4RF5A

Crystal structure of ketoreductase from lactobacillus kefir, e145s mutant
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
251
structure length
251
Chain Sequence
TDRLKGKVAIVTGGTLGIGLAIADKFVEEGAKVVITGRHADVGEKAAKSIGGTDVIRFVQHDASDEAGWTKLFDTTEEAFGPVTTVVNNAGIAVSKSVEDTTTEEWRKLLSVNLDGVFFGTRLGIQRMKNKGLGASIINMSSISGFVGDPTLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLEGAEEMMSQRTKTPMGHIGEPNDIAWICVYLASDESKFATGAEFVVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origins of stereoselectivity in evolved ketoreductases.
pubmed doi rcsb
source organism Lactobacillus kefiri
molecule tags Oxidoreductase
molecule keywords NADPH dependent R-specific alcohol dehydrogenase
total genus 90
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rf5A00
1QLHA 4WOKA 3RKUA 3BMNA 4CMJA 1ZXBA 4PLCA 4LVCA 4PLZA 4O59O 3AM3A 1JQBA 2QYTA 5FFFA 3GLQA 2B0JA 3PLRA 1M75A 1UAGA 1YQXA 5A03A 2FZEA 3QHAA 1HWYA 1K3TA 5JDCC 4Y9DA 1XG5A 1XIVA 1VPDA 4CLXA 3ZU2A 1H6DA 2GNAA 4XGKA 2VHVA 1H0KA 1Y9EA 4WKGA 2NQ8A 4TZKA 4U8GA 3GR6A 3V1YA 4CM5A 2ZJ1A 1HE4A 2V6GA 3WGIA 2IEBA 3MWDB 5KKCA 4TROA 4NK4A 5ENDA 3IIEA 3C7DB 3LC1O 4XB1A 3FD8A 2E37A 1ZK4A 4WLOA 3ZHBA 2B83A 3U49A 1XR3A 2W90A 2YDXA 2ZCVA 4UAGA 4HADA 3WTBA 4MDHA 4RORA 3IQDB 2VWGA 3WX0A 4DGSA 3AUTA 5T8KC 3PJEA 4PG5A 5EJ2A 1V3VA 3OF2A 3WLFA 5C37A 3OA2A 5DBFA 1I3KA 1NFQA 1DAOA 4URFA 1PR9A 3IL2A 2AEJA 2E82A 4DLAA 1E3EA 3O03A 4E5KA 3HQ4O 3S2FA 1OAAA 1ONOA 5HTOA 4BOYA 3FCOA 1G0NA 3H9QA 4BNNA 3T7CA 4DMMA 1GQ2A 1X0VA 2X23A 5JE8A 3PQDA 4MVJM 3L4BC 2PFGA 1K6IA 3X2EA 3GPDG 3E9NA 3IMFA 4P8RA 3K9QO 4RL6A 2ZKLA 4BGIA 4DBZA 2JL1A 1Q0QA 2OORA 1RM0A 1GPJA 3WSWA 3RU9A 4NBWA 2G5CA 3DZGA 1NWHA 5DOVA 2C5EA 2VOEA 2R00A 1A5ZA 1K89A 2GUGA 1HT0A 3AUAA 3GK3A 4B3IA 1X13A 4NIMA 4J7UA 1BW9B 1LDMA 5IF3A 4IIVA 4MO2A 1DLJA 4OYRA 3CSDA 4J1QA 5EIOA 5A05A 1DSSG 3BIOA 3ZGYA 2P9EA 3K6JA 3KB6A 4Y98A 1A71A 4R1TA 1A7KA 1KVRA 3NKLA 4IBOA 2O7QA 2WD7B 1IHXA 2C54A 1Z45A 3JD1A 5EESA 1S6YA 1G0OA 2O3QA 1GZ4A 4R68A 2AEMA 2UUOA 3VTFA 1ZW1A 4DQUA 5FF9A 1XHLA 5KIAA 1OZAA 4L74A 1JU9A 2HSDA 4FGWA 3U4HA 3TL3A 4EUEA 1Y8QA 5BSGA 2JFHA 3MJEA 2IZZA 1FDVA 1FMCA 2I66A 3AOGA 4PRKA 1WMBA 2P4QA 2HDHA 4IINA 2NQTA 4MOWA 4UULA 4FJ0A 1Z75A 3HDJA 1DIAA 4HWKA 3ZWMA 1SOWA 4EYEA 1TT7A 4I9NA 2CSUA 2IYPA 2IODA 2OUIA 4H3VA 3LT2A 2G1UA 3QA9A 4CM6A 4NZ9A 4N5LA 2A94A 3CE6A 2O3JA 3DTYA 1VKOA 1MV8A 3W4IA 1D1SA 1I0ZA 5F3RA 1RKXA 3FR8A 4XIYA 2IXAA 4E6PA 2WMDA 4XEHA 1C0IA 2FMUA 3GQVA 4FC7A 4NFHA 4UVHA 4K28A 4OO3A 3ANMA 3DAFA 5JFOA 4N5MA 1B3RA 4BKPA 2ZB8A 5ER6A 1TT5B 1PJTA 1W8DA 2B4QA 4IZHA 3RASA 3V2GA 5L53A 1O8CA 2X6TA 4WCFC 2Q45A 4XWYA 1A4UA 5G0VA 4J0EA 3TWOA 4EZBA 1MC4A 4XRGA 5A1TA 2DUUA 4IJWA 3S2IA 4NFSA 3WIEA 5I7SA 1MA0A 2GZ2A 1EVIA 3O38A 2BI8A 3TRIA 3I9JA 3QWIA 4WCFB 1NX6A 3RUAA 4QO8A 3TOZA 4BNFA 2VWPA 4PLYA 4NJMA 2OGUA 5C7OO 1Q0LA 2D1YA 3E9QA 5B37A 5KJEA 2Z5LA 2Y0EA 3F1KA 4CV3A 4PLFA 2NU9A 2O3TA 4NG5A 1GFSA 4YXFA 3DONA 1E3SA 1YONA 2PGDA 3D7LA 2Y0CA 4CMHA 3CKYA 2RCYA 3UOGA 3OJLA 4CLOA 1BDBA 1H94A 1LQUA 1LI4A 3FN4A 4R9RA 3AUSA 3D0OA 3STHA 3DAPA 1I10A 5J23A 3WIDA 5ENVA 1NP3A 3LC7O 3F9IA 2POQX 3GH3A 3RUIA 4E32A 5TLSA 3AM4A 4H16A 4CODB 1ENOA 4RVUA 4U6QA 1GADO 4B3JA 5KJ6A 1XQ1A 5F5LA 3HADA 2FRDA 4OKIA 4XYLA 5EPOA 2YQ5A 4DPMA 3GF4A 4MVJH 2HJSA 1N9GA 4RPKA 1HDYA 3I6IA 1IUKA 4N54A 1OOEA 2X7HA 3JD4A 3ROMA 5JNLA 4QT0A 1E3LA 3RBZA 4DRYA 5AXDA 5BR7A 4YTEA 1ZSYA 1QKIA 4FGSA 4KMSA 3TZCA 3MJSA 5HS6A 3JQAD 1SCUA 4Z9YA 4ZVVA 1V3TA 5I9LA 3MJ4A 3WNVA 3DBHA 1KS9A 2NV6A 4XR9A 1JLLA 5CFZA 2IZ1A 4XGIA 2VRBA 4BO7A 4BO0A 5B4TA 1LSOA 1MG5A 1DPGA 2YQ4A 5JAMA 5C7LO 1TA4A 3H3JA 4MP3A 3RVDA 3JQAB 5KCZA 3H9EO 4DYDA 1PZFA 4J1NA 1L7EA 1BXZA 2B69A 4ALIA 5CEJA 3KVOA 9LDTA 3JQFA 8LDHA 5I7FA 4BQPA 1I8TA 1V9LA 1EBUA 1O6ZA 2CFCA 1ZSNA 4UEKA 3ADOA 5U1PA 2JCYA 4CQMB 3INGA 5EL0A 3G1UA 4P4NA 1LRKA 4ZQEA 5TT0A 2DFVA 3VZSA 3IJPA 2X5KO 2VNSA 3F47A 2O23A 3O8QA 2G82A 1WW8A 1Y6JA 1I32A 4I9HA 4XA8A 4JLWA 2TMGA 2OXIA 5CAEA 1E0DA 2Q3EA 2NTJA 4B8ZA 4QX6A 2GDZA 2EW2A 1NASA 4QFCA 2OMEA 5K9ZA 4WLUA 1UZNA 3UGKA 4L4RA 1NBOA 1JKJA 3W1VA 4O5OA 3E18A 7ADHA 1BGVA 4KDFA 1TI7A 4F3YA 1VKNA 2EKQA 3PIDA 2V6MA 3R3JA 4B7UA 4OAQA 1W4ZA 1BHSA 4FW8A 2E4AA 3UUWA 1XYGA 3EVNA 3OICA 4Q3EA 2JD0A 5L7TA 1MB4A 4BVAA 3JQ9C 3H7AA 3KM0A 1HE3A 4Y6PA 1PJCA 1X7HA 3TL2A 3RC9A 4D0SA 4Q3BA 4CUJA 2YUTA 4YAKA 3KYDB 4XQGA 3OFSA 3D5TA 1L7DA 1BRMA 1D7OA 3GZNA 2CNBA 3ZWCA 1GZ6A 1N1EA 4KUEA 5AXAA 3RC1A 4CMCA 4ZRNA 2WYVA 2H5LA 4YQYA 1R0KA 5DBIA 1NAHA 4B79A 2VHXA 1LRLA 1KBZA 2NADA 4J9VA 4CLEA 1E92A 1SC6A 4XYBA 1ZK2A 1A72A 4CMKA 3ONEA 1U4OA 3ENKA 1EQ2A 4IJUA 3GEMA 4OOFA 3ANLA 1HKUA 1B3BA 2F00A 2ZATA 4LN1A 2HAEA 3KSZO 1YJQA 4Y6RA 1ISIA 5JS6A 3H5RA 4RVDA 3MJCA 3MOIA 4GX2A 4KUGA 2DLDA 1AHIA 3DZFA 2FSVA 3DAGA 3ZNNA 4ZU3A 4ALNA 2V7PA 4IXWA 4OGWA 4WEQA 3V1TC 2PY6A 2QRJA 1DBVO 4UUNA 5CPFA 2VQ3A 3IC5A 2FR0A 3PHHA 3UICA 4W9NA 5C3MA 1LSUA 3ETDA 2O4UX 1BVUA 1OMOA 2RHRA 3IS3A 3NAQA 4R51A 2HK7A 3LT4A 1EE2A 3BTVA 4W82A 5ILGA 2AG8A 1YQDA 2WJPA 3PGXA 3I3OA 3HDYA 1YBVA 2FN7A 3OH8A 5CDUA 1LDNA 1SB8A 3U4IA 1DB3A 2VZ9A 3FHLA 1NYTA 2C5AA 1DRWA 1YQGA 2QYSA 5H81A 3VH3A 4J4TA 3CMMA 3RUHA 1I3LA 3LDHA 4BHTA 1WZIA 1CQIA 2Y1OA 2XXBA 3E9MA 1VJ1A 4CM4A 5GZ3A 3IOYA 3PK0A 4NBUA 4GWKA 2I9PA 2DFDA 4NMHA 1ZXLA 2DBVO 4ILKA 3BMOB 2IZ0A 3SLGA 4CMEC 1XU9A 3G3EA 1LRJA 3PHGA 3DHYA 3PVZA 1QV6A 4PG4A 1OC2A 2VTDA 1ZJZA 1ONPA 5ICMA 1WVGA 4RF4A 5JW6A 1PEDA 4PLVA 4E2YA 3DOCA 1HXHA 3IP3A 1Y8RA 4J91A 5ER9A 2ZB7A 3DL2A 1NWCA 1B15A 3WGTA 3WDSA 1LDGA 4Q3CA 1PJLA 1GTMA 3TDKA 5IZCA 4QSMA 4K6CA 1SBYA 2UYYA 1N5DA 5IN5A 2H1SA 1E3WA 3GVIA 1KVTA 1I33A 5K6AC 3I1JA 4IZIA 2PZKA 3GFBA 4EEZA 1B8VA 3R3SA 1ISJA 3WICA 1B8PA 3SC4A 4WUVA 3ASVA 4IMRA 4JROA 2OZPA 2E48A 3B1KA 1PQWA 5F5NA 1A9YA 1GDHA 2BH9A 3ZDFA 5L4LA 4DPLA 3EY4A 5A9TA 3NUGA 2J5RA 1FK8A 3OECA 4KUHA 2P2SA 3S2GA 1HTBA 2RIRA 3JQGB 5KJFA 3BHJA 5G2OA 3E5MA 3JQ9A 1ADFA 2FY8A 5G4KA 4CL8A 4PG8A 2W2LA 4CMEA 3MCVA 3A9WA 1MLDA 3VOSA 4FB5A 4O6VA 1LLDA 4JJFA 3GEDA 4LRTB 2HUNA 1KEVA 3FF4A 3VZRA 1EVJA 2VUTA 4JGBA 1UP6A 4B7XA 3D3WB 4EJMA 3PJGA 3CPSA 3GG2A 3MEQA 3MJVA 2CY0A 4FDAA 3VPGA 1R0SA 2A4KA 3EMKA 3DMTA 3A1NA 4I5FA 3HFSA 4RF2A 4YT2A 1NQAO 3ANNA 3OIDA 1YDWA 1YVEI 4OOEA 3OIFA 3ZH2A 1M67A 4YJFA 4HV4A 2CVZA 3C1AA 4DMLA 1IHYA 1LDEA 4YAEA 3EDMA 1R4MA 3ASUA 4I9UA 1PJBA 3RQSA 5ITVA 3D4NA 4CQLB 3GN2A 4KZPA 2BGMA 3RU7A 1UZMA 1I5RA 2DT5A 1EQUA 4IMPA 1PQUA 2D8AA 4FIZA 5COAA 1PJ4A 1BG6A 4AL4A 3RCBA 1K2WA 1WPQA 3F4BA 3PEFA 5IAAA 3HSKA 2PGJA 3KUXA 1H6BA 1KVUA 2YFQA 3ZV5A 1GV0A 1A9ZA 5LDHA 3SLKA 3C3XA 1C0KA 4J16A 2D5AA 2GN8A 5H83A 2PR2A 3ZU3A 2BFOA 2NVUA 2X0JA 2QX7A 2X0NA 2ET6A 4GL4A 3ROPA 1HL3A 5HM8A 5JCJD 3TZHA 1ADCA 2PGLA 3R1IA 3BMCA 2UV8A 4MKZA 5L4NA 4KQWA 2DTEA 2W2KB 3JV7A 1KEPA 3PJFA 4YB8A 3NDIA 2W4QA 4LCJA 4XJTA 3QVTA 1C0PA 3SBOA 4AJIA 4E33A 3A14A 1HE2A 4YRDA 2P68A 3RJ5A 5EMHA 1YL7A 1NM5A 2Q2QA 1F8GA 4GGPA 1ID1A 3LT1A 3GAZA 3UN1A 3FNHA 1T2CA 1HDXA 1K0UA 2X5JO 3I9KA 2EKLA 2FPIA 3I9LA 3O8QB 3Q1LA 2I6TA 4QO7A 2DBQA 4YAGA 5JSFA 2WM3A 4J4BA 3OEWA 3DO5A 2QHXA 3DMYA 1P33A 2VWQA 4IGFA 3DBVO 5CDSA 5T5QA 4GQAA 1N1GA 1WP4A 3DFZA 1MFPA 5EERA 3H9UA 1YJ8A 2XXJA 1R4NA 2QG4A 5TT1A 5C7IO 2EJVA 1HSZA 3CZRA 2JHGA 3NX4A 3U9LA 5A3JA 3RJ9A 4OL9A 4MKRA 4RPGA 4CJXA 3AW9A 5IFLA 1CERA 1CIVA 1U3TA 3KXDA 4D44A 3WBBA 3RFXA 1B2LA 5L4SA 3ICPA 4RF3A 5A3VA 4CLHA 2WD8A 4M1QA 4J3FA 4F6CA 1HSOA 4D41A 4JQCA 2NU8A 1C1DA 1H9AA 5G0WA 5BSEA 2ZJ0A 2I67A 4GBJA 4L9RA 1Z73A 3U4CA 1B14A 3W4KA 1BMDA 4BIIA 4W4TA 2O3UA 4JBHA 2C29D 1LA2A 4LW8A 1X0XA 1KVSA 2Y99A 1ZK1A 5JMWA 4GMGA 4WPGA 3GVHA 4A73A 3D4OA 2B36A 4EUHA 3WGHA 1KVQA 3JYPA 5JCJA 4Z9FA 5IDQA 4ROSA 3ADPA 3UFXA 2G76A 1DIGA 1ENYA 1ZFNA 2J5KA 2NM0A 5I7VA 1GQYA 4HFNA 4RQUA 5A04A 4A03A 4HFRA 1Q7CA 4RVSA 2H9IA 3TOXA 4BO1A 4PLWA 3ZHXA 1TEHA 3EC7A 1ZIDA 3ZWVA 5F1PA 4R4JA 5C5IA 4QEDA 1GR0A 2NU6A 5L3ZA 3V5NA 4A2CA 5G4LA 3Q6IA 5ITWA 5IDWA 4FR5A 1I30A 4AJ2A 3OMLA 4RVGA 4JIGA 1VI2A 3R0IA 1ULUA 4UUOA 4HFMA 4RLHA 2GN4A 3IP1A 4FBGA 2OBNA 2AQKA 4J0FA 1H6CA 2EG9A 3DZKA 2CZCA 5DNAA 5F21A 2YZ7A 1SNYA 4ZHSA 4JK3A 3WMXA 4YA6A 1HF3A 4YAIA 3ZNQA 2VOJA 3H4VA 4HY3A 3D1LA 5JO9A 4UVDA 4BNKA 1O89A 1U5AA 1ZBQA 3DC2A 4MVJF 4E31A 3ZWPA 3ZU4A 5JAIA 1T1RA 1TLTA 4YQZA 3AU8A 5KJ1A 4LK3A 1GZ3A 2JD1A 1Y1PA 4ND4A 4CMGA 1EBFA 4D79A 2X5OA 5ILOA 3GMSA 5AOVA 3M2PA 3K73O 1E7QA 2IRWA 4CM9D 1I2BA 4Q9NA 1BTOA 1FDTA 5TQVA 1HDZA 4W7HA 1U28A 4PN3A 4YJHB 3BTOA 1ZK0A 2E49A 5A9SA 2VT2A 4IDBA 3LF2A 1ZKMA 4EJ0A 2XPCA 4CLOB 2X9NA 1CRWG 1X7DA 4OQZA 4E2WA 1A4IA 3I4CA 5DULA 4YJGB 3QLJA 4ZGWA 2GZ3A 3HB5X 3L6OO 3NTOA 3OQ1A 4GVLA 3NDJA 1DC5A 1CDOA 1SPXA 2PKQP 3PWKA 4HUJA 4PLPA 3WQSB 4ESOA 1TVEA 4RJTA 4JP3A 3L4BA 4R9SA 3OJFA 4PZDA 3PRJA 2VCYA 3ZN2A 1EFLA 2FPPA 5G0TA 4AJJA 3C7CB 3K5PA 4WASA 3QRWA 3VPXA 4DIBA 1XSEA 4GMFA 2VYND 4XGNA 3KOUA 1R0LA 4CM4B 2YFHA 4YRAA 4BO3A 5KWEA 1YXMA 3CZMA 1NQ5A 1ULSA 2DTDA 2IYOA 3L9XA 3KYCB 4J1TA 2I76A 4MVJG 4J90A 1FDUA 2YW9A 3D64A 1Z7EA 4BO8A 4MIEA 4NU6A 4AJHA 1GUZA 3B1FA 4IQ8A 3ICCA 1ZJYA 5KNLA 3C1OA 3IUSA 4INAA 1C0LA 1UXGA 2D3TA 4BO2A 5AXBA 1M76A 3RD5A 1QLJA 1JVSA 3GDOA 3PFWO 1J5PA 5L40A 5AQ1A 5IG2A 4E0BA 4RF5A 1PQPA 4DPKA 4ZQHA 3H9GA 3V1UA 5I9MA 1U5CA 2GZ1A 2PD3A 1YBAA 5L95A 1ZNQO 4YDRA 2VHZA 4EJ6A 1F0YA 1N8KA 1EVZA 3GC6A 2O50A 3SVTA 3ZNOA 4O0LA 4BNGA 3UHAA 1NHWA 2Y68A 4YT8A 4YCAA 3NV9A 5IDYA 1YGYA 2WE7A 3E8XA 2EW8A 4TVBA 3L77A 5BNTA 1AGNA 3TZQA 4B4WA 4J9UE 1MXFA 1RM4A 4W6ZA 2HMUA 3FBGA 5IXSA 4IS3A 1CEQA 4D3FA 3PHIA 2PK3A 1WMAA 2O3SA 3JTMA 1UXKA 2VUUA 4DIOA 1P44A 4IIUA 4N5NA 2AQHA 3QVOA 5ICSA 2WSBA 5A5FA 1HDGO 1DHRA 1F06A 1DO8A 2VWHA 4XYGA 5GY7A 1P0CA 2Y66A 3LK7A 3PXXA 2GERA 3BMQB 3B20A 1P9LA 5CG2A 1C3VA 3CUKA 1NNUA 1PGJA 2H63A 1Z74A 2EIHA 3BZUA 3WGOA 3V2HA 4OMUA 2BLLA 2NSDA 4JJIA 4Y67A 3E6AA 1LXCA 1Y81A 4FPXA 5HBRA 1UAYA 2JD2A 1E6WA 1UXHA 2NLOA 1WLYA 3EGOA 1EUCA 3AY3A 1F8FA 3WYBA 3GVPA 2Q4EA 4FN4A 1GCUA 2B35A 5KJCA 5T67A 2GASA 3GN1A 3NGLA 3Q9UA 2EEZA 2JFFA 1WXDA 1LU9A 4ZQBA 2P9GA 6LDHA 4NU5A 1YB4A 4IDGA 1PGQA 2R2GA 4ZA2A 1QR6A 3WXBA 2FP4A 2BI7A 3JQ7A 4YPOA 3VHRA 2HK8A 3T4XA 1D1TA 3MTJA 3OIGA 1U4SA 3VVCA 4P38A 4WEOA 2YYYA 2AA3A 4FFRA 2IE0A 2JKVA 1C14A 3KSDO 1CETA 3N58A 4RV9A 4YEDA 4E2XA 4HKTA 4BNIA 1U1IA 3TPCA 2EKPA 3WR5A 1MFZA 3JQBC 1EEHA 3RAJA 1H5QA 1EUZA 3LC2O 1CQJA 5JCXA 3PIIA 5BSHA 3C8MA 2DPHA 4B3HA 2Q2VA 2EGHA 4GKBA 4QUKA 4WGGA 4BL5A 5JY1A 4L4XA 4GSKA 5JDCA 4IDCA 4BUCA 1VL0A 1V35A 1NR7A 4CV0A 4NJOA 1NVGA 4DWVA 1T25A 4DA9A 3PDJA 2J3JA 3C24A 1E6EA 1NQTA 4FS3A 3ZU5A 3AU9A 4U6SA 1RM5A 1KETA 3JQ6A 1T2EA 4D43A 1JA9A 2B4RO 4TKMA 4P22A 1IPEA 1BXKA 3H3FA 3GNQA 4P4GA 3WTCA 1I3MA 2G17A 3OP4A 2UAGA 4BNUA 3FWZA 3OM9A 1R16A 3VKUA 2VTEA 2VZ8A 1UP7A 1NXQA 4TMFA 1T26A 4R5HA 5BNFA 3ZV4A 1DAPA 1K6JA 2C59A 1BWSA 3KZVA 4E5PA 3U62A 4AJOA 1E3IA 3DBRB 2R6JA 3WB9A 4Z3KA 5DT9A 1LX6A 3HB4X 3GUCA 4WNIA 5FI3A 3NGXA 2QIOA 4TWRA 3WGQA 1LC3A 1UDAA 4JX8A 3HHPA 3P19A 5CG1A 4NK5A 1DDOA 5HWSA 3UXYA 1DIRA 1YH3A 7MDHA 3GFGA 5KVVA 4KQXA 5IZCC 4CR6A 5TX7A 1GCOA 2C2XA 2ZTMA 4DXHA 4PRLA 3FSRA 4MIOA 1ZMOA 1U2GA 4K26A 5GZ1A 1UXJA 3QP9A 4BS9A 3M6IA 2Y1CA 3EVTA 1U3UA 4U5QA 3OJEA 1ZSVA 1A27A 1G1AA 4PG6A 1VLLA 2I5PO 4JBIA 4BMVA 3ZWOA 3PHLA 4CLRB 1PJQA 1DEHA 2Q1UA 4CV2A 1N7HA 1Y8QB 2VHWA 1P1IA 1AE1A 4HNHA 3KHUA 4DLBA 1Z7BA 1QXSA 1LTHR 4P4LA 3AI2A 4UREA 2FHSA 4PLGA 5TSDA 1ZZEA 1GYQA 3TZ6A 4CMBA 2PV7A 3QW2A 3JYNA 1H2BA 2DUWA 2GD1O 3ZWBA 2NVWA 3HDQA 4BGEA 2GN6A 2A35A 5KOIA 1LLUA 3PDUA 1ML3A 4E5YA 1DXYA 3I9OA 1OFGA 2X0RA 5EN4A 3VVBA 1M6HA 1EUDA 5JDIC 2X9GA 1IOLA 4HNGA 4W9NC 1NFRA 2OFPA 3SXPA 2Y1GA 4J7CA 1IZ0A 1ISFA 2EJWA 3EUWA 3CXRA 3GRKA 4YAJA 3Q9NA 1EZ4A 1Q2XA 4UVGA 4JXKA 3BMOA 1HLDA 3BHIA 3H65A 3I5MA 3CMCO 1U3VA 4D0RA 2J5QA 1GV1A 4L76A 4LRSB 3RSHA 2EGGA 3W8EA 3WQQA 4EW6A 4ND2A 1ISGA 3NRCA 1XEAA 4MVJI 3LQFA 3GUYA 3WNQA 3GHHA 3WWZA 5I7EA 5CPBA 3AI3A 3QWAA 3V2UA 3HUDA 1PSDA 3WJAA 1QSGA 1YS4A 1GUYA 2X0IA 3FWNA 2PZJA 4ZQFA 4FD3A 1E1LA 2Q4BA 3KRTA 4I5EA 5I8WA 3EZYA 3FPCA 2WYWA 3RFVA 4BNHA 4S3MA 3GRPA 3QJ5A 3ONFA 3EK2A 3QVSA 1IB6A 1HYHA 2Z1NA 1A7AA 3PP8A 3PLNA 5U9CA 3TJRA 2BD0A 1NAIA 3ABIA 4Y6SA 2X1HA 3AOEC 4TQGA 1DIHA 3HNPA 4NHEA 1EVYA 4BQRA 1P1JA 1DC3A 3OSUA 4BMSA 4DQVA 2Y0DA 3DBHB 5G0UA 4DUPA 2NVBA 3HWRA 2BFPA 1MGOA 3TNLA 4QFDA 4H15A 1O95A 3RBXA 2D2IA 3D4PA 3Q2KA 5A06A 4CQMD 2GR9A 4KDEA 2NUAA 4M8SA 3WLEA 1XDWA 1GYPA 1N9GB 2X22A 5KVCA 1JKFA 2BMAA 1MUUA 3KEOA 1SO8A 5TS3A 5A9RA 4OXYA 1H2HA 2PZLA 3ETGA 2IXBA 4IM7A 4WCDA 5B12A 2I3AA 4I08A 1K5HA 3DZJA 4JP2A 4W99A 2AQIA 1IPFA 2D59A 3KTDA 3QY9A 3T4EA 2QW8A 3INTA 4TSKA 1Z82A 3Q2IA 2X9VA 4IQGA 3CIFA 1PU2A 4IJVA 4BB5A 3QQPA 2XAAA 2VHYA 3H5AA 2PTGA 5ADHA 4NBRA 2AHRA 2C2YA 4E3ZA 1IY8A 3BTUA 1ENZA 2R00C 2Y1DA 4OKNA 4BO9A 3M1AA 3BYZA 2FR1A 2ZCUA 2P4HX 3VH4A 3E03A 5CDGA 2NWQA 1VM6A 2QRLA 4CMIB 4OIMA 5EQDA 3OBBA 1CJCA 1MX3A 3AY6A 5DF1A 3JQDA 2YHIB 3PYXA 2NU7A 4YJDA 5L9AA 3F46A 1VJ0A 4LVUA 5JLAA 1IULA 5CEEA 3BMQA 1ONNA 2HJRA 1FXSA 4NBVA 3K30A 4IDFA 4CQMA 3DOJA 4N18A 4L75A 4XR4A 4LGVA 1LBEA 4G2NA 1S7CA 2W8ZA 3UKOA 4B8WA 3QIVA 1YB5A 1SB9A 1QG6A 3VDRA 2CDBA 1X15A 1CYDA 1UDBA 3C7AA 4Z0HO 3P5SA 3O4RA 2FSSA 5GZ6A 4ID9A 4EUFA 5BSFA 2Y67A 3ZWXA 4ALLA 1SOVA 3EW7A 5HS4A 2OO5A 3QVWA 4PFJA 4XB2A 1V0JA 2GF2A 3I52A 5DOZA 3RWBA 2CVOA 2VZ0A 4YT4A 2E6UX 3QE3A 4AJ1A 2NTVA 3GOHA 4Z3DA 1P74A 1HETA 3L4SO 3GHYA 3HZZA 3UVEA 4R16A 3IJRA 1T4DA 3DMTC 1JKIA 1D4FA 5B4VA 4CR8A 2G0TA 2RH4A 3GY0A 3KLPX 1JDJA 1Q7BA 3CH6A 4BNLA 2OBYA 4BKOA 4MIYA 5JC8A 5DZSA 1I2CA 3D3EA 2UDPA 5CDYA 4FFLA 3WYCA 1B16A 1EK6A 4CM7A 4F46A 3EHEA 4DL9A 1X14A 1MG0A 4BKUA 3LLSA 4NBTA 3PPIA 2AXQA 1FJHA 1R37A 4AJPA 3BTSA 4DYVA 5T6BA 3INRA 5ES3A 4PZCA 4EEXA 4E21A 2RH8A 3ZZNA 3AOEA 2X4GA 3TF5A 2GRAA 4DTIA 3ITDA 1HDRA 3GNSA 2J3HA 3A4VA 4MKXA 1D8AA 1C1XA 2ZQYA 3I83A 5LC1A 4HXYA 3UCFA 5L45A 2AE1A 3ONDA 4BNZA 3NDRA 5U4QA 4R54A 2O2YA 1Q7GA 1J4AA 1EFKA 2HMTA 2XOXA 4ND5A 1V6AA 4LISA 1CWUA 2Y93A 4RZHA 2P91A 5K6AA 3TFOA 1Y9AA 1SZJG 3AWDA 4FFNA 4D3SA 1ZEMA 1P77A 2CMDA 2Q50A 2B4TO 4GX5A 4DIFA 3L9WA 5FEUA 3DZBA 1XKQA 2CVQA 2DBZA 1R4NB 3RKRA 3NYWA 3JD0A 3PZBA 3G0OA 3QWHA 3L0DA 2DU8A 3PWSA 1QMGA 1PJ2A 4M54A 2DM6A 1C1XB 2OOSA 4AJNA 2H6EA 1NHGA 1JAYA 3JCZA 4QQRA 2V6FA 4CM9A 3HG7A 3JQGA 5CP8A 4Q3DA 5I8ZA 4QXMA 1C1DB 1PGPA 2I3GA 4HX5A 1WDLA 4GWGA 2VYVA 1LDBA 5EINA 1HE5A 5G4KB 3VPHA 2TMDA 4FFPA 3OQ6A 4WJZA 3JQCA 4F45A 5JDIA 4CLRA 3LYLA 1E5QA 1NPYA 4IUYA 1E3WB 4GPD1 1QYCA 3TFQA 4AICA 3F1LA 4CMIA 3FNEA 1UXIA 2I99A 4I8XA 1PL8A 4O1MA 4RVFA 2AQ8A 4MINA 1ORRA 2B5WA 4AVYA 1WAMA 2JAHA 1EMDA 3NTQA 5H82A 1V8BA 2WWRA 1GU7A 2NTNA 4BNWA 4ITUA 3GPIA 4RO0A 3GVXA 1HYEA 1DC4A 4OH1A 1AXGA 4LCEA 2EF1A 4I5DA 1R4MB 3KEQA 4AG3A 4R69A 2OHXA 4BKRA 3G1TA 1E1MA 3KYDA 1SEVA 4CM8A 4NNJA 1MXHA 1JTVA 2BGKA 4KP7A 1HYGA 4GLOA 1QRRA 2Q1SA 2BKAA 4WE3A 1XU7A 4FOOA 5DCYA 1B26A 5A02A 3MOGA 4D42A 3CINA 3TN7A 3OHSX 1HDOA 3LSYA 3SC6A 3C85A 4Q39A 4XJSA 2VYVD 4LMPA 3WGYA 3TQHA 3QSGA 3SX2A 3WBFA 1QYXA 2GO1A 2HMWA 3ZNPA 3NJ8A 4G65A 3JYQA 3D3WA 4EI2A 4OQYA 2PWZA 2DAPA 4J1SA 4MP6A 4AJLA 3G79A 4X54A 2CDAA 2GGSA 4CR7A 5FYDA 3PGJA 4U7WA 1J6UA 4PVCA 3VTZA 2C0CA 4UUMA 3PHJA 1T2AA 1T2DA 1IE3A 1KIFA 1DIBA 1T24A 1ZK3A 2O2SA 2OL4A 3OEYA 4R1UA 2YV2A 1LUAA 2UUPA 1B7GO 3OETA 3U0BA 1F14A 1T1SA 2V6BA 4MJLA 4YJHA 3PYMA 5A5EA 1LJ8A 1PS8A 1PZGA 1QV7A 1I36A 4OJNA 3U4DA 4M49A 3WJ7A 4AFNA 1HRDA 1TB4A 2J3KA 4FC6A 4FJ2A 4J2OA 5BNIA 3RC7A 4NI5A 4CLDA 1GY8A 1YL5A 4DQXA 1PJSA 4GAEA 3ZW9A 1NVMB 3MJTA 3QVXA 4BGVA 4AJKA 2HQ1A 3FTPA 1JWAB 2JCVA 1FDWA 1NPTO 4K9DA 3I6QA 1LQTA 3GA0A 1E7MA 4M87A 2QZ9A 1U8FO 4RDHA 1KYQA 4B4UA 5AYVA 4IDAA 1KEUA 4YBZA 3WYEA 3ZWYA 3T7EA 4B4VA 1OC4A 3ZV6A 4E2ZA 2BFAA 3OQBA 2AEFA 3M1LA 4YT5A 4CM3A 2C82A 1GEGA 4BNTA 3EZLA 4G81A 3WGGA 3F3SA 5JC1A 2P5UA 1NR1A 3PWZA 5HA5A 1EDZA 1O94A 4J7XA 3KYCA 4WNCA 2EHDA 1GPDG 2O3RA 4R1NA 4E13A 1NPDA 1UJMA 5COQA 4YJGA 2EP7A 4OSPA 3FPLA 3KSUA 1CF2O 1UH5A 5JY6A 4GI2A 1E7RA 4G5HA 1ISMA 2IDZA 4GVXA 4J4HA 4D7AA 3V8BA 1PWZA 3WQRA 4GH5A 4U0KA 1AUPA 2BHLA 2DBRA 4A0SA 5F1OA 1YL6A 3AFNA 1WDMA 4A5OA 4PG7A 3AJRA 4E5MA 1P1RA 2PKRA 3RROA 4NFYA 1TXGA 2PH3A 1RJWA 1HDCA 2NNLD 3VPFA 4EGFA 2A9FA 3H2ZA 4YVFA 3WSVA 5JAZA 4CUKA 1P3DA 4E30A 3P7MA 4ALMA 1ADBA 2HU2A 5BT9A 1GAEO 4F6LA 3DFUA 1XA0A 1P1FA 4FOSA 1VSVA 1GQQA 1P0FA 1YOVA 4KTVE 4RPJA 4XRRA 4ZQGA 2GN9A 4Z0TA 2WDZA 4CM8B 4MVJP 1IYZA 4E5NA 1SAYA 1DFGA 3ON5A 4IJKA 2J6IA 2VRCA 2Q1TA 2D4AA 1O9BA 3NT2A 4IY1A 1M2WA 4ONEA 4GX1A 4LSMA 1W73A 2ZYGA 1JAXA 4KTTE 4WECA 4ZICA 2QRKA 3LT0A 2ZTVA 3GEGA 3GG9A 2DC1A 4ZJUA 5KTKA 3HN7A 5T64A 3PFFA 3RUCA 1VJTA 3FNGA 2GYYA 3IKVA 1B8UA 1AN9A 1E7WA 3WGZA 3H2SA 4Z9XA 1R12A 4NJMB 3DHEA 4GLLA 4EITA 2ZTUA 1PGNA 1D3AA 1YDEA 5LDGA 3DEYX 4C4OA 1QP8A 1VRWA 1LSSA 2C7GA 3KV3O 3PQFA 4XYMA 3H8VA 5A9SB 2P5YA 4L0QA 3ZW8A 2JFGA 3UAGA 3GZNB 3L6EA 4OXNA 6ADHA 1ZVMA 3H5NA 2W98A 2O7SA 3U5TA 1KC3A 1XGKA 5T57A 4M89A 3DBLB 4RLSA 4CQLA 1PL7A 3BA1A 3ITKA 2WYUA 1NVTA 4BNJA 4B7CA 1GD1O 4Q3NA 2FZWA 2AE2A 2X58A 3WFIA 3H6KA 3PTZA 1N7GA 3BHMA 2DVMA 3I23A 2RAFA 1XELA 4WOJA 2ZB4A 1EK5A 2ZB3A 3S2EA 2HLPA 3JQAA 4TRNA 3U09A 1J0XO 1QYDA 2FOIA 3CEAA 4PVDA 4WCFA 3BAZA 3KO8A 1RYEA 1BSVA 3QWFA 4M55A 1U7TA 4TRRA 5BQFA 4GKVA 3DXFA 1E77A 3JQFC 3HE3A 1RYDA 1NTOA 3UCEA 5K0ZA 1E6UA 4A26A 1VL6A 3N74A 2V65A 1JWBB 4A10A 3GGOA 3ORFA 4I1IA 3WOHA 1DHTA 4U0JA 3NJ4A 2NACA 1Y5RA 2AMFA 5COBA 4E4YA 5KVSA 4BMNA 2Y05A 1YB1A 4D45A 3VH2A 3QV1A 4R1SA 5FWNA 5TJ9A 4CM1A 4CPDA 1PS0A 1KY5A 3DZHA 4FQ8A 3ZHYA 5JPIA 4DC0A 2ZYDA 3ZCXA 3JQEA 4IQ0A 1LNQA 4JN6B 4UVIA 3TSCA 4A7PA 5THQA 3X2FA 2AG5A 4KOAA 2P9CA 1PZEA 4NH4A 1HLPA 1PZHA 4C7JA 1GL3A 2VN8A 3IDSA 3NT4A 2EWMA 2LDXA 2VYNA 1ZH8A 3VC7A 4BNXA 1Q0HA 2YY7A 3G17A 4L4SA 3W8DA 4WLNA 2A92A 4UEJA 1E5LA 2EV9A 3ST7A 1R15A 4MP8A 2ZYAA 3OJ0A 5A4DA 4IGEA 1DRVA 1RM3A 2J8ZA 1LSJA 1LLCA 4L8VA 1UP4A 2B5VA 3DOOA 3W8FA 1Y7TA 4DVJA 4OXKA 3F5SA 2ZQZA 2X8LA 1DJNA 1KY4A 2C20A 2VT3A 1FF9A 4FFMA 1PGOA 4KWIA 4FSHA 1HEUA 5TRTA 3NT5A 4UUPA 4YYZA 1OBFO 3A06A 3KLMX 1G6KA 1UR5A 3W4JA 1PS9A 1DFIA 3B6ZA 3LF1A 2D5CA 4PGFA 5IDXA 2X86A 1R6DA 3JYOA 1P31A 5TNXA 2ZK7A 1KERA 2UVDA 1W0CA 1MP0A 4HFJA 5IZ4A 2DKNA 2VUSA 4MVJA 3B70A 4ND1A 1E1NA 1M6WA 3FNFA 4Z6KA 3KETA 4HBGA 4S1VA 4RPLA 4W7IA 2HO5A 2O4CA 4A27A 1TT5A 3AM5A 1PTJA 3GDGA 4QTZA 1JVBA 1E7YA 1AXEA 3GGPA 4XCVA 3PI7A 2Y1FA 4R01A 4RGBA 1JN0A 4NDNE 3IAHA 3GGGA 2YDYA 4TKLA 4AJ4A 2GCGA 3K8ZA 1Q1NA 3Q3CA 5F1KA 2FPGA 1L1FA 5L7YA 2O48X 3ZHZA 3F6YA 4B4OA 3EYWA 2WE8A 1BVRA 3K92A 3PZRA 3K2EA 1YWGO 1XLTA 4N7RA 4D3DA 4LMRA 1T4BA 1YRLA 2J3IA 3JQ7B 3AI1A 3QWBA 1I01A 1VC2A 2PZMA 2PNFA 1P1KA 4XDZA 5DN9A 3GT0A 5FI5A 2B37A 3JD2A 3K31A 3RUEA 2CUKA 5DCWA 3B1JA 2EERA 3D5QA 4II3A 3VPSA 5MDHA 2HRZA 1PWXA 3FR7A 3SEFA 4CL3A 2HKIA 3ZWNA 1U8XX 3LLVA 1DLIA 1FDSA 3WMWA 4XQCA 5KKAA 5B4UA 4ZD6A 5IXYA 3A28A 3RIHA 1H9BA 3AK4A 1I2ZA 5IN4A 3RUFA 4BV9A 3DR3A 4JBGA 4DREA 4EBFA 3ZI0A 3IUPA 3AFMA 5LCXA 4II2A 4CV1A 3K96A 1DFHA 4K6FA 4CMAA 3FTNA 1UUFA 1SMKA 3U3XA 4AJEA 4GSLA 2DQ4A 4JCOA 4M86A 4OM8A 4H7PA 3C1TA 3GNTA 2QZZA 3E48A 2JAPA 2DTXA 2Q99A 1PX0A 1Y8RB 1QYVA 1DC6A 4J6FA 1LC0A 1YBMA 4R3WA 2OP1A 5JBIA 2BGLA 5TC4A 2I65A 3DQPA 3VH1A 3MZ0A 4QECA 3VDQA 2WD7A 5TJHA 5IJZA 2QQ5A 5JAQA 1MC5A 3DZIA 2WTBA 1BXGA 1H6AA 1O0SA 2AW5A 2C07A 1O5IA 5JYEA 4MVJD 1T2FA 4BB6A 1VE9A 1X1EA 2OP0A 3BMCB 3VKVA 1X7GA 2YJZA 1Z6ZA 1WDKA 4RVHA 4BNMA 2C7VA 3VZQA 1ARZA 2YHUA 5CHEA 4LSWA 2FWMX 1BW9A 1XQ6A 3HFGA 4PLHA 3ROQA 1AHHA 4BO4A 1W6UA 4GX0A 1YO6A 1IZ9A 4J49A 1NQOA 4DLLA 4WK6A 2EP5A 1LDYA 2D0IA 2Q2WA 4TRMA 5DP2A 4XKJA 4FCCA 2Q49A 1ENPA 4KWHA 5T8KA 5CEFA 3BXXA 5I9NA 2IEDA 3KBOA 1BXGB 4YR9A 5HRUA 3UW3A 4ALKA 2LDBA 4TVOA 5AVOA 5L7WA 1DRUA 1R66A 1YKFA 3LZ6A 4NPCA 4TZTA 2PD4A 3CTMA 3GZ4A 4RDIA 5THKA 1ZEJA 4NQZA 1VL8A 4JNKA 3O9ZA 4UVEA 3KYBA 4ND3A 3Q11A 1NFFA 1IL0A 1X1TA 1PIWA 4XIJA 3S1LA 4YRBA 2Q1WA 1HZJA 3E82A 5CDTA 4BO6A 3JQ8B 1E3JA 1WZEA 3FRJA 3N7UA 1BDMA 5JMPA 2Q46A 2VNAA 2RHCA 3VAZA 4R3NA 3WG9A 2ZIZA 3PQEA 4FJ1A 3NEPX 1OI7A 3R6DA 1XCBA 2BRUA 5MGBA 3G49A 4XX0A 3SJUA 3ETEA 4E12A 2CF5A 5JYDA 1RWBA 4XQEA 1WNTA 4OHUA 3GVCA 2GSDA 3AY7A 3DBLA 5EQFA 1DJQA 3TZKA 3DB2A 1U2DA 1YE3A 3SJ7A 3HN2A 1F12A 3ZV3A 1GEEA 2ZTLA 1PJ3A 2EXXA 4RCVA 2PH5A 1DOHA 4WLEA 4ZRMA 1ZCJA 2HMSA 2FR8A 3I9NA 2GPTA 4BNYA 3PJDA 4OSOA 3MWEB 4PLTA 4YACA 1U9JA 3JQ8A 1V3UA 4BNVA 1RPNA 1JW9B 3E5RA 4IXTA 3UH1A 4R5MA 4XDYA 3I4FA 1EDOA 5DBGA 3S8MA 3E1KA 2W2LD 1I3NA 4MVJE 1KC1A 1PL6A 1ISHA 2BFMA 3F4LA 2Z95A 4WLFA 4PIVA 1QYWA 4RZIA 5TGDA 3ENNA 4L73A 4XYEA 3H9JA 2CDCA 2PLAA 5TIIA 4Q3AA 4I5GA 3O26A 3EAGA 4RPHA 3DWFA 3W6ZA 2GLXA 3GDFA 9LDBA 2Z1MA 8ADHA 3GMDA 4XZ3A 4PZEA 3DHNA 4UEOA 3RBVA 5L51A 4O63O 4IDEA 4YWJA 3L07A 3PYLA 3DDNA 3JQBA 3COSA 1KEWA 1GYRA 1H93A 2NVUB 4K1LA 1KOLA 1P1HA 3L6DA 4RQTA 3RC2A 3JYLA 3DTTA 1UZLA 1U7HA 1WWKA 3JD3A 4ALJA 3MTGA 2RBEA 4PCVA 2PD6A 2Y1EA 1M66A 5TF4A 2XF8A 4YJFB 3ULKA 3I9MA 4GGOA 4Y8VA 2BELA 5DCUA 3ROKA 5B1YA 3VZPA 3Q0EA 5G0SA 2HK9A 2BF7A 3M2TA 1LEHA 1I24A 3RFTA 3RI3A 4BO5A 2DPGA 3RUDA 4DBVO 4IPTA 3UF0A 4R41A 4HP8A 2VRCD 4Z0PA 4CUZA 3IKTA 4NR0A 3UCXA 4IS2A 1E7SA 1ADGA 4C7KA 3OA0A 5DDIP 4XQ9A 2ILTA 2HRBA 2CD9A 3AUUA 4IDDA 3JSAA 4FFOA 4XD2A 2SCUA 3OJOA 1J49A 4WLVA 2PKQO 3ZWAA 3F5QA 1QORA 2YHIA 3WWYA 5JXWA 2HMVA 3BMNB 5AXCA 3P2YA 5JO0A 1K6XA 3W6UA 4BV8A 3HDHA 1LLQA 4J2HA 2HCTA 2WEKA 4J43A 3ZWWA 1HZZA 2W2KA 1P45A 1U3WA 2F1KA 3DBRA 2CF6A 1XWFA 1Y5MA 3LU1A 2YV1A 1SEPA 4BKQA 1EE9A 2PA3A 3FI9A 1N92A 1B0AA 2JHFA 1VSUA 1ZO8A 3WS7A 1ZMTA 1F17A 4DC1A 1YOVB 3P2OA 2JCXA 3GAFA 5DP1A 3K2BA 4ZN6A 1GUFA 5GMOA 4EDFA 1UDCA 1E1KA 1PR3A 2YV3A 4TRJA 3WFJA 3HJAA 3LVFO 3NTRA 2JJYA 1N2SA 4JJGA 4BGUA 1ZUD1 4MPDA 3FBTA 4D46A 5KVQA 3S55A
chains in the Genus database with same CATH superfamily
4YPVA 1ZU5A 1E2FA 4GE3A 3NC0C 4PLCA 4P08A 4LVCA 1P4GA 1I1OA 4UUBA 4BUJA 3AM3A 4KMRA 5LIPA 3Q6NA 3RIXA 5CB4A 1UK9A 5F1YA 4GDFA 2B0JA 3PLRA 3ZG6A 4DR3B 1UAGA 2O8FA 1L2TA 2FZEA 2G5PA 1AZTA 2ZSBA 1Y37A 3TOVA 3G2QA 5CH8A 4Y9DA 1XG5A 1XIVA 2EZUA 3C5HA 4CLXA 3ZU2A 5B2FA 4URYR 4EKEA 4Q4CA 4XGKA 1W34A 3X1XA 3O83A 1Y9EA 2OYCA 1PN3A 4QYXA 1NXVA 4WZBE 2X1VA 1I5OA 1HE4A 2EYQA 5LZ4A 5JPCA 4UQOA 2OXFA 3BFVA 4ZOBA 4TROA 1J42A 1QRDA 3LCRA 4TTVA 3IIEA 3BIWA 3DDSA 3U49A 3QPWA 1BGWA 3U60B 4UAGA 3WTBA 1IK4A 4LKOA 3KPUA 4MDHA 3N2GB 4D9IA 1EB9A 1QCYA 2H0RA 3WX0A 4ZI7A 4DGSA 1KDZA 4I8DA 2KI5A 3AUTA 2Z3WA 2ZRAA 5EZ5A 4S0XA 4PG5A 3WLFA 2ZWMA 3OA2A 4H27A 1I3KA 2JJ2D 5DBFA 3USES 2XSZA 1E3EA 3I30X 2WUVA 2RH5A 4ZV9A 1ONOA 1Q22A 3MCAA 1Q1BA 3AJ9A 4ETWA 3JARB 4I3FA 3OT1A 3FCOA 1M34B 4HGOA 1G0NA 3FETA 4QXOA 5C1PA 5HUQA 1VHTA 4XJXA 3V4OA 1Z8HA 3PQDA 5IBQA 4UNQA 2QK4A 3Q88A 5FPYA 1J9ZA 3UMJA 2O5EA 4TLMB 1IY1A 1LVHA 4RKYA 1MMFB 1BCRA 1E0JA 7YASA 2QJFA 2J0QA 3IMFA 3K9QO 5A71A 3KD3A 3IX7A 4BGIA 4DBZA 3OTHA 2QTLA 3PD0A 3V46A 3HBMA 1Q0QA 1SCIA 4II7A 4K7JA 1E18A 5FPKA 1U8UA 3LO5A 1RM0A 1GPJA 3ENQA 1THMA 3T3IA 4BMYA 4WBNB 5JASA 3U7GA 1ECJA 1QH1B 3DZGA 4D3YA 4A2WA 4DAEA 3N07A 2DXIA 2QBYA 2R00A 3AV0B 3GK3A 3WGLA 3AEYA 3I1IA 1NN1A 1OLSB 3KPVA 4NIMA 2CMHA 1RAHA 4X8LA 5IUKC 3CEJA 5IF3A 4AP5A 1PD0A 4O08A 3MLEA 4IIVA 5J4KA 4POOA 2QXUA 3D81A 4WZBA 3ZGYA 5KQMA 3OQIB 5B1IA 5JS2A 2QJWA 10MHA 1GLVA 5AESA 5A7GA 2SBTA 2YR0A 2P6NA 2HNKA 2XR1A 4Y98A 1Y1RA 4NCKA 3N0RA 4PNHA 5BRJA 1N5IA 3GWZA 1N5RA 4IBOA 1SBTA 2CSXA 1YUNA 3T0IA 2ZDQA 3ER6A 1SOMA 3ZDZB 1G0OA 1TW3A 2O3QA 3LBNA 1UBJS 4ZEOA 3N2KB 2Q3HA 5UKDA 3IYLW 3WK8A 4ZTZB 4GI1A 1QG4A 2WHXA 1TLFA 4M83A 2Q7DA 3HKEB 4JXJA 5BSGA 5JS1A 4IJ5A 3MJEA 4B6SA 2RJ3A 4V1CI 1FMCA 2CJFA 2HDHA 3I6BA 3OVMA 4IINA 3VQTA 4I99A 3M6FA 4TQ9A 2BHRA 2QVCA 4DDMA 1IONA 1HG1A 1TT7A 4ASUD 1KPIA 2CSUA 4MQUA 2IYPA 2YWCA 4KQKA 1C41A 5DV9A 2Z8YM 5J2UA 4DQ0A 2GMWA 3EVGA 3CE6A 3PXDA 4FFBA 5DYTA 4KWTA 3MHPA 1XF1A 5P8WA 5CGZA 1I0ZA 4V03A 4ZGBA 4LJYA 1GDDA 3FR8A 4PS0A 5K3DA 2WWHA 2IXAA 4H7DA 2W42A 4ZQIA 5G02A 4ZZ0A 2HQOA 2VA8A 1C0IA 2AR7A 3L7IA 4G4SP 4U2GA 4XEHA 3T35A 3B13B 3CWZA 4OO3A 1KFCB 4XH9B 1R3UA 5JNTA 1II8A 2DY0A 3T7RA 1U7XA 4TLEA 1T1IA 4IIYA 2AYXA 2E4WA 4N5MA 4NHOA 5BYAA 3T5CA 3Q8KA 1RXIA 2XA1A 4I2NA 3U44B 1KIMA 1PJTA 1RC1A 2B4QA 2P9BA 3CUUA 4X3PA 5H1YA 1QFSA 3UWPA 3PBKA 3JXEA 4WCFC 1A4UA 1DKPA 2WHYA 2Z8YA 5G0VA 1JG1A 1X7WB 3EBOA 1XMSA 2D1RA 1FNSA 3B12A 2YN4A 3S2IA 2V97A 4IF4A 4NFSA 2LBPA 1EVIA 3K8OE 4ZVLA 4XWGA 1YS1X 2XUOA 2VPWA 1HEYA 4F2WA 4DR2B 1ZAYA 3VRHA 4RM3A 1LJLA 3QWIA 3E70C 2Z1DA 2E2WA 4TQUS 1QAMA 1S8FA 5JS7A 5FA6A 1B23P 1A96A 1L7XA 4QO8A 4Z1MA 2VWPA 4GOJA 3UAVA 4BNFA 4F2DA 1UBTS 3TBHA 5IHXA 2IYAA 5AK0A 2D1YA 1NUQA 3E9QA 4WA8A 5B37A 2PYZA 3VR5H 2A78A 3G0DA 2PE5A 2Y0EA 3R3XA 1FNMA 3F1KA 1I7DA 4LF8B 1Z37A 2GBFA 1MN6A 2O3TA 4EB8A 1GFSA 2VJAA 2ZPAA 4YX9A 4BRUA 2W70A 3I2KA 3TD9A 3ROXA 2PGDA 5FCDA 4RULA 2Y0CA 1U8YA 4CMHA 1S8OA 1ZVQA 5K8VA 3GLUA 4CLOA 2RCYA 3OURA 1WKBA 4KCGA 4U3JA 4XD7D 4ZT4A 3SBDA 4OB6A 3SLRA 1GCIA 2HDNB 4NCXA 4R9RA 2PJRA 1F7UA 4LJ9A 3AUSA 1K3FA 4KVZA 3LL4A 4WY2A 2DZDA 5JCZA 5J23A 3QEMB 5HE9A 3STTA 4EPTA 3VKGA 1VL1A 2ZS7A 4KGZA 1AX9A 2G25A 2HRQA 1H3EA 3GH3A 2VDQB 1W46A 3AM4A 3AW8A 2FX2A 3LPLA 4HEA6 4H16A 5FHRA 5JQGB 4RVUA 4OHKA 4B3JA 5F78A 3LUHA 3E3AA 3S4YA 1WX1A 2PS3A 3JWGA 3PHCA 3V9PA 4AQDA 4IMIB 4L3OA 3PQCA 5F5LA 5SY6A 3AL0C 3IUBA 3HADA 2FRDA 4OKIA 4AAYA 3ZD6A 2IUEA 3B85A 3EGWA 4MVJH 1WY7A 3KOXA 4BMPB 1U7WA 1VZ3A 1XHFA 4QIHA 1SUPA 5ETJA 2FFRA 4C3VA 2CLSA 2YMQA 4MCJA 1MKYA 2Z9DA 1G98A 3B5JA 4JKYA 1OY1A 4L1KA 5JNLA 3L92A 3OD1A 4CKCB 5AXDA 121PA 1ZSYA 1QKIA 2D62A 2DQZA 4FGSA 4KMSA 1TLLA 4MWEA 4Z9YA 4ZVVA 4X00A 4BFVA 3WNVA 5EVJA 1NBME 3MSCA 2XMCA 4F4CA 2P0EA 2ACKA 3GJXC 2EQAA 3EPKA 1COWA 2P6OA 2VRBA 2B3DA 3D7RA 3GQBA 4BO0A 1NIPA 5TY0A 2XVYA 2AG1A 5C7LO 1TA4A 3JAWB 1G41A 3JYHA 4MP3A 1KQ3A 2X8JB 5I01A 3VJRA 3H9EO 2D2XA 4LQCA 4DYDA 1PZFA 3OZRA 3W3AA 4YRIA 4UQLA 1L7EA 4WJLA 4DV7B 4U2EA 3WLPA 2BFWA 2AYYA 5KYWB 1DBQA 2NQ2C 1GUAA 4ALIA 3SK0A 5CEJA 2BM0A 2L82A 4EG1A 4JP1A 4YRQA 2NPOA 1CUAA 1EBUA 1O6ZA 4UARA 3OJWA 4ED9A 4QPDA 1C5KA 4DSUA 1P7VA 2JCYA 1F9AA 4CQMB 1BYIA 5EL0A 2IP4A 3OZAA 4HRAA 5KTYA 1DAKA 1JEEA 1VJGA 3M6LA 1AZLA 3C6YA 5CCEA 3QU5A 5TT0A 2DFVA 4JI3B 1T9CA 3IJPA 4J0KA 4NS1A 5JNSA 3A26A 1DX4A 5B1HA 2VF8A 4EGSA 3D31A 4UAUA 3O8QA 3N87A 1Y6JA 4PHGA 3O4IA 1P17A 1I32A 5FO0A 4KAFA 1FFEA 2LW7A 1E0DA 2Q3EA 3QV2A 4B8ZA 3HEBA 3H1AA 4QX6A 1PFUA 3AFIA 5KTOA 4Y2GA 2EW2A 1DTWB 1P9WA 1R6XA 3IURA 2JAXA 4Y2XA 4DAOA 1IHUA 4UUAA 5K9ZA 4AMYA 1P3JA 1XTKA 1JKJA 1WOMA 2FJPA 3W1VA 2DLCX 1BGVA 3KVRA 3U13A 4HRYA 3TR6A 5CA1A 3U6BA 3DCJA 2WQ6A 4UDOA 5AR1A 1JTFA 2OQ2A 4F3YA 2CXHA 3OLVA 4Y1GA 3EGVA 2IIQA 2H06A 4YCMA 1E61A 4YUYA 5HK9A 3IHWA 3G9UA 4OAQA 4G86A 2X3YA 3BCHA 4FW8A 2AEEA 2P6UA 1DC7A 4NCJA 1G291 2BFBB 3UUWA 1IEVA 1XYGA 3EOBI 3EVNA 3E8MA 2D1SA 2TMKA 3FNRA 3KPJA 3OICA 4Q3EA 2PUAA 1MB4A 1I9CA 1R0WA 1UMCA 4HXFB 1VIYA 2MSWA 1T9DA 5EFZA 4GBMA 5JCPA 3JS5A 2BEVB 4CUJA 3SE7A 3SICE 3G8DA 4E1AA 3WYDA 3OFSA 4QDJA 4EL5A 4ER0A 2VJDA 1ULZA 5EE1A 3TLGA 4D4HA 5DNYB 3ZWCA 1DVRA 1O87A 1GZ6A 1SCDA 4UM8B 4DJ5X 1N1EA 3N7AA 2RH9B 4QYTA 4ZRNA 1CY6A 2PLWA 1FU8A 2DYKA 2ZDGA 4FINA 2B92A 1R0KA 4YQYA 3HO6A 3K4QA 2V4ZA 3S44A 5A5DA 4QVIA 3OEED 4MMXB 1Q84A 1XTJA 5C5DA 1Z33A 2ZVPX 4MQ4A 4PCLA 4B79A 5FBRB 1WHSA 4CLEA 5KTPA 2O54A 5B7NA 4XYBA 1SA0B 4MK4A 4ETIA 2YJ5A 3PQ8A 5LZ2A 3BE5A 1A72A 1W2HA 3COPA 4HB4A 1XJCA 4CMKA 3M83A 1JYFA 1QDLB 1I80A 1Y33E 3ENKA 1UJNA 3GLFA 1EQ2A 3OZCA 1O0CA 5KMGA 1PHRA 4O2BA 3V55A 1AO0A 5JCOA 1HKUA 3P0FA 1B3BA 2F00A 2HLNA 2ZKIA 3LDUA 1E2KA 4JEIA 4DMUB 4UM9B 4GMHA 1KOJA 2J0UB 2HAEA 4J16C 1YJQA 5F4ZA 1MJ5A 2WIGA 1NBAA 1ISIA 3SS7X 5JS6A 3T41A 3H5RA 1JECA 3D1JA 2QMOA 4PYRA 1Y8CA 4FKMA 3UJBA 3WZ2A 3T38A 4XM1A 4BDSA 3QA3E 4IQFA 4ALNA 4E2FA 2V7PA 3OZGA 5IT9A 3BKXA 3ESCA 5EKSA 1ODKA 2VXCA 4MS3A 1RP1A 3BULA 3MAJA 2XWBF 3ML1A 3CRMA 1DXHA 1DBVO 1E1YA 2WSSD 1WXHA 3G2IA 3NBXX 4FYKA 3BFPA 4TXNA 5CPFA 3W3ZB 4NLLA 4PR0A 4U00A 4CEHA 3UICA 3CLUD 1VOTA 4H7FA 3O2JA 1LSUA 4EG4A 2B8NA 2ZPTX 3ETDA 2CE2X 4OPMA 5FPTA 1LLFA 1U99A 2ZYVX 3IS3A 3NAQA 4JASB 1EE2A 2XRYA 3A4NA 5ILGA 2AG8A 4FDTA 2ONZA 3C3MA 3EIOA 4EGQA 3I3OA 3C43A 2FN7A 3JWHA 4L22A 1MAUA 1RCFA 2HF2A 2OV8A 2P5SA 3QK7A 5CNJA 1YZHA 1E5XA 2FFHA 3IILA 4KN8A 2Q4DA 1A8QA 4OJYA 3JWIA 1XZBA 1B0UA 2QYSA 3BSYA 4RYDA 1HE1C 4UCWA 3CX6A 3Q3EA 4HBZA 3HY3A 3L0PA 4WOBA 1CQIA 1J7JA 1L0BA 1EM8A 1L8XA 2Y1OA 3THSA 1JG2A 1N3IA 2XXBA 4MWZA 4QJ5A 4CM4A 3ACDA 3TUZC 3KXKA 2D2FA 1O57A 2D1FA 2J3LA 3LBAA 3O31A 3IHKA 2DFDA 4BFCA 3KSRA 4BB9A 1ZXLA 1XCOA 2ID9A 1M0WA 4TWJA 4CMEC 4ZK6A 3KNZA 1RQ2A 3QX9A 3N6XA 1LRJA 1R0ZA 3A6JA 2VQFB 2FSVC 3ACCA 1ZJZA 2F59A 1FNDA 1TU0A 4X91A 1SVWA 3ZDXB 3BX1A 1VL5A 2JLXA 2GPJA 4E2YA 5EJ6A 1HXHA 3O82A 1JQLB 5TPWA 3TBKA 1WMEA 3VR3A 1U8ZA 4KE6A 4YBRA 3SSAA 3HJHA 2FETA 3WGTA 1MF7A 1L4YA 3DW3X 4MW9A 3ORHA 4UDNA 4XD7A 4ZODA 5D84A 5IM5A 1LS1A 2NSHA 2R8YA 2B5OA 5F33A 3T7AA 3K1YA 3IVRA 4YRCA 1AF4A 5K0BA 3OE7A 3W6PA 2H1SA 3IDAA 2P7HA 4QRHA 3HB7A 3O94A 2BTQA 5K6AC 4IZIA 3AEKB 5J5CA 1QRUA 2GZAA 4EY7A 4W5HA 2BP7A 1GGMA 2DP4E 4YQFA 3K9FC 3SC4A 4JROA 3PTAA 1ZD8A 1PNQA 4M7PA 4WNAB 4GWLA 5K0JA 2H0AA 1FOEB 1OT5A 3C2QA 2XB9A 3DCYA 3UPUA 3GPCA 1A7UA 2WIBA 5BN5A 3HR7A 1I2MA 1AIPA 1X7YB 3ZDFA 3OLYA 2ASVA 4K9LA 2VUIB 2FN9A 4OHOA 1IC6A 3P1JA 4EFNA 1BEUB 4IDHA 5KNCA 1VMAA 4Q9KA 3TRFA 2XEDA 3RF6A 1J1UA 4X1OA 3DDCA 2XZTA 1HTBA 2RIRA 1X1BA 1NVAA 1XNJA 2BTOA 3JQ9A 4PR3A 1OYVA 1ZGHA 3PQ4A 3TE7A 3DMFA 1BDJA 4UZFA 2R11A 4O6VA 2C2MA 4MO9A 2FMXA 4JJFA 2XOKD 1MAWA 1OLOA 2OHVA 2EIXA 2HUNA 1KEVA 4DMFA 1SVIA 2VUTA 5KX5A 3EGXB 3KWJA 1XB2A 1UP6A 4FE7A 1NVKA 4JGBA 4YN3A 4B7XA 3EPJA 2XTMA 4N9WA 1A8SA 2Z6VA 4HVAA 3JALA 4GOMD 1B1CA 2XWJI 1C3JA 3EMKA 3NGMA 3L7CA 3A1NA 4IIBA 4BFLA 3EIEA 2G72A 2R6GA 3FYTA 3KX2A 4OHWA 1GGNA 4YMWA 2WOOA 1Y9JA 3ANNA 2PUEA 3CGWA 1M0SA 1YVEI 3EWIA 5F3DA 3RW9A 4BRSA 1E98A 2FPGB 3V1LA 4D9GA 1R5JA 3OZVA 2QRZA 2VDLB 4Y0NA 4YJFA 2VDRB 5J58A 5DLPA 2E21A 4HV4A 2QN1A 1FFYA 3KKNA 1QGYA 1EVEA 3C1AA 3VV2A 1QIHA 2VJOA 2ZRBA 3E2IA 2QX6A 1R4MA 1SIWA 3L1IA 4P2GA 3BXFA 1KE2A 1PJBA 1ILEA 4H35A 5K3AA 3MINA 1GTZA 4XOUA 3T34A 2J5BA 3RU7A 4X8OA 3TOSA 2FQ1A 1CUCA 1EQUA 1LPNA 3GP5A 2JRLA 1ZWLA 4FIZA 5COAA 1MO4A 3L0BA 4ZO9A 5D8DA 4PIMA 1J2EA 4O4IA 3OMXA 3PEFA 4OKSA 2GPYA 3HSKA 2D1QA 5TGZA 2NUTB 1JQKA 4F11A 1SKAA 2H1CA 3ZK9A 4LRWA 5D3MA 3ZV5A 4OLBA 4F72A 1ZCBA 1FLDA 1KORA 1JBKA 3UBMA 4BV2A 2EEPA 3L1VA 1JEOA 1U90A 2YZKA 4UTXA 3IMEA 4F91B 2BV3A 1W48A 4IEFB 1RZVA 3TMAA 3WKEA 4IZOA 1ADCA 2PGLA 1WLSA 2JIZA 4XTCS 4Z7NB 6REQA 2UV8A 4IDPA 1M74A 3DLCA 5L4NA 1CS0B 4DILA 4WCVA 3RT9A 2DTEA 1L7NA 3C41J 4YB8A 3MRTA 3NDIA 4EYOA 1Z8FA 4LCJA 5BN4B 2H57A 4EX6A 4UCXA 3T5TA 3L6CA 3ZQKA 4YRPA 1K06A 1ZGBA 1IBRA 3OE4A 4Q1CA 3BB1A 4A36A 3R5XA 2I1WA 1WCXA 3E9YA 4RYLA 4WW0A 3K70D 4Z7QB 1F8GA 5C3UA 5AJHA 3FNHA 1T2CA 3BWXA 4URXR 3I9KA 1K0UA 4K6HA 4OMFG 1TYDE 2QAJA 4NZMA 4M8NE 1M10A 1CCWA 3LJKA 3E2MA 2E9SA 4Q01A 1Z0UA 4DMRA 2CGEA 3Q85A 5GIOE 1PV1A 1KZ9A 2PBRA 4C88A 1CVRA 3J80A 4KMMA 1TCUA 3ZW7A 5T5QA 2C31A 4GQAA 4CDMA 1MZPA 5E6UA 5K01A 4W6QA 2P9YA 1L8AA 1C8BA 1R4NA 2QG4A 2IPNA 1CE8B 2PVSA 3RSZA 3FSJX 2EJVA 2F3PA 3NX4A 4QHTA 4CF5A 1CUDA 1ZGZA 3F6RA 3RJ9A 1IN1A 2B82A 3JZIA 1JA0A 4P0PB 3D54D 1QH8A 3QY0A 1NX9A 1TM3E 2IZ7A 3HU1A 3LPCA 2A5LA 2IH2A 2VCEA 3RABA 1U3TA 4RC9A 4D44A 3UXMA 3V1NA 5L4SA 2AKAB 3JU3A 3QW4B 4M8IA 2XWSA 4RF3A 1E2MA 2WD8A 3BE8A 4QPPA 4J3FA 5CX1B 1HSOA 2BCJQ 4JQCA 2HRDA 5FBHA 5EGSA 1ADJA 2IYYA 2NU8A 2CFIA 4DQDA 1KAHA 3IUQA 1Z73A 2PBFA 3KVNA 2WQZA 3OFNA 5AUPB 1BMDA 3IB6A 3QELA 3F98A 2O3UA 3AP1A 4X71A 3SGLA 3LQ1A 1P81A 3QEOA 3ZDAA 4JCCA 3B52X 2Y99A 1ZK1A 2O9JA 1JJIA 5JMWA 3IALA 1PR0A 1R27A 1A5AB 1JL3A 1I7QB 5KOJA 1PK7A 3GVHA 4IOJA 2R97A 3D4OA 2YZNA 4H6PA 4L8YA 1KJ9A 1OILA 4WN9B 4ZCSA 5KBYA 2AJBA 4O4IF 1JFRA 5KWIA 3S3TA 1DX6A 3ADPA 1USGA 3AX6A 1V48A 1DIGA 1UK6A 1ENYA 1ZFNA 2C04A 1NJ1A 2J5KA 4FMBB 4ZU6X 5AWFC 2XKKA 3KQQA 2JAWA 2QVBA 3AM1A 3C6ZA 3BE6A 4KO3S 1Z4MA 4GIBA 4DCGA 4UEWA 1GAQA 2H9IA 4RVSA 3TOXA 4B80A 3GLSA 4JOCA 4H1TA 5K0SA 1TEHA 3EC7A 3CVYA 2ZEJA 1YJCA 1REQA 2UZ3A 4HAVA 4NZNA 2XUJA 2AOVA 2AZ4A 1O54A 3EEIA 4R4JA 5EHGA 5F1PA 4EBBA 1XZQA 3GYBA 3KFXA 3NBYC 5DTMA 3V5NA 3M89A 4A2CA 2ETVA 1K75A 2Q5HA 4JL6A 3H84A 5ITWA 1T8YA 2YHBA 3NO4A 4JB8A 2I4LA 3IPRA 1VG0B 4OVKA 3SYKA 1V45E 4KQ9A 2Z58A 1ZM7A 3I2HA 1XVIA 4UUOA 4YRGA 4G9BA 2C2OA 1QBGA 4YJ2B 2PGIA 4HNRA 2AQKA 2EG9A 3I1FA 2LV8A 2Z83A 3FLAA 2CZCA 1WQ1R 1ZG3A 5ALLA 3EPLA 3EPRA 4B3TB 2YZ7A 4ZHSA 4JK3A 2R2AA 3LT5A 3PQ5A 4PPGA 2BGIA 1HF3A 2AI2A 3QF4A 3WMXA 4BNKA 2G07A 2ZIEA 1Z34A 4O4HA 2QN8A 3ROEA 5GONB 4MVJF 3DC2A 4HZGA 4FMCF 2XCUA 4E31A 3LNCA 2I8LA 1FX0B 5JAIA 5JTUA 2V3VA 5I8PA 3H2GA 4QYIB 2QTVB 4LC0A 4PZLA 3EIQA 1GZ3A 2A9PA 1Y1PA 2JD1A 4LK3A 1EBFA 3WKDA 4CMGA 4OFXA 4D79A 3EH1A 2C3MA 4LWQA 5JWRA 4GMXA 3IT3A 3K73O 3GLIE 1E7QA 2HEIA 1A50B 4MQFB 3FPJA 5KPJA 3PSAA 6ABPA 1E59A 2Z3ZA 1WS6A 1V5IA 4C07A 7ABPA 2FMKA 4CCYA 3I5UA 5BUCA 4ZKDA 3UJ7A 4EHHA 5JYBA 1X8JA 2ZUEA 3BQ9A 2RKWA 5LP6F 2GFQA 3OTIA 621PA 3WI7A 1Z88A 3DPIA 3SHOA 4LDAA 1E9VA 4CLOB 2CXUA 3CGGA 1X7DA 2QM7A 1WSAA 1A4IA 1TF5A 2BDTA 2CMKA 4YJGB 3KQNA 2OYRA 1F8YA 3OQ1A 2OG1A 3GROA 3U2QA 4B3BA 3WDMA 2X8AA 4UPEA 1OVMA 1ACMA 1BU5A 1CDOA 3L40A 4R8KA 3T9EA 4ESOA 3UTDA 4H60A 1EESA 4RJTA 1FMJA 2HTEA 4O4JF 4C7BA 1S2NA 1Z0KA 3NALA 5CX4A 2RGDA 3NUQA 4IO1A 4NMLA 1WNFA 4FD2A 2ACEA 4LY9A 5LLTA 3K70B 1KJJA 4FQ5A 4TLCA 3FPHA 4GPIB 1S3GA 2INGX 4I36A 3VPXA 4DIBA 1CZNA 3A27A 3H1EA 3Q7RA 4U5XA 3CVXA 2PJZA 2VYND 1YI0A 1SCNE 1YMQA 4G1CA 5H8WA 3LKZA 3ZHRA 2PA0A 4BEWA 4YRAA 4MUKA 1K3UB 1YXMA 1NQ5A 4AX8A 2B98A 2DTDA 3UFBA 3LUBA 4MVJG 3DOHA 1INLA 1Z7EA 1EX6A 2EW1A 3ECAA 3PNKA 3B1FA 3A4MA 3ICCA 3QF7A 3K9NA 3P94A 1UXGA 3LNTA 3QUSA 4BO2A 4LC1A 1JFFA 5AXBA 5JZVA 1QLJA 4EB3A 2PL9A 3GUHA 2VDVE 4YUVA 3DTNA 2PL3A 5AQ1A 5IG2A 2VSOA 4JD5A 2KSQA 3THRA 1DADA 1Z68A 5JXHA 3HYSA 3QBTA 1P5FA 2EBWA 2QLJA 4LXIA 2V74B 3N5CA 1KYIA 5I7UA 2BONA 3H9GA 4UC0A 2XXAA 3O3CA 2Z5VA 2DJ5A 3CB2A 1KEEA 1HNZB 1CJVC 3AF1A 1NUHA 1U5CA 4BZQA 1E96A 3O1IC 4JYMA 3DAHA 1GJRA 4F3NA 4ZIRA 2GZ1A 2A0XA 4LSGA 2FE4A 5L95A 3IXMA 2VHZA 3KUKA 4ZYXA 4DCOA 2WM8A 1EVZA 3F6BX 3AG6A 4QUDA 1OPXA 3GUUA 1TW2A 3PTLA 2AX4A 1JSCA 2XE7A 4R8MA 2O50A 3EVCA 1M2OA 1Y6RA 4G97A 1Z8NA 1ZZGA 4JI1B 2Y68A 3B51X 3R0XA 4HN2A 5IDYA 1W76A 2H3EA 2WG2A 2BI4A 1PSZA 2WE7A 3S1AA 3G8AA 1LVGA 4RV5A 1IM5A 1N2EA 4ZXFA 3ELWA 3K5HA 3TZQA 4Z53A 4B4WA 2G7ZA 2QAGA 4HDOB 4L8WB 4J9UE 4UHHA 2Z4TA 1T4MA 2PUTA 4KQIA 4Q3KA 3FBGA 5IXSA 4CG2A 2WWGA 1TQHA 3AWIA 1OBOA 4ZOLB 2PFKA 3KQPA 4CCAA 1BHQ1 2I7XA 5F7JA 3QKRB 4DS3A 1J5EB 2ZJ6A 1P61B 4IHJB 3JTMA 3N1UA 2X42A 2JB9A 1P44A 3L8MA 4IIUA 2AQHA 4JT9A 4N5NA 3QVOA 1ABFA 1GKYA 4PRZA 1S3IA 2WSBA 1P4RA 2BMDA 3PVCA 1SQFA 2B25A 1HDGO 3FPEA 4MUHA 1DO8A 4XYGA 4L5BA 1AV7A 1YIAA 3FHJA 1TGVA 3FSEA 1FRVA 2AG0A 2WFLB 2OK7A 1F2TB 1VI5A 3CC8A 5IYZB 5JALA 2VR1A 1C3VA 2KBFA 1XNHA 1YR6A 2O2DA 1TFRA 3FDZB 1J2YA 2G8LA 4TOIA 1NQWA 3IMKA 3SR4A 1D0VA 2YWJA 4OMUA 1DBRA 4PSUA 1IIBA 2A5YB 2PWAA 1Y81A 2Q29A 3MRVA 4FPXA 2G9UA 4RHEA 4WESB 4C01A 4S04A 4UFOA 1YBHA 1G3QA 1EUCA 1CEXA 4LF6B 1GQSA 1F8FA 1RI5A 1OU4A 3GVPA 3CW8X 3TR5A 2Q4EA 4BLTA 3TLGB 2QTTA 2EVWX 1NATA 2HY7A 1KDRA 2ZSUA 1JJ7A 1NKVA 2I2XB 1E6KA 2QPAA 1W6RA 2PRKA 3Q9UA 3O95A 1MAVA 2EEZA 2XV1A 5EKUA 2JFFA 3G23A 1LU9A 5MN6A 4NV0A 4ZQBA 5I5GA 5A5GA 4X60A 4ZXPA 1RRGA 2OKCA 3IAS6 4RGQA 3BREA 4RIGA 2M32A 1EKXA 2NT3A 2JFWA 4BC1A 4DOMA 4K86A 5FTWA 3WLJA 1WPGA 4YPOA 1ID8A 2XE4A 1YTUA 3T4XA 2UXBB 2V7BA 3OIGA 4FMPA 2M6LA 3LCMA 3VVCA 3ASZA 4P38A 5ALDA 2IP1A 3R5HA 3LP8A 3KSDO 1C14A 4YEDA 2H1LA 3MFQA 4HDNB 1U1IA 4B35A 3PVSA 3U48A 3O21A 4QT4A 4JEMA 3GFTA 1G3IA 4L85A 2PMBA 4ZANA 4ZVKA 5JD3A 3JQBC 4BZZA 4EGJA 3RAJA 1YS9A 3GGCA 3K9GA 3BSSA 7REQB 1AA6A 4MQ5A 2A9JA 2N3ZA 3EGDB 5AW1A 2Q2VA 1UC8A 2I2AA 4QUKA 5JY1A 4L50A 5JDCA 4BUCA 4FGZA 1KJ8A 1O1YA 1IUPA 3VMMA 1V35A 2GM4A 2VAXA 1VQ1A 4PXSA 2DQKA 4DCNA 1J2UA 3ZJUA 1JIUA 3C24A 2HU7A 3PUZA 4ZI2A 1ULHA 3AU9A 4I3GA 1KSFX 2ARKA 1T9KA 1E5VA 1JIVA 2BEWA 1F6WA 3JATB 3O84A 1L7RA 2XDAA 4GLJA 3BD8A 5ALZA 2HHLA 1T2EA 1EFVB 1VIVA 1NVFA 3U9TA 1IPEA 3F7TA 3PL5A 4RJKA 4LJLA 5FL3A 4ZJPA 1QUFA 4LY0A 4P4GA 2OXTA 3WTCA 5ARBA 2G17A 5IVIA 2ATIA 4M0KA 5KNBA 1TCBA 2JEYA 1ZRMA 2GD0A 3NHUA 3LECA 3T5GA 4BNUA 1YK1A 2IQIA 4S05A 2HN9A 3OM9A 5TV2A 5CCDA 1Q0TA 2ECQA 4D25A 2FOLA 5LYJF 1TJPB 3KWMA 4LTMA 3SFVA 1T26A 5GJBA 3ZV4A 2AXPA 1DAPA 3C3JA 1BWSA 1O6CA 5C9ZA 4M0FA 1Z06A 2CKDA 2R6JA 2BL4A 2CBGA 1NL3A 3WWOA 1AV6A 3ZIDA 4KQ1A 1J0AA 5FT9A 4D56A 2KHZA 1UT8A 2CE7A 1KQFA 4N48A 4G23A 1ZN8A 1ZUWA 4ERXA 4JH0A 1O96A 1FBTA 5CG1A 2C2ZA 1DIRA 1YH3A 2R96A 2ZT7A 3R3WA 1OLSA 3GFGA 3NORA 4L6IA 1R00A 2Q9UA 5CNMA 3OFJA 4Y1FA 1OBCA 4OM7A 3SDBA 3ZE9A 4E1VA 3W8RA 1BYUA 2DWUA 1PR4A 3DS8A 4MIOA 4KKXB 3WV4A 1T1EA 4MI6A 2YXDA 3MUOA 4Q21A 4LBYA 3BL8A 1U9ZA 1RWKA 5FWDA 4UD6A 5D1NA 1DP4A 1A27A 2LZ0A 1VLLA 4JBIA 5EYPB 1M5RA 2QSYA 2P1ZA 4UHDA 2QM8A 4CLRB 1DEHA 2WSMA 1VYVA 2KLBA 1N5KA 1AMNA 2FLWA 2V7GA 4IVRA 4PGAA 1FUYB 4TMTA 2R751 5JHGB 1QTRA 2MYTA 1FMFA 1AE1A 2XWQA 4LXUA 1JR3E 2BGJA 3EZ2A 3WMRA 2OV6A 3ZXXA 1Z7BA 4RHCA 2VPTA 3GLTA 4UREA 3TZ6A 1D2EA 4PO3X 4W5TA 1EXMA 2QYOA 3AHEA 5KYVA 2HHCA 4GEGA 1YBFA 1PDOA 2DUWA 3NIDB 1ZCFA 3KJQA 4OXRA 5HKBA 3O4VA 5AFSA 4PF1A 3S81A 2WHEA 3ND7A 5KOIA 2QF7A 5FP0A 1LLUA 5LZ9A 1OXSC 2NV2B 3IPCA 3OPVA 4K46A 1XMQB 3Q3IA 2JGRA 1YT5A 2BR5A 1QOZA 2QL5A 2QKYA 3VGJA 3BWYA 5HXAA 5EN4A 4WA7A 3V48A 3VVBA 2FWNA 1U8TA 3K53A 3IVMA 5E8JA 3FWKA 3S1SA 2YS7A 4W9NC 3O1HB 2V5AA 1IZ0A 2IKQA 3DE2X 1II8B 3DO6A 2G4LA 1L7AA 1SBCA 1T0PA 3CXRA 2FQXA 1H5UA 3BJMA 3EUWA 3IOEA 3KOYA 4YAJA 1W88A 3AI7A 3BHIA 3TQIA 3USZA 3FKQA 1YULA 4E94A 3OC6A 3A05A 5LP1A 4BX3A 1V25A 2WTUA 3M4JA 4I50A 1FS4A 5BP7A 5I7EA 3JVIA 1ZKDA 5JAUA 2ZBQA 3U3ZA 2X15A 4ESVA 3OT4A 3WJAA 5FUYA 3GUVA 3RRJA 4EFMA 2X0IA 1G8GA 1SUFA 3ELBA 1RI1A 4LDQA 3TIVA 4BJHB 2YBDA 1GA6A 1NKTA 1NI5A 3FGOA 3PPYA 4I5EA 2FJ0A 3EZYA 5BORA 1U1GA 1JS1X 3RFVA 3E23A 1B6GA 5BRNA 3ONFA 3BF8A 2ACWA 3QVSA 4Y9TA 1IB6A 4HAZA 3KWFA 4P7KA 4ZARA 3W2IA 4MW2A 1NAIA 4INPA 2UKDA 3AOEC 4WADA 3LIIA 3AMVA 4TQGA 5YASA 3WAJA 1HQCA 1UXOA 3HNPA 4PXAA 1EVYA 2BC9A 4R9VA 4WZZA 2Y9PB 4NP6A 2XUHA 4KO2S 2AFIA 3MMZA 2E1PA 1NJGA 5AK6A 3OSUA 5ALPA 1UKZA 1V26A 1UFRA 1J0BA 1UMDB 2XLCA 4BMSA 2IQ5A 4G9EA 4DQVA 2C92A 2R84A 1WP9A 2I1VB 2AVDA 4EATA 2QNIA 4NQRA 1OX5A 3HWRA 5EEGA 3TLKA 4UTOA 2FN3A 3TNLA 5AVZA 2C42A 3IV7A 3L4KA 1OI4A 2BFNA 1NSTA 3KZCA 4H15A 2QP3A 2D2IA 3D4PA 2R6DA 3R23A 4Q9AA 4QEKA 3UTCA 3K0FA 5FULA 4KDEA 4DANA 4FLMA 1JEJA 2I0FA 5HQ3B 3E7DA 1XDWA 4GYKA 5BSVA 2QP9X 1N2JA 3EQ6A 1JKFA 1TC1A 4MKHA 2O8DA 3D9QX 1MUUA 4BNDB 1SO8A 4XCQA 2Q9AA 4HNVA 1YIOA 4XIGS 5JIBA 3GB9A 1T3GA 4LE1A 4WCDA 5ALRA 4O1IA 4FYWA 4YCDA 3G2MA 5EMKA 3R9XA 1VPTA 5HCIA 4JP2A 1D1QA 2ZZNA 4ND8B 4M0MA 5IWCA 5D86A 1WY5A 2AN9A 5CVEA 1SHTX 2WVGA 3T4EA 2QW8A 1WB4A 2WA2A 4TSKA 5EPUA 3A3YA 3MGAA 1WCV1 1EK0A 1QK4A 1PJRA 3FYUA 2YY6A 2VHYA 4C4ZA 4KU4A 4MUYA 2PTGA 4OGKA 3E27A 2GJKA 2C2YA 1KH1A 1RLJA 3CEHA 4NBRA 3VBEA 4KXMA 1IY8A 3BDVA 4A8PA 1ENZA 4BO9A 5CA0F 1F48A 3S5UA 5KQGA 1T5DX 2IOHA 4FGJA 3WAGA 1ESDA 3V34A 4ENTA 3AF0A 1K68A 4P33A 4Q05A 1TDJA 2J48A 3EVBA 4MVCA 5DB4A 4GMDA 3VH4A 1GRVA 1VM6A 4KSBA 5AW2A 1ZICA 1G16A 4CMIB 4OIMA 3H19A 3P8ZA 4UW9A 1L3CA 4LOIA 3WIVA 3JQDA 2K2WA 5AKIA 4YJDA 5L9AA 1YR9A 2ZRLA 3SIXA 4ZZ1A 3HL0A 1JXQA 3QENA 2R4TA 4GC5A 4BXOA 3C6MA 5CEEA 3TIXB 3EFHA 3KHTA 2A2ZA 1QM5A 1ONNA 4OFBA 1ODCA 4NBVA 4F3RA 4CQMA 2M2IA 1G8JA 4N18A 1NQVA 4L75A 3S68A 1H4SA 3TFWA 4XR4A 1O6BA 1PEYA 3CZAA 4G2NA 4RADA 1S7CA 1FCJA 1WEHA 2W8ZA 4HDAA 3UKOA 5AW9A 2G1AA 3DLIA 4N3GA 2IS4A 5LA6A 5FPPA 1DWOA 3H8JA 1GVNB 4XWAA 3P9SA 4JR0A 3T5BA 2CDBA 4K0KB 2YW2A 4RANA 1UDBA 2EL7A 1JTEA 5B6PA 2JFZA 4Z0HO 3P5SA 4IFBA 5GZ6A 3WHLA 4EUFA 3NVDA 1D4OA 1E20A 1QNLA 2Y67A 4MWCA 4PSCA 4ALLA 5K8IA 1IM8A 2OO5A 2BTEA 3A0RB 4PFJA 3I52A 1F2UB 3AP3A 1SKYE 4NONA 3IT1A 3QE3A 5AVWA 3V7FA 3VU3A 2NTYC 4O4JA 3PR3A 2DKOA 2M98A 2NTVA 3AF4A 3I2IA 1HETA 2NOAA 13PKA 3A6DA 3L4SO 5BW6B 1IOZA 2QL9A 3UVEA 2PO5A 4R16A 3UJ8A 5AW8A 4S1NA 3DMTC 1JKIA 1VXRA 3L8ZA 2ZBFA 2O2EA 2O8FB 5ECGC 1T9GR 2V58A 3FSGD 4F5WA 2KS6A 2R1UA 4NICA 3IBYA 4H1VA 2OHIA 3ESRA 4RHFA 5E7JA 2I2WA 1T6XA 5CG2A 1R3DA 2XZLA 5C8VA 3D7MA 5LSAA 1I2CA 3CXUA 3D3EA 4RIFA 2UDPA 3RVKA 1LW6E 3SNKA 3WVNA 4I4CA 1D09A 1U3GA 3RTAA 2DR0A 2H8KA 3MGBA 3X2SA 1U3FA 2QMQA 4G5RA 4B8YA 1QQTA 3EHEA 4DL9A 1X14A 1MG0A 2QGFA 3KEMA 2BIFA 4DCVA 1C3EA 2G0NA 5F51A 5IBRA 1DAIA 3FGNA 1UBCA 4B3SB 2RAVA 2LCIA 4I46A 1J90A 3G88A 4E21A 2WWXA 3EMBA 5A0TA 3I5XA 4ZFNA 2FAXA 4MCHA 3PE6A 2HSJA 1C3OB 1FTQA 1UCFA 4QOFA 2DWPA 1Z13A 1P4JA 2I4NA 4D0GA 5K05A 2J3HA 4A9AA 1D8AA 1GU1A 3U7RA 5L45A 3BBPA 3Q5EA 2I1QA 5U4QA 4YJ3F 4R54A 1VBKA 3RVBA 1L5MA 2VXOA 1N32B 2XYGA 2GAJA 1T0UA 3KG2A 5ICCA 4RWZA 3MWEA 3N86A 4UBMA 1N2BA 4KX3A 4YV2A 3TTVA 5CVVA 5C8DA 1L6RA 1JUDA 1OVGA 1ZLYA 2VHEA 3GPLA 2BR4A 5K6AA 3HBFA 4R8LA 3ZDQA 2XZDA 4EQ6A 2DLNA 3AWDA 4FFNA 5DTJA 3RM3A 1ZM4A 1P77A 1V5EA 3AF2A 2IYQA 3L9WA 4IYJA 1CUYA 1T1GA 2JHCA 1JIJA 5AVJA 3K20A 3ODPA 1U1EA 3H2YA 2DBZA 4RL4A 4JJ7A 3NYWA 4JENA 5C7YA 4F6RA 3HYCA 3UAOA