A 3IMCA 4S12A 4GFDA 4O1IA 4B5KA 1NBME 3G8YA 2I4LA 3RYCB 1SEVA 2B8EA 4UHJA 4GMDA 4EZEA 5ALYA 2P11A 2C1ZA 4A8JA 5EJ5A 4RMIA 4XTRA 2MU1A 2CLOB 2F17A 1RTKA 1YHZA 3NO4A 3DMPA 4B4VA 1UZAA 3HDVA 4B5LA 3B7WA 3NHBA 1EVZA 1VJDA 1KU0A 2XH8A 3RJZA 3TDNA 3ACCA 1EK2A 3ZUGA 4RTNA 5LMNB 2NSJA 4EGQA 4CMIA 1JMVA 3DZHA 4FGKA 4OP1A 4IHJA 3IOEA 2RKOA 1M0SA 3KETA 3RV3A 4TV9F 1JDVA 1AJEA 4RA9B 5DF1A 3MEQA 2YMQA 3A8TA 1DRVA 1NQOA 1XKTA 2JJQA 1PJ4A 3UHOA 3CFYA 4QOJA 1LTHR 1KJ9A 4TX1A 4KUGA 3GIDA 4UFOA 3TGWA 4DJEC 3JWJA 3GJ3A 1V4NA 3IUJA 2B1GA 4CTOA 2QP9X 3TQCA 2ZCJA 5DX1A 4D0RA 1NR1A 1OLUB 2DSTA 2X0FA 1FXWA 4UXHA 5EL0A 1EE9A 4ZEOA 5B6IA 1GPDG 1DRUA 1UANA 4NONA 1LK0A 4TKZA 4S24A 1RYZA 5TRTA 3DMDA 4CF4A 4DA8A 5CXUA 5HOQA 3OJCA 2ZK7A 2V7TA 3DKVA 2C5GA 1DAGA 4G0YA 5E2AA 2A88A 3K5IA 3SIRA 1U02A 4R1QA 4R8RA 4MHOA 3U7EB 4OAOA 4U39A 4D4HA 4WY8A 1UC4B 1PF7E 3AX6A 4KXVA 2WRZA 3AEXA 4PAQA 1EI9A 3WWZA 1WZCA 3KV3O 3SR3A 1KO7A 4J7UA 5KOJB 1DMSA 3GCWA 1EMDA 2CC2A 1X8KA 3OTGA 1IWPB 3A36A 4TXNA 3SOZA 5AJTA 1P4HA 4OQZA 1W5EA 1G3IA 2FETA 2R79A 4TV8A 1JDPA 3URKA 3VOAA 3SQWA 3FUUA 4UHHA 3DV0B 4AJEA 4YRIA 3UJNA 3HFJA 3WLIA 3LUCA 1QORA 4BV3A 2QLJA 1E1DA 5D1NA 2FMFA 2FQXA 2BOVA 2QMZA 1XHLA 3PC3A 5H9VA 3OIYA 3GMIA 4UATA 1JHPA 3BL6A 3PEYA 2FF5A 1XG5A 2CMKA 1E2MA 2W4MA 4LX8A 3DAFA 1WS6A 2ZE5A 1BEZA 1J0XO 2QGNA 4C5AA 5IVDA 1E64A 2HDOA 1ZNZA 2A0WA 2Q3BA 4RSHA 5A4AA 5IAKA 4ES6A 4MUYA 3TKAA 3HKEB 5HCUA 4B35A 2ZSUA 1L4NA 3GR6A 4P7BA 3WXBA 5HK8A 3KQHA 2V5AA 3JQAA 2F7SA 5C31A 1G18A 3F3SA 4NMWA 3PK0A 1RXCA 2KPOA 2OHXA 2GF0A 3Q0TA 3LU1A 1PT8A 4N3CA 5CG2A 1SXPA 5HDBB 4Q39A 1W34A 3INGA 4BQSA 3OIWA 3OJFA 4YLEA 1W94A 2O7RA 1L7OA 1NW5A 2HDWA 2FEOA 1VOTA 4DM4A 1IY8A 1PBNA 4G5FA 4F4DA 1AQIA 3KD2A 5H8WA 5F98A 1PZNA 3JYQA 2WFLA 4F4FA 1B0AA 2X58A 1DBVO 3MT9A 1YGYA 4PZ0A 2ECQA 3A9CA 3DOEA 4G5QA 1R0BA 3DZDA 1XVIA 2KX7A 4MJ3A 4X63A 5A5FA 2E21A 1E69A 4RVOA 5IM4F 3FNHA 2H1CA 5EI5A 5B12A 2VJLA 1B74A 3ZDCA 3JQCA 3LKZA 2AXQA 1B0PA 2H9YA 3O3OB 4KODA 4NRDA 3NPMA 1KO1A 1TCBA 4X1OA 1XDBA 4H16A 4B4KA 2WI8A 2C5SA 2WAMA 5WRFA 4KQHA 2WYUA 4ZXFA 1VP9A 3W05A 5B3AA 2Z6VA 2GOYA 1IBCA 3LUDA 2CJYA 4L5BA 1PYGA 3W5JA 4IBOA 2PQ6A 1N8NA 5HUJA 2XEXA 3ABZA 1A8QA 1VBKA 1YFZA 1GQOA 4WEQA 3KBOA 2RGYA 1R0RE 4PNHA 2IOQA 2LTAA 1W36B 5A02A 3RS9A 3VR4D 1GZ6A 1JU9A 3RB8A 2HB6A 3IJPA 3D43A 5C9ZA 2Y93A 2QN9A 3FSGD 3UJ9A 1OFVA 5I5EA 1ZNYA 5HR5A 2HBYA 4KREA 2V7EA 1Y9DA 4QRHA 5AQ1A 1P9OA 2A33A 1W49A 2G5PA 2GZSA 3GJ0A 4IH9A 4BZZA 3G85A 3C6QA 1PE0A 3I2GA 2HM7A 3CF2A 2FVYA 2OFOA 1UDWA 3LVRE 5DYTA 3FDIA 1BGVA 4LWOA 4Y2RA 3UATA 4PZEA 5D5QA 2WWVD 1U0EA 4ER6A 4ESVA 1R6VA 4HMOA 4L2IB 2A9JA 3HA3A 4TL9A 3GNLA 4C7OA 4W9RA 2O6HA 1G7RA 4H3HB 1RHMA 2C8JA 3AFGA 1D5WA 3IERA 3DHWC 3KDAA 4LJRA 4Q9NA 2OG1A 3C15C 2F9MA 1VL2A 3WLEA 2VXYA 4XH9B 1LF5A 3WLFA 1BMFD 1Z0UA 1F0YA 3RK0A 2YV2A 1G8AA 2J46A 2VDKB 2P0YA 2P2SA 3Q5DA 3RJTA 4F60A 1SU7A 2DR0A 5ALNA 2P1ZA 3EGVA 3WLJA 2RCNA 2P1DA 4S2UA 5LLDA 1JBEA 3N8NA 5AIAA 2UZ0A 4X6LA 4ZQHA 3FFXA 4K87A 4YUAA 2JB9A 3K70B 1ZUNA 3PJFA 5DYNA 4CT4B 1DNPA 1KSFX 3MMSA 3HZZA 1LC3A 4YALA 1IY1A 4K9SA 4B6EA 5KDDA 3TTVA 5EPUA 4E21A 1DIHA 1N1MA 2QRVB 3ELYA 3FCUB 4GKVA 4RGYA 1TQDA 4BNHA 2FPGA 1O03A 3DBRB 2B6HA 4FGZA 5TS2A 5FTKA 3NWPA 1SB9A 3VPXA 3KALA 2CZCA 1GPJA 3DE0X 3FPKA 3HCWA 4J2TA 2F3TA 4NE7A 1NNSA 2PIDA 4CL3A 5K0FA 4KYVA 8MHTA 5KTTA 5FUVA 3N8DA 3FHTA 5CA1F 3LX8A 4K5QA 2B37A 1VI2A 1OAKA 4KBFA 4KXNA 3EGOA 5TT1A 4ZN6A 3PUZA 1DX4A 2FOXA 5GGXA 2ZPUA 3L4KA 5LQKA 1THTA 1ZVQA 3KWMA 4DQ0A 1AN0A 3EIHA 5AM3A 3I64A 3B1WA 3QNMA 4RVCA 4BZPA 4JDUA 3F6YA 4KN6A 1I2BA 1FTYA 4JBHA 3LFTA 4JUCA 3O91A 3V2HA 1KDPA 3C41J 3TE7A 3TINA 2O57A 3LT5A 4M4SA 5K3OA 3MVEA 1NU6A 1Q44A 4TMWA 3MWJA 5H4HA 2KSQA 3A1SA 5FWNA 3QWHA 4EQZA 2O2DA 4MGIR 8ADHA 1DCTA 3Q2KA 1NHWA 1VE7A 3HFGA 4I8DA 3MELA 2FZKA 2HMUA 4JR2A 3QBDA 5E4JA 4BNZA 3CT6A 1GV1A 3PC7A 4HTAA 5BSMA 3CLSD 4K1LA 4Z0PA 3IILA 2JGLA 2D5LA 4QM7A 3E18A 3ND9A 2VUUA 4MQEB 3EGXB 3LCMA 2EL7A 4L74A 4MKGA 5EHXA 2WHPA 3ICEA 4QXAA 5FWXB 2BI7A 4I55F 4CDGA 2IZ6A 5AJZA 1J5XA 4KBGA 4F5EA 1HDZA 1OLUA 4TUYA 1P4RA 2F1RA 4IGEA 1SOMA 3A1UA 1FUIA 2RDMA 4YWJA 3LA8A 4I81A 2CMFA 5JH7A 3EXG2 4KO4S 4F96A 3TMKA 4MVJM 3Q72A 3D7MA 2OZPA 3ICCA 3MGBA 5GM1A 4DR1B 3AJRA 1Z75A 1WVMA 4YCNA 2I2XB 5AM1A 4N41A 1RM3A 1MV8A 3BWCA 3P2IA 1WEKA 2HSZA 4A2PA 4RC9A 3TOXA 3MJSA 2EBFX 1MG5A 4A8TA 2WV9A 1XU7A 3X1ZA 4EY7A 1GVNB 1RLJA 3E8SA 2HCTA 1JB9A 3UAOA 5JH7F 2BT4A 5CX1B 5JD5A 2XKJE 4CU5A 1HFKA 2GN9A 1Z4IA 1KVUA 4K6KA 1R4MB 2FXVA 1PZXA 1W4ZA 4RH3A 4O3MA 1BAPA 1HURA 1F8FA 3P19A 2FPRA 2P90A 4HWSA 2X0KA 2O4CA 4MP3A 2VRNA 1TUGA 3VPGA 4Q1FA 2Q4BA 3H1TA 3ZI0A 2GJ8A 3NXKA 3PXEA 1N5JA 3VZCA 4YCMA 2QPLA 1RTTA 5K3CA 2YRXA 3NP9A 3F4LA 1TA4A 4E33A 3GAZA 3AHGA 3NC0C 1K06A 4DV1B 5HQJA 3G7NA 3ILHA 3A9VA 1V6SA 2PV0A 1Y34E 1Z5OA 2WAAA 4IZHA 4PANA 1KDOA 4OD0A 1P5HA 4DILA 3D4PA 3NI2A 3IAM1 1JAIA 2O3QA 3H04A 3ZPXA 1J06A 3OMLA 3GPBA 1CF4A 4N4AA 4MI1A 3EAGA 2ODPA 1GGNA 1HFWA 3ID6C 3IKVA 2XGSA 4UMEA 3E1KA 2PS0A 3HVHA 4KIUA 2DETA 5EN4A 4JL5A 5I48A 1DMRA 3CBGA 4P92A 4WVLA 3DL2A 1EAYA 3G5TA 5DCWA 3HPQA 4LOLA 4HZIA 1Y9EA 4MITA 1T25A 4OBEA 3TX6A 4ZHQF 1DBQA 3NBQA 3SLRA 4ETNA 1P0MA 3ZK8A 4DUPA 3ROXA 2NXNA 3PPIA 1BN7A 4URUR 3ZGXA 3LY9A 4B2LA 3A1CA 1GXSA 4KQXA 1I7DA 1TVKB 1AUQA 3LVFO 3NKLA 3L41A 3LJKA 5LZ5A 4FFRA 2GCOB 2MIIA 4NYMR 5HKAA 3F73A 1P2FA 3RGGA 2X6TA 1SPBS 3AUUA 3HNPA 3T38A 2BGRA 2ASEA 1AUXA 1PZFA 4GZ5A 5DHSA 5EHGA 4ENVA 5BWMA 1ZINA 3HCNA 2A5FA 1TYAE 1J2UA 3D6UA 3U7IA 3VR1A 3ZEIA 5LQJA 3BE5A 4B3HA 1DJNA 4ZI5A 3WZLA 5CM9C 2ZLBA 2HQ1A 3D3QA 1QYVA 5F12A 1U7OA 4KR0A 4FOTA 5JZ9A 1JIJA 5I7UA 2X0DA 3L3BA 3GVIA 1YASA 3NPAA 3DOFA 3V6MA 2EP7A 3AUSA 1FVHA 4JC5A 4WZBE 1EP1B 3RKRA 2XCUA 5FQNA 4DMCA 2FQQA 1R6XA 2EEPA 4PCAA 4EBFA 4DA9A 1EDZA 3AHEA 2WQZA 1U9ZA 2Y68A 1YFJA 1XVLA 1BHQ1 2ZE6A 3QEMA 3QM1A 2QQGA 4TT8A 1I4TD 1Y8QB 2QGFA 3VHXA 5C37A 3NETA 1NOKA 5JCPA 4QYXA 5LDDC 2F9LA 1KKUA 4J4TA 4NMLA 3JAKB 2P5UA 2PL1A 1LPAB 2J3MA 2OPBA 2GZ1A 2I6XA 2P8SA 3BXOA 3C3XA 1V11A 3DJYA 4M1OA 5P8WA 2VYVA 4XPIB 4ZZ1A 1RKVA 3H0KA 4ABTA 4PZCA 4MKXA 1GRCA 3DF7A 1EXVA 3I2HA 3E3AA 2HZ7A 2WWHA 1J2TA 2V7UA 4LVCA 3KJFA 2FZVA 2QLLA 1Z26A 1ZVKA 2ZRBA 3AFIA 4MWBA 4QU0A 4K9NA 3PNMA 3OEHA 3SZRA 4ESEA 5I7RA 2QENA 1KI7A 1QIMA 1TAGA 1Y3FE 1XEXA 1ZUD1 4K28A 1YJBA 1ZWLA 4UJ3A 3ZWVA 3U5ZB 2P6OA 4YYEA 1YMVA 1N6NA 1BCRB 5D85A 5JI2E 2BMFA 3AR4A 3W5CA 4N18A 3K9HA 4PW0A 3B6EA 3NORA 1SPXA 4IFEA 1Z6QA 1Q91A 3OLVA 5DGDA 2H9IA 4QHTA 1M76A 2WJWA 4K0KB 1K7SN 2SCUB 4B40A 3JR7A 4XX0B 2FQYA 5JZVA 2FFRA 3V9AA 2R1VB 1ETUA 1UINA 3MUOA 2B1RA 1SVIA 2QN8A 1GTL1 1G9TA 2W6JD 3K1TA 4LRQA 1GNLA 2MYNA 2P40A 4RIIA 5FF9A 3FNQA 5ICGA 2IYEA 1WHSA 2WUEA 3KXPA 2VIIA 1B76A 1ZIPA 4D3ZA 2QZ9A 1U8YA 3EDQA 5DXAA 4OKNA 2G76A 3GT3A 4C6TA 2P9BA 3FCOA 4TWBA 3LC1O 4LTMA 4DDHA 2QMHA 1JS1X 4B3BA 4EH1A 2I0FA 3LMKA 2FWAA 4F6CA 3TJZA 2BKLA 2AF4C 4PLGA 3QEOA 4NCJA 4RPHA 3RUIA 1PW7A 2WKPA 1GNRA 2D0PB 3MJ4A 3VI4B 3KWJA 1E3JA 1WCYA 4E4TA 1E5LA 4Z53A 1VMIA 2EIHA 2HJGA 2SCUA 3R5XA 4D9GA 3F6CA 2ZRQA 2NSYA 5JCXA 2BN4A 4EO4A 7ADHA 2C94A 2XDWA 1NBIA 3CLHA 4UBJA 1KP3A 4Q00A 1Q6YA 1ULBA 3DE1X 4C2AA 1N2JA 2ZW9A 4OI2A 2XOKA 3JU3A 5IJ9B 5LNK6 3R1IA 1ZVVA 5FPSA 4ZAYA 5IEBA 1XFDA 3IQWA 4R2WA 5G41A 2XUGA 5F7JA 5EWLB 5EWJA 1G3UA 1UMBA 3PTLA 4Q48A 3E2MA 4F38A 1SUSA 2HLHA 4LJYA 2AOTB 2NU9B 1QRRA 2ATIA 4RDCA 3ZZMA 1URPA 1ZC4A 2G07A 4KQMA 1CP2A 2J9FB 2XYVA 3ETDA 4UUNA 3VQTA 5JJ5A 3G2MA 4IRUB 2R11A 2A4KA 3AUXA 3MMZA 4H6PA 2JASA 1L1FA 5BQOA 3I30X 3KKPA 1XA4A 2DHRA 4Q19A 3O1LA 1PV1A 2I66A 2EWVA 1M6YA 5T3UA 1IXSB 3MLBA 4EPYA 3FTCA 1UMCA 3WK8A 3RQSA 1AHPA 1YIDA 5BNTA 1DU4A 1RJFA 4TLEA 5EA2A 4D3DA 1AXEA 3KKLA 3TYXA 3COVA 4D25A 1OYVA 1L5WA 2IF2A 4IS3A 3AHJA 1TM4E 3I0NA 1QHEA 3GA0A 2GKSA 3BMOA 3R09A 1YAJA 3C6BA 2IOFA 3C74A 4YIKA 5AVKA 2OSBA 3T7EA 2GS9A 4PN7A 2UYCA 1PU2A 2COKA 4QG3A 1GQSA 3DL7A 3S3TA 2RJNA 3O1JC 1Y98A 2B9EA 4DIEA 1I4DD 3PUIA 2C95A 2C99A 1EAMA 2KE5A 4L5CA 4DCVA 4XRGA 1L8LA 3KVVA 1Z12A 4G5RA 3W3AD 5HUQA 3CNHA 3Q7TA 1SXIA 1EK5A 1PGPA 2Q8PA 2XLBA 3B1ZA 4B43A 2XWBF 4RM3A 3UGTA 2DFVA 3QBJA 2UUBB 2NN3C 3PZRA 4XGRA 1UC8A 3K30A 3IR6A 2O0MA 4M1TA 3JQDA 4G0VA 5I8WA 1KWKA 2VUHB 3ZXUB 1OV4A 2QUKA 3BOSA 4P9NA 4EYSA 2ZDGA 3A1EA 1OLXA 4RPLA 3UEOA 2WNHA 3IAS6 1HTWA 1OX4A 2H48A 1V8BA 1FVXA 4KSBA 2RGCA 4KZKA 4UDXX 1XEWY 4C5BA 2WAXA 2WVAA 4BFTA 2P3LA 2RGXA 2P9QA 1VHWA 4RQBA 4UBLA 4HT3B 3VNUA 3VZSA 3ZDAA 5EAIA 4NBNA 1V5FA 3ISVA 4L8YA 4ZI3A 1ABBA 2JBHA 2XUOA 1GCGA 2YRWA 1PGNA 2BP7A 3ZU2A 1U1FA 3DOJA 1P4JA 2VAVA 1MT3A 1RKUA 1TUEA 4TYNA 4LY0A 4J9VA 4M8NE 2C2GA 4KWCA 4A23A 4PX3A 1G6Q1 1XFAA 2NOAA 1HSZA 2O48X 2XSZA 5A5GA 3R7BA 3RVSA 3HSSA 2FPLA 2O3UA 1ONBA 2BTQB 2EX4A 3A27A 5BYAA 1QU3A 2IU0A 2GCNA 4HB4A 4EF5A 3ERCA 1GY8A 2BZ1A 2BIFA 4MR9B 4BNUA 5BPHA 1QTNA 1U2QA 4MQLA 4RAQA 1Q16A 1P19A 2FRVA 4RCVA 4XUDA 5AXAA 4DSTA 2Q21A 4ZQEA 2OR3A 4PU0A 3HO1A 1VBFA 3THXA 3TTUA 1OXVA 2JL1A 4JT8A 4YECA 5AW2A 2BF7A 1S89A 4JVMA 4NK5A 1ZD1A 1I14A 1WXIA 2DPXA 4Y1RB 2E85A 3ESXA 2OWEA 1F6DA