4RG2A

Tudor domain of tumor suppressor p53bp1 with small molecule ligand
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Identification of a fragment-like small molecule ligand for the methyl-lysine binding protein, 53BP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4rg2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4rg2A01
2EQUA 2R57A 3H8ZA 3MO8A 3CMAT 5IN1A 5IT9E 1VQKT 1YIJA 3CCMT 2MI6A 1OI1A 3PIOA 2EIFA 4A4HA 1S72A 5KE3A 2RHXA 2LDMA 3OYNA 1VQ5A 2RJCA 2BKDN 4IKFA 3FDRA 2LTOA 2LQ8A 2EKOA 3MEWA 3CC2T 2G3RA 3I56A 3MP6A 3PFSA 5D6WA 1NPPA 4A4EA 4BACA 3E9GA 2QA4A 2LRQA 3MEUA 3CCJT 1OYXA 3ASKA 1KQSA 3CC7T 2D9TA 3P8BB 3CD6A 1YHQT 3DLLA 3Q1JA 1IZ6A 3OYHA 3OYMA 4ZN1A 2E6NA 1VQPT 3J80E 2K3YA 3DLMA 3OYDA 3LX7A 3MEAA 1K73U 3G4SA 3S6WA 2JOYA 1Q82C 3OYCA 3CCVA 3OYAA 2L3RA 3OS0A 5LL6S 3A5ZB 2YRVA 5J3BA 2RJEA 5C6SA 1XTDA 2QEXA 4Q5WA 5CIUA 1VQNA 1W2BS 4QQGA 4IUPA 3OY9A 1VQ8T 1KHCA 1RL2A 2E70A 4N4HA 4IUQA 3J7AF 2RHYA 4PL6A 2CKKA 3L2WA 3CCLT 2DIGA 1Q86C 1QVGA 3CCRT 3I55A 3QJ6A 1K9MU 3KBGA 5A2QE 2BUDA 4QVZA 2RO0A 4II1A 1KD1C 4E7LA 3OYGA 3J81E 1JJ2A 1VQ9T 1Q81U 1M90U 3LGLA 2OTLA 3CPFA 3CC4T 2M16A 4C5IA 3CCQA 4EDUA 5FROA 3L2QA 3CCEA 3PMTA 3P8HA 3OYBA 2R5AA 5J39A 3CXCA 1VQKA 3CCMA 3E9FA 3FLGA 1M1KU 2HQEA 1RI0A 3QBYA 4TVRA 3OYLA 5D6YA 2P0KA 3S3MA 1VQ4T 2XK0A 1NPRA 3QKJA 3OW2A 1KC8C 1YITT 4E7IA 4N4GA 4E7JA 2JTFA 2GFUA 3BDLA 4E7KA 2O4XA 3CC2A 5KCHA 4X34A 4RG2A 3OMCA 2OTJT 1KHIA 2DIQA 3OYKA 3CMET 3MP1A 1OZ2A 2RI3A 3CCJA 3NTKA 1VQMT 4ZTJA 3CC7A 3OYIA 3CCST 1WJSA 1UEBA 3M9QA 4YTLA 3CCUA 1YI2T 2IG0A 4IUVA 2K3XA 1YJ9T 2PQWA 1OZ3A 1X6OA 1KQSS 5KCOA 3CPWA 3MEVA 5KH6A 5DM7R 3PNWC 5FRMA 1YJNT 1VQ7T 3ME9A 4PLLA 4FU6A 1YBYA 1N8RC 4CRIA 3OMGA 2GF7A 2XHCA 1EIFA 2O4XB 1VQ8A 4UC4A 3QIIA 1NJIU 3L42A 1XNIA 2RI5A 3JAME 3NTHA 3CCLA 3CCRA 3CD6T 2MWOA 1K8AC 3G6ET 1WJQA 1VQLT 3NTIA 2DO3A 1Q7YU 4ZTFA 3OYEA 3H6ZA 3ZEHA 4BE1A 3C4SA 2RJDA 2JZ2A 3OYFA 3HKSA 1YJWT 2RI2A 3CC4A 2HQXA 4FL6A 2JVVA 5J26A 1QVGS 2JNGA 2LVMA 2X4YA 1K9MC 1VQ6T 1Q86U 4BE2A 3CEYA 2RHUA 3OB9A 3OYJA 5M9OA 1JJ2S 1SSFA 1KD1U 2BIVA 1Q81C 1M90C 1WGSA 1VQ4A 3CMAA 2L8DA 5FLXE 3META 1YITA 3S3NA 3CXCS 4B9XA 2FHDA 1M1KC 4C5GA 5DLQE 4N4IA 3OS2A 2EFIA 3ER0A 2X35A 2OTJA 1QVFA 3DB3A 2DAQA 3L2VA 3OYYA 3CMEA 2GFAA 1VQOT 3OW2S 2R58A 3FEOA 4GY5A 5IAYA 1G5VA 3CCSA 3CCET 3S3OA 3LLRA 2X4XA 2X4WA 3UWNA 3G71T 1WJRA 2RHIA 3LH0A 1M1GA 3O8VA 1YI2A 2R5MA 4A4FA 4E7HA 5KE2A 1YJ9A 3OQ5A 1YHQA 3DB4A 1YIJT 1VQPA 1YJNA 1VQ7A 1BKBA 1S72T 4C5HA 4ZN3A 2QQRA 5HY6A 3FC3A 1VQ5T 2EQMA 3PMIA 3P8DA 4NS5A 4QW2A 1NZ9A 2L89A 3CPWS 3LYIA 3I56T 2LCLA 4OVAA 2XDPA 2LCCA 2MWPA 1K73C 2EQKA 2NLUA 2E5QA 4IURA 3G6EA 1VQLA 2QA4T 1N8RU 4C5EA 2KDSA 2M1HA 3KUFA 3CCUT 1YJWA 1Q82U 4PLIA 3TREA 2M0OA 4QQDA 1NJIC 2QQSA 2WACA 3PIPA 2F5KA 1VQ9A 1VQ6A 4B9WA 5FRNA 1Q7YC 1MHNA 3EAEA 1K8AU 4Z02A 1W2BA 4A4GA 2KVQG 4IUUA 3G4ST 3CCVT 4BDYA 2RJFA 3L2RA 2QEXT 3F70A 4BE0A 4BD3A 2JUFA 1VQNT 4IUTA 5D6XA 2E6ZA 4L59A 3LGFA 3SD4A 2RHZA 3MP8A 1VQOA 4HCZA 3I55T 2VYTA 4BDZA 3OS1A 4QQ6A 3UT1A 3G71A 1N27A 3GOXA 2B8AA 4LD6A 1H3ZA 2OTLT 3L2UA 1QVFS 3OA6A 1VQMA 3CCQT 2EQJA 5C0MA 1KC8U
chains in the Genus database with same CATH superfamily
4BI8B 2EQUA 3QWYA 1WHKA 4OB2B 5IN1A 3CMAT 5IT9E 2QK0A 1YIJA 3CCMT 1OI1A 2AKKA 2EIFA 4A4HA 1S72A 4M77G 2FPEA 4GLMA 3ULRB 1M8MA 1MNEA 2AK5A 4J8OA 1BCMA 2DNUA 2CYZB 2ZPEB 2E10A 1PHTA 2MYSA 1NEBA 2X9HA 1Z9QA 2A37A 2H3JA 1WHJA 2EKOA 3TQ7P 1BU1A 2LQWA 1GFDA 5D6WA 1HSQA 2DXBA 4QVCA 1M2OA 2CP5A 3V8JA 4E7ZA 5CKFA 4XK8E 5GAN7 2YUPA 2RA2A 2XDBA 3ASKA 4A53A 1KQSA 5ECAA 1E7OA 3LWIA 1U1SA 1TOVA 2CH4A 4XU3A 4M7AG 4HCCA 3BFMA 3DLLA 4OGCA 2EWNA 3GNGA 1Y07A 3J80E 1FX7A 2M0YA 5EC7A 1M3AA 3LX7A 3EGDA 2EYXA 1K73R 1H8KA 1T0JA 2CS7A 2JOYA 3OYCA 2L3RA 2COYA 2AKLA 2YRVA 3A5ZB 3TEEA 1C6VX 5J3BA 1XTDA 1KK7A 4M7DE 5CIUA 1BIBA 1FMWA 5CAIA 4QQGA 3OY9A 4M75G 2Y4YA 4N4HA 4IUQA 2RHYA 4PL6A 3L2WA 1SRLA 2FZGB 3KBGA 4QVZA 2CREA 2GQVA 3V7CA 1WZOA 2F2VA 2NWMA 1Z9ZA 1YFNA 1N9RA 4J6XA 1Q81U 1NG2A 2JN0A 3LGLA 3GIBA 1JU5C 4FYYB 1JQQA 4MDWA 2ED1A 3EGDB 3RESA 3OYBA 5J39A 1VQKA 4HT9A 3FLGA 4OMOA 1M1KU 2CP3A 2HQEA 3SEMA 1RI0A 3QBYA 3ZL7C 4TVRA 4C92F 2XMFA 3ZBDA 4KT0E 3S3MA 1VQ4T 3T9NA 4XTZA 3LWHA 1QP3A 1KC8C 1J3TA 5I22A 1PD1A 1E6HA 2JTFA 5A0DA 5IH2A 3BDLA 3CC2A 2VXFA 2KRMA 3M55A 1KQ2A 1UHCA 5LJ5g 2ED0A 2DRKA 2ZPBB 2ECZA 3JCMd 2J05A 4LDVA 1NLPC 1M1FA 4YTLA 4F14A 1YI2T 2IG0A 2X3WD 1SKUB 4IUVA 4ZNXA 3TCJA 2PQWA 4JZ4A 1OZ3A 1ZSZC 1KQSS 4AFZC 4PFOA 5KCOA 3CPWA 1GCPA 5DM7R 3PNWC 3M54A 3ME9A 1W1FA 5LJ3d 4LUEA 3OMGA 2GF7A 3LW5E 1I8FA 2HKQB 2D8JA 3FIFA 4M7AF 4RKUE 2DTIA 1H92A 1RAIB 1X27A 3QIIA 1NJIU 1KJWA 1BIAA 2RI5A 1VYVA 3NTHA 1Q82R 3H41A 1WYXA 4JPBW 4E6RA 2MWOA 4JUVA 2D0QB 4L6V5 3NTIA 2DK3A 4Y92A 2DE0X 4ZTFA 5LJ3j 4J7FA 2DTOA 2RJDA 2QGGA 2JZ2A 4BUGA 4PJOE 2VC8A 1LOJA 3HKSA 4Z8AA 4E47A 5IXFA 1VQNQ 2HQXA 2E1HA 3EH1A 2HSPA 5J26A 1LJOA 2KGTA 5KYUA 4PFZA 1R77A 4M75F 4RTZA 4C92C 2JTMA 1WXUA 1FWZA 1WHLA 2LT1A 1Y57A 2DRMA 4RTUA 4XTUA 2KYMA 2BIVA 4J83A 2W0ZA 1WGSA 2M51A 3QO3A 1LCKA 3MHXA 2O01E 5CKBA 3JCMJ 4B9XA 4C0GA 3CCEQ 3RKYA 3AT1B 2YXYA 5GAOp 3OS2A 2X35A 2HMAA 1G8XA 4KUIA 2OTJA 1Y96A 3L2ZA 1GFCA 1QVFA 2DAQA 2DFUA 2VXEA 3OYYA 3CMEA 1MGQA 3NGPA 5IHIA 1VQOT 4AMCA 2OAUA 2KEAA 2D8HA 3CCET 1X6GA 2LJ1A 3LLRA 2X4XA 2X4WA 3UWNA 5GMKj 2DJZA 3M4YA 4IIMA 4OMNA 1KIKA 2AT1B 5KYUB 1K9AA 3EFOA 4DBFA 1ZUKA 1NLOC 3A8MB 3DB4A 2J06A 3CCJQ 3THKA 1KQSP 2GCXA 1VQ7A 2HBWA 4M7AC 1GCQC 4ZN3A 2ZPGB 3H0HA 2XD0A 1HXDA 1VUBA 5HY6A 2KQWA 1WX6A 3PMIA 4ANJA 5I2MA 1SRMA 1SSHA 1G3WA 2L5QA 2VB6A 4IIOA 3CPWS 1Y96B 3M57A 2L3PA 1ZX6A 2EYZA 3V8KA 1W6XA 1WLPB 4OVAA 2BZXA 1TH7A 2NLUA 3HTRA 3QYHB 4JS4A 3L1AA 1VQLA 2RK2A 4FSXA 2LX7A 2M9UA 4ZGEB 4PLIA 3TREA 4M75C 5L23A 1IRXA 2OAWA 3EFRA 3EFOB 2QQSA 2O9VA 3PVQA 3R6OA 2DKGA 1OU8A 3CCVT 2DILA 4BDYA 1AOJA 4OMPA 3X25B 3L2RA 1QW1A 2JUFA 1TS9A 5A0LA 2EVRA 2QYZA 3EG9A 4EMKC 3VRZA 4DQ2A 2NUPA 1OEBA 2ROTA 4F04B 4RMOA 1Q81R 2RHZA 1GRIA 3GNFB 2VYTA 4FW2A 4D8KA 4ZGDB 1YITQ 2PVDB 2BZYA 1YNZA 4FIBA 4LD6A 1M1KR 1QVFS 1B34A 4F7UG 3QSUA 2EQJA 4M4ZA 2V1QA 5GAMg 3HFOA 2V8KA 2KE9A 3MO8A 3HPWA 1UG1A 2JJ9A 4OMQA 2CZ6B 4ESRA 4Y28E 1KG1A 1OX9A 2LDMA 2LQKA 2J6FA 3OYNA 1AVZC 1VQ5A 1QQJA 1GCQA 4M78G 4IKFA 2LTOA 3JB9G 3CC7Q 4F17A 3M0PA 3EG9B 1BI1A 2G3RA 3I56A 1YHQQ 1WI7A 2NUPB 1WNLA 3KXTA 3CPWP 3EGUA 4FT4A 2L0AA 4BACA 4C8QG 1VQPQ 1YJNQ 2IVWA 2M02A 1M4ZA 2A36A 1ACMB 2NUZA 2LC4A 3CC7T 2D9TA 4AG2C 2P4RA 3CD6A 2QGFB 4GBQA 1C0MA 1YHQT 1B34B 3JCMf 4V2SA 4ZN1A 1VQPT 1WHMA 2D1XA 2CP7A 3A98A 1VIEA 4C0ZA 3G6EQ 3S6WA 3WVEB 2CZ7B 4C92E 1IXDA 2F1LA 4HVVA 5LL6S 7AT1B 3N5BB 3CCRQ 1NJIR 2RJEA 2O88A 2QEXA 5LJ3f 2LJ0A 2KSSA 4R0KA 1W70A 4Q5WA 1BI3A 2E4HA 4IUPA 1X2KA 1VQ8T 1RL2A 4VUBA 3CC4Q 3J7AF 4M7DA 2IIMA 2KBTA 1OX8A 5GANh 1QVGA 2J6OA 3CCRT 3I55A 1E6GA 1H641 4M7DD 1HYOA 2DXTA 1QCOA 4E7LA 3UA6A 3OYGA 3J81E 2GBQA 3C94A 1V1CA 2OTLA 3CC4T 3VUBA 1C1AA 1NM7A 3L2QA 1SG5A 3PMTA 2MF2A 2HQHA 3CXCA 2BE7D 4J9EA 3CCMA 3E9FA 3EG3A 5D7UA 1MMNA 2EQIA 4DBQA 3VS3A 1UE9A 2V8JA 1IHVA 5EG2A 2K5LA 4J9BA 1VA7A 2EKHA 1QKWA 3CBOA 4M7AE 8AT1B 3QKJA 4J6WA 3OW2A 3I5RA 2CP6A 3E2UA 3M0QA 2EW3A 3CCSQ 4E7KA 2YLBA 3X28B 1QMCA 4M7DB 2FVUA 1YIJQ 1ZBXA 3QYGB 1IHWA 3JRZA 5LJ5d 3OYKA 1OZ2A 5I21A 1NBEB 3VYGA 4J9CA 2GNCA 3EHQA 1ZQ1A 2MPXC 1D0YA 4B6MA 2GGRA 3CCST 3I5SA 2F2XA 2SEMA 4M78F 2CSQA 3A8LB 3NPFA 4KGXB 2ABLA 1I1JA 3JB9F 1UEBA 2AIRB 4M75E 3CCUA 4E7SA 4AG1C 1VOMA 4HVWA 5LJ5j 1RACB 1M30A 3RBBB 3VU3C 4C8QF 5FRMA 3WVDB 1LNXA 2CDTA 4PLLA 2RB6A 4FU6A 2WSCE 2ZPHB 5GMKi 1TU0B 3VS1A 3JCMP 2DPPB 2YUQA 3HL8A 2JT4A 2MIOA 3TSWA 3FRNA 3LH5A 1UECA 1YJWQ 4UC4A 2LCSA 2P0QA 2CUBA 2X4JA 5FU6C 3JCMe 4DBRA 1X69A 1K8AC 2QASA 1VQ6Q 4J9IA 1Q7YU 1ABOA 1ZUYA 3OBWA 2K5FA 2J7IA 2A28A 3OYFA 1T3LA 1YJWT 3QG1A 4KH1B 4PNOA 4OB1B 1BI2A 4WTOB 4OMMA 2PTKA 4FL6A 1RADB 4C0FA 1M3BA 1QVGS 2COZA 5LJ3e 2LNHB 2F5TX 2LVMA 4PJOA 1K9MC 4X1VA 1VQ6T 1Q86R 4ORZA 2DF6A 4BE2A 9ATCB 5AYFA 4L5GA 2JW4A 2KR3A 2CSIA 2JM8A 1PCXA 1KD1R 1AWXA 4PJOD 4CI0C 2NYSA 1M90C 2FZCB 4Z89A 1B3QA 1VQ4A 5FW9A 3UATA 2L8DA 5FLXE 1QVPA 3X20B 1PNJA 3VJPA 2DD4A 3CXCS 4OGEA 2KRSA 4PJNA 1UFFA 1D0XA 2DETA 1WA7A 1VQKQ 4PK4A 1TWBA 4HXJA 2BE9B 1TUCA 2DL5A 1GXIE 4M78C 3OW2S 4OP0A 2KK4A 2R58A 1WQWA 5IAYA 1G5VA 2RHIA 1WJRA 5CR2A 3LH0A 1M1GA 3FB9A 4M77F 4C8QC 1YI2A 1RAGB 2R5MA 1D0ZA 4PJOB 4E7HA 1G83A 3M53A 4A63B 2HD0A 5GMKe 4CC7A 2FRYA 2MMPA 4LD9K 3JB9I 3FC3A 4Y91A 2YHTA 2QA4Q 5CKHA 1RLQC 1X43A 3REBB 1N5ZA 2C06A 1GBRA 5HKCA 2DBKA 1WQ7A 1R0BG 2EJ9A 4FYXB 2LCLA 3RMSA 2O9SA 4WF2A 2XDPA 1YN8A 1K73C 2JMAA 3FJPA 3QWXX 4MMLA 2QA4T 4MZMA 1N8RR 1O9SA 3EFSA 3M0RA 1RI9A 5GAOn 3WXMB 2M1HA 3GF5A 4NOYA 3G4SQ 3MCAB 2I0NA 2CH4W 2DTHA 4N0AC 4FW1A 4J9GA 2CT3A 1YP5A 2V1RA 1VQ9A 1QVGP 5FRNA 4BY6C 1PC0A 1K8AU 1W2BA 1X01A 2LQNA 3G4ST 1R0CB 5DLOA 4JZ3A 2VVKA 2QG9B 2VV5A 4RCCA 2RJFA 2ZPFB 4F16A 1JEGA 3QDRB 1MMAA 1G3YA 3AHUA 4BD3A 1TG0A 4RG8A 1Y0MA 1VQNT 2DL4A 3M58A 3A8HB 3H0FA 5D6XA 3ZFJA 2HZYA 3VS7A 3VS4A 1QP2A 4RTTA 5CO7A 2OJ2A 1O75A 3CCQQ 1B7TA 5FU6B 3TU4K 3MP8A 1VQOA 3VYHB 1M9SA 4BB7A 4M77C 3OW2P 1OPKA 4M78A 1WPYA 1N27A 3GOXA 2KXCA 4GLKA 2HDAA 3UDCA 4KGZB 1Y7XA 1VQMA 5GAMd 3CCQT 3OS5A 2OTJQ 1IO6A 2C0TA 1KC8U 5GAOm 2R57A 4XAXB 2GQIA 2GTOA 4O6JA 3JCMh 2DEQA 4PJMA 3PIOA 1IGQA 2LJ3A 1M2VA 4JRPA 4FT2A 2RHXA 1IGUA 1VYUA 2RPNA 1FMKA 3FDRA 1TXQA 2LQ8A 5GAMj 1ZSZA 2QDLA 2HNIA 1UJYA 3MP6A 3DKMA 5LJ3h 1K0XA 2E5KA 2Z0WA 3U23A 4A4EA 3OSSC 3MEUA 3CCJT 5LJ5f 4M78B 2RQTA 2D6FA 1I4K1 4NL2A 1D3BA 3P8BB 4LDWA 4X9DA 2CUDA 3OYMA 2E6NA 4KUDK 1T0HA 2QXFA 4OMLA 3VS5A 3MEAA 1K73U 1WXTA 1WDXA 2J6KA 4K11A 2SRCA 2FRWA 1VQLQ 1M2VB 1Q82C 3CCVA 3OYAA 1K1ZA 4EPCA 2K3BA 2I2LA 3CCLQ 2DZ9A 2C0IA 2KT8A 1PKSA 1ZSZB 4C92A 3JCMQ 2AHJB 1W2BS 2KXDA 1Q7YR 4RCBA 2FPFA 3V7RA 4C92D 4D6WA 1G3TA 2QTVA 4JLIA 3GPLA 2ATCB 2CKKA 4ELZC 3CCLT 2DIGA 1TUGB 5GMKh 1U06A 3TSZA 2E41A 5KYWA 4C0DC 4OB0B 2HCKA 1D3BB 4II1A 2E65A 1D1BA 2P4TA 4M78E 2KNBB 5KYYA 1QCFA 2PNIA 2P84A 4M77A 3CPFA 1EFNA 4C5IA 4EDUA 1PSEA 2PVOB 1NYFA 3PGGA 4EIKA 4C8QE 3HHTB 3SHWA 1T3SA 3D7SB 2EGAA 2PUOB 1AD5A 1UGRB 2L3QA 3OYLA 5D6YA 1JO8A 3MJXA 4C92B 1IREB 5GMKl 1NPRA 1RLPC 3PTAA 2JS2A 1YITT 4LDYA 1WXBA 4E7JA 4QVDA 2O4XA 4XU1A 1OPLA 1RAFB 4DBHA 2VKNA 4RG2A 1FYNA 8ATCB 4M7AA 1AWJA 2BZ8A 5GANj 1AZGB 3MP1A 2RI3A 5GAN3 1YJ9Q 5KYWB 2E3HA 4M7AD 1P92A 3A8GB 1IB8A 5I11A 4J9FA 3CC7A 2P0PA 4ZTJA 5KYYB 2K4YA 1FMVA 4M77B 4HT8A 2GTJA 2YDLA 2QDYB 4ATOA 1Q95G 3I56Q 2ESWA 1DJ7B 4A54A 1YJ9T 2RD1A 2JTEA 1FXXA 1BB9A 1UGSB 1I0CA 5CVIA 4Z88A 3MEVA 5KH6A 3RDVA 1YJNT 1PD0A 4M75A 2F69A 3M0UA 4LUDA 1XJWB 3NHNA 1YBYA 3CD6Q 2DXUA 4PJLA 1ZA1B 4M75D 3OSVA 5FWBA 5LJ5e 1CKBA 1EIFA 2O4XB 1HJDA 2PUKB 2DM1A 1VQ8A 1PM3A 4M7AB 1U5SA 3URGA 4E2FB 3L42A 3JB9H 1XNIA 1YCSB 4OMFB 2DJQA 3CCRA 2K5IA 4LDXA 3CD6T 3G6ET 1WJQA 3UPUA 2DO3A 2FEIA 2JXBA 1VYTA 2K2MA 4BE1A 3C4SA 3RUXA 4JRKA 2LT4A 3EG0A 2RI2A 4M77E 4EMKA 3M59A 3CC4A 3JCMW 2JVVA 3HRUA 1AEYA 2JNGA 4MDXA 3MKDA 3RKXA 4AFSC 3QDFA 3CEYA 1AHJB 2E3IA 3I55Q 2RHUA 2RNAA 4J9DA 4M75B 4HA8A 5M9OA 5IXBA 4AFQC 1QVFP 3H0IA 1Q81C 2IPOB 3CMAA 1UB4A 4JJDA 4QKUA 1AWWA 1KSWA 2OTLQ 1BCOA 2JM9A 3META 3S3NA 5HK3A 5GMKm 4LXCA 2HEQA 4DA4A 5GANg 1A0NB 5I2SA 4C5GA 1M1KC 2KY9A 3M56A 3G71Q 3ER0A 3CCMQ 2WSEE 3DB3A 4JJBA 3L2VA 3VKIA 4F7UF 5KYNA 2E12A 3RNJA 2HSEB 1BI0A 1X6BA 1X75C 2V26A 5CKDA 1X2QA 2HKNA 4HVUA 1KC8R 3CCSA 4C0DB 4EMKB 1MMDA 1S72Q 3G71T 2H3EB 2DD5A 3O8VA 4JLGA 2YRDA 1M8VA 5KE2A 3OQ5A 1MNDA 2KT1A 5GAN6 2EBPA 2DYIA 4LDUA 5GAMf 2RK1A 4AFUC 2XKOC 2X51A 2YUNA 1YIJT 1AZEA 2MK5A 1QWFA 4XTYA 2KI7A 2MAMA 1PRLC 1BKBA 4C5HA 2A0FB 1S72T 4KH0B 2COWA 2QQRA 1UDLA 2EQMA 3HFNA 3P8DA 3A1PA 2ZCFB 4NS5A 4QW2A 2L89A 3CCUQ 4A4KA 2DL7A 4XQ3A 3QPHA 3RKWA 3FJ5A 2O31A 4J6YA 2A08A 2LX9A 3C0CA 2K7AA 2MWPA 1ARKA 2KMTA 4IURA 2E5QA 4MZTA 4DEXA 2YSQA 4XTWA 2KDSA 3X24B 3CCUT 2OI3A 1YJWA 5HCKA 1BBZA 1SEMA 2M0OA 4EMHA 2RQUA 2DEUA 1NJIC 1G3SA 3C12A 3RR6A 3INZA 2XU8A 2WACA 5KYXA 1D1AA 1VQ6A 4B9WA 3EAEA 4IUUA 2FPDA 2OX7A 2AZSA 2C0OA 1N9SA 4KBMB 3OBYA 1RAAB 1GBQA 2HL5C 4XTVA 4FYWB 3EG2A 2XICA 3RERA 3F70A 4BE0A 1VIFA 2RMOA 4ME7A 5GAN2 4HCBA 3G1JA 2QQAA 1NEGA 2E6ZA 3M5AA 2KROA 3LGFA 3VS2A 1GL5A 2XG8D 3SD4A 4HCZA 3JCMV 1VQ4Q 1WHGA 4FCYA 3NMZC 3GBQA 4QQ6A 4RTVA 2D0NA 1G2BA 5IHNA 3UT1A 2ZZDA 2QI2A 4JS5A 2MOXA 2B8AA 1SHGA 4WCIA 5LJ5h 3VV0A 3L2UA 4M7DG 5L8RE 4HKEA 1UGPB 5KYXB 2LNVA 3RMQA 5C0MA 1UHFA 3HRTA 3H8ZA 2DL3A 2DERA 1VQKT 2MI6A 2FO0A 1I5OB 3SFMA 3QUIA 1PG5B 3CC2Q 5CKEA 5GAOl 2NUTA 4KRTA 2DYBA 1K0SA 5KE3A 5GANf 4EMGA 1MV0B 1RABB 2RJCA 5AT1B 4MZPA 2BKDN 2KAFA 4P5NA 1ZHIA 1YI2Q 3MEWA 2RF0A 2A3LA 2DMOA 1KFZA 2PVGB 3CC2T 3QZ9B 3PFSA 4KULA 3JB9J 1NPPA 2LMJA 1JRIA 5CCAA 2RN8A 3E9GA 2QA4A 4XTXA 5GAMe 2LRQA 2Y90A 1M5Q1 2FYKA 1XQHA 1OYXA 1ABQA 1ZLMA 2B86A 2CT4A 2YT6A 1SF9A 2H8HA 2EYYA 2AZVA 3Q1JA 1IZ6A 3OYHA 5GAOq 2FL7A 4CC2A 1MUZA 4D8DA 2K3YA 3DLMA 1OULA 3OYDA 2E64A 3REAB 2XDDA 1BK2A 5DY9A 2DLPA 2NUTB 3IQLA 4PJJA 3G4SA 3VS6A 4O5VA 3NFCA 1I07A 3OS0A 4DEYA 1RAEB 1I81A 5C6SA 3MPUB 1D09B 2QAZA 1OQKA 3GP8A 1VQNA 3PT9A 1VQ9Q 1KHCA 1ZUUA 2E70A 4KGVB 2PZ1A 4F7UA 1N6AA 1Q86C 1H3HA 3CXCP 2DVJA 3QJ6A 1K9MU 3SB2A 5A2QE 2BUDA 2RO0A 3EH2A 1KD1C 5CQYA 3M0TA 2QQBA 1HK9A 1JJ2A 1VQ9T 1M90U 1UJ0A 2YLCA 2M16A 2FG0A 3CCQA 5FU7C 5FROA 1OV3A 3CCEA 4J5YA 5IHKA 3P8HA 4QT7A 2R5AA 1YWPA 2ROLA 2MCNA 1JB0E 1RUWA 1VQOQ 1JBMA 2W10A 4M78D 3EGXA 2P0KA 2DX1A 1WIEA 3JB9D 3CMEQ 4C8QA 1PRMC 2XK0A 4PJOG 4E7IA 1K76A 1VQMQ 2VUBA 2FB7A 4N4GA 4M7DF 2KYBA 2GFUA 4C8QD 1YCYA 5KCHA 4X34A 3R6NA 3SWNC 2QQ9A 3OMCA 2OTJT 1KHIA 4F7UB 2DIQA 4RTWA 1PKTA 2CZ1B 5GAN4 1TUDA 3JCMc 4HCKA 3CMET 1V76A 3EG1A 2QTXA 3CCJA 2G6FX 2V8IA 1W4SA 3NTKA 1VQMT 1U8RA 4X9CA 3HRSA 3OYIA 1XOVA 1WJSA 1VQ7Q 3GLXA 2RM4A 3JCMg 2LZ6B 3UA7A 5GANe 5CK9A 3E1SA 2WSFE 3I9QA 3M9QA 1QCNA 2K3XA 4DOWA 2XI9A 4MMKA 2X3XD 1X6OA 1WFWA 3O5ZA 3JCMX 2VWFA 3EGXB 3E19A 3V7SA 1VQ7T 4N0AA 4C8QB 1N8RC 1U3OA 4CRIA 5LJ3g 3QZ5B 2XHCA 2CGHA 3QXEB 2RQRA 3KFVA 2K2VA 2CZ0B 1UGVA 1U1TA 2CP2A 1HD3A 2L3SA 4LN2A 4OF1A 5A0GA 4F7UE 3JAME 3CCLA 3CCVQ 1UGQB 2EGEA 4OB3B 1EX4A 1VQLT 2RQWA 4NL3A 2K79A 3OYEA 1QKXA 3H6ZA 3SDZA 3ZEHA 1LPLA 1D1CA 4J9HA 4ELYC 4FSSA 2XIDA 1ZSGA 2CP0A 2LP5A 1RAHB 1M3CA 2EJGA 1F1BB 2EGCA 2X4YA 3HP9A 1ZBJA 1Q86U 3VUZA 4R56A 5GAN8 1EZZB 3OB9A 3OYJA 1JJ2S 1SSFA 1KD1U 5GAMh 4M77D 3PE0A 4RTYA 4M7DC 3VRYA 1UUEA 3UF4A 2DA9A 4JRQA 3JCMb 4JJNK 4R55A 4RTXA 1YITA 4BY6B 2JMCA 4PFPA 5GANd 1TTHB 3BE3A 1S1NA 3A8OB 1KQ1A 1Y71A 3JV3A 2FHDA 4JJCA 3V8LA 5DLQE 4N4IA 1QWEA 2EFIA 1QLYA 5GJWB 3SWNA 2ZAEA 1R8OB 2L2PA 1OU9A 2GFAA 4LNPA 4FYVB 3FEOA 4GY5A 1B07A 4XU2A 2DL8A 3S3OA 4PKCC 4PJOF 4DOVA 1VQ5Q 4A4FA 1YJ9A 5FU7B 4BI3A 3CBMA 1BYMA 5GJVB 1YHQA 1SPKA 2VGNA 2BTTA 2RH2A 1VQPA 1YJNA 2PU9B 2A7YA 2DVEA 3HSBA 1JXOA 2DZCA 1VQ5T 3CQTA 3M0SA 2DXCA 4FM4B 1PSFA 1NZ9A 3RIRA 2RQVA 1WHHA 3LYIA 3BW1A 4XU0A 3I56T 1AWOA 2JS0A 3BDUA 3SWNB 3PVLA 4ZGJB 1LVKA 2YWWA 2LCCA 4AT1B 2EQKA 3G6EA 5FWCA 1CKAA 2VGMA 1N8RU 1W2BP 4C5EA 3KUFA 3VS0A 3TVTA 2EJFA 1Q82U 1MMGA 1OOTA 4CC3A 4QQDA 2ZPIB 4CC4B 1PWTA 4LE9A 5CQXA 1VQ8Q 4RUGA 3I35A 2Y4XA 2QEXQ 2F5KA 3PIPA 1NYGA 2DBMA 1MHNA 2HBPA 1Q7YC 2HAXA 1K8AR 4Z02A 1ZA2B 4A4GA 2KVQG 6AT1B 2FZKB 2F2WA 2K9GA 2ZGWA 3X26B 1JJ2P 3C95A 1I5LA 2HL3A 1TSFA 4J7IA 4JDSA 2YRCA 2YUOA 5HK0A 1UTIA 2K57A 5GAN5 3JSCA 2QEXT 2ENMA 2EYQA 3M4GA 2EYWA 1K9MR 4IUTA 1YWOA 4JRIA 5GAOr 2O2OA 1MV3A 2EAYA 1SHFA 1JXMA 3H9NA 4L59A 1V29B 1K4US 2KRNA 1M90R 3EHRA 3CBPA 4BI4A 4C92G 1AT1B 3I55T 4PJOC 1CSKA 3CMAQ 4BDZA 3OS1A 3BY7A 3QJYA 2VASA 3QHSA 3G71A 2EPDA 1H3ZA 2OTLT 1M27C 2K6DA 3OA6A 3G7ZA 1NE8A
chains in the Genus database with same CATH topology
4BI8B 3HFOA 2EQUA 5GAOm 2V8KA 2R57A 3H8ZA 3HRTA 3HPWA 3MO8A 4OB2B 4XAXB 5IN1A 3CMAT 5IT9E 4O6JA 3JCMh 1YIJA 1VQKT 3CCMT 2MI6A 2DEQA 1OI1A 3SFMA 2EIFA 3QUIA 3PIOA 5CKEA 4A4HA 5GAOl 1S72A 4M77G 2CZ6B 4Y28E 4JRPA 4FT2A 1KG1A 4J8OA 2RHXA 5KE3A 2LDMA 5GANf 2LQKA 3OYNA 4EMGA 1VQ5A 2CYZB 2ZPEB 2RJCA 2E10A 4MZPA 4M78G 2BKDN 2KAFA 3FDRA 4IKFA 2LTOA 1ZHIA 2LQ8A 4P5NA 5GAMj 3JB9G 2H3JA 2EKOA 3MEWA 2A3LA 1BI1A 2PVGB 3CC2T 3QZ9B 2G3RA 2HNIA 3I56A 3MP6A 3PFSA 3DKMA 1WNLA 4KULA 5LJ3h 3KXTA 5D6WA 3JB9J 1NPPA 2DXBA 4FT4A 4A4EA 4BACA 3OSSC 4C8QG 1JRIA 4QVCA 3V8JA 5CCAA 2IVWA 3E9GA 1M4ZA 5CKFA 2QA4A 4XTXA 5GAMe 4XK8E 2LRQA 5GAN7 3MEUA 3CCJT 2Y90A 1M5Q1 2RA2A 5LJ5f 2FYKA 1XQHA 2LC4A 1OYXA 3ASKA 2XDBA 4M78B 4A53A 1KQSA 2D6FA 1I4K1 4NL2A 1D3BA 3CC7T 2D9TA 3P8BB 3LWIA 1U1SA 3CD6A 4XU3A 4M7AG 1YHQT 1B34B 3BFMA 3DLLA 3Q1JA 4HCCA 1IZ6A 3OYHA 4OGCA 2EWNA 3JCMf 3GNGA 4LDWA 5GAOq 4V2SA 1Y07A 2FL7A 4X9DA 3OYMA 2E6NA 4ZN1A 1VQPT 4KUDK 3J80E 1FX7A 2QXFA 2K3YA 3DLMA 3OYDA 2E64A 3LX7A 3MEAA 2XDDA 1K73U 1VIEA 2CS7A 4C0ZA 5DY9A 3S6WA 3WVEB 3G4SA 2JOYA 2CZ7B 4C92E 4O5VA 1Q82C 3OYCA 3CCVA 3NFCA 3OYAA 3OS5A 2L3RA 3OS0A 5LL6S 4EPCA 2I2LA 2YRVA 3A5ZB 3TEEA 3N5BB 2DZ9A 5J3BA 1I81A 2RJEA 5C6SA 1XTDA 2QEXA 5LJ3f 4C92A 3JCMQ 2KSSA 4M7DE 3GP8A 4Q5WA 5CIUA 1BI3A 1BIBA 1VQNA 2AHJB 5CAIA 1W2BS 3PT9A 4QQGA 4IUPA 3OY9A 1VQ8T 1KHCA 1RL2A 2E70A 4M75G 4RCBA 3V7RA 4VUBA 4C92D 4D6WA 2Y4YA 4N4HA 4IUQA 1G3TA 4JLIA 2RHYA 4PL6A 3J7AF 4M7DA 4F7UA 3GPLA 2CKKA 4ELZC 3L2WA 3CCLT 1N6AA 2DIGA 5GANh 1Q86C 1QVGA 5GMKh 3CCRT 2E41A 3I55A 3QJ6A 1K9MU 3SB2A 3KBGA 4QVZA 2BUDA 5A2QE 2RO0A 1H641 4C0DC 2GQVA 4OB0B 1D3BB 4M7DD 4II1A 3V7CA 1KD1C 5CQYA 2E65A 2DXTA 4E7LA 2P4TA 2QQBA 1HK9A 3OYGA 4M78E 1N9RA 3J81E 1JJ2A 1VQ9T 3C94A 4J6XA 1Q81U 1M90U 2JN0A 4M77A 3LGLA 2OTLA 3CPFA 2YLCA 2M16A 3CC4T 4C5IA 3GIBA 3VUBA 3CCQA 4MDWA 4EDUA 5FU7C 5FROA 3L2QA 3CCEA 3PMTA 4J5YA 3P8HA 1PSEA 3OYBA 2PVOB 3RESA 2MF2A 2R5AA 3PGGA 5J39A 3CXCA 4C8QE 1VQKA 4HT9A 3CCMA 3HHTB 3E9FA 3FLGA 1JB0E 1M1KU 1JBMA 2HQEA 2PUOB 1UGRB 1RI0A 3QBYA 4M78D 4TVRA 3OYLA 5D6YA 4C92F 2V8JA 2P0KA 4KT0E 5EG2A 3ZBDA 2K5LA 3S3MA 3JB9D 1VQ4T 3T9NA 3CBOA 4C8QA 2XK0A 4C92B 1IREB 5GMKl 4XTZA 1NPRA 1QP3A 3LWHA 3QKJA 4PJOG 4M7AE 4J6WA 3OW2A 3PTAA 1KC8C 1YITT 4LDYA 4E7IA 2VUBA 2FB7A 4N4GA 4M7DF 4E7JA 2JTFA 2GFUA 5A0DA 4C8QD 1YCYA 3BDLA 4QVDA 2O4XA 4XU1A 4E7KA 5KCHA 4X34A 3SWNC 3CC2A 2YLBA 3X28B 2QQ9A 2FVUA 3OMCA 4RG2A 4M7AA 4M7DB 1KHIA 4F7UB 1ZBXA 2VXFA 2DIQA 3QYGB 2OTJT 3M55A 1KQ2A 2CZ1B 5GAN4 3JRZA 3JCMc 5LJ5d 3OYKA 5GANj 3CMET 3MP1A 1OZ2A 2RI3A 5I21A 5GAN3 5LJ5g 2QTXA 3VYGA 3CCJA 4M7AD 1P92A 2V8IA 1W4SA 3NTKA 1VQMT 2ZPBB 1U8RA 3A8GB 1ZQ1A 4X9CA 3CC7A 2P0PA 4ZTJA 3HRSA 2K4YA 3OYIA 3CCST 4M77B 3JCMd 1XOVA 1WJSA 4HT8A 3GLXA 2RM4A 4M78F 3JCMg 5GANe 5CK9A 3A8LB 2QDYB 4LDVA 3JB9F 3E1SA 2WSFE 4ATOA 1UEBA 3M9QA 1M1FA 4M75E 4YTLA 3CCUA 1YI2T 2IG0A 1DJ7B 2K3XA 4IUVA 3TCJA 4A54A 1YJ9T 2RD1A 4DOWA 2XI9A 2PQWA 4MMKA 1FXXA 1OZ3A 5LJ5j 1UGSB 1X6OA 1KQSS 4C8QF 3VU3C 5CVIA 3JCMX 5KCOA 3CPWA 3MEVA 5KH6A 3RMQA 3PNWC 3E19A 5DM7R 5FRMA 1YJNT 4M75A 3V7SA 2F69A 3WVDB 3M54A 1LNXA 3ME9A 1VQ7T 4PLLA 4N0AA 4C8QB 2RB6A 5LJ3d 4FU6A 1YBYA 2WSCE 2ZPHB 1N8RC 5GMKi 2DXUA 4CRIA 3OMGA 2GF7A 3LW5E 5LJ3g 2DPPB 3JCMP 3QZ5B 1I8FA 4M75D 2XHCA 3OSVA 5LJ5e 3FIFA 4M7AF 3HL8A 4RKUE 1EIFA 2CGHA 2O4XB 2DTIA 2PUKB 3FRNA 3QXEB 1VQ8A 4UC4A 4M7AB 2K2VA 2CZ0B 3QIIA 2P0QA 1NJIU 2X4JA 1U1TA 5FU6C 3L42A 3URGA 3JCMe 3JB9H 1BIAA 1XNIA 2RI5A 3NTHA 4OF1A 4F7UE 5A0GA 3JAME 3CCLA 4OMFB 1UGQB 3CCRA 2K5IA 4LDXA 2MWOA 4OB3B 4JUVA 1K8AC 3CD6T 2D0QB 4L6V5 3G6ET 1WJQA 3UPUA 1VQLT 3NTIA 2DK3A 2DO3A 4NL3A 1Q7YU 4ZTFA 5LJ3j 4J7FA 2DTOA 3H6ZA 3OYEA 3SDZA 3ZEHA 4BE1A 3C4SA 2RJDA 3RUXA 2JZ2A 3OBWA 2K5FA 4BUGA 4PJOE 3OYFA 2VC8A 4JRKA 2LT4A 1LOJA 3HKSA 1YJWT 3QG1A 2RI2A 4M77E 4E47A 3M59A 4PNOA 4OB1B 4ELYC 4EMKA 1BI2A 3CC4A 2HQXA 4FL6A 2XIDA 3JCMW 2JVVA 3HRUA 4C0FA 2E1HA 5J26A 1QVGS 1LJOA 2JNGA 2EJGA 5LJ3e 2F5TX 2LVMA 4M75F 4C92C 4PJOA 2JTMA 2X4YA 1K9MC 3HP9A 1VQ6T 4MDXA 1Q86U 1FWZA 3RKXA 4BE2A 2LT1A 3CEYA 5AYFA 3VUZA 4L5GA 1AHJB 5GAN8 4R56A 2RHUA 3OB9A 4M75B 4HA8A 3OYJA 5M9OA 4XTUA 1JJ2S 1SSFA 4PJOD 1KD1U 2BIVA 4CI0C 1Q81C 4J83A 5GAMh 1M90C 4M77D 1WGSA 1VQ4A 4M7DC 3CMAA 1UB4A 2L8DA 4JRQA 5FLXE 3JCMb 1QVPA 4JJNK 3QO3A 4R55A 3META 3X20B 1YITA 4BY6B 3S3NA 5HK3A 5GANd 3MHXA 2DD4A 3VJPA 2O01E 5CKBA 5GMKm 3A8OB 4OGEA 1KQ1A 3CXCS 3JCMJ 4B9XA 4DA4A 1Y71A 4C0GA 5GANg 5I2SA 2FHDA 4C5GA 3V8LA 5DLQE 3RKYA 1M1KC 2KY9A 3M56A 4N4IA 3OS2A 5GAOp 2EFIA 3ER0A 2X35A 4KUIA 2OTJA 1Y96A 3L2ZA 2WSEE 1QVFA 2DAQA 3DB3A 3L2VA 2VXEA 3OYYA 3SWNA 3CMEA 3VKIA 1R8OB 4F7UF 2E12A 1MGQA 2GFAA 1VQOT 1GXIE 1BI0A 4M78C 3OW2S 4OP0A 2KK4A 2R58A 3FEOA 4GY5A 1WQWA 2OAUA 5IAYA 1X75C 4XU2A 5CKDA 1G5VA 3CCSA 3CCET 4C0DB 4EMKB 3S3OA 3LLRA 4PKCC 2X4XA 2X4WA 3UWNA 5GMKj 2RHIA 1WJRA 5CR2A 4PJOF 3G71T 3LH0A 2DJZA 3M4YA 1M1GA 2DD5A 3FB9A 3O8VA 4JLGA 4M77F 4DOVA 4C8QC 1M8VA 1YI2A 2R5MA 4A4FA 4PJOB 4E7HA 5KE2A 3OQ5A 1YJ9A 5FU7B 5GAN6 4LDUA 4BI3A 5GAMf 2RK1A 3CBMA 1BYMA 1YHQA 3A8MB 2XKOC 3DB4A 3M53A 1YIJT 2HD0A 2VGNA 5GMKe 4XTYA 2MAMA 2RH2A 1VQPA 1YJNA 2PU9B 2GCXA 2MMPA 1VQ7A 2A7YA 4LD9K 1BKBA 4C5HA 1S72T 4M7AC 3JB9I 4ZN3A 2DVEA 2ZPGB 2XD0A 3HSBA 2QQRA 1HXDA 1VUBA 5HY6A 3FC3A 2DZCA 1VQ5T 2KQWA 2EQMA 3PMIA 3HFNA 4Y91A 2YHTA 2DXCA 3P8DA 4FM4B 1PSFA 5CKHA 5I2MA 2ZCFB 4NS5A 4QW2A 1G3WA 2C06A 1NZ9A 3RIRA 2L5QA 2L89A 5HKCA 4A4KA 4XQ3A 3CPWS 3LYIA 3QPHA 1Y96B 3RKWA 3M57A 3BW1A 4J6YA 4XU0A 3I56T 1WQ7A 3V8KA 2EJ9A 2LX9A 2LCLA 3BDUA 3RMSA 3SWNB 4OVAA 4WF2A 4ZGJB 2XDPA 2LCCA 2MWPA 1TH7A 2EQKA 2KMTA 2NLUA 2E5QA 3QYHB 4IURA 3FJPA 4JS4A 3L1AA 3G6EA 1VQLA 2VGMA 4MMLA 2QA4T 4MZTA 4MZMA 2RK2A 4FSXA 1O9SA 3EFSA 1N8RU 4C5EA 4XTWA 2KDSA 5GAOn 3WXMB 2M1HA 3KUFA 2M9UA 3GF5A 4NOYA 3MCAB 3X24B 3CCUT 4ZGEB 2EJFA 1YJWA 1Q82U 4PLIA 2DTHA 2M0OA 4M75C 4QQDA 3TREA 4EMHA 2ZPIB 1G3SA 1NJIC 4N0AC 3C12A 5CQXA 3EFRA 3INZA 2XU8A 2QQSA 2Y4XA 2WACA 2F5KA 3PIPA 1VQ9A 5FRNA 4B9WA 1VQ6A 4BY6C 1MHNA 2HBPA 1Q7YC 2HAXA 3EAEA 1K8AU 4Z02A 4A4GA 3R6OA 1W2BA 1X01A 2KVQG 4IUUA 3G4ST 5DLOA 2DKGA 2ZGWA 3X26B 3CCVT 4BDYA 3C95A 1N9SA 1I5LA 2VV5A 4J7IA 2RJFA 4JDSA 2ZPFB 4RCCA 4KBMB 3OBYA 3X25B 5HK0A 3QDRB 2K57A 1G3YA 4XTVA 3L2RA 1QW1A 5GAN5 2XICA 3JSCA 2QEXT 3AHUA 3F70A 3RERA 4BE0A 4BD3A 4RG8A 1VIFA 2JUFA 4ME7A 2EYQA 5GAN2 3M58A 3M4GA 1VQNT 5A0LA 3A8HB 4HCBA 4IUTA 5D6XA 3ZFJA 2QQAA 4EMKC 4JRIA 5GAOr 2E6ZA 2EAYA 3M5AA 1QP2A 4L59A 5CO7A 4DQ2A 1O75A 1V29B 3LGFA 5FU6B 4RMOA 3TU4K 2XG8D 3SD4A 2RHZA 3MP8A 4HCZA 3VYHB 1VQOA 3JCMV 3CBPA 4BI4A 4C92G 3I55T 1K73C 3GNFB 4PJOC 2VYTA 1M9SA 4BB7A 4BDZA 4M77C 3OS1A 4QQ6A 4ZGDB 3BY7A 3QJYA 3QHSA 3UT1A 4M78A 2ZZDA 2PVDB 3G71A 2QI2A 1WPYA 1N27A 4JS5A 3GOXA 2B8AA 4FIBA 4LD6A 1H3ZA 5LJ5h 3L2UA 3VV0A 2OTLT 4GLKA 4M7DG 1QVFS 5L8RE 3UDCA 1B34A 1Y7XA 4HKEA 4F7UG 3OA6A 1UGPB 5GAMd 1VQMA 3QSUA 3CCQT 2EQJA 2LNVA 3G7ZA 1NE8A 5C0MA 5GAMg 1KC8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQU A;  2R57 A;  3H8Z A;  3MO8 A;  3CMA T;  5IN1 A;  5IT9 E;  1VQK T;  1YIJ A;  3CCM T;  2MI6 A;  1OI1 A;  3PIO A;  2EIF A;  4A4H A;  1S72 A;  5KE3 A;  2RHX A;  2LDM A;  3OYN A;  1VQ5 A;  2RJC A;  2BKD N;  4IKF A;  3FDR A;  2LTO A;  2LQ8 A;  2EKO A;  3MEW A;  3CC2 T;  2G3R A;  3I56 A;  3MP6 A;  3PFS A;  5D6W A;  1NPP A;  4A4E A;  4BAC A;  3E9G A;  2QA4 A;  2LRQ A;  3MEU A;  3CCJ T;  1OYX A;  3ASK A;  1KQS A;  3CC7 T;  2D9T A;  3P8B B;  3CD6 A;  1YHQ T;  3DLL A;  3Q1J A;  1IZ6 A;  3OYH A;  3OYM A;  4ZN1 A;  2E6N A;  1VQP T;  3J80 E;  2K3Y A;  3DLM A;  3OYD A;  3LX7 A;  3MEA A;  1K73 U;  3G4S A;  3S6W A;  2JOY A;  1Q82 C;  3OYC A;  3CCV A;  3OYA A;  2L3R A;  3OS0 A;  5LL6 S;  3A5Z B;  2YRV A;  5J3B A;  2RJE A;  5C6S A;  1XTD A;  2QEX A;  4Q5W A;  5CIU A;  1VQN A;  1W2B S;  4QQG A;  4IUP A;  3OY9 A;  1VQ8 T;  1KHC A;  1RL2 A;  2E70 A;  4N4H A;  4IUQ A;  3J7A F;  2RHY A;  4PL6 A;  2CKK A;  3L2W A;  3CCL T;  2DIG A;  1Q86 C;  1QVG A;  3CCR T;  3I55 A;  3QJ6 A;  1K9M U;  3KBG A;  5A2Q E;  2BUD A;  4QVZ A;  2RO0 A;  4II1 A;  1KD1 C;  4E7L A;  3OYG A;  3J81 E;  1JJ2 A;  1VQ9 T;  1Q81 U;  1M90 U;  3LGL A;  2OTL A;  3CPF A;  3CC4 T;  2M16 A;  4C5I A;  3CCQ A;  4EDU A;  5FRO A;  3L2Q A;  3CCE A;  3PMT A;  3P8H A;  3OYB A;  2R5A A;  5J39 A;  3CXC A;  1VQK A;  3CCM A;  3E9F A;  3FLG A;  1M1K U;  2HQE A;  1RI0 A;  3QBY A;  4TVR A;  3OYL A;  5D6Y A;  2P0K A;  3S3M A;  1VQ4 T;  2XK0 A;  1NPR A;  3QKJ A;  3OW2 A;  1KC8 C;  1YIT T;  4E7I A;  4N4G A;  4E7J A;  2JTF A;  2GFU A;  3BDL A;  4E7K A;  2O4X A;  3CC2 A;  5KCH A;  4X34 A;  4RG2 A;  3OMC A;  2OTJ T;  1KHI A;  2DIQ A;  3OYK A;  3CME T;  3MP1 A;  1OZ2 A;  2RI3 A;  3CCJ A;  3NTK A;  1VQM T;  4ZTJ A;  3CC7 A;  3OYI A;  3CCS T;  1WJS A;  1UEB A;  3M9Q A;  4YTL A;  3CCU A;  1YI2 T;  2IG0 A;  4IUV A;  2K3X A;  1YJ9 T;  2PQW A;  1OZ3 A;  1X6O A;  1KQS S;  5KCO A;  3CPW A;  3MEV A;  5KH6 A;  5DM7 R;  3PNW C;  5FRM A;  1YJN T;  1VQ7 T;  3ME9 A;  4PLL A;  4FU6 A;  1YBY A;  1N8R C;  4CRI A;  3OMG A;  2GF7 A;  2XHC A;  1EIF A;  2O4X B;  1VQ8 A;  4UC4 A;  3QII A;  1NJI U;  3L42 A;  1XNI A;  2RI5 A;  3JAM E;  3NTH A;  3CCL A;  3CCR A;  3CD6 T;  2MWO A;  1K8A C;  3G6E T;  1WJQ A;  1VQL T;  3NTI A;  2DO3 A;  1Q7Y U;  4ZTF A;  3OYE A;  3H6Z A;  3ZEH A;  4BE1 A;  3C4S A;  2RJD A;  2JZ2 A;  3OYF A;  3HKS A;  1YJW T;  2RI2 A;  3CC4 A;  2HQX A;  4FL6 A;  2JVV A;  5J26 A;  1QVG S;  2JNG A;  2LVM A;  2X4Y A;  1K9M C;  1VQ6 T;  1Q86 U;  4BE2 A;  3CEY A;  2RHU A;  3OB9 A;  3OYJ A;  5M9O A;  1JJ2 S;  1SSF A;  1KD1 U;  2BIV A;  1Q81 C;  1M90 C;  1WGS A;  1VQ4 A;  3CMA A;  2L8D A;  5FLX E;  3MET A;  1YIT A;  3S3N A;  3CXC S;  4B9X A;  2FHD A;  1M1K C;  4C5G A;  5DLQ E;  4N4I A;  3OS2 A;  2EFI A;  3ER0 A;  2X35 A;  2OTJ A;  1QVF A;  3DB3 A;  2DAQ A;  3L2V A;  3OYY A;  3CME A;  2GFA A;  1VQO T;  3OW2 S;  2R58 A;  3FEO A;  4GY5 A;  5IAY A;  1G5V A;  3CCS A;  3CCE T;  3S3O A;  3LLR A;  2X4X A;  2X4W A;  3UWN A;  3G71 T;  1WJR A;  2RHI A;  3LH0 A;  1M1G A;  3O8V A;  1YI2 A;  2R5M A;  4A4F A;  4E7H A;  5KE2 A;  1YJ9 A;  3OQ5 A;  1YHQ A;  3DB4 A;  1YIJ T;  1VQP A;  1YJN A;  1VQ7 A;  1BKB A;  1S72 T;  4C5H A;  4ZN3 A;  2QQR A;  5HY6 A;  3FC3 A;  1VQ5 T;  2EQM A;  3PMI A;  3P8D A;  4NS5 A;  4QW2 A;  1NZ9 A;  2L89 A;  3CPW S;  3LYI A;  3I56 T;  2LCL A;  4OVA A;  2XDP A;  2LCC A;  2MWP A;  1K73 C;  2EQK A;  2NLU A;  2E5Q A;  4IUR A;  3G6E A;  1VQL A;  2QA4 T;  1N8R U;  4C5E A;  2KDS A;  2M1H A;  3KUF A;  3CCU T;  1YJW A;  1Q82 U;  4PLI A;  3TRE A;  2M0O A;  4QQD A;  1NJI C;  2QQS A;  2WAC A;  3PIP A;  2F5K A;  1VQ9 A;  1VQ6 A;  4B9W A;  5FRN A;  1Q7Y C;  1MHN A;  3EAE A;  1K8A U;  4Z02 A;  1W2B A;  4A4G A;  2KVQ G;  4IUU A;  3G4S T;  3CCV T;  4BDY A;  2RJF A;  3L2R A;  2QEX T;  3F70 A;  4BE0 A;  4BD3 A;  2JUF A;  1VQN T;  4IUT A;  5D6X A;  2E6Z A;  4L59 A;  3LGF A;  3SD4 A;  2RHZ A;  3MP8 A;  1VQO A;  4HCZ A;  3I55 T;  2VYT A;  4BDZ A;  3OS1 A;  4QQ6 A;  3UT1 A;  3G71 A;  1N27 A;  3GOX A;  2B8A A;  4LD6 A;  1H3Z A;  2OTL T;  3L2U A;  1QVF S;  3OA6 A;  1VQM A;  3CCQ T;  2EQJ A;  5C0M A;  1KC8 U; 
#chains in the Genus database with same CATH topology
 4BI8 B;  2EQU A;  3QWY A;  1WHK A;  4OB2 B;  5IN1 A;  3CMA T;  5IT9 E;  2QK0 A;  1YIJ A;  3CCM T;  1OI1 A;  2AKK A;  2EIF A;  4A4H A;  1S72 A;  4M77 G;  2FPE A;  4GLM A;  3ULR B;  1M8M A;  1MNE A;  2AK5 A;  4J8O A;  1BCM A;  2DNU A;  2CYZ B;  2ZPE B;  2E10 A;  1PHT A;  2MYS A;  1NEB A;  2X9H A;  1Z9Q A;  2A37 A;  2H3J A;  1WHJ A;  2EKO A;  3TQ7 P;  1BU1 A;  2LQW A;  1GFD A;  5D6W A;  1HSQ A;  2DXB A;  4QVC A;  1M2O A;  2CP5 A;  3V8J A;  4E7Z A;  5CKF A;  4XK8 E;  5GAN 7;  2YUP A;  2RA2 A;  2XDB A;  3ASK A;  4A53 A;  1KQS A;  5ECA A;  1E7O A;  3LWI A;  1U1S A;  1TOV A;  2CH4 A;  4XU3 A;  4M7A G;  4HCC A;  3BFM A;  3DLL A;  4OGC A;  2EWN A;  3GNG A;  1Y07 A;  3J80 E;  1FX7 A;  2M0Y A;  5EC7 A;  1M3A A;  3LX7 A;  3EGD A;  2EYX A;  1K73 R;  1H8K A;  1T0J A;  2CS7 A;  2JOY A;  3OYC A;  2L3R A;  2COY A;  2AKL A;  2YRV A;  3A5Z B;  3TEE A;  1C6V X;  5J3B A;  1XTD A;  1KK7 A;  4M7D E;  5CIU A;  1BIB A;  1FMW A;  5CAI A;  4QQG A;  3OY9 A;  4M75 G;  2Y4Y A;  4N4H A;  4IUQ A;  2RHY A;  4PL6 A;  3L2W A;  1SRL A;  2FZG B;  3KBG A;  4QVZ A;  2CRE A;  2GQV A;  3V7C A;  1WZO A;  2F2V A;  2NWM A;  1Z9Z A;  1YFN A;  1N9R A;  4J6X A;  1Q81 U;  1NG2 A;  2JN0 A;  3LGL A;  3GIB A;  1JU5 C;  4FYY B;  1JQQ A;  4MDW A;  2ED1 A;  3EGD B;  3RES A;  3OYB A;  5J39 A;  1VQK A;  4HT9 A;  3FLG A;  4OMO A;  1M1K U;  2CP3 A;  2HQE A;  3SEM A;  1RI0 A;  3QBY A;  3ZL7 C;  4TVR A;  4C92 F;  2XMF A;  3ZBD A;  4KT0 E;  3S3M A;  1VQ4 T;  3T9N A;  4XTZ A;  3LWH A;  1QP3 A;  1KC8 C;  1J3T A;  5I22 A;  1PD1 A;  1E6H A;  2JTF A;  5A0D A;  5IH2 A;  3BDL A;  3CC2 A;  2VXF A;  2KRM A;  3M55 A;  1KQ2 A;  1UHC A;  5LJ5 g;  2ED0 A;  2DRK A;  2ZPB B;  2ECZ A;  3JCM d;  2J05 A;  4LDV A;  1NLP C;  1M1F A;  4YTL A;  4F14 A;  1YI2 T;  2IG0 A;  2X3W D;  1SKU B;  4IUV A;  4ZNX A;  3TCJ A;  2PQW A;  4JZ4 A;  1OZ3 A;  1ZSZ C;  1KQS S;  4AFZ C;  4PFO A;  5KCO A;  3CPW A;  1GCP A;  5DM7 R;  3PNW C;  3M54 A;  3ME9 A;  1W1F A;  5LJ3 d;  4LUE A;  3OMG A;  2GF7 A;  3LW5 E;  1I8F A;  2HKQ B;  2D8J A;  3FIF A;  4M7A F;  4RKU E;  2DTI A;  1H92 A;  1RAI B;  1X27 A;  3QII A;  1NJI U;  1KJW A;  1BIA A;  2RI5 A;  1VYV A;  3NTH A;  1Q82 R;  3H41 A;  1WYX A;  4JPB W;  4E6R A;  2MWO A;  4JUV A;  2D0Q B;  4L6V 5;  3NTI A;  2DK3 A;  4Y92 A;  2DE0 X;  4ZTF A;  5LJ3 j;  4J7F A;  2DTO A;  2RJD A;  2QGG A;  2JZ2 A;  4BUG A;  4PJO E;  2VC8 A;  1LOJ A;  3HKS A;  4Z8A A;  4E47 A;  5IXF A;  1VQN Q;  2HQX A;  2E1H A;  3EH1 A;  2HSP A;  5J26 A;  1LJO A;  2KGT A;  5KYU A;  4PFZ A;  1R77 A;  4M75 F;  4RTZ A;  4C92 C;  2JTM A;  1WXU A;  1FWZ A;  1WHL A;  2LT1 A;  1Y57 A;  2DRM A;  4RTU A;  4XTU A;  2KYM A;  2BIV A;  4J83 A;  2W0Z A;  1WGS A;  2M51 A;  3QO3 A;  1LCK A;  3MHX A;  2O01 E;  5CKB A;  3JCM J;  4B9X A;  4C0G A;  3CCE Q;  3RKY A;  3AT1 B;  2YXY A;  5GAO p;  3OS2 A;  2X35 A;  2HMA A;  1G8X A;  4KUI A;  2OTJ A;  1Y96 A;  3L2Z A;  1GFC A;  1QVF A;  2DAQ A;  2DFU A;  2VXE A;  3OYY A;  3CME A;  1MGQ A;  3NGP A;  5IHI A;  1VQO T;  4AMC A;  2OAU A;  2KEA A;  2D8H A;  3CCE T;  1X6G A;  2LJ1 A;  3LLR A;  2X4X A;  2X4W A;  3UWN A;  5GMK j;  2DJZ A;  3M4Y A;  4IIM A;  4OMN A;  1KIK A;  2AT1 B;  5KYU B;  1K9A A;  3EFO A;  4DBF A;  1ZUK A;  1NLO C;  3A8M B;  3DB4 A;  2J06 A;  3CCJ Q;  3THK A;  1KQS P;  2GCX A;  1VQ7 A;  2HBW A;  4M7A C;  1GCQ C;  4ZN3 A;  2ZPG B;  3H0H A;  2XD0 A;  1HXD A;  1VUB A;  5HY6 A;  2KQW A;  1WX6 A;  3PMI A;  4ANJ A;  5I2M A;  1SRM A;  1SSH A;  1G3W A;  2L5Q A;  2VB6 A;  4IIO A;  3CPW S;  1Y96 B;  3M57 A;  2L3P A;  1ZX6 A;  2EYZ A;  3V8K A;  1W6X A;  1WLP B;  4OVA A;  2BZX A;  1TH7 A;  2NLU A;  3HTR A;  3QYH B;  4JS4 A;  3L1A A;  1VQL A;  2RK2 A;  4FSX A;  2LX7 A;  2M9U A;  4ZGE B;  4PLI A;  3TRE A;  4M75 C;  5L23 A;  1IRX A;  2OAW A;  3EFR A;  3EFO B;  2QQS A;  2O9V A;  3PVQ A;  3R6O A;  2DKG A;  1OU8 A;  3CCV T;  2DIL A;  4BDY A;  1AOJ A;  4OMP A;  3X25 B;  3L2R A;  1QW1 A;  2JUF A;  1TS9 A;  5A0L A;  2EVR A;  2QYZ A;  3EG9 A;  4EMK C;  3VRZ A;  4DQ2 A;  2NUP A;  1OEB A;  2ROT A;  4F04 B;  4RMO A;  1Q81 R;  2RHZ A;  1GRI A;  3GNF B;  2VYT A;  4FW2 A;  4D8K A;  4ZGD B;  1YIT Q;  2PVD B;  2BZY A;  1YNZ A;  4FIB A;  4LD6 A;  1M1K R;  1QVF S;  1B34 A;  4F7U G;  3QSU A;  2EQJ A;  4M4Z A;  2V1Q A;  5GAM g;  3HFO A;  2V8K A;  2KE9 A;  3MO8 A;  3HPW A;  1UG1 A;  2JJ9 A;  4OMQ A;  2CZ6 B;  4ESR A;  4Y28 E;  1KG1 A;  1OX9 A;  2LDM A;  2LQK A;  2J6F A;  3OYN A;  1AVZ C;  1VQ5 A;  1QQJ A;  1GCQ A;  4M78 G;  4IKF A;  2LTO A;  3JB9 G;  3CC7 Q;  4F17 A;  3M0P A;  3EG9 B;  1BI1 A;  2G3R A;  3I56 A;  1YHQ Q;  1WI7 A;  2NUP B;  1WNL A;  3KXT A;  3CPW P;  3EGU A;  4FT4 A;  2L0A A;  4BAC A;  4C8Q G;  1VQP Q;  1YJN Q;  2IVW A;  2M02 A;  1M4Z A;  2A36 A;  1ACM B;  2NUZ A;  2LC4 A;  3CC7 T;  2D9T A;  4AG2 C;  2P4R A;  3CD6 A;  2QGF B;  4GBQ A;  1C0M A;  1YHQ T;  1B34 B;  3JCM f;  4V2S A;  4ZN1 A;  1VQP T;  1WHM A;  2D1X A;  2CP7 A;  3A98 A;  1VIE A;  4C0Z A;  3G6E Q;  3S6W A;  3WVE B;  2CZ7 B;  4C92 E;  1IXD A;  2F1L A;  4HVV A;  5LL6 S;  7AT1 B;  3N5B B;  3CCR Q;  1NJI R;  2RJE A;  2O88 A;  2QEX A;  5LJ3 f;  2LJ0 A;  2KSS A;  4R0K A;  1W70 A;  4Q5W A;  1BI3 A;  2E4H A;  4IUP A;  1X2K A;  1VQ8 T;  1RL2 A;  4VUB A;  3CC4 Q;  3J7A F;  4M7D A;  2IIM A;  2KBT A;  1OX8 A;  5GAN h;  1QVG A;  2J6O A;  3CCR T;  3I55 A;  1E6G A;  1H64 1;  4M7D D;  1HYO A;  2DXT A;  1QCO A;  4E7L A;  3UA6 A;  3OYG A;  3J81 E;  2GBQ A;  3C94 A;  1V1C A;  2OTL A;  3CC4 T;  3VUB A;  1C1A A;  1NM7 A;  3L2Q A;  1SG5 A;  3PMT A;  2MF2 A;  2HQH A;  3CXC A;  2BE7 D;  4J9E A;  3CCM A;  3E9F A;  3EG3 A;  5D7U A;  1MMN A;  2EQI A;  4DBQ A;  3VS3 A;  1UE9 A;  2V8J A;  1IHV A;  5EG2 A;  2K5L A;  4J9B A;  1VA7 A;  2EKH A;  1QKW A;  3CBO A;  4M7A E;  8AT1 B;  3QKJ A;  4J6W A;  3OW2 A;  3I5R A;  2CP6 A;  3E2U A;  3M0Q A;  2EW3 A;  3CCS Q;  4E7K A;  2YLB A;  3X28 B;  1QMC A;  4M7D B;  2FVU A;  1YIJ Q;  1ZBX A;  3QYG B;  1IHW A;  3JRZ A;  5LJ5 d;  3OYK A;  1OZ2 A;  5I21 A;  1NBE B;  3VYG A;  4J9C A;  2GNC A;  3EHQ A;  1ZQ1 A;  2MPX C;  1D0Y A;  4B6M A;  2GGR A;  3CCS T;  3I5S A;  2F2X A;  2SEM A;  4M78 F;  2CSQ A;  3A8L B;  3NPF A;  4KGX B;  2ABL A;  1I1J A;  3JB9 F;  1UEB A;  2AIR B;  4M75 E;  3CCU A;  4E7S A;  4AG1 C;  1VOM A;  4HVW A;  5LJ5 j;  1RAC B;  1M30 A;  3RBB B;  3VU3 C;  4C8Q F;  5FRM A;  3WVD B;  1LNX A;  2CDT A;  4PLL A;  2RB6 A;  4FU6 A;  2WSC E;  2ZPH B;  5GMK i;  1TU0 B;  3VS1 A;  3JCM P;  2DPP B;  2YUQ A;  3HL8 A;  2JT4 A;  2MIO A;  3TSW A;  3FRN A;  3LH5 A;  1UEC A;  1YJW Q;  4UC4 A;  2LCS A;  2P0Q A;  2CUB A;  2X4J A;  5FU6 C;  3JCM e;  4DBR A;  1X69 A;  1K8A C;  2QAS A;  1VQ6 Q;  4J9I A;  1Q7Y U;  1ABO A;  1ZUY A;  3OBW A;  2K5F A;  2J7I A;  2A28 A;  3OYF A;  1T3L A;  1YJW T;  3QG1 A;  4KH1 B;  4PNO A;  4OB1 B;  1BI2 A;  4WTO B;  4OMM A;  2PTK A;  4FL6 A;  1RAD B;  4C0F A;  1M3B A;  1QVG S;  2COZ A;  5LJ3 e;  2LNH B;  2F5T X;  2LVM A;  4PJO A;  1K9M C;  4X1V A;  1VQ6 T;  1Q86 R;  4ORZ A;  2DF6 A;  4BE2 A;  9ATC B;  5AYF A;  4L5G A;  2JW4 A;  2KR3 A;  2CSI A;  2JM8 A;  1PCX A;  1KD1 R;  1AWX A;  4PJO D;  4CI0 C;  2NYS A;  1M90 C;  2FZC B;  4Z89 A;  1B3Q A;  1VQ4 A;  5FW9 A;  3UAT A;  2L8D A;  5FLX E;  1QVP A;  3X20 B;  1PNJ A;  3VJP A;  2DD4 A;  3CXC S;  4OGE A;  2KRS A;  4PJN A;  1UFF A;  1D0X A;  2DET A;  1WA7 A;  1VQK Q;  4PK4 A;  1TWB A;  4HXJ A;  2BE9 B;  1TUC A;  2DL5 A;  1GXI E;  4M78 C;  3OW2 S;  4OP0 A;  2KK4 A;  2R58 A;  1WQW A;  5IAY A;  1G5V A;  2RHI A;  1WJR A;  5CR2 A;  3LH0 A;  1M1G A;  3FB9 A;  4M77 F;  4C8Q C;  1YI2 A;  1RAG B;  2R5M A;  1D0Z A;  4PJO B;  4E7H A;  1G83 A;  3M53 A;  4A63 B;  2HD0 A;  5GMK e;  4CC7 A;  2FRY A;  2MMP A;  4LD9 K;  3JB9 I;  3FC3 A;  4Y91 A;  2YHT A;  2QA4 Q;  5CKH A;  1RLQ C;  1X43 A;  3REB B;  1N5Z A;  2C06 A;  1GBR A;  5HKC A;  2DBK A;  1WQ7 A;  1R0B G;  2EJ9 A;  4FYX B;  2LCL A;  3RMS A;  2O9S A;  4WF2 A;  2XDP A;  1YN8 A;  1K73 C;  2JMA A;  3FJP A;  3QWX X;  4MML A;  2QA4 T;  4MZM A;  1N8R R;  1O9S A;  3EFS A;  3M0R A;  1RI9 A;  5GAO n;  3WXM B;  2M1H A;  3GF5 A;  4NOY A;  3G4S Q;  3MCA B;  2I0N A;  2CH4 W;  2DTH A;  4N0A C;  4FW1 A;  4J9G A;  2CT3 A;  1YP5 A;  2V1R A;  1VQ9 A;  1QVG P;  5FRN A;  4BY6 C;  1PC0 A;  1K8A U;  1W2B A;  1X01 A;  2LQN A;  3G4S T;  1R0C B;  5DLO A;  4JZ3 A;  2VVK A;  2QG9 B;  2VV5 A;  4RCC A;  2RJF A;  2ZPF B;  4F16 A;  1JEG A;  3QDR B;  1MMA A;  1G3Y A;  3AHU A;  4BD3 A;  1TG0 A;  4RG8 A;  1Y0M A;  1VQN T;  2DL4 A;  3M58 A;  3A8H B;  3H0F A;  5D6X A;  3ZFJ A;  2HZY A;  3VS7 A;  3VS4 A;  1QP2 A;  4RTT A;  5CO7 A;  2OJ2 A;  1O75 A;  3CCQ Q;  1B7T A;  5FU6 B;  3TU4 K;  3MP8 A;  1VQO A;  3VYH B;  1M9S A;  4BB7 A;  4M77 C;  3OW2 P;  1OPK A;  4M78 A;  1WPY A;  1N27 A;  3GOX A;  2KXC A;  4GLK A;  2HDA A;  3UDC A;  4KGZ B;  1Y7X A;  1VQM A;  5GAM d;  3CCQ T;  3OS5 A;  2OTJ Q;  1IO6 A;  2C0T A;  1KC8 U;  5GAO m;  2R57 A;  4XAX B;  2GQI A;  2GTO A;  4O6J A;  3JCM h;  2DEQ A;  4PJM A;  3PIO A;  1IGQ A;  2LJ3 A;  1M2V A;  4JRP A;  4FT2 A;  2RHX A;  1IGU A;  1VYU A;  2RPN A;  1FMK A;  3FDR A;  1TXQ A;  2LQ8 A;  5GAM j;  1ZSZ A;  2QDL A;  2HNI A;  1UJY A;  3MP6 A;  3DKM A;  5LJ3 h;  1K0X A;  2E5K A;  2Z0W A;  3U23 A;  4A4E A;  3OSS C;  3MEU A;  3CCJ T;  5LJ5 f;  4M78 B;  2RQT A;  2D6F A;  1I4K 1;  4NL2 A;  1D3B A;  3P8B B;  4LDW A;  4X9D A;  2CUD A;  3OYM A;  2E6N A;  4KUD K;  1T0H A;  2QXF A;  4OML A;  3VS5 A;  3MEA A;  1K73 U;  1WXT A;  1WDX A;  2J6K A;  4K11 A;  2SRC A;  2FRW A;  1VQL Q;  1M2V B;  1Q82 C;  3CCV A;  3OYA A;  1K1Z A;  4EPC A;  2K3B A;  2I2L A;  3CCL Q;  2DZ9 A;  2C0I A;  2KT8 A;  1PKS A;  1ZSZ B;  4C92 A;  3JCM Q;  2AHJ B;  1W2B S;  2KXD A;  1Q7Y R;  4RCB A;  2FPF A;  3V7R A;  4C92 D;  4D6W A;  1G3T A;  2QTV A;  4JLI A;  3GPL A;  2ATC B;  2CKK A;  4ELZ C;  3CCL T;  2DIG A;  1TUG B;  5GMK h;  1U06 A;  3TSZ A;  2E41 A;  5KYW A;  4C0D C;  4OB0 B;  2HCK A;  1D3B B;  4II1 A;  2E65 A;  1D1B A;  2P4T A;  4M78 E;  2KNB B;  5KYY A;  1QCF A;  2PNI A;  2P84 A;  4M77 A;  3CPF A;  1EFN A;  4C5I A;  4EDU A;  1PSE A;  2PVO B;  1NYF A;  3PGG A;  4EIK A;  4C8Q E;  3HHT B;  3SHW A;  1T3S A;  3D7S B;  2EGA A;  2PUO B;  1AD5 A;  1UGR B;  2L3Q A;  3OYL A;  5D6Y A;  1JO8 A;  3MJX A;  4C92 B;  1IRE B;  5GMK l;  1NPR A;  1RLP C;  3PTA A;  2JS2 A;  1YIT T;  4LDY A;  1WXB A;  4E7J A;  4QVD A;  2O4X A;  4XU1 A;  1OPL A;  1RAF B;  4DBH A;  2VKN A;  4RG2 A;  1FYN A;  8ATC B;  4M7A A;  1AWJ A;  2BZ8 A;  5GAN j;  1AZG B;  3MP1 A;  2RI3 A;  5GAN 3;  1YJ9 Q;  5KYW B;  2E3H A;  4M7A D;  1P92 A;  3A8G B;  1IB8 A;  5I11 A;  4J9F A;  3CC7 A;  2P0P A;  4ZTJ A;  5KYY B;  2K4Y A;  1FMV A;  4M77 B;  4HT8 A;  2GTJ A;  2YDL A;  2QDY B;  4ATO A;  1Q95 G;  3I56 Q;  2ESW A;  1DJ7 B;  4A54 A;  1YJ9 T;  2RD1 A;  2JTE A;  1FXX A;  1BB9 A;  1UGS B;  1I0C A;  5CVI A;  4Z88 A;  3MEV A;  5KH6 A;  3RDV A;  1YJN T;  1PD0 A;  4M75 A;  2F69 A;  3M0U A;  4LUD A;  1XJW B;  3NHN A;  1YBY A;  3CD6 Q;  2DXU A;  4PJL A;  1ZA1 B;  4M75 D;  3OSV A;  5FWB A;  5LJ5 e;  1CKB A;  1EIF A;  2O4X B;  1HJD A;  2PUK B;  2DM1 A;  1VQ8 A;  1PM3 A;  4M7A B;  1U5S A;  3URG A;  4E2F B;  3L42 A;  3JB9 H;  1XNI A;  1YCS B;  4OMF B;  2DJQ A;  3CCR A;  2K5I A;  4LDX A;  3CD6 T;  3G6E T;  1WJQ A;  3UPU A;  2DO3 A;  2FEI A;  2JXB A;  1VYT A;  2K2M A;  4BE1 A;  3C4S A;  3RUX A;  4JRK A;  2LT4 A;  3EG0 A;  2RI2 A;  4M77 E;  4EMK A;  3M59 A;  3CC4 A;  3JCM W;  2JVV A;  3HRU A;  1AEY A;  2JNG A;  4MDX A;  3MKD A;  3RKX A;  4AFS C;  3QDF A;  3CEY A;  1AHJ B;  2E3I A;  3I55 Q;  2RHU A;  2RNA A;  4J9D A;  4M75 B;  4HA8 A;  5M9O A;  5IXB A;  4AFQ C;  1QVF P;  3H0I A;  1Q81 C;  2IPO B;  3CMA A;  1UB4 A;  4JJD A;  4QKU A;  1AWW A;  1KSW A;  2OTL Q;  1BCO A;  2JM9 A;  3MET A;  3S3N A;  5HK3 A;  5GMK m;  4LXC A;  2HEQ A;  4DA4 A;  5GAN g;  1A0N B;  5I2S A;  4C5G A;  1M1K C;  2KY9 A;  3M56 A;  3G71 Q;  3ER0 A;  3CCM Q;  2WSE E;  3DB3 A;  4JJB A;  3L2V A;  3VKI A;  4F7U F;  5KYN A;  2E12 A;  3RNJ A;  2HSE B;  1BI0 A;  1X6B A;  1X75 C;  2V26 A;  5CKD A;  1X2Q A;  2HKN A;  4HVU A;  1KC8 R;  3CCS A;  4C0D B;  4EMK B;  1MMD A;  1S72 Q;  3G71 T;  2H3E B;  2DD5 A;  3O8V A;  4JLG A;  2YRD A;  1M8V A;  5KE2 A;  3OQ5 A;  1MND A;  2KT1 A;  5GAN 6;  2EBP A;  2DYI A;  4LDU A;  5GAM f;  2RK1 A;  4AFU C;  2XKO C;  2X51 A;  2YUN A;  1YIJ T;  1AZE A;  2MK5 A;  1QWF A;  4XTY A;  2KI7 A;  2MAM A;  1PRL C;  1BKB A;  4C5H A;  2A0F B;  1S72 T;  4KH0 B;  2COW A;  2QQR A;  1UDL A;  2EQM A;  3HFN A;  3P8D A;  3A1P A;  2ZCF B;  4NS5 A;  4QW2 A;  2L89 A;  3CCU Q;  4A4K A;  2DL7 A;  4XQ3 A;  3QPH A;  3RKW A;  3FJ5 A;  2O31 A;  4J6Y A;  2A08 A;  2LX9 A;  3C0C A;  2K7A A;  2MWP A;  1ARK A;  2KMT A;  4IUR A;  2E5Q A;  4MZT A;  4DEX A;  2YSQ A;  4XTW A;  2KDS A;  3X24 B;  3CCU T;  2OI3 A;  1YJW A;  5HCK A;  1BBZ A;  1SEM A;  2M0O A;  4EMH A;  2RQU A;  2DEU A;  1NJI C;  1G3S A;  3C12 A;  3RR6 A;  3INZ A;  2XU8 A;  2WAC A;  5KYX A;  1D1A A;  1VQ6 A;  4B9W A;  3EAE A;  4IUU A;  2FPD A;  2OX7 A;  2AZS A;  2C0O A;  1N9S A;  4KBM B;  3OBY A;  1RAA B;  1GBQ A;  2HL5 C;  4XTV A;  4FYW B;  3EG2 A;  2XIC A;  3RER A;  3F70 A;  4BE0 A;  1VIF A;  2RMO A;  4ME7 A;  5GAN 2;  4HCB A;  3G1J A;  2QQA A;  1NEG A;  2E6Z A;  3M5A A;  2KRO A;  3LGF A;  3VS2 A;  1GL5 A;  2XG8 D;  3SD4 A;  4HCZ A;  3JCM V;  1VQ4 Q;  1WHG A;  4FCY A;  3NMZ C;  3GBQ A;  4QQ6 A;  4RTV A;  2D0N A;  1G2B A;  5IHN A;  3UT1 A;  2ZZD A;  2QI2 A;  4JS5 A;  2MOX A;  2B8A A;  1SHG A;  4WCI A;  5LJ5 h;  3VV0 A;  3L2U A;  4M7D G;  5L8R E;  4HKE A;  1UGP B;  5KYX B;  2LNV A;  3RMQ A;  5C0M A;  1UHF A;  3HRT A;  3H8Z A;  2DL3 A;  2DER A;  1VQK T;  2MI6 A;  2FO0 A;  1I5O B;  3SFM A;  3QUI A;  1PG5 B;  3CC2 Q;  5CKE A;  5GAO l;  2NUT A;  4KRT A;  2DYB A;  1K0S A;  5KE3 A;  5GAN f;  4EMG A;  1MV0 B;  1RAB B;  2RJC A;  5AT1 B;  4MZP A;  2BKD N;  2KAF A;  4P5N A;  1ZHI A;  1YI2 Q;  3MEW A;  2RF0 A;  2A3L A;  2DMO A;  1KFZ A;  2PVG B;  3CC2 T;  3QZ9 B;  3PFS A;  4KUL A;  3JB9 J;  1NPP A;  2LMJ A;  1JRI A;  5CCA A;  2RN8 A;  3E9G A;  2QA4 A;  4XTX A;  5GAM e;  2LRQ A;  2Y90 A;  1M5Q 1;  2FYK A;  1XQH A;  1OYX A;  1ABQ A;  1ZLM A;  2B86 A;  2CT4 A;  2YT6 A;  1SF9 A;  2H8H A;  2EYY A;  2AZV A;  3Q1J A;  1IZ6 A;  3OYH A;  5GAO q;  2FL7 A;  4CC2 A;  1MUZ A;  4D8D A;  2K3Y A;  3DLM A;  1OUL A;  3OYD A;  2E64 A;  3REA B;  2XDD A;  1BK2 A;  5DY9 A;  2DLP A;  2NUT B;  3IQL A;  4PJJ A;  3G4S A;  3VS6 A;  4O5V A;  3NFC A;  1I07 A;  3OS0 A;  4DEY A;  1RAE B;  1I81 A;  5C6S A;  3MPU B;  1D09 B;  2QAZ A;  1OQK A;  3GP8 A;  1VQN A;  3PT9 A;  1VQ9 Q;  1KHC A;  1ZUU A;  2E70 A;  4KGV B;  2PZ1 A;  4F7U A;  1N6A A;  1Q86 C;  1H3H A;  3CXC P;  2DVJ A;  3QJ6 A;  1K9M U;  3SB2 A;  5A2Q E;  2BUD A;  2RO0 A;  3EH2 A;  1KD1 C;  5CQY A;  3M0T A;  2QQB A;  1HK9 A;  1JJ2 A;  1VQ9 T;  1M90 U;  1UJ0 A;  2YLC A;  2M16 A;  2FG0 A;  3CCQ A;  5FU7 C;  5FRO A;  1OV3 A;  3CCE A;  4J5Y A;  5IHK A;  3P8H A;  4QT7 A;  2R5A A;  1YWP A;  2ROL A;  2MCN A;  1JB0 E;  1RUW A;  1VQO Q;  1JBM A;  2W10 A;  4M78 D;  3EGX A;  2P0K A;  2DX1 A;  1WIE A;  3JB9 D;  3CME Q;  4C8Q A;  1PRM C;  2XK0 A;  4PJO G;  4E7I A;  1K76 A;  1VQM Q;  2VUB A;  2FB7 A;  4N4G A;  4M7D F;  2KYB A;  2GFU A;  4C8Q D;  1YCY A;  5KCH A;  4X34 A;  3R6N A;  3SWN C;  2QQ9 A;  3OMC A;  2OTJ T;  1KHI A;  4F7U B;  2DIQ A;  4RTW A;  1PKT A;  2CZ1 B;  5GAN 4;  1TUD A;  3JCM c;  4HCK A;  3CME T;  1V76 A;  3EG1 A;  2QTX A;  3CCJ A;  2G6F X;  2V8I A;  1W4S A;  3NTK A;  1VQM T;  1U8R A;  4X9C A;  3HRS A;  3OYI A;  1XOV A;  1WJS A;  1VQ7 Q;  3GLX A;  2RM4 A;  3JCM g;  2LZ6 B;  3UA7 A;  5GAN e;  5CK9 A;  3E1S A;  2WSF E;  3I9Q A;  3M9Q A;  1QCN A;  2K3X A;  4DOW A;  2XI9 A;  4MMK A;  2X3X D;  1X6O A;  1WFW A;  3O5Z A;  3JCM X;  2VWF A;  3EGX B;  3E19 A;  3V7S A;  1VQ7 T;  4N0A A;  4C8Q B;  1N8R C;  1U3O A;  4CRI A;  5LJ3 g;  3QZ5 B;  2XHC A;  2CGH A;  3QXE B;  2RQR A;  3KFV A;  2K2V A;  2CZ0 B;  1UGV A;  1U1T A;  2CP2 A;  1HD3 A;  2L3S A;  4LN2 A;  4OF1 A;  5A0G A;  4F7U E;  3JAM E;  3CCL A;  3CCV Q;  1UGQ B;  2EGE A;  4OB3 B;  1EX4 A;  1VQL T;  2RQW A;  4NL3 A;  2K79 A;  3OYE A;  1QKX A;  3H6Z A;  3SDZ A;  3ZEH A;  1LPL A;  1D1C A;  4J9H A;  4ELY C;  4FSS A;  2XID A;  1ZSG A;  2CP0 A;  2LP5 A;  1RAH B;  1M3C A;  2EJG A;  1F1B B;  2EGC A;  2X4Y A;  3HP9 A;  1ZBJ A;  1Q86 U;  3VUZ A;  4R56 A;  5GAN 8;  1EZZ B;  3OB9 A;  3OYJ A;  1JJ2 S;  1SSF A;  1KD1 U;  5GAM h;  4M77 D;  3PE0 A;  4RTY A;  4M7D C;  3VRY A;  1UUE A;  3UF4 A;  2DA9 A;  4JRQ A;  3JCM b;  4JJN K;  4R55 A;  4RTX A;  1YIT A;  4BY6 B;  2JMC A;  4PFP A;  5GAN d;  1TTH B;  3BE3 A;  1S1N A;  3A8O B;  1KQ1 A;  1Y71 A;  3JV3 A;  2FHD A;  4JJC A;  3V8L A;  5DLQ E;  4N4I A;  1QWE A;  2EFI A;  1QLY A;  5GJW B;  3SWN A;  2ZAE A;  1R8O B;  2L2P A;  1OU9 A;  2GFA A;  4LNP A;  4FYV B;  3FEO A;  4GY5 A;  1B07 A;  4XU2 A;  2DL8 A;  3S3O A;  4PKC C;  4PJO F;  4DOV A;  1VQ5 Q;  4A4F A;  1YJ9 A;  5FU7 B;  4BI3 A;  3CBM A;  1BYM A;  5GJV B;  1YHQ A;  1SPK A;  2VGN A;  2BTT A;  2RH2 A;  1VQP A;  1YJN A;  2PU9 B;  2A7Y A;  2DVE A;  3HSB A;  1JXO A;  2DZC A;  1VQ5 T;  3CQT A;  3M0S A;  2DXC A;  4FM4 B;  1PSF A;  1NZ9 A;  3RIR A;  2RQV A;  1WHH A;  3LYI A;  3BW1 A;  4XU0 A;  3I56 T;  1AWO A;  2JS0 A;  3BDU A;  3SWN B;  3PVL A;  4ZGJ B;  1LVK A;  2YWW A;  2LCC A;  4AT1 B;  2EQK A;  3G6E A;  5FWC A;  1CKA A;  2VGM A;  1N8R U;  1W2B P;  4C5E A;  3KUF A;  3VS0 A;  3TVT A;  2EJF A;  1Q82 U;  1MMG A;  1OOT A;  4CC3 A;  4QQD A;  2ZPI B;  4CC4 B;  1PWT A;  4LE9 A;  5CQX A;  1VQ8 Q;  4RUG A;  3I35 A;  2Y4X A;  2QEX Q;  2F5K A;  3PIP A;  1NYG A;  2DBM A;  1MHN A;  2HBP A;  1Q7Y C;  2HAX A;  1K8A R;  4Z02 A;  1ZA2 B;  4A4G A;  2KVQ G;  6AT1 B;  2FZK B;  2F2W A;  2K9G A;  2ZGW A;  3X26 B;  1JJ2 P;  3C95 A;  1I5L A;  2HL3 A;  1TSF A;  4J7I A;  4JDS A;  2YRC A;  2YUO A;  5HK0 A;  1UTI A;  2K57 A;  5GAN 5;  3JSC A;  2QEX T;  2ENM A;  2EYQ A;  3M4G A;  2EYW A;  1K9M R;  4IUT A;  1YWO A;  4JRI A;  5GAO r;  2O2O A;  1MV3 A;  2EAY A;  1SHF A;  1JXM A;  3H9N A;  4L59 A;  1V29 B;  1K4U S;  2KRN A;  1M90 R;  3EHR A;  3CBP A;  4BI4 A;  4C92 G;  1AT1 B;  3I55 T;  4PJO C;  1CSK A;  3CMA Q;  4BDZ A;  3OS1 A;  3BY7 A;  3QJY A;  2VAS A;  3QHS A;  3G71 A;  2EPD A;  1H3Z A;  2OTL T;  1M27 C;  2K6D A;  3OA6 A;  3G7Z A;  1NE8 A; 
#chains in the Genus database with same CATH homology
 4BI8 B;  3HFO A;  2EQU A;  5GAO m;  2V8K A;  2R57 A;  3H8Z A;  3HRT A;  3HPW A;  3MO8 A;  4OB2 B;  4XAX B;  5IN1 A;  3CMA T;  5IT9 E;  4O6J A;  3JCM h;  1YIJ A;  1VQK T;  3CCM T;  2MI6 A;  2DEQ A;  1OI1 A;  3SFM A;  2EIF A;  3QUI A;  3PIO A;  5CKE A;  4A4H A;  5GAO l;  1S72 A;  4M77 G;  2CZ6 B;  4Y28 E;  4JRP A;  4FT2 A;  1KG1 A;  4J8O A;  2RHX A;  5KE3 A;  2LDM A;  5GAN f;  2LQK A;  3OYN A;  4EMG A;  1VQ5 A;  2CYZ B;  2ZPE B;  2RJC A;  2E10 A;  4MZP A;  4M78 G;  2BKD N;  2KAF A;  3FDR A;  4IKF A;  2LTO A;  1ZHI A;  2LQ8 A;  4P5N A;  5GAM j;  3JB9 G;  2H3J A;  2EKO A;  3MEW A;  2A3L A;  1BI1 A;  2PVG B;  3CC2 T;  3QZ9 B;  2G3R A;  2HNI A;  3I56 A;  3MP6 A;  3PFS A;  3DKM A;  1WNL A;  4KUL A;  5LJ3 h;  3KXT A;  5D6W A;  3JB9 J;  1NPP A;  2DXB A;  4FT4 A;  4A4E A;  4BAC A;  3OSS C;  4C8Q G;  1JRI A;  4QVC A;  3V8J A;  5CCA A;  2IVW A;  3E9G A;  1M4Z A;  5CKF A;  2QA4 A;  4XTX A;  5GAM e;  4XK8 E;  2LRQ A;  5GAN 7;  3MEU A;  3CCJ T;  2Y90 A;  1M5Q 1;  2RA2 A;  5LJ5 f;  2FYK A;  1XQH A;  2LC4 A;  1OYX A;  3ASK A;  2XDB A;  4M78 B;  4A53 A;  1KQS A;  2D6F A;  1I4K 1;  4NL2 A;  1D3B A;  3CC7 T;  2D9T A;  3P8B B;  3LWI A;  1U1S A;  3CD6 A;  4XU3 A;  4M7A G;  1YHQ T;  1B34 B;  3BFM A;  3DLL A;  3Q1J A;  4HCC A;  1IZ6 A;  3OYH A;  4OGC A;  2EWN A;  3JCM f;  3GNG A;  4LDW A;  5GAO q;  4V2S A;  1Y07 A;  2FL7 A;  4X9D A;  3OYM A;  2E6N A;  4ZN1 A;  1VQP T;  4KUD K;  3J80 E;  1FX7 A;  2QXF A;  2K3Y A;  3DLM A;  3OYD A;  2E64 A;  3LX7 A;  3MEA A;  2XDD A;  1K73 U;  1VIE A;  2CS7 A;  4C0Z A;  5DY9 A;  3S6W A;  3WVE B;  3G4S A;  2JOY A;  2CZ7 B;  4C92 E;  4O5V A;  1Q82 C;  3OYC A;  3CCV A;  3NFC A;  3OYA A;  3OS5 A;  2L3R A;  3OS0 A;  5LL6 S;  4EPC A;  2I2L A;  2YRV A;  3A5Z B;  3TEE A;  3N5B B;  2DZ9 A;  5J3B A;  1I81 A;  2RJE A;  5C6S A;  1XTD A;  2QEX A;  5LJ3 f;  4C92 A;  3JCM Q;  2KSS A;  4M7D E;  3GP8 A;  4Q5W A;  5CIU A;  1BI3 A;  1BIB A;  1VQN A;  2AHJ B;  5CAI A;  1W2B S;  3PT9 A;  4QQG A;  4IUP A;  3OY9 A;  1VQ8 T;  1KHC A;  1RL2 A;  2E70 A;  4M75 G;  4RCB A;  3V7R A;  4VUB A;  4C92 D;  4D6W A;  2Y4Y A;  4N4H A;  4IUQ A;  1G3T A;  4JLI A;  2RHY A;  4PL6 A;  3J7A F;  4M7D A;  4F7U A;  3GPL A;  2CKK A;  4ELZ C;  3L2W A;  3CCL T;  1N6A A;  2DIG A;  5GAN h;  1Q86 C;  1QVG A;  5GMK h;  3CCR T;  2E41 A;  3I55 A;  3QJ6 A;  1K9M U;  3SB2 A;  3KBG A;  4QVZ A;  2BUD A;  5A2Q E;  2RO0 A;  1H64 1;  4C0D C;  2GQV A;  4OB0 B;  1D3B B;  4M7D D;  4II1 A;  3V7C A;  1KD1 C;  5CQY A;  2E65 A;  2DXT A;  4E7L A;  2P4T A;  2QQB A;  1HK9 A;  3OYG A;  4M78 E;  1N9R A;  3J81 E;  1JJ2 A;  1VQ9 T;  3C94 A;  4J6X A;  1Q81 U;  1M90 U;  2JN0 A;  4M77 A;  3LGL A;  2OTL A;  3CPF A;  2YLC A;  2M16 A;  3CC4 T;  4C5I A;  3GIB A;  3VUB A;  3CCQ A;  4MDW A;  4EDU A;  5FU7 C;  5FRO A;  3L2Q A;  3CCE A;  3PMT A;  4J5Y A;  3P8H A;  1PSE A;  3OYB A;  2PVO B;  3RES A;  2MF2 A;  2R5A A;  3PGG A;  5J39 A;  3CXC A;  4C8Q E;  1VQK A;  4HT9 A;  3CCM A;  3HHT B;  3E9F A;  3FLG A;  1JB0 E;  1M1K U;  1JBM A;  2HQE A;  2PUO B;  1UGR B;  1RI0 A;  3QBY A;  4M78 D;  4TVR A;  3OYL A;  5D6Y A;  4C92 F;  2V8J A;  2P0K A;  4KT0 E;  5EG2 A;  3ZBD A;  2K5L A;  3S3M A;  3JB9 D;  1VQ4 T;  3T9N A;  3CBO A;  4C8Q A;  2XK0 A;  4C92 B;  1IRE B;  5GMK l;  4XTZ A;  1NPR A;  1QP3 A;  3LWH A;  3QKJ A;  4PJO G;  4M7A E;  4J6W A;  3OW2 A;  3PTA A;  1KC8 C;  1YIT T;  4LDY A;  4E7I A;  2VUB A;  2FB7 A;  4N4G A;  4M7D F;  4E7J A;  2JTF A;  2GFU A;  5A0D A;  4C8Q D;  1YCY A;  3BDL A;  4QVD A;  2O4X A;  4XU1 A;  4E7K A;  5KCH A;  4X34 A;  3SWN C;  3CC2 A;  2YLB A;  3X28 B;  2QQ9 A;  2FVU A;  3OMC A;  4RG2 A;  4M7A A;  4M7D B;  1KHI A;  4F7U B;  1ZBX A;  2VXF A;  2DIQ A;  3QYG B;  2OTJ T;  3M55 A;  1KQ2 A;  2CZ1 B;  5GAN 4;  3JRZ A;  3JCM c;  5LJ5 d;  3OYK A;  5GAN j;  3CME T;  3MP1 A;  1OZ2 A;  2RI3 A;  5I21 A;  5GAN 3;  5LJ5 g;  2QTX A;  3VYG A;  3CCJ A;  4M7A D;  1P92 A;  2V8I A;  1W4S A;  3NTK A;  1VQM T;  2ZPB B;  1U8R A;  3A8G B;  1ZQ1 A;  4X9C A;  3CC7 A;  2P0P A;  4ZTJ A;  3HRS A;  2K4Y A;  3OYI A;  3CCS T;  4M77 B;  3JCM d;  1XOV A;  1WJS A;  4HT8 A;  3GLX A;  2RM4 A;  4M78 F;  3JCM g;  5GAN e;  5CK9 A;  3A8L B;  2QDY B;  4LDV A;  3JB9 F;  3E1S A;  2WSF E;  4ATO A;  1UEB A;  3M9Q A;  1M1F A;  4M75 E;  4YTL A;  3CCU A;  1YI2 T;  2IG0 A;  1DJ7 B;  2K3X A;  4IUV A;  3TCJ A;  4A54 A;  1YJ9 T;  2RD1 A;  4DOW A;  2XI9 A;  2PQW A;  4MMK A;  1FXX A;  1OZ3 A;  5LJ5 j;  1UGS B;  1X6O A;  1KQS S;  4C8Q F;  3VU3 C;  5CVI A;  3JCM X;  5KCO A;  3CPW A;  3MEV A;  5KH6 A;  3RMQ A;  3PNW C;  3E19 A;  5DM7 R;  5FRM A;  1YJN T;  4M75 A;  3V7S A;  2F69 A;  3WVD B;  3M54 A;  1LNX A;  3ME9 A;  1VQ7 T;  4PLL A;  4N0A A;  4C8Q B;  2RB6 A;  5LJ3 d;  4FU6 A;  1YBY A;  2WSC E;  2ZPH B;  1N8R C;  5GMK i;  2DXU A;  4CRI A;  3OMG A;  2GF7 A;  3LW5 E;  5LJ3 g;  2DPP B;  3JCM P;  3QZ5 B;  1I8F A;  4M75 D;  2XHC A;  3OSV A;  5LJ5 e;  3FIF A;  4M7A F;  3HL8 A;  4RKU E;  1EIF A;  2CGH A;  2O4X B;  2DTI A;  2PUK B;  3FRN A;  3QXE B;  1VQ8 A;  4UC4 A;  4M7A B;  2K2V A;  2CZ0 B;  3QII A;  2P0Q A;  1NJI U;  2X4J A;  1U1T A;  5FU6 C;  3L42 A;  3URG A;  3JCM e;  3JB9 H;  1BIA A;  1XNI A;  2RI5 A;  3NTH A;  4OF1 A;  4F7U E;  5A0G A;  3JAM E;  3CCL A;  4OMF B;  1UGQ B;  3CCR A;  2K5I A;  4LDX A;  2MWO A;  4OB3 B;  4JUV A;  1K8A C;  3CD6 T;  2D0Q B;  4L6V 5;  3G6E T;  1WJQ A;  3UPU A;  1VQL T;  3NTI A;  2DK3 A;  2DO3 A;  4NL3 A;  1Q7Y U;  4ZTF A;  5LJ3 j;  4J7F A;  2DTO A;  3H6Z A;  3OYE A;  3SDZ A;  3ZEH A;  4BE1 A;  3C4S A;  2RJD A;  3RUX A;  2JZ2 A;  3OBW A;  2K5F A;  4BUG A;  4PJO E;  3OYF A;  2VC8 A;  4JRK A;  2LT4 A;  1LOJ A;  3HKS A;  1YJW T;  3QG1 A;  2RI2 A;  4M77 E;  4E47 A;  3M59 A;  4PNO A;  4OB1 B;  4ELY C;  4EMK A;  1BI2 A;  3CC4 A;  2HQX A;  4FL6 A;  2XID A;  3JCM W;  2JVV A;  3HRU A;  4C0F A;  2E1H A;  5J26 A;  1QVG S;  1LJO A;  2JNG A;  2EJG A;  5LJ3 e;  2F5T X;  2LVM A;  4M75 F;  4C92 C;  4PJO A;  2JTM A;  2X4Y A;  1K9M C;  3HP9 A;  1VQ6 T;  4MDX A;  1Q86 U;  1FWZ A;  3RKX A;  4BE2 A;  2LT1 A;  3CEY A;  5AYF A;  3VUZ A;  4L5G A;  1AHJ B;  5GAN 8;  4R56 A;  2RHU A;  3OB9 A;  4M75 B;  4HA8 A;  3OYJ A;  5M9O A;  4XTU A;  1JJ2 S;  1SSF A;  4PJO D;  1KD1 U;  2BIV A;  4CI0 C;  1Q81 C;  4J83 A;  5GAM h;  1M90 C;  4M77 D;  1WGS A;  1VQ4 A;  4M7D C;  3CMA A;  1UB4 A;  2L8D A;  4JRQ A;  5FLX E;  3JCM b;  1QVP A;  4JJN K;  3QO3 A;  4R55 A;  3MET A;  3X20 B;  1YIT A;  4BY6 B;  3S3N A;  5HK3 A;  5GAN d;  3MHX A;  2DD4 A;  3VJP A;  2O01 E;  5CKB A;  5GMK m;  3A8O B;  4OGE A;  1KQ1 A;  3CXC S;  3JCM J;  4B9X A;  4DA4 A;  1Y71 A;  4C0G A;  5GAN g;  5I2S A;  2FHD A;  4C5G A;  3V8L A;  5DLQ E;  3RKY A;  1M1K C;  2KY9 A;  3M56 A;  4N4I A;  3OS2 A;  5GAO p;  2EFI A;  3ER0 A;  2X35 A;  4KUI A;  2OTJ A;  1Y96 A;  3L2Z A;  2WSE E;  1QVF A;  2DAQ A;  3DB3 A;  3L2V A;  2VXE A;  3OYY A;  3SWN A;  3CME A;  3VKI A;  1R8O B;  4F7U F;  2E12 A;  1MGQ A;  2GFA A;  1VQO T;  1GXI E;  1BI0 A;  4M78 C;  3OW2 S;  4OP0 A;  2KK4 A;  2R58 A;  3FEO A;  4GY5 A;  1WQW A;  2OAU A;  5IAY A;  1X75 C;  4XU2 A;  5CKD A;  1G5V A;  3CCS A;  3CCE T;  4C0D B;  4EMK B;  3S3O A;  3LLR A;  4PKC C;  2X4X A;  2X4W A;  3UWN A;  5GMK j;  2RHI A;  1WJR A;  5CR2 A;  4PJO F;  3G71 T;  3LH0 A;  2DJZ A;  3M4Y A;  1M1G A;  2DD5 A;  3FB9 A;  3O8V A;  4JLG A;  4M77 F;  4DOV A;  4C8Q C;  1M8V A;  1YI2 A;  2R5M A;  4A4F A;  4PJO B;  4E7H A;  5KE2 A;  3OQ5 A;  1YJ9 A;  5FU7 B;  5GAN 6;  4LDU A;  4BI3 A;  5GAM f;  2RK1 A;  3CBM A;  1BYM A;  1YHQ A;  3A8M B;  2XKO C;  3DB4 A;  3M53 A;  1YIJ T;  2HD0 A;  2VGN A;  5GMK e;  4XTY A;  2MAM A;  2RH2 A;  1VQP A;  1YJN A;  2PU9 B;  2GCX A;  2MMP A;  1VQ7 A;  2A7Y A;  4LD9 K;  1BKB A;  4C5H A;  1S72 T;  4M7A C;  3JB9 I;  4ZN3 A;  2DVE A;  2ZPG B;  2XD0 A;  3HSB A;  2QQR A;  1HXD A;  1VUB A;  5HY6 A;  3FC3 A;  2DZC A;  1VQ5 T;  2KQW A;  2EQM A;  3PMI A;  3HFN A;  4Y91 A;  2YHT A;  2DXC A;  3P8D A;  4FM4 B;  1PSF A;  5CKH A;  5I2M A;  2ZCF B;  4NS5 A;  4QW2 A;  1G3W A;  2C06 A;  1NZ9 A;  3RIR A;  2L5Q A;  2L89 A;  5HKC A;  4A4K A;  4XQ3 A;  3CPW S;  3LYI A;  3QPH A;  1Y96 B;  3RKW A;  3M57 A;  3BW1 A;  4J6Y A;  4XU0 A;  3I56 T;  1WQ7 A;  3V8K A;  2EJ9 A;  2LX9 A;  2LCL A;  3BDU A;  3RMS A;  3SWN B;  4OVA A;  4WF2 A;  4ZGJ B;  2XDP A;  2LCC A;  2MWP A;  1TH7 A;  2EQK A;  2KMT A;  2NLU A;  2E5Q A;  3QYH B;  4IUR A;  3FJP A;  4JS4 A;  3L1A A;  3G6E A;  1VQL A;  2VGM A;  4MML A;  2QA4 T;  4MZT A;  4MZM A;  2RK2 A;  4FSX A;  1O9S A;  3EFS A;  1N8R U;  4C5E A;  4XTW A;  2KDS A;  5GAO n;  3WXM B;  2M1H A;  3KUF A;  2M9U A;  3GF5 A;  4NOY A;  3MCA B;  3X24 B;  3CCU T;  4ZGE B;  2EJF A;  1YJW A;  1Q82 U;  4PLI A;  2DTH A;  2M0O A;  4M75 C;  4QQD A;  3TRE A;  4EMH A;  2ZPI B;  1G3S A;  1NJI C;  4N0A C;  3C12 A;  5CQX A;  3EFR A;  3INZ A;  2XU8 A;  2QQS A;  2Y4X A;  2WAC A;  2F5K A;  3PIP A;  1VQ9 A;  5FRN A;  4B9W A;  1VQ6 A;  4BY6 C;  1MHN A;  2HBP A;  1Q7Y C;  2HAX A;  3EAE A;  1K8A U;  4Z02 A;  4A4G A;  3R6O A;  1W2B A;  1X01 A;  2KVQ G;  4IUU A;  3G4S T;  5DLO A;  2DKG A;  2ZGW A;  3X26 B;  3CCV T;  4BDY A;  3C95 A;  1N9S A;  1I5L A;  2VV5 A;  4J7I A;  2RJF A;  4JDS A;  2ZPF B;  4RCC A;  4KBM B;  3OBY A;  3X25 B;  5HK0 A;  3QDR B;  2K57 A;  1G3Y A;  4XTV A;  3L2R A;  1QW1 A;  5GAN 5;  2XIC A;  3JSC A;  2QEX T;  3AHU A;  3F70 A;  3RER A;  4BE0 A;  4BD3 A;  4RG8 A;  1VIF A;  2JUF A;  4ME7 A;  2EYQ A;  5GAN 2;  3M58 A;  3M4G A;  1VQN T;  5A0L A;  3A8H B;  4HCB A;  4IUT A;  5D6X A;  3ZFJ A;  2QQA A;  4EMK C;  4JRI A;  5GAO r;  2E6Z A;  2EAY A;  3M5A A;  1QP2 A;  4L59 A;  5CO7 A;  4DQ2 A;  1O75 A;  1V29 B;  3LGF A;  5FU6 B;  4RMO A;  3TU4 K;  2XG8 D;  3SD4 A;  2RHZ A;  3MP8 A;  4HCZ A;  3VYH B;  1VQO A;  3JCM V;  3CBP A;  4BI4 A;  4C92 G;  3I55 T;  1K73 C;  3GNF B;  4PJO C;  2VYT A;  1M9S A;  4BB7 A;  4BDZ A;  4M77 C;  3OS1 A;  4QQ6 A;  4ZGD B;  3BY7 A;  3QJY A;  3QHS A;  3UT1 A;  4M78 A;  2ZZD A;  2PVD B;  3G71 A;  2QI2 A;  1WPY A;  1N27 A;  4JS5 A;  3GOX A;  2B8A A;  4FIB A;  4LD6 A;  1H3Z A;  5LJ5 h;  3L2U A;  3VV0 A;  2OTL T;  4GLK A;  4M7D G;  1QVF S;  5L8R E;  3UDC A;  1B34 A;  1Y7X A;  4HKE A;  4F7U G;  3OA6 A;  1UGP B;  5GAM d;  1VQM A;  3QSU A;  3CCQ T;  2EQJ A;  2LNV A;  3G7Z A;  1NE8 A;  5C0M A;  5GAM g;  1KC8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...