4RG2A

Tudor domain of tumor suppressor p53bp1 with small molecule ligand
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of a fragment-like small molecule ligand for the methyl-lysine binding protein, 53BP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Tumor suppressor p53-binding protein 1
total genus 30
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4rg2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4rg2A01
1N8RU 5FLXE 4IKFA 3G71T 1MHNA 3QJ6A 2K3YA 1VQPA 1YI2A 2OTLT 2YRVA 4HCZA 3MEUA 3CC2A 4N4GA 3PMIA 3CXCA 1VQMT 5C6SA 2LQ8A 3DB4A 1YHQA 2EQUA 1OYXA 5DLQE 1M1KC 1M90C 2BIVA 3CCST 3CCQA 3MP1A 2QQSA 3ASKA 3GOXA 2JTFA 1K8AC 3OQ5A 3PIOA 2JOYA 3FEOA 3C4SA 1Q81C 3MEVA 4E7HA 2FHDA 1SSFA 3I55T 1N8RC 3G4SA 4N4IA 3OS2A 3DLLA 2EQKA 2RI5A 3DLMA 1VQ6T 3META 1YJ9A 1VQOA 3L2UA 2BUDA 4A4GA 5KCHA 4BDYA 4B9XA 4L59A 4IUQA 2R58A 3MP6A 2R5MA 4RG2A 3OYCA 5FRMA 2X4XA 4OVAA 2LCCA 4QQ6A 1XTDA 3L2WA 3J80E 1BKBA 4C5GA 2OTJA 4E7KA 2GFUA 3OS0A 2RO0A 5J3BA 3CCQT 5DM7R 2L89A 4C5IA 2P0KA 3CMET 3CCSA 2IG0A 1NJIU 3S3OA 3OYDA 1VQ7A 2DIGA 2DO3A 2NLUA 4CRIA 3CMAT 3TREA 1JJ2A 3S6WA 1H3ZA 2GF7A 1KHIA 2RJDA 2QEXT 1WJQA 2DAQA 3CPFA 3G71A 4BE1A 3OYLA 3OYIA 4TVRA 1WJRA 3BDLA 3FLGA 1IZ6A 3S3NA 5IT9E 5HY6A 1VQKT 3CCET 1X6OA 2EKOA 3KBGA 1EIFA 3G4ST 4IURA 2RHZA 2X4WA 2QA4A 4BACA 2XHCA 3CCUT 4IUTA 2XK0A 1XNIA 3PMTA 3CCRA 5KCOA 3J7AF 1K9MU 2RI2A 2RHYA 1Q7YU 3MEAA 3SD4A 2LCLA 4QQDA 3KUFA 3LH0A 2E6NA 5J26A 1KD1U 2EQJA 1VQ8T 3S3MA 3I56A 2R57A 3Q1JA 1YHQT 3QKJA 2MWPA 3P8BB 2M1HA 2HQXA 3DB3A 3OW2A 1M1KU 1YJNT 3OYYA 2QEXA 2JUFA 4IUPA 2OTLA 3I55A 2MI6A 2O4XB 2QQRA 3E9FA 2RI3A 2VYTA 2CKKA 3H6ZA 4GY5A 2R5AA 2G3RA 3I56T 3A5ZB 4QQGA 4BE0A 1JJ2S 2LRQA 3CCJT 3OYHA 5CIUA 5M9OA 3OY9A 3CMAA 3CCVT 1M90U 3OYKA 3PFSA 2EFIA 3OYNA 2RJEA 1S72A 1WJSA 1YJWT 5KE3A 4QVZA 3CCJA 3MP8A 1Q7YC 1Q82U 3CC7A 4IUUA 2JVVA 4NS5A 3P8HA 1KD1C 3EAEA 4A4EA 2WACA 3H8ZA 2LVMA 1YJNA 1NZ9A 2RHIA 1KHCA 3CXCS 2O4XA 3CCMA 4YTLA 4II1A 3L2RA 2F5KA 1VQ9T 4A4FA 4ZTFA 4Q5WA 2X4YA 3CC7T 3MEWA 2JZ2A 3NTHA 1Q82C 1KQSA 4C5EA 2K3XA 5J39A 1YJWA 4E7LA 3CCUA 4ZN3A 2QA4T 3NTIA 3L2VA 3CCLT 1VQ5A 1K73C 4E7IA 3CCEA 2E5QA 2KVQG 1NJIC 4FU6A 5KE2A 3CC4A 3OS1A 2HQEA 2KDSA 2EQMA 3ZEHA 1YITT 1N27A 2GFAA 1KC8C 3M9QA 2LDMA 2RHXA 3F70A 2RHUA 1VQLA 1VQ8A 3CMEA 1UEBA 2MWOA 3CD6A 3CCLA 2L3RA 1OZ2A 3OB9A 1YBYA 1W2BS 1K73U 2XDPA 2DIQA 3LGLA 3OMCA 3OYFA 3LX7A 5IN1A 3L42A 2B8AA 5A2QE 4BE2A 2BKDN 3CPWA 3OYJA 1RL2A 1RI0A 4PL6A 3UT1A 4ZTJA 3PNWC 3PIPA 3G6ET 3OW2S 1K8AU 2D9TA 1QVFS 4PLIA 1K9MC 5C0MA 1VQOT 3J81E 2E6ZA 1YJ9T 1YIJA 3CC2T 4QW2A 1VQ4T 3FDRA 3OMGA 1YITA 3QBYA 3OYAA 3MO8A 1Q86C 1S72T 3CC4T 1VQ7T 2M16A 3O8VA 3HKSA 1W2BA 1WGSA 1KQSS 3CEYA 5FROA 1G5VA 4C5HA 4LD6A 3OYMA 2E70A 4B9WA 3CCVA 1KC8U 5D6XA 3JAME 3OA6A 3LGFA 3P8DA 2RJFA 4EDUA 2RJCA 1YIJT 1M1GA 1Q86U 3OYEA 3CPWS 4IUVA 3OYGA 1VQNT 2OTJT 5IAYA 4UC4A 4BD3A 1VQ9A 4PLLA 3ER0A 3E9GA 2LTOA 1VQ4A 1YI2T 1VQPT 2JNGA 2EIFA 1QVFA 4Z02A 3G6EA 3L2QA 4FL6A 5LL6S 4E7JA 3CCMT 1VQ6A 3FC3A 2PQWA 5D6WA 3LYIA 1VQNA 1NPRA 1VQ5T 3LLRA 1QVGA 2X35A 2L8DA 1OZ3A 3CCRT 2M0OA 5FRNA 3QIIA 3ME9A 3NTKA 4A4HA 4ZN1A 4N4HA 3OYBA 1OI1A 1Q81U 1VQLT 1QVGS 1NPPA 5KH6A 3UWNA 3CD6T 5D6YA 4BDZA 4X34A 1VQKA 1VQMA
chains in the Genus database with same CATH superfamily
3A8LB 5KYXB 4M77G 5FLXE 2F2XA 2KK4A 2HQHA 2GBQA 2OTLT 1CKAA 1M5Q1 3X25B 3BE3A 4HCZA 3CC2A 2KR3A 3M0TA 2F5TX 3QG1A 5C6SA 2CREA 1RAAB 1OYXA 2P4RA 6AT1B 4QVDA 3I35A 2BIVA 4PNOA 3MP1A 3CCQA 2QQSA 1D0YA 2GCXA 2RQUA 1LJOA 2LT4A 3PIOA 4X1VA 2DFUA 2HNIA 2FL7A 3CCSQ 1ZQ1A 1JXMA 1N5ZA 4JRQA 3MEVA 1N9SA 3X28B 2KRSA 1Z9QA 4C92E 4M7DD 1SSFA 2EQKA 2RI5A 4M75C 2QGGA 1X75C 1YJ9A 1RAIB 1VQOA 2VWFA 2DD4A 1JRIA 3G71Q 4IUQA 3MP6A 3X20B 2DE0X 4LDYA 3EG9A 3OYCA 1X2QA 1ZLMA 3A98A 2X4XA 1UG1A 2J6OA 2PVGB 3BW1A 2O2OA 4AFSC 1VQLQ 3QHSA 4HVUA 1H92A 3QXEB 4AMCA 3HRUA 1Z9ZA 2DYIA 2VV5A 2DMOA 3OS0A 4M7DB 5J3BA 4M7AG 5A0LA 3CMET 4JRPA 1YFNA 3OYDA 2LJ0A 4OB3B 5IXFA 5GAN5 3CMAT 1JJ2A 1OX9A 1LPLA 3I5SA 1SPKA 2DF6A 2AZSA 2QTXA 1G2BA 1YIJQ 1UB4A 2VKNA 4DOVA 3V8JA 1IZ6A 1GBQA 1TG0A 2E12A 1YWOA 2EKHA 1VQ6Q 1H3HA 1VQKT 2J05A 5FU7B 2BTTA 3E19A 2EKOA 3VU3C 2CP2A 4FIBA 4KGVB 1I07A 5DY9A 4DEYA 3EG2A 3QWXX 1ZBXA 3CCRA 5KCOA 1K9MU 2RHYA 5LJ3d 2RF0A 3VYGA 2LCLA 1ZSGA 3CBPA 3LH0A 1MMGA 3CC4Q 3OBYA 5J26A 4M4ZA 3M0PA 4MZTA 1B07A 3RNJA 2KNBB 3Q1JA 4J6XA 5ECAA 2FPFA 1OPLA 1BYMA 2M1HA 3OW2A 4C0FA 4IUPA 2MI6A 2QQRA 3SWNC 2C0IA 1M2VA 4GY5A 3HHTB 4QQGA 3TU4K 2Y4YA 1VQKQ 1X01A 3CCJT 5LJ5h 3CMAA 2ENMA 1M90U 4N0AC 4BUGA 4ESRA 1MMDA 1WJSA 1ZBJA 4B6MA 4DOWA 1C0MA 2YSQA 1BBZA 2RK1A 2XG8D 3D7SB 1OU9A 1Y57A 4M7DC 1C1AA 1R0CB 4IUUA 1FMWA 2HCKA 3P8HA 4WTOB 2DERA 1KQ2A 2ZPHB 4F16A 1U06A 1AZEA 3PT9A 2RHIA 2WSFE 4CC4B 5KYXA 4C92A 4M78B 1Y96A 1O9SA 3L2RA 3GLXA 2RQRA 1VQ9T 1WXBA 2F2VA 1AWOA 1E6GA 4Q5WA 2ED0A 1T3LA 1YN8A 1S1NA 3CC7T 3MEWA 4M7AE 1IRXA 1R77A 1KQSA 4C5EA 2A36A 2XU8A 1YJWA 5IHIA 3CCUA 4JPBW 4ZN3A 4M7AB 2DXCA 1NLPC 1K73C 1VA7A 4CC3A 2ZPIB 1N6AA 4LN2A 3CCEA 2KVQG 1NJIC 1YCSB 3VS3A 1YP5A 4FU6A 3VS7A 3CC4A 2RPNA 4JUVA 1QCNA 5CAIA 3VS2A 3CC7Q 4PJOC 2LJ1A 4F7UF 3ZEHA 1N27A 3M9QA 4LDUA 4IIMA 2LDMA 3CCEQ 2KSSA 4A63B 1BU1A 1QVGP 2DX1A 1K9AA 1LVKA 2MF2A 1AVZC 2X51A 1VQ8A 2QGFB 4XTXA 3NPFA 2PUKB 4AFUC 5I11A 3OBWA 4L6V5 2KRMA 3BY7A 1OX8A 1UECA 1SHFA 2K7AA 5GAMj 2VGMA 2XDPA 1BI0A 4VUBA 4M75F 2CT3A 2B8AA 5A2QE 1LCKA 4OMNA 1TS9A 3JCMg 5GAMh 4HT9A 1T0HA 5LJ5d 1UJ0A 3VKIA 4D6WA 4NL2A 2AK5A 4PL6A 2DBMA 2RNAA 3OW2S 2CT4A 4PLIA 1M1FA 1HXDA 4KT0E 4E6RA 1D0XA 2E6ZA 1OQKA 1RACB 1YIJA 2DILA 4QW2A 2XMFA 2LQNA 3FDRA 2NUPB 1YITA 1RAFB 3A8HB 3EH1A 4BY6C 2K4YA 4F14A 3MO8A 4FW1A 4P5NA 4EPCA 3LWHA 2Z0WA 3V7RA 4OB0B 5KYWB 1B3QA 3QWYA 4RCBA 4GLMA 3CC4T 4M7DG 1W6XA 2HDAA 1Y0MA 3REAB 3SFMA 1BI1A 1BCOA 2WSCE 3VUBA 1WGSA 3PVQA 2DD5A 2LNHB 1G5VA 4XU2A 4GLKA 5I2MA 3PGGA 4RTXA 1T0JA 4M77F 3LGFA 3JAME 2RJFA 5GANj 3OYEA 3CPWS 2VXFA 1BIBA 4R0KA 1V1CA 2ESWA 4UC4A 5CK9A 1ABQA 2LMJA 3FIFA 3E9GA 2DL8A 2HBPA 4PKCC 1M2VB 2EIFA 4Z02A 2C0OA 3G6EA 1QP3A 3L2QA 3V7SA 2MK5A 4E7JA 3INZA 2VVKA 2YXYA 5KYYB 1TUGB 3H9NA 4M78E 1KK7A 2YDLA 1Q81R 1NPRA 1AD5A 5FU7C 2J7IA 2V8JA 1X2KA 3UPUA 1QVGA 4PJLA 4MMLA 4RKUE 1IGUA 1IB8A 1UDLA 1OU8A 4A4KA 1M9SA 3M0SA 4RTTA 4QT7A 4FT4A 3O5ZA 4M7AA 1QVGS 1LOJA 1NPPA 2KXCA 3UWNA 1YHQQ 1U8RA 1K76A 4FCYA 4ZGDB 2EQIA 2DXTA 3EH2A 1VQKA 1H641 2HBWA 2JTMA 1MHNA 2W0ZA 3QJ6A 4J5YA 4HA8A 4M77A 2GQIA 1QLYA 1FWZA 3MEUA 4M77B 3TQ7P 1VQMT 3FJ5A 4C92B 3OS5A 3OW2P 2BE9B 3FJPA 3VS1A 5DLQE 2LX7A 4FYYB 2RK2A 4O6JA 1MNDA 1M1KC 2E64A 3GBQA 2OJ2A 3VYHB 4M75A 2YRDA 3SHWA 1M8MA 1K1ZA 4KH1B 4DBHA 1K9MR 3FEOA 2VXEA 3M59A 4E7HA 4M77D 1IHVA 5LJ5f 4CC2A 4J6WA 3OS2A 2NWMA 5A0DA 5KCHA 4O5VA 2CSQA 4RG8A 2FRYA 2QEXQ 1PCXA 4OVAA 2LCCA 2DXBA 3HRSA 4F7UA 3L2WA 1TXQA 4PJOE 4C5GA 2A0FB 2VB6A 1YJ9Q 1SF9A 1VOMA 3NHNA 5GAMd 2D6FA 5KYWA 2K5LA 2EWNA 1D1BA 3JSCA 2RO0A 3C94A 5GAMf 2J6KA 4C5IA 1NM7A 4M7DA 2P0KA 1Q82R 3CCSA 2JTEA 5GAN8 5FU6B 5IHNA 3RBBB 3TREA 3S6WA 2O9VA 3M0UA 4XK8E 4XTUA 2XICA 1RI9A 2RJDA 2QEXT 2YRCA 2EGAA 2DAQA 2IIMA 3CPFA 5GANh 1N9RA 2M51A 2XD0A 5EC7A 4JJNK 4AFZC 1WHLA 2KY9A 3QZ9B 2OAWA 5A0GA 1QW1A 3M56A 5GAN4 3S3NA 1ZSZA 3I55Q 2RA2A 5D7UA 1X6OA 5GAN7 2OTJQ 4FW2A 4DEXA 2DJZA 3JCMP 4IURA 4F17A 2JM9A 2QA4A 3JCMW 2XHCA 4PFPA 2I2LA 1JO8A 1KD1R 1TTHB 4LNPA 1MNEA 4ELYC 4WCIA 2AKLA 2MIOA 4JJDA 2JM8A 3KUFA 1WYXA 5GANf 1A0NB 1VQOQ 1D0ZA 1KQ1A 3GNGA 3S3MA 1VQ8T 2R57A 3OSSC 4C8QA 2G6FX 2XKOC 2OX7A 2FYKA 1GL5A 1GFDA 3P8BB 4C8QG 2CP6A 3CC2Q 2PZ1A 3RESA 5GMKj 2JUFA 2HD0A 2EYYA 4OMMA 5CQXA 4M75E 1W2BP 2K9GA 5FW9A 5IHKA 2G3RA 2E41A 4X9CA 1N8RR 5IXBA 2RQVA 4M77E 4BE0A 2AZVA 1JJ2S 2RQWA 2GTOA 1HSQA 4XQ3A 3OYHA 3OYKA 4R55A 4C92D 1AHJB 2EYZA 5LJ3h 2FO0A 2H3EB 3M54A 1MV0B 2O9SA 5KE3A 4M78C 2QDYB 1D1CA 3CCJA 1GBRA 1M8VA 3MP8A 1QKXA 1Q7YC 4PFZA 1WNLA 3EAEA 4F7UE 3JCMe 4OB2B 2RD1A 2V8IA 3WVDB 2PVDB 2HAXA 3CXCS 4RMOA 2LJ3A 4Y28E 3CCJQ 3ZBDA 2DL3A 1W1FA 3QPHA 1YITQ 4HKEA 4ZTFA 2CZ7B 4C0GA 2X4YA 1AEYA 4ORZA 3NGPA 1KSWA 2QG9B 1RLQC 1Q7YR 1TUCA 2QASA 1VQMQ 1VIEA 4OF1A 4J7IA 1K4US 2EYXA 2K2MA 8ATCB 1IREB 1HK9A 2FZCB 2K3XA 4MZMA 5J39A 4FSXA 2KYMA 2QA4T 2I0NA 3CCLT 2FZKB 1VQ5A 1Y71A 3E1SA 5GAN3 1WLPB 5LJ5j 3HP9A 4FT2A 5KE2A 5DLOA 3RMQA 3JCMf 1I0CA 2KBTA 2HQEA 2ZZDA 2KDSA 3CCUQ 5GAN6 2PTKA 1YITT 1PC0A 4JJCA 4KGZB 3CQTA 1CSKA 2F2WA 2YUPA 1EX4A 1WFWA 4RCCA 1VQLA 1WA7A 3KXTA 2JW4A 5GJWB 2C06A 3VS0A 1UEBA 4OMPA 1BI3A 4XU1A 1GFCA 2K3BA 3OB9A 1RLPC 2RM4A 1YI2Q 1VQPQ 1YBYA 3PE0A 1FX7A 2DEQA 3EG1A 1K73U 4OP0A 1Y07A 4HT8A 1FMKA 2CP3A 4ELZC 3LX7A 2RB6A 2QI2A 5GMKi 2EW3A 4FM4B 5IN1A 1PKTA 2A28A 3CPWA 2DZ9A 1YJNQ 2EGEA 1RL2A 2CP5A 5EG2A 3G6ET 3KFVA 2D0NA 2DPPB 1BCMA 2COZA 1I4K1 5GAMe 4NL3A 1K9MC 4OMLA 2KGTA 4RTZA 3CC2T 1VQ4T 1SSHA 3WVEB 2QQ9A 2DEUA 4N0AA 4RUGA 1QKWA 2DETA 8AT1B 1S72T 3WXMB 2M16A 2FEIA 2KE9A 2EAYA 1IO6A 3HKSA 3RMSA 2ZPGB 1RAEB 2K79A 3M5AA 1KQSS 3GPLA 4LD6A 1PNJA 5I22A 4B9WA 2O31A 2BZYA 2MYSA 5GJVB 4KULA 4EDUA 1M1GA 1LNXA 3TEEA 4AG1C 5IAYA 1AT1B 1M3BA 1PRLC 1VQ9A 1WX6A 1ACMB 3H0IA 3M0QA 4M7AD 1UTIA 2A08A 3M58A 1Q95G 3MJXA 1UHCA 5AT1B 4DA4A 4PJOG 1VQ6A 1ABOA 4E47A 1BK2A 1IGQA 2DRMA 1VQ5T 3CD6Q 1GRIA 2JS2A 2YLCA 3M0RA 4JZ3A 2X4JA 2M0OA 3EGXA 3NTKA 4LDWA 2HMAA 2ZAEA 1PG5B 3TVTA 4J9IA 4M75B 2A37A 4M77C 1VQLT 1UFFA 4EMGA 2JXBA 4HVWA 4BB7A 1UGSB 3CBOA 4AT1B 2NUTA 3EFOA 1VQMA 3G1JA 4RTUA 2DJQA 2HKQB 5GMKh 1N8RU 3CCMQ 4IKFA 3G71T 2LC4A 2O88A 2GQVA 3VS5A 1M4ZA 2E4HA 1M30A 4PJOF 1G3YA 4N4GA 3PMIA 5GAOl 1ZHIA 1ZSZC 3M57A 2LQ8A 2EQUA 3DB4A 3LW5E 1WDXA 3CCST 3RKWA 2CYZB 3ASKA 4HVVA 1NYFA 2K5FA 9ATCB 2IPOB 2JOYA 1ARKA 2K57A 2EJ9A 5FU6C 4BI4A 2L5QA 2J6FA 2GTJA 2PVOB 2D8HA 1N8RC 3G4SA 1TH7A 2V1QA 3DLLA 3DLMA 4C0DC 1VQ6T 2MAMA 1RAGB 1ZA2B 3META 1PSEA 1NE8A 3L2UA 1QWFA 4A4GA 3VJPA 4B9XA 2C0TA 2DNUA 3JCMc 1K0XA 4XTWA 5CKFA 1D3BB 3EGDA 2CZ0B 3QUIA 4J9CA 2DKGA 1E6HA 2KI7A 4ME7A 4PJOB 4QQ6A 1MMNA 3J80E 3QSUA 1BKBA 2HKNA 2OTJA 5L23A 5KYNA 3PVLA 1J3TA 1VQ9Q 3RIRA 1B34A 4E7KA 2DVJA 2GFUA 3TCJA 1UGRB 1X69A 3QJYA 3DKMA 2L3QA 2EBPA 1YWPA 2FB7A 4XTYA 1VQ5Q 2CDTA 1PHTA 2IG0A 5LJ3g 1B7TA 4DBRA 1PD0A 2DO3A 2L2PA 3V8KA 3MCAB 4RTVA 1EFNA 1WQWA 2DZCA 2NLUA 3JB9G 2GF7A 1KHIA 3L2ZA 4J9EA 3C0CA 3M53A 2CP7A 3G71A 4BE1A 3OYLA 2CGHA 4XU3A 2CS7A 4TVRA 2DVEA 1WJRA 3FLGA 3QZ5B 2ED1A 5IT9E 2XDDA 3OSVA 4HCCA 3JB9H 1QMCA 2VC8A 5GAOn 3R6OA 1ZSZB 3NFCA 2DYBA 3VUZA 3KBGA 2E1HA 2X4WA 1NEBA 1R8OB 3CCUT 3E2UA 1X6GA 1ZUKA 2K2VA 1XNIA 2XK0A 3URGA 1UJYA 3J7AF 1XQHA 2HSEB 3SD4A 1Q7YU 4R56A 1ZA1B 1AWWA 2HL3A 4L5GA 4QQDA 5GAN2 1NYGA 4M78F 3HFNA 1PRMC 2E6NA 3CCLQ 4JRKA 1KD1U 3CMEQ 2EQJA 1AZGB 4D8KA 4NOYA 3I56A 4JS4A 4EMKA 1YHQT 4OMFB 3QKJA 2YLBA 2KXDA 3DB3A 3HFOA 1M1KU 1YJNT 2QEXA 2FG0A 2RI3A 1SKUB 2LRQA 5CIUA 5M9OA 1PWTA 2CH4W 1TUDA 1VYTA 3CCVT 3PFSA 3CXCP 2CZ6B 2EFIA 2DLPA 3OYNA 2RJEA 2KROA 1S72A 2X3WD 4Z89A 1YJWT 3JV3A 4QVZA 3CCVQ 2LP5A 2V1RA 2P4TA 4KBMB 3CC7A 1Y7XA 2E3HA 2PU9B 4NS5A 1VQNQ 4JDSA 2HZYA 4MDXA 2COWA 4A4EA 2WACA 3H8ZA 2LVMA 1WZOA 1SRLA 1KHCA 2RMOA 2O4XA 4YTLA 3A8GB 4GBQA 5I2SA 4MZPA 3VS4A 4X9DA 1BB9A 1WXTA 2DRKA 4C8QF 1OV3A 4OMQA 2E65A 4A4FA 1VUBA 2K5IA 3ZFJA 3PTAA 3THKA 4DBFA 1D09B 2DA9A 2JZ2A 2FZGB 3NTHA 2FPDA 2MMPA 2PNIA 4A54A 2YUOA 1Q82C 2OI3A 4E7LA 2V26A 2F1LA 4MMKA 1PSFA 4WF2A 2E5QA 1S72Q 4M78D 2GNCA 1CKBA 1Y96B 4HCKA 1R0BG 2IVWA 3MHXA 2ABLA 5L8RE 3I5RA 3H41A 3OS1A 3UA7A 3HSBA 2EQMA 1KG1A 3VV0A 2GFAA 4XAXB 2YHTA 1WHKA 3G6EQ 4EMKC 1X43A 2RHXA 3GIBA 3JCMV 5CKHA 4DQ2A 1KC8R 1I81A 2RHUA 1JXOA 2SRCA 1WI7A 3CMAQ 3CMEA 1TOVA 4C8QB 3REBB 2MWOA 4FYWB 3CD6A 3CCLA 2L3RA 1OZ2A 2V8KA 4BI3A 1JQQA 4J9DA 1HYOA 5FWCA 1I5LA 2EYQA 3UA6A 2RQTA 5LJ3j 2NUPA 1B34B 2P0PA 5FWBA 3OMCA 2AKKA 3SEMA 5GANg 4V2SA 3JB9I 2YWWA 3UATA 2OAUA 3OYJA 2DTOA 3QDRB 1U3OA 2KAFA 3UT1A 3PNWC 3PIPA 1SHGA 4EIKA 2D0QB 1GCQC 1K8AU 2QQAA 2ZPEB 2D9TA 2O01E 3AHUA 2VUBA 5C0MA 1VQOT 3J81E 3UDCA 1YJ9T 3JB9D 2KRNA 3M4YA 1M3CA 2BZXA 1UGQB 3RKYA 3QBYA 1XJWB 2JJ9A 3OYAA 4ANJA 2ZPFB 1QWEA 1Q86C 2Y4XA 5HKCA 1T3SA 2QA4Q 3O8VA 4XTVA 3MPUB 5LJ5g 4M75G 1W2BA 3CEYA 5FROA 2ATCB 5GANe 1D1AA 4J83A 4C5HA 2QQBA 1GXIE 2LX9A 1XOVA 3A8MB 3P8DA 4J6YA 2H3JA 1WQ7A 4IUVA 3SB2A 3OYGA 1MGQA 4K11A 1VQNT 3UF4A 5GANd 4JLIA 5CR2A 1TSFA 4BD3A 4PLLA 3V7CA 1RABB 4CC7A 1YI2T 1VQPT 2JNGA 4EMHA 1QVFA 1YJWQ 1ZUYA 3EFSA 4FL6A 3T9NA 5LL6S 3VRZA 3CCMT 2X3XD 1NBEB 2JS0A 4D8DA 2NUZA 2PQWA 4F7UG 1HD3A 3LYIA 1VQNA 2BE7D 3LLRA 5HK0A 3CCQQ 2X35A 2H8HA 4BY6B 3HPWA 3RDVA 3CCRT 5FRNA 4C92C 3ME9A 4FYVB 4ZN1A 2QAZA 4C8QC 1ZUUA 1Q81U 1SG5A 1GCPA 1UHFA 3JCMd 3CD6T 1UE9A 5D6YA 1RAHB 2HSPA 4BDZA 4X34A 2ROLA 1U1TA 4MDWA 4PJOD 3EGUA 2K3YA 1VQPA 1YI2A 4F04B 2YRVA 4XU0A 2MPXC 3EHRA 1KIKA 1GCQA 3ZL7C 3CXCA 3JCMQ 2M02A 3EFRA 4LUDA 4A53A 3H0FA 1YHQA 2XDBA 2CUBA 3H0HA 4JS5A 3JRZA 2FVUA 4PJOA 1M90C 2E3IA 4J9BA 2JT4A 3GOXA 2JTFA 3SWNA 1K8AC 3OQ5A 3GF5A 2EJGA 4ZGEB 1TU0B 1SEMA 2M9UA 2KT1A 1RADB 3C4SA 1Q81C 3CPWP 4J9GA 1VQ7Q 1ZX6A 2DBKA 2FHDA 2YUQA 3I55T 2F69A 3I9QA 4N4IA 1M3AA 2JN0A 2RN8A 3ULRB 2BUDA 2JMCA 5GMKl 2CP0A 4BDYA 4OGCA 1UGPB 4L59A 2R58A 3TSWA 2R5MA 3QO3A 4RG2A 2DTIA 4PJNA 3C95A 5FRMA 2YT6A 1XTDA 2NUTB 3A1PA 3RR6A 1F1BB 2OTLQ 1QVFP 1WHJA 1C6VX 3SWNB 1QCFA 3X26B 3LH5A 2MCNA 4C92F 2ECZA 3JCMh 5GAMg 2P0QA 1BI2A 1PKSA 1WXUA 2LCSA 3G7ZA 4RTWA 5LJ3f 2X9HA 4J9HA 3TSZA 5GAOq 5DM7R 3CCQT 4LDXA 2BZ8A 3NMZC 2L89A 1M1KR 1I1JA 3N5BB 2L3PA 5GMKe 2L3SA 1PM3A 1NJIU 4ATOA 3S3OA 1NLOC 1VQ7A 2DIGA 1EZZB 4CRIA 2P84A 2EPDA 5GAOm 1H3ZA 4E7SA 3QYHB 3EG9B 2QK0A 2M0YA 1WJQA 1X6BA 4XTZA 2KT8A 3OYIA 2MOXA 3AT1B 1VYUA 1V76A 2LZ6B 3BDLA 4FSSA 2CSIA 4EMKB 1VIFA 1SRMA 1RUWA 1PD1A 2LQKA 5HY6A 3RUXA 3CCET 2W10A 3JB9J 4PJJA 4JRIA 1OULA 2PUOB 4AG2C 1EIFA 4PK4A 3G4ST 5GAOr 2RHZA 4PJMA 3GP8A 4BACA 4M7DE 2YUNA 2CUDA 2JMAA 4IUTA 1P92A 3PMTA 4Y91A 2DM1A 2RI2A 3MEAA 4LD9K 1VQ8Q 1M27C 1U5SA 2L0AA 4LE9A 2QTVA 1JEGA 2ZPBB 4RTYA 1JBMA 1KJWA 2E10A 3BFMA 5CKEA 3HRTA 2SEMA 2MWPA 2HQXA 2A7YA 4M7AC 2QYZA 3OYYA 1FXXA 4Y92A 2OTLA 2AT1B 4ZNXA 3I55A 2O4XB 3E9FA 3G4SQ 2VYTA 2CKKA 4CI0C 1IHWA 3H6ZA 2E5KA 2R5AA 3I56T 3A5ZB 4OB1B 4AFQC 5KYUB 1I5OB 3OY9A 1Q86R 4OMOA 2FRWA 3R6NA 5KYUA 4HXJA 3V8LA 2NYSA 2LQWA 1QQJA 1AWJA 2ZGWA 3CCRQ 4ZGJB 3X24B 4IIOA 4E7ZA 3FB9A 3EG3A 1W4SA 1MMAA 5CO7A 1Q82U 2JVVA 4KGXB 1KD1C 2DL5A 1OOTA 3RERA 1W70A 4JZ4A 4M78G 4C8QE 1YJNA 1NZ9A 1M2OA 4M78A 4FYXB 4KUIA 2DK3A 2LNVA 3RKXA 3VRYA 3CCMA 1OEBA 4II1A 4C8QD 1TWBA 2F5KA 1KQSP 5KYYA 5I21A 3HL8A 3JCMb 4LUEA 3HTRA 3JCMJ 4J8OA 4HCBA 1I8FA 5CCAA 1G83A 3QDFA 2D8JA 3GNFB 3QYGB 4E2FB 3LWIA 3JCMX 3NTIA 1X27A 3L2VA 1VQ4Q 4E7IA 1G3WA 1VYVA 1JJ2P 2EVRA 2J06A 2WSEE 1G3TA 4JLGA 3A8OB 1DJ7B 1FMVA 1WPYA 5IH2A 2ZCFB 7AT1B 2CH4A 1E7OA 4M7AF 3BDUA 4LDVA 1U1SA 3M4GA 1KC8C 5GAOp 1NG2A 1O75A 1BIAA 1JB0E 2EGCA 4QVCA 3F70A 4LXCA 2VGNA 5CVIA 1QP2A 2RH2A 4C0DB 2KQWA 3L1AA 2VASA 4C0ZA 4Z88A 1QCOA 1UGVA 2COYA 3EFOB 5GMKm 1W2BS 4PFOA 2DIQA 3LGLA 3OYFA 5CKDA 1H8KA 3L42A 3FRNA 1V29B 1WHGA 2A3LA 4BE2A 1WHHA 4JJBA 4M75D 2BKDN 2DL7A 1RI0A 5HK3A 2AHJB 4ZTJA 2K6DA 5CQYA 3CBMA 1UUEA 1NEGA 2HEQA 4C92G 1FYNA 3EG0A 3JB9F 1QVFS 5LJ3e 1M90R 2EYWA 2LT1A 4KRTA 4BI8B 2CZ1B 3OMGA 1WHMA 2XIDA 3EHQA 2D1XA 1VQ7T 1QVPA 3MKDA 5HCKA 3OYMA 2E70A 4KUDK 4DBQA 4QKUA 3CCVA 1KC8U 3M55A 5D6XA 4Z8AA 1D3BA 2DL4A 3EGDB 3OA6A 1YCYA 5AYFA 2RJCA 1IXDA 1YIJT 3EGXB 4M7DF 1Q86U 2KMTA 1G3SA 4F7UB 5LJ5e 2XI9A 2OTJT 1AWXA 2FPEA 5CKBA 1NJIR 3ER0A 2GGRA 1K0SA 2LTOA 1VQ4A 1KFZA 4J7FA 2QXFA 1K73R 3SDZA 3U23A 2AIRB 1OPKA 2HL5C 2Y90A 3FC3A 2KEAA 5D6WA 1MUZA 2B86A 4OGEA 2L8DA 3C12A 2DXUA 1OZ3A 1MV3A 4KH0B 3QIIA 4A4HA 3I56Q 1K8AR 2QDLA 2DTHA 4N4HA 3OYBA 1OI1A 3VS6A 2ROTA 2EJFA 1G8XA 4J9FA 3IQLA 1HJDA 1YNZA 2KYBA 5KH6A 1JU5C 1WIEA 1AOJA
chains in the Genus database with same CATH topology
1U1TA 3A8LB 4MDWA 1H641 5GMKh 1N8RU 4M77G 5FLXE 2JTMA 4IKFA 2KK4A 3G71T 1MHNA 2LC4A 4PJOD 3QJ6A 2K3YA 4J5YA 1VQPA 2GQVA 4HA8A 4M77A 1YI2A 2YRVA 2OTLT 1M4ZA 1M5Q1 4XU0A 3X25B 4PJOF 4HCZA 1G3YA 1FWZA 3MEUA 3CC2A 4M77B 3PMIA 4N4GA 3CXCA 5GAOl 1ZHIA 3JCMQ 2F5TX 3EFRA 2LQ8A 3M57A 3QG1A 4C92B 5C6SA 1VQMT 2EQUA 3DB4A 4A53A 1YHQA 2XDBA 3OS5A 1OYXA 3LW5E 4JS5A 3FJPA 3JRZA 5DLQE 2FVUA 2RK2A 4O6JA 1M1KC 4PJOA 4QVDA 1M90C 2E64A 2BIVA 4PNOA 3MP1A 3CCQA 3CCST 3RKWA 2CYZB 2QQSA 3ASKA 3GOXA 2GCXA 2JTFA 3SWNA 3VYHB 1K8AC 1LJOA 2LT4A 3OQ5A 3PIOA 4M75A 3GF5A 2EJGA 2K5FA 4ZGEB 2HNIA 2FL7A 2M9UA 1ZQ1A 2JOYA 3FEOA 3C4SA 4JRQA 1Q81C 3MEVA 2K57A 2VXEA 2EJ9A 3M59A 1N9SA 4E7HA 1Q86U 5FU6C 4M77D 3X28B 4BI4A 2L5QA 5LJ5f 2FHDA 2PVOB 4C92E 4M7DD 1SSFA 3I55T 1N8RC 4J6WA 2F69A 1TH7A 4N4IA 3OS2A 2EQKA 2RI5A 3DLMA 4M75C 2JN0A 4C0DC 2MAMA 3DLLA 1VQ6T 1X75C 3META 1YJ9A 1PSEA 1NE8A 1VQOA 3L2UA 2BUDA 5GMKl 5A0DA 4A4GA 4OGCA 3VJPA 2DD4A 5KCHA 4BDYA 4O5VA 4B9XA 1UGPB 1JRIA 4L59A 4IUQA 2R58A 3MP6A 3JCMc 3X20B 2R5MA 3QO3A 4RG2A 4LDYA 3OYCA 2DTIA 4RG8A 3C95A 4XTWA 5CKFA 2X4XA 1D3BB 5FRMA 2CZ0B 3QUIA 2PVGB 3BW1A 2DKGA 4OVAA 2LCCA 4PJOB 4ME7A 4QQ6A 1XTDA 2DXBA 3HRSA 4F7UA 3L2WA 3J80E 3QSUA 1BKBA 4PJOE 4C5GA 3SWNB 3QHSA 2OTJA 4M7AD 3X26B 4C92F 3QXEB 3JCMh 3RIRA 5GAMg 1B34A 4E7KA 2P0QA 1BI2A 5GAMd 2D6FA 2GFUA 3TCJA 1UGRB 3HRUA 3QJYA 2K5LA 2EWNA 3JSCA 2RO0A 2VV5A 3C94A 3G7ZA 5LJ3f 3DKMA 3OS0A 4M7DB 5J3BA 5GAOq 5GAMf 5DM7R 3CCQT 4LDXA 2FB7A 4XTYA 2L89A 4C5IA 4M7AG 5A0LA 2P0KA 3N5BB 3CMET 4JRPA 4M7DA 5GMKe 3CCSA 2IG0A 1NJIU 4ATOA 3S3OA 5LJ3g 3OYDA 1VQ7A 4OB3B 2DIGA 2DO3A 3V8KA 5GAN8 3MCAB 5FU6B 1WQWA 2DZCA 2NLUA 4CRIA 5GAN5 3CMAT 3TREA 1JJ2A 3S6WA 5GAOm 3JB9G 1H3ZA 4XK8E 2GF7A 2XICA 1KHIA 2RJDA 3L2ZA 3QYHB 4XTUA 2QEXT 3M53A 1WJQA 2DAQA 3CPFA 3G71A 4XTZA 4BE1A 5GANh 3OYLA 1N9RA 2CGHA 4XU3A 3OYIA 2CS7A 4TVRA 2XD0A 2QTXA 4JJNK 2DVEA 1WJRA 2KY9A 3BDLA 3FLGA 3QZ5B 3QZ9B 1UB4A 4DOVA 4EMKB 3V8JA 5A0GA 1VIFA 1IZ6A 1QW1A 3M56A 5GAN4 2E12A 5IT9E 3S3NA 2XDDA 2LQKA 3OSVA 4HCCA 3JB9H 5HY6A 1VQKT 2RA2A 3RUXA 3CCET 2VC8A 1X6OA 5FU7B 5GAN7 5GAOn 3E19A 3R6OA 3JB9J 3NFCA 4JRIA 2EKOA 2DJZA 2PUOB 3VUZA 3KBGA 1EIFA 3VU3C 3JCMP 4FIBA 4IURA 2E1HA 3G4ST 5GAOr 2RHZA 2X4WA 3GP8A 2QA4A 4BACA 1R8OB 3JCMW 4M7DE 2XHCA 3CCUT 5DY9A 4IUTA 1P92A 2I2LA 2XK0A 2K2VA 1XNIA 3PMTA 1ZBXA 4Y91A 3URGA 3CCRA 5KCOA 3J7AF 1XQHA 2RI2A 2RHYA 3MEAA 3SD4A 5LJ3d 1Q7YU 1K9MU 4R56A 4LD9K 4ELYC 3VYGA 4L5GA 2LCLA 4QQDA 3CBPA 5GAN2 3KUFA 4M78F 3LH0A 5GANf 3HFNA 2ZPBB 1JBMA 3OBYA 2E6NA 4JRKA 5J26A 4MZTA 1KQ1A 3GNGA 1KD1U 2EQJA 2E10A 3S3MA 4NOYA 1VQ8T 3I56A 2R57A 4JS4A 3OSSC 3Q1JA 4J6XA 4C8QA 3BFMA 2XKOC 5CKEA 4EMKA 4OMFB 1YHQT 3HRTA 2FYKA 3QKJA 2MWPA 2YLBA 3P8BB 4C8QG 1BYMA 2M1HA 2HQXA 3DB3A 3HFOA 2A7YA 3OW2A 1YJNT 3RESA 3OYYA 4C0FA 2QEXA 5GMKj 4M7AC 1FXXA 2JUFA 4IUPA 2HD0A 2OTLA 5CQXA 4M75E 3I55A 2MI6A 2O4XB 2QQRA 3E9FA 2RI3A 2VYTA 2CKKA 3SWNC 4CI0C 3H6ZA 4GY5A 2R5AA 2G3RA 2E41A 4X9CA 3HHTB 3A5ZB 3I56T 4M77E 4QQGA 4BE0A 3TU4K 2Y4YA 1X01A 2LRQA 4OB1B 1JJ2S 4XQ3A 3OYHA 5CIUA 5M9OA 3CCJT 3OY9A 5LJ5h 3CMAA 3CCVT 1M90U 3OYKA 4R55A 4C92D 4N0AC 4BUGA 1AHJB 3PFSA 2CZ6B 2EFIA 5LJ3h 3V8LA 3M54A 3OYNA 2RJEA 1WJSA 2ZGWA 1S72A 1YJWT 4DOWA 4ZGJB 2RK1A 2XG8D 4M78C 2QDYB 4QVZA 3X24B 5KE3A 3CCJA 1M8VA 3MP8A 3FB9A 2P4TA 1W4SA 4M7DC 1Q7YC 5CO7A 1Q82U 1WNLA 4KBMB 3CC7A 4IUUA 1Y7XA 2JVVA 2PU9B 4NS5A 3P8HA 1KD1C 4JDSA 3EAEA 1KQ2A 3RERA 4MDXA 2ZPHB 4A4EA 4M78G 4F7UE 2WACA 3H8ZA 4C8QE 3JCMe 2LVMA 1YJNA 4OB2B 1NZ9A 3PT9A 2RD1A 2RHIA 4M78A 1KHCA 4KUIA 2V8IA 3WVDB 2DK3A 2LNVA 2PVDB 3RKXA 3CXCS 2HAXA 2O4XA 2WSFE 4RMOA 4YTLA 3CCMA 4C92A 3A8GB 4Y28E 4II1A 4M78B 4C8QD 5I2SA 1Y96A 1O9SA 4MZPA 3L2RA 2F5KA 3GLXA 3ZBDA 5I21A 4X9DA 3HL8A 3JCMb 3QPHA 4C8QF 2E65A 1VQ9T 3JCMJ 4J8OA 4A4FA 4HKEA 1VUBA 2K5IA 3ZFJA 3PTAA 2CZ7B 4ZTFA 4Q5WA 4C0GA 1I8FA 4HCBA 2X4YA 5CCAA 3CC7T 3MEWA 2JZ2A 3OA6A 4M7AE 1VIEA 3GNFB 3QYGB 4OF1A 3NTHA 4J7IA 2MMPA 4A54A 1Q82C 1KQSA 4C5EA 1IREB 1HK9A 2XU8A 2K3XA 4MZMA 5J39A 3LWIA 4FSXA 4E7LA 3CCUA 1YJWA 4ZN3A 3JCMX 3NTIA 2QA4T 4MMKA 3L2VA 4M7AB 3CCLT 2DXCA 1VQ5A 1K73C 4E7IA 1G3WA 2ZPIB 1Y71A 1N6AA 1PSFA 3E1SA 5GAN3 3CCEA 4M7DF 4WF2A 2E5QA 4M78D 5LJ5j 2KVQG 3HP9A 2WSEE 1G3TA 4JLGA 1NJIC 1Y96B 4FU6A 4FT2A 5KE2A 5DLOA 2IVWA 3A8OB 3MHXA 5L8RE 3CC4A 1DJ7B 4JUVA 1WPYA 3RMQA 5CAIA 3JCMf 3OS1A 2ZCFB 2HQEA 2ZZDA 3HSBA 2KDSA 4PJOC 4F7UF 2EQMA 1KG1A 3ZEHA 4M7AF 3BDUA 4LDVA 3G4SA 1U1SA 5GAN6 3VV0A 1YITT 1N27A 2GFAA 3M4GA 3M9QA 5GAOp 4XAXB 1KC8C 2YHTA 4LDUA 1O75A 1JB0E 1BIAA 2LDMA 2KSSA 4EMKC 2RHXA 3GIBA 3JCMV 4QVCA 3F70A 5CKHA 4DQ2A 2VGNA 5CVIA 2MF2A 1I81A 2RHUA 4RCCA 1VQLA 3KXTA 1QP2A 2RH2A 1VQ8A 4C0DB 3CMEA 2C06A 2KQWA 3L1AA 4C8QB 1UEBA 2MWOA 4C0ZA 4XTXA 3CD6A 3CCLA 1BI3A 2L3RA 4XU1A 1OZ2A 2V8KA 2PUKB 4BI3A 3OB9A 3OBWA 1I5LA 2EYQA 3AHUA 4L6V5 2RM4A 3BY7A 1YBYA 5GMKm 1W2BS 1FX7A 2DEQA 5LJ3j 1B34B 1K73U 4OP0A 5GAMj 2VGMA 1Y07A 2P0PA 2XDPA 2DIQA 1BI0A 4ELZC 4HT8A 3LGLA 3OMCA 5CKDA 3OYFA 3LX7A 2RB6A 4VUBA 2QI2A 4M75F 5GMKi 4FM4B 5IN1A 3L42A 2B8AA 3FRNA 5GANg 5A2QE 1V29B 4V2SA 2A3LA 4BE2A 3JCMg 4M75D 5GAMh 3JB9I 4HT9A 2BKDN 2OAUA 3CPWA 5LJ5d 3OYJA 2DZ9A 3VKIA 2DTOA 4D6WA 1RL2A 3QDRB 1RI0A 5HK3A 4NL2A 2KAFA 2AHJB 4PL6A 3UT1A 5EG2A 4ZTJA 3PNWC 3PIPA 3G6ET 3OW2S 2DPPB 2D0QB 5CQYA 3CBMA 1K8AU 4C92G 2QQAA 3JB9F 1I4K1 2ZPEB 2D9TA 2O01E 5GAMe 4NL3A 4PLIA 1M1FA 1HXDA 2VUBA 4KT0E 5C0MA 5LJ3e 2E6ZA 3J81E 1VQOT 3UDCA 1YJ9T 3JB9D 3M4YA 2LT1A 1YIJA 3CC2T 4QW2A 1VQ4T 1UGQB 4BI8B 3WVEB 3FDRA 2QQ9A 2CZ1B 3OMGA 3RKYA 1YITA 3A8HB 3QBYA 4N0AA 4BY6C 2K4YA 3OYAA 3MO8A 4P5NA 4EPCA 2ZPFB 3LWHA 2XIDA 3V7RA 1Q86C 4OB0B 2Y4XA 1S72T 4RCBA 3WXMB 3CC4T 2M16A 5HKCA 1QVPA 1VQ7T 4M7DG 2EAYA 3SFMA 3O8VA 4XTVA 1BI1A 2WSCE 5LJ5g 3HKSA 4M75G 3RMSA 1W2BA 3VUBA 1WGSA 2DD5A 2ZPGB 3CEYA 3M5AA 5FROA 5GANe 1KQSS 1G5VA 4C5HA 4J83A 4LD6A 4XU2A 3GPLA 3OYMA 1QVFS 2QQBA 2E70A 4GLKA 5I2MA 1GXIE 4KUDK 2LX9A 4B9WA 1XOVA 3CCVA 3PGGA 1KC8U 3M55A 5D6XA 1D3BA 3A8MB 3JAME 4M77F 1YCYA 3LGFA 3P8DA 4J6YA 2RJFA 4KULA 5AYFA 4EDUA 5GANj 2RJCA 2H3JA 1YIJT 1M1GA 1WQ7A 2KMTA 1G3SA 1LNXA 3OYEA 4IUVA 3SB2A 3TEEA 3OYGA 3CPWS 2VXFA 1BIBA 1MGQA 4F7UB 5LJ5e 2XI9A 1VQNT 2OTJT 5GANd 4UC4A 5IAYA 5CK9A 4JLIA 5CR2A 3FIFA 4BD3A 1VQ9A 4PLLA 5CKBA 3ER0A 3E9GA 3V7CA 2LTOA 2HBPA 4PKCC 1VQ4A 1YI2T 2JNGA 2EIFA 4EMHA 1VQPT 3M58A 4J7FA 4Z02A 1QVFA 2QXFA 3G6EA 1QP3A 3SDZA 3L2QA 3V7SA 3EFSA 4FL6A 3T9NA 5LL6S 4E7JA 4PJOG 4DA4A 3CCMT 3INZA 1VQ6A 4E47A 2Y90A 3FC3A 1K9MC 2PQWA 5D6WA 4M78E 4F7UG 3LYIA 1VQNA 1NPRA 3UPUA 2V8JA 5FU7C 1VQ5T 3LLRA 4OGEA 5HK0A 1QVGA 2X35A 2YLCA 2L8DA 4BY6B 2X4JA 3C12A 2DXUA 1OZ3A 3HPWA 2M0OA 4MMLA 4RKUE 3CCRT 4C92C 5FRNA 3QIIA 3ME9A 3NTKA 4LDWA 4A4HA 2DTHA 4ZN1A 4N4HA 3OYBA 1OI1A 1M1KU 4A4KA 4C8QC 1M9SA 2EJFA 4FT4A 4M75B 4M77C 1Q81U 1VQLT 1QVGS 1LOJA 1NPPA 4M7AA 5KH6A 3UWNA 4EMGA 3JCMd 1U8RA 4BB7A 1UGSB 3CD6T 3CBOA 5D6YA 4ZGDB 2DXTA 4BDZA 4X34A 1VQKA 1VQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R U;  5FLX E;  4IKF A;  3G71 T;  1MHN A;  3QJ6 A;  2K3Y A;  1VQP A;  1YI2 A;  2OTL T;  2YRV A;  4HCZ A;  3MEU A;  3CC2 A;  4N4G A;  3PMI A;  3CXC A;  1VQM T;  5C6S A;  2LQ8 A;  3DB4 A;  1YHQ A;  2EQU A;  1OYX A;  5DLQ E;  1M1K C;  1M90 C;  2BIV A;  3CCS T;  3CCQ A;  3MP1 A;  2QQS A;  3ASK A;  3GOX A;  2JTF A;  1K8A C;  3OQ5 A;  3PIO A;  2JOY A;  3FEO A;  3C4S A;  1Q81 C;  3MEV A;  4E7H A;  2FHD A;  1SSF A;  3I55 T;  1N8R C;  3G4S A;  4N4I A;  3OS2 A;  3DLL A;  2EQK A;  2RI5 A;  3DLM A;  1VQ6 T;  3MET A;  1YJ9 A;  1VQO A;  3L2U A;  2BUD A;  4A4G A;  5KCH A;  4BDY A;  4B9X A;  4L59 A;  4IUQ A;  2R58 A;  3MP6 A;  2R5M A;  4RG2 A;  3OYC A;  5FRM A;  2X4X A;  4OVA A;  2LCC A;  4QQ6 A;  1XTD A;  3L2W A;  3J80 E;  1BKB A;  4C5G A;  2OTJ A;  4E7K A;  2GFU A;  3OS0 A;  2RO0 A;  5J3B A;  3CCQ T;  5DM7 R;  2L89 A;  4C5I A;  2P0K A;  3CME T;  3CCS A;  2IG0 A;  1NJI U;  3S3O A;  3OYD A;  1VQ7 A;  2DIG A;  2DO3 A;  2NLU A;  4CRI A;  3CMA T;  3TRE A;  1JJ2 A;  3S6W A;  1H3Z A;  2GF7 A;  1KHI A;  2RJD A;  2QEX T;  1WJQ A;  2DAQ A;  3CPF A;  3G71 A;  4BE1 A;  3OYL A;  3OYI A;  4TVR A;  1WJR A;  3BDL A;  3FLG A;  1IZ6 A;  3S3N A;  5IT9 E;  5HY6 A;  1VQK T;  3CCE T;  1X6O A;  2EKO A;  3KBG A;  1EIF A;  3G4S T;  4IUR A;  2RHZ A;  2X4W A;  2QA4 A;  4BAC A;  2XHC A;  3CCU T;  4IUT A;  2XK0 A;  1XNI A;  3PMT A;  3CCR A;  5KCO A;  3J7A F;  1K9M U;  2RI2 A;  2RHY A;  1Q7Y U;  3MEA A;  3SD4 A;  2LCL A;  4QQD A;  3KUF A;  3LH0 A;  2E6N A;  5J26 A;  1KD1 U;  2EQJ A;  1VQ8 T;  3S3M A;  3I56 A;  2R57 A;  3Q1J A;  1YHQ T;  3QKJ A;  2MWP A;  3P8B B;  2M1H A;  2HQX A;  3DB3 A;  3OW2 A;  1M1K U;  1YJN T;  3OYY A;  2QEX A;  2JUF A;  4IUP A;  2OTL A;  3I55 A;  2MI6 A;  2O4X B;  2QQR A;  3E9F A;  2RI3 A;  2VYT A;  2CKK A;  3H6Z A;  4GY5 A;  2R5A A;  2G3R A;  3I56 T;  3A5Z B;  4QQG A;  4BE0 A;  1JJ2 S;  2LRQ A;  3CCJ T;  3OYH A;  5CIU A;  5M9O A;  3OY9 A;  3CMA A;  3CCV T;  1M90 U;  3OYK A;  3PFS A;  2EFI A;  3OYN A;  2RJE A;  1S72 A;  1WJS A;  1YJW T;  5KE3 A;  4QVZ A;  3CCJ A;  3MP8 A;  1Q7Y C;  1Q82 U;  3CC7 A;  4IUU A;  2JVV A;  4NS5 A;  3P8H A;  1KD1 C;  3EAE A;  4A4E A;  2WAC A;  3H8Z A;  2LVM A;  1YJN A;  1NZ9 A;  2RHI A;  1KHC A;  3CXC S;  2O4X A;  3CCM A;  4YTL A;  4II1 A;  3L2R A;  2F5K A;  1VQ9 T;  4A4F A;  4ZTF A;  4Q5W A;  2X4Y A;  3CC7 T;  3MEW A;  2JZ2 A;  3NTH A;  1Q82 C;  1KQS A;  4C5E A;  2K3X A;  5J39 A;  1YJW A;  4E7L A;  3CCU A;  4ZN3 A;  2QA4 T;  3NTI A;  3L2V A;  3CCL T;  1VQ5 A;  1K73 C;  4E7I A;  3CCE A;  2E5Q A;  2KVQ G;  1NJI C;  4FU6 A;  5KE2 A;  3CC4 A;  3OS1 A;  2HQE A;  2KDS A;  2EQM A;  3ZEH A;  1YIT T;  1N27 A;  2GFA A;  1KC8 C;  3M9Q A;  2LDM A;  2RHX A;  3F70 A;  2RHU A;  1VQL A;  1VQ8 A;  3CME A;  1UEB A;  2MWO A;  3CD6 A;  3CCL A;  2L3R A;  1OZ2 A;  3OB9 A;  1YBY A;  1W2B S;  1K73 U;  2XDP A;  2DIQ A;  3LGL A;  3OMC A;  3OYF A;  3LX7 A;  5IN1 A;  3L42 A;  2B8A A;  5A2Q E;  4BE2 A;  2BKD N;  3CPW A;  3OYJ A;  1RL2 A;  1RI0 A;  4PL6 A;  3UT1 A;  4ZTJ A;  3PNW C;  3PIP A;  3G6E T;  3OW2 S;  1K8A U;  2D9T A;  1QVF S;  4PLI A;  1K9M C;  5C0M A;  1VQO T;  3J81 E;  2E6Z A;  1YJ9 T;  1YIJ A;  3CC2 T;  4QW2 A;  1VQ4 T;  3FDR A;  3OMG A;  1YIT A;  3QBY A;  3OYA A;  3MO8 A;  1Q86 C;  1S72 T;  3CC4 T;  1VQ7 T;  2M16 A;  3O8V A;  3HKS A;  1W2B A;  1WGS A;  1KQS S;  3CEY A;  5FRO A;  1G5V A;  4C5H A;  4LD6 A;  3OYM A;  2E70 A;  4B9W A;  3CCV A;  1KC8 U;  5D6X A;  3JAM E;  3OA6 A;  3LGF A;  3P8D A;  2RJF A;  4EDU A;  2RJC A;  1YIJ T;  1M1G A;  1Q86 U;  3OYE A;  3CPW S;  4IUV A;  3OYG A;  1VQN T;  2OTJ T;  5IAY A;  4UC4 A;  4BD3 A;  1VQ9 A;  4PLL A;  3ER0 A;  3E9G A;  2LTO A;  1VQ4 A;  1YI2 T;  1VQP T;  2JNG A;  2EIF A;  1QVF A;  4Z02 A;  3G6E A;  3L2Q A;  4FL6 A;  5LL6 S;  4E7J A;  3CCM T;  1VQ6 A;  3FC3 A;  2PQW A;  5D6W A;  3LYI A;  1VQN A;  1NPR A;  1VQ5 T;  3LLR A;  1QVG A;  2X35 A;  2L8D A;  1OZ3 A;  3CCR T;  2M0O A;  5FRN A;  3QII A;  3ME9 A;  3NTK A;  4A4H A;  4ZN1 A;  4N4H A;  3OYB A;  1OI1 A;  1Q81 U;  1VQL T;  1QVG S;  1NPP A;  5KH6 A;  3UWN A;  3CD6 T;  5D6Y A;  4BDZ A;  4X34 A;  1VQK A;  1VQM A; 
#chains in the Genus database with same CATH topology
 3A8L B;  5KYX B;  4M77 G;  5FLX E;  2F2X A;  2KK4 A;  2HQH A;  2GBQ A;  2OTL T;  1CKA A;  1M5Q 1;  3X25 B;  3BE3 A;  4HCZ A;  3CC2 A;  2KR3 A;  3M0T A;  2F5T X;  3QG1 A;  5C6S A;  2CRE A;  1RAA B;  1OYX A;  2P4R A;  6AT1 B;  4QVD A;  3I35 A;  2BIV A;  4PNO A;  3MP1 A;  3CCQ A;  2QQS A;  1D0Y A;  2GCX A;  2RQU A;  1LJO A;  2LT4 A;  3PIO A;  4X1V A;  2DFU A;  2HNI A;  2FL7 A;  3CCS Q;  1ZQ1 A;  1JXM A;  1N5Z A;  4JRQ A;  3MEV A;  1N9S A;  3X28 B;  2KRS A;  1Z9Q A;  4C92 E;  4M7D D;  1SSF A;  2EQK A;  2RI5 A;  4M75 C;  2QGG A;  1X75 C;  1YJ9 A;  1RAI B;  1VQO A;  2VWF A;  2DD4 A;  1JRI A;  3G71 Q;  4IUQ A;  3MP6 A;  3X20 B;  2DE0 X;  4LDY A;  3EG9 A;  3OYC A;  1X2Q A;  1ZLM A;  3A98 A;  2X4X A;  1UG1 A;  2J6O A;  2PVG B;  3BW1 A;  2O2O A;  4AFS C;  1VQL Q;  3QHS A;  4HVU A;  1H92 A;  3QXE B;  4AMC A;  3HRU A;  1Z9Z A;  2DYI A;  2VV5 A;  2DMO A;  3OS0 A;  4M7D B;  5J3B A;  4M7A G;  5A0L A;  3CME T;  4JRP A;  1YFN A;  3OYD A;  2LJ0 A;  4OB3 B;  5IXF A;  5GAN 5;  3CMA T;  1JJ2 A;  1OX9 A;  1LPL A;  3I5S A;  1SPK A;  2DF6 A;  2AZS A;  2QTX A;  1G2B A;  1YIJ Q;  1UB4 A;  2VKN A;  4DOV A;  3V8J A;  1IZ6 A;  1GBQ A;  1TG0 A;  2E12 A;  1YWO A;  2EKH A;  1VQ6 Q;  1H3H A;  1VQK T;  2J05 A;  5FU7 B;  2BTT A;  3E19 A;  2EKO A;  3VU3 C;  2CP2 A;  4FIB A;  4KGV B;  1I07 A;  5DY9 A;  4DEY A;  3EG2 A;  3QWX X;  1ZBX A;  3CCR A;  5KCO A;  1K9M U;  2RHY A;  5LJ3 d;  2RF0 A;  3VYG A;  2LCL A;  1ZSG A;  3CBP A;  3LH0 A;  1MMG A;  3CC4 Q;  3OBY A;  5J26 A;  4M4Z A;  3M0P A;  4MZT A;  1B07 A;  3RNJ A;  2KNB B;  3Q1J A;  4J6X A;  5ECA A;  2FPF A;  1OPL A;  1BYM A;  2M1H A;  3OW2 A;  4C0F A;  4IUP A;  2MI6 A;  2QQR A;  3SWN C;  2C0I A;  1M2V A;  4GY5 A;  3HHT B;  4QQG A;  3TU4 K;  2Y4Y A;  1VQK Q;  1X01 A;  3CCJ T;  5LJ5 h;  3CMA A;  2ENM A;  1M90 U;  4N0A C;  4BUG A;  4ESR A;  1MMD A;  1WJS A;  1ZBJ A;  4B6M A;  4DOW A;  1C0M A;  2YSQ A;  1BBZ A;  2RK1 A;  2XG8 D;  3D7S B;  1OU9 A;  1Y57 A;  4M7D C;  1C1A A;  1R0C B;  4IUU A;  1FMW A;  2HCK A;  3P8H A;  4WTO B;  2DER A;  1KQ2 A;  2ZPH B;  4F16 A;  1U06 A;  1AZE A;  3PT9 A;  2RHI A;  2WSF E;  4CC4 B;  5KYX A;  4C92 A;  4M78 B;  1Y96 A;  1O9S A;  3L2R A;  3GLX A;  2RQR A;  1VQ9 T;  1WXB A;  2F2V A;  1AWO A;  1E6G A;  4Q5W A;  2ED0 A;  1T3L A;  1YN8 A;  1S1N A;  3CC7 T;  3MEW A;  4M7A E;  1IRX A;  1R77 A;  1KQS A;  4C5E A;  2A36 A;  2XU8 A;  1YJW A;  5IHI A;  3CCU A;  4JPB W;  4ZN3 A;  4M7A B;  2DXC A;  1NLP C;  1K73 C;  1VA7 A;  4CC3 A;  2ZPI B;  1N6A A;  4LN2 A;  3CCE A;  2KVQ G;  1NJI C;  1YCS B;  3VS3 A;  1YP5 A;  4FU6 A;  3VS7 A;  3CC4 A;  2RPN A;  4JUV A;  1QCN A;  5CAI A;  3VS2 A;  3CC7 Q;  4PJO C;  2LJ1 A;  4F7U F;  3ZEH A;  1N27 A;  3M9Q A;  4LDU A;  4IIM A;  2LDM A;  3CCE Q;  2KSS A;  4A63 B;  1BU1 A;  1QVG P;  2DX1 A;  1K9A A;  1LVK A;  2MF2 A;  1AVZ C;  2X51 A;  1VQ8 A;  2QGF B;  4XTX A;  3NPF A;  2PUK B;  4AFU C;  5I11 A;  3OBW A;  4L6V 5;  2KRM A;  3BY7 A;  1OX8 A;  1UEC A;  1SHF A;  2K7A A;  5GAM j;  2VGM A;  2XDP A;  1BI0 A;  4VUB A;  4M75 F;  2CT3 A;  2B8A A;  5A2Q E;  1LCK A;  4OMN A;  1TS9 A;  3JCM g;  5GAM h;  4HT9 A;  1T0H A;  5LJ5 d;  1UJ0 A;  3VKI A;  4D6W A;  4NL2 A;  2AK5 A;  4PL6 A;  2DBM A;  2RNA A;  3OW2 S;  2CT4 A;  4PLI A;  1M1F A;  1HXD A;  4KT0 E;  4E6R A;  1D0X A;  2E6Z A;  1OQK A;  1RAC B;  1YIJ A;  2DIL A;  4QW2 A;  2XMF A;  2LQN A;  3FDR A;  2NUP B;  1YIT A;  1RAF B;  3A8H B;  3EH1 A;  4BY6 C;  2K4Y A;  4F14 A;  3MO8 A;  4FW1 A;  4P5N A;  4EPC A;  3LWH A;  2Z0W A;  3V7R A;  4OB0 B;  5KYW B;  1B3Q A;  3QWY A;  4RCB A;  4GLM A;  3CC4 T;  4M7D G;  1W6X A;  2HDA A;  1Y0M A;  3REA B;  3SFM A;  1BI1 A;  1BCO A;  2WSC E;  3VUB A;  1WGS A;  3PVQ A;  2DD5 A;  2LNH B;  1G5V A;  4XU2 A;  4GLK A;  5I2M A;  3PGG A;  4RTX A;  1T0J A;  4M77 F;  3LGF A;  3JAM E;  2RJF A;  5GAN j;  3OYE A;  3CPW S;  2VXF A;  1BIB A;  4R0K A;  1V1C A;  2ESW A;  4UC4 A;  5CK9 A;  1ABQ A;  2LMJ A;  3FIF A;  3E9G A;  2DL8 A;  2HBP A;  4PKC C;  1M2V B;  2EIF A;  4Z02 A;  2C0O A;  3G6E A;  1QP3 A;  3L2Q A;  3V7S A;  2MK5 A;  4E7J A;  3INZ A;  2VVK A;  2YXY A;  5KYY B;  1TUG B;  3H9N A;  4M78 E;  1KK7 A;  2YDL A;  1Q81 R;  1NPR A;  1AD5 A;  5FU7 C;  2J7I A;  2V8J A;  1X2K A;  3UPU A;  1QVG A;  4PJL A;  4MML A;  4RKU E;  1IGU A;  1IB8 A;  1UDL A;  1OU8 A;  4A4K A;  1M9S A;  3M0S A;  4RTT A;  4QT7 A;  4FT4 A;  3O5Z A;  4M7A A;  1QVG S;  1LOJ A;  1NPP A;  2KXC A;  3UWN A;  1YHQ Q;  1U8R A;  1K76 A;  4FCY A;  4ZGD B;  2EQI A;  2DXT A;  3EH2 A;  1VQK A;  1H64 1;  2HBW A;  2JTM A;  1MHN A;  2W0Z A;  3QJ6 A;  4J5Y A;  4HA8 A;  4M77 A;  2GQI A;  1QLY A;  1FWZ A;  3MEU A;  4M77 B;  3TQ7 P;  1VQM T;  3FJ5 A;  4C92 B;  3OS5 A;  3OW2 P;  2BE9 B;  3FJP A;  3VS1 A;  5DLQ E;  2LX7 A;  4FYY B;  2RK2 A;  4O6J A;  1MND A;  1M1K C;  2E64 A;  3GBQ A;  2OJ2 A;  3VYH B;  4M75 A;  2YRD A;  3SHW A;  1M8M A;  1K1Z A;  4KH1 B;  4DBH A;  1K9M R;  3FEO A;  2VXE A;  3M59 A;  4E7H A;  4M77 D;  1IHV A;  5LJ5 f;  4CC2 A;  4J6W A;  3OS2 A;  2NWM A;  5A0D A;  5KCH A;  4O5V A;  2CSQ A;  4RG8 A;  2FRY A;  2QEX Q;  1PCX A;  4OVA A;  2LCC A;  2DXB A;  3HRS A;  4F7U A;  3L2W A;  1TXQ A;  4PJO E;  4C5G A;  2A0F B;  2VB6 A;  1YJ9 Q;  1SF9 A;  1VOM A;  3NHN A;  5GAM d;  2D6F A;  5KYW A;  2K5L A;  2EWN A;  1D1B A;  3JSC A;  2RO0 A;  3C94 A;  5GAM f;  2J6K A;  4C5I A;  1NM7 A;  4M7D A;  2P0K A;  1Q82 R;  3CCS A;  2JTE A;  5GAN 8;  5FU6 B;  5IHN A;  3RBB B;  3TRE A;  3S6W A;  2O9V A;  3M0U A;  4XK8 E;  4XTU A;  2XIC A;  1RI9 A;  2RJD A;  2QEX T;  2YRC A;  2EGA A;  2DAQ A;  2IIM A;  3CPF A;  5GAN h;  1N9R A;  2M51 A;  2XD0 A;  5EC7 A;  4JJN K;  4AFZ C;  1WHL A;  2KY9 A;  3QZ9 B;  2OAW A;  5A0G A;  1QW1 A;  3M56 A;  5GAN 4;  3S3N A;  1ZSZ A;  3I55 Q;  2RA2 A;  5D7U A;  1X6O A;  5GAN 7;  2OTJ Q;  4FW2 A;  4DEX A;  2DJZ A;  3JCM P;  4IUR A;  4F17 A;  2JM9 A;  2QA4 A;  3JCM W;  2XHC A;  4PFP A;  2I2L A;  1JO8 A;  1KD1 R;  1TTH B;  4LNP A;  1MNE A;  4ELY C;  4WCI A;  2AKL A;  2MIO A;  4JJD A;  2JM8 A;  3KUF A;  1WYX A;  5GAN f;  1A0N B;  1VQO Q;  1D0Z A;  1KQ1 A;  3GNG A;  3S3M A;  1VQ8 T;  2R57 A;  3OSS C;  4C8Q A;  2G6F X;  2XKO C;  2OX7 A;  2FYK A;  1GL5 A;  1GFD A;  3P8B B;  4C8Q G;  2CP6 A;  3CC2 Q;  2PZ1 A;  3RES A;  5GMK j;  2JUF A;  2HD0 A;  2EYY A;  4OMM A;  5CQX A;  4M75 E;  1W2B P;  2K9G A;  5FW9 A;  5IHK A;  2G3R A;  2E41 A;  4X9C A;  1N8R R;  5IXB A;  2RQV A;  4M77 E;  4BE0 A;  2AZV A;  1JJ2 S;  2RQW A;  2GTO A;  1HSQ A;  4XQ3 A;  3OYH A;  3OYK A;  4R55 A;  4C92 D;  1AHJ B;  2EYZ A;  5LJ3 h;  2FO0 A;  2H3E B;  3M54 A;  1MV0 B;  2O9S A;  5KE3 A;  4M78 C;  2QDY B;  1D1C A;  3CCJ A;  1GBR A;  1M8V A;  3MP8 A;  1QKX A;  1Q7Y C;  4PFZ A;  1WNL A;  3EAE A;  4F7U E;  3JCM e;  4OB2 B;  2RD1 A;  2V8I A;  3WVD B;  2PVD B;  2HAX A;  3CXC S;  4RMO A;  2LJ3 A;  4Y28 E;  3CCJ Q;  3ZBD A;  2DL3 A;  1W1F A;  3QPH A;  1YIT Q;  4HKE A;  4ZTF A;  2CZ7 B;  4C0G A;  2X4Y A;  1AEY A;  4ORZ A;  3NGP A;  1KSW A;  2QG9 B;  1RLQ C;  1Q7Y R;  1TUC A;  2QAS A;  1VQM Q;  1VIE A;  4OF1 A;  4J7I A;  1K4U S;  2EYX A;  2K2M A;  8ATC B;  1IRE B;  1HK9 A;  2FZC B;  2K3X A;  4MZM A;  5J39 A;  4FSX A;  2KYM A;  2QA4 T;  2I0N A;  3CCL T;  2FZK B;  1VQ5 A;  1Y71 A;  3E1S A;  5GAN 3;  1WLP B;  5LJ5 j;  3HP9 A;  4FT2 A;  5KE2 A;  5DLO A;  3RMQ A;  3JCM f;  1I0C A;  2KBT A;  2HQE A;  2ZZD A;  2KDS A;  3CCU Q;  5GAN 6;  2PTK A;  1YIT T;  1PC0 A;  4JJC A;  4KGZ B;  3CQT A;  1CSK A;  2F2W A;  2YUP A;  1EX4 A;  1WFW A;  4RCC A;  1VQL A;  1WA7 A;  3KXT A;  2JW4 A;  5GJW B;  2C06 A;  3VS0 A;  1UEB A;  4OMP A;  1BI3 A;  4XU1 A;  1GFC A;  2K3B A;  3OB9 A;  1RLP C;  2RM4 A;  1YI2 Q;  1VQP Q;  1YBY A;  3PE0 A;  1FX7 A;  2DEQ A;  3EG1 A;  1K73 U;  4OP0 A;  1Y07 A;  4HT8 A;  1FMK A;  2CP3 A;  4ELZ C;  3LX7 A;  2RB6 A;  2QI2 A;  5GMK i;  2EW3 A;  4FM4 B;  5IN1 A;  1PKT A;  2A28 A;  3CPW A;  2DZ9 A;  1YJN Q;  2EGE A;  1RL2 A;  2CP5 A;  5EG2 A;  3G6E T;  3KFV A;  2D0N A;  2DPP B;  1BCM A;  2COZ A;  1I4K 1;  5GAM e;  4NL3 A;  1K9M C;  4OML A;  2KGT A;  4RTZ A;  3CC2 T;  1VQ4 T;  1SSH A;  3WVE B;  2QQ9 A;  2DEU A;  4N0A A;  4RUG A;  1QKW A;  2DET A;  8AT1 B;  1S72 T;  3WXM B;  2M16 A;  2FEI A;  2KE9 A;  2EAY A;  1IO6 A;  3HKS A;  3RMS A;  2ZPG B;  1RAE B;  2K79 A;  3M5A A;  1KQS S;  3GPL A;  4LD6 A;  1PNJ A;  5I22 A;  4B9W A;  2O31 A;  2BZY A;  2MYS A;  5GJV B;  4KUL A;  4EDU A;  1M1G A;  1LNX A;  3TEE A;  4AG1 C;  5IAY A;  1AT1 B;  1M3B A;  1PRL C;  1VQ9 A;  1WX6 A;  1ACM B;  3H0I A;  3M0Q A;  4M7A D;  1UTI A;  2A08 A;  3M58 A;  1Q95 G;  3MJX A;  1UHC A;  5AT1 B;  4DA4 A;  4PJO G;  1VQ6 A;  1ABO A;  4E47 A;  1BK2 A;  1IGQ A;  2DRM A;  1VQ5 T;  3CD6 Q;  1GRI A;  2JS2 A;  2YLC A;  3M0R A;  4JZ3 A;  2X4J A;  2M0O A;  3EGX A;  3NTK A;  4LDW A;  2HMA A;  2ZAE A;  1PG5 B;  3TVT A;  4J9I A;  4M75 B;  2A37 A;  4M77 C;  1VQL T;  1UFF A;  4EMG A;  2JXB A;  4HVW A;  4BB7 A;  1UGS B;  3CBO A;  4AT1 B;  2NUT A;  3EFO A;  1VQM A;  3G1J A;  4RTU A;  2DJQ A;  2HKQ B;  5GMK h;  1N8R U;  3CCM Q;  4IKF A;  3G71 T;  2LC4 A;  2O88 A;  2GQV A;  3VS5 A;  1M4Z A;  2E4H A;  1M30 A;  4PJO F;  1G3Y A;  4N4G A;  3PMI A;  5GAO l;  1ZHI A;  1ZSZ C;  3M57 A;  2LQ8 A;  2EQU A;  3DB4 A;  3LW5 E;  1WDX A;  3CCS T;  3RKW A;  2CYZ B;  3ASK A;  4HVV A;  1NYF A;  2K5F A;  9ATC B;  2IPO B;  2JOY A;  1ARK A;  2K57 A;  2EJ9 A;  5FU6 C;  4BI4 A;  2L5Q A;  2J6F A;  2GTJ A;  2PVO B;  2D8H A;  1N8R C;  3G4S A;  1TH7 A;  2V1Q A;  3DLL A;  3DLM A;  4C0D C;  1VQ6 T;  2MAM A;  1RAG B;  1ZA2 B;  3MET A;  1PSE A;  1NE8 A;  3L2U A;  1QWF A;  4A4G A;  3VJP A;  4B9X A;  2C0T A;  2DNU A;  3JCM c;  1K0X A;  4XTW A;  5CKF A;  1D3B B;  3EGD A;  2CZ0 B;  3QUI A;  4J9C A;  2DKG A;  1E6H A;  2KI7 A;  4ME7 A;  4PJO B;  4QQ6 A;  1MMN A;  3J80 E;  3QSU A;  1BKB A;  2HKN A;  2OTJ A;  5L23 A;  5KYN A;  3PVL A;  1J3T A;  1VQ9 Q;  3RIR A;  1B34 A;  4E7K A;  2DVJ A;  2GFU A;  3TCJ A;  1UGR B;  1X69 A;  3QJY A;  3DKM A;  2L3Q A;  2EBP A;  1YWP A;  2FB7 A;  4XTY A;  1VQ5 Q;  2CDT A;  1PHT A;  2IG0 A;  5LJ3 g;  1B7T A;  4DBR A;  1PD0 A;  2DO3 A;  2L2P A;  3V8K A;  3MCA B;  4RTV A;  1EFN A;  1WQW A;  2DZC A;  2NLU A;  3JB9 G;  2GF7 A;  1KHI A;  3L2Z A;  4J9E A;  3C0C A;  3M53 A;  2CP7 A;  3G71 A;  4BE1 A;  3OYL A;  2CGH A;  4XU3 A;  2CS7 A;  4TVR A;  2DVE A;  1WJR A;  3FLG A;  3QZ5 B;  2ED1 A;  5IT9 E;  2XDD A;  3OSV A;  4HCC A;  3JB9 H;  1QMC A;  2VC8 A;  5GAO n;  3R6O A;  1ZSZ B;  3NFC A;  2DYB A;  3VUZ A;  3KBG A;  2E1H A;  2X4W A;  1NEB A;  1R8O B;  3CCU T;  3E2U A;  1X6G A;  1ZUK A;  2K2V A;  1XNI A;  2XK0 A;  3URG A;  1UJY A;  3J7A F;  1XQH A;  2HSE B;  3SD4 A;  1Q7Y U;  4R56 A;  1ZA1 B;  1AWW A;  2HL3 A;  4L5G A;  4QQD A;  5GAN 2;  1NYG A;  4M78 F;  3HFN A;  1PRM C;  2E6N A;  3CCL Q;  4JRK A;  1KD1 U;  3CME Q;  2EQJ A;  1AZG B;  4D8K A;  4NOY A;  3I56 A;  4JS4 A;  4EMK A;  1YHQ T;  4OMF B;  3QKJ A;  2YLB A;  2KXD A;  3DB3 A;  3HFO A;  1M1K U;  1YJN T;  2QEX A;  2FG0 A;  2RI3 A;  1SKU B;  2LRQ A;  5CIU A;  5M9O A;  1PWT A;  2CH4 W;  1TUD A;  1VYT A;  3CCV T;  3PFS A;  3CXC P;  2CZ6 B;  2EFI A;  2DLP A;  3OYN A;  2RJE A;  2KRO A;  1S72 A;  2X3W D;  4Z89 A;  1YJW T;  3JV3 A;  4QVZ A;  3CCV Q;  2LP5 A;  2V1R A;  2P4T A;  4KBM B;  3CC7 A;  1Y7X A;  2E3H A;  2PU9 B;  4NS5 A;  1VQN Q;  4JDS A;  2HZY A;  4MDX A;  2COW A;  4A4E A;  2WAC A;  3H8Z A;  2LVM A;  1WZO A;  1SRL A;  1KHC A;  2RMO A;  2O4X A;  4YTL A;  3A8G B;  4GBQ A;  5I2S A;  4MZP A;  3VS4 A;  4X9D A;  1BB9 A;  1WXT A;  2DRK A;  4C8Q F;  1OV3 A;  4OMQ A;  2E65 A;  4A4F A;  1VUB A;  2K5I A;  3ZFJ A;  3PTA A;  3THK A;  4DBF A;  1D09 B;  2DA9 A;  2JZ2 A;  2FZG B;  3NTH A;  2FPD A;  2MMP A;  2PNI A;  4A54 A;  2YUO A;  1Q82 C;  2OI3 A;  4E7L A;  2V26 A;  2F1L A;  4MMK A;  1PSF A;  4WF2 A;  2E5Q A;  1S72 Q;  4M78 D;  2GNC A;  1CKB A;  1Y96 B;  4HCK A;  1R0B G;  2IVW A;  3MHX A;  2ABL A;  5L8R E;  3I5R A;  3H41 A;  3OS1 A;  3UA7 A;  3HSB A;  2EQM A;  1KG1 A;  3VV0 A;  2GFA A;  4XAX B;  2YHT A;  1WHK A;  3G6E Q;  4EMK C;  1X43 A;  2RHX A;  3GIB A;  3JCM V;  5CKH A;  4DQ2 A;  1KC8 R;  1I81 A;  2RHU A;  1JXO A;  2SRC A;  1WI7 A;  3CMA Q;  3CME A;  1TOV A;  4C8Q B;  3REB B;  2MWO A;  4FYW B;  3CD6 A;  3CCL A;  2L3R A;  1OZ2 A;  2V8K A;  4BI3 A;  1JQQ A;  4J9D A;  1HYO A;  5FWC A;  1I5L A;  2EYQ A;  3UA6 A;  2RQT A;  5LJ3 j;  2NUP A;  1B34 B;  2P0P A;  5FWB A;  3OMC A;  2AKK A;  3SEM A;  5GAN g;  4V2S A;  3JB9 I;  2YWW A;  3UAT A;  2OAU A;  3OYJ A;  2DTO A;  3QDR B;  1U3O A;  2KAF A;  3UT1 A;  3PNW C;  3PIP A;  1SHG A;  4EIK A;  2D0Q B;  1GCQ C;  1K8A U;  2QQA A;  2ZPE B;  2D9T A;  2O01 E;  3AHU A;  2VUB A;  5C0M A;  1VQO T;  3J81 E;  3UDC A;  1YJ9 T;  3JB9 D;  2KRN A;  3M4Y A;  1M3C A;  2BZX A;  1UGQ B;  3RKY A;  3QBY A;  1XJW B;  2JJ9 A;  3OYA A;  4ANJ A;  2ZPF B;  1QWE A;  1Q86 C;  2Y4X A;  5HKC A;  1T3S A;  2QA4 Q;  3O8V A;  4XTV A;  3MPU B;  5LJ5 g;  4M75 G;  1W2B A;  3CEY A;  5FRO A;  2ATC B;  5GAN e;  1D1A A;  4J83 A;  4C5H A;  2QQB A;  1GXI E;  2LX9 A;  1XOV A;  3A8M B;  3P8D A;  4J6Y A;  2H3J A;  1WQ7 A;  4IUV A;  3SB2 A;  3OYG A;  1MGQ A;  4K11 A;  1VQN T;  3UF4 A;  5GAN d;  4JLI A;  5CR2 A;  1TSF A;  4BD3 A;  4PLL A;  3V7C A;  1RAB B;  4CC7 A;  1YI2 T;  1VQP T;  2JNG A;  4EMH A;  1QVF A;  1YJW Q;  1ZUY A;  3EFS A;  4FL6 A;  3T9N A;  5LL6 S;  3VRZ A;  3CCM T;  2X3X D;  1NBE B;  2JS0 A;  4D8D A;  2NUZ A;  2PQW A;  4F7U G;  1HD3 A;  3LYI A;  1VQN A;  2BE7 D;  3LLR A;  5HK0 A;  3CCQ Q;  2X35 A;  2H8H A;  4BY6 B;  3HPW A;  3RDV A;  3CCR T;  5FRN A;  4C92 C;  3ME9 A;  4FYV B;  4ZN1 A;  2QAZ A;  4C8Q C;  1ZUU A;  1Q81 U;  1SG5 A;  1GCP A;  1UHF A;  3JCM d;  3CD6 T;  1UE9 A;  5D6Y A;  1RAH B;  2HSP A;  4BDZ A;  4X34 A;  2ROL A;  1U1T A;  4MDW A;  4PJO D;  3EGU A;  2K3Y A;  1VQP A;  1YI2 A;  4F04 B;  2YRV A;  4XU0 A;  2MPX C;  3EHR A;  1KIK A;  1GCQ A;  3ZL7 C;  3CXC A;  3JCM Q;  2M02 A;  3EFR A;  4LUD A;  4A53 A;  3H0F A;  1YHQ A;  2XDB A;  2CUB A;  3H0H A;  4JS5 A;  3JRZ A;  2FVU A;  4PJO A;  1M90 C;  2E3I A;  4J9B A;  2JT4 A;  3GOX A;  2JTF A;  3SWN A;  1K8A C;  3OQ5 A;  3GF5 A;  2EJG A;  4ZGE B;  1TU0 B;  1SEM A;  2M9U A;  2KT1 A;  1RAD B;  3C4S A;  1Q81 C;  3CPW P;  4J9G A;  1VQ7 Q;  1ZX6 A;  2DBK A;  2FHD A;  2YUQ A;  3I55 T;  2F69 A;  3I9Q A;  4N4I A;  1M3A A;  2JN0 A;  2RN8 A;  3ULR B;  2BUD A;  2JMC A;  5GMK l;  2CP0 A;  4BDY A;  4OGC A;  1UGP B;  4L59 A;  2R58 A;  3TSW A;  2R5M A;  3QO3 A;  4RG2 A;  2DTI A;  4PJN A;  3C95 A;  5FRM A;  2YT6 A;  1XTD A;  2NUT B;  3A1P A;  3RR6 A;  1F1B B;  2OTL Q;  1QVF P;  1WHJ A;  1C6V X;  3SWN B;  1QCF A;  3X26 B;  3LH5 A;  2MCN A;  4C92 F;  2ECZ A;  3JCM h;  5GAM g;  2P0Q A;  1BI2 A;  1PKS A;  1WXU A;  2LCS A;  3G7Z A;  4RTW A;  5LJ3 f;  2X9H A;  4J9H A;  3TSZ A;  5GAO q;  5DM7 R;  3CCQ T;  4LDX A;  2BZ8 A;  3NMZ C;  2L89 A;  1M1K R;  1I1J A;  3N5B B;  2L3P A;  5GMK e;  2L3S A;  1PM3 A;  1NJI U;  4ATO A;  3S3O A;  1NLO C;  1VQ7 A;  2DIG A;  1EZZ B;  4CRI A;  2P84 A;  2EPD A;  5GAO m;  1H3Z A;  4E7S A;  3QYH B;  3EG9 B;  2QK0 A;  2M0Y A;  1WJQ A;  1X6B A;  4XTZ A;  2KT8 A;  3OYI A;  2MOX A;  3AT1 B;  1VYU A;  1V76 A;  2LZ6 B;  3BDL A;  4FSS A;  2CSI A;  4EMK B;  1VIF A;  1SRM A;  1RUW A;  1PD1 A;  2LQK A;  5HY6 A;  3RUX A;  3CCE T;  2W10 A;  3JB9 J;  4PJJ A;  4JRI A;  1OUL A;  2PUO B;  4AG2 C;  1EIF A;  4PK4 A;  3G4S T;  5GAO r;  2RHZ A;  4PJM A;  3GP8 A;  4BAC A;  4M7D E;  2YUN A;  2CUD A;  2JMA A;  4IUT A;  1P92 A;  3PMT A;  4Y91 A;  2DM1 A;  2RI2 A;  3MEA A;  4LD9 K;  1VQ8 Q;  1M27 C;  1U5S A;  2L0A A;  4LE9 A;  2QTV A;  1JEG A;  2ZPB B;  4RTY A;  1JBM A;  1KJW A;  2E10 A;  3BFM A;  5CKE A;  3HRT A;  2SEM A;  2MWP A;  2HQX A;  2A7Y A;  4M7A C;  2QYZ A;  3OYY A;  1FXX A;  4Y92 A;  2OTL A;  2AT1 B;  4ZNX A;  3I55 A;  2O4X B;  3E9F A;  3G4S Q;  2VYT A;  2CKK A;  4CI0 C;  1IHW A;  3H6Z A;  2E5K A;  2R5A A;  3I56 T;  3A5Z B;  4OB1 B;  4AFQ C;  5KYU B;  1I5O B;  3OY9 A;  1Q86 R;  4OMO A;  2FRW A;  3R6N A;  5KYU A;  4HXJ A;  3V8L A;  2NYS A;  2LQW A;  1QQJ A;  1AWJ A;  2ZGW A;  3CCR Q;  4ZGJ B;  3X24 B;  4IIO A;  4E7Z A;  3FB9 A;  3EG3 A;  1W4S A;  1MMA A;  5CO7 A;  1Q82 U;  2JVV A;  4KGX B;  1KD1 C;  2DL5 A;  1OOT A;  3RER A;  1W70 A;  4JZ4 A;  4M78 G;  4C8Q E;  1YJN A;  1NZ9 A;  1M2O A;  4M78 A;  4FYX B;  4KUI A;  2DK3 A;  2LNV A;  3RKX A;  3VRY A;  3CCM A;  1OEB A;  4II1 A;  4C8Q D;  1TWB A;  2F5K A;  1KQS P;  5KYY A;  5I21 A;  3HL8 A;  3JCM b;  4LUE A;  3HTR A;  3JCM J;  4J8O A;  4HCB A;  1I8F A;  5CCA A;  1G83 A;  3QDF A;  2D8J A;  3GNF B;  3QYG B;  4E2F B;  3LWI A;  3JCM X;  3NTI A;  1X27 A;  3L2V A;  1VQ4 Q;  4E7I A;  1G3W A;  1VYV A;  1JJ2 P;  2EVR A;  2J06 A;  2WSE E;  1G3T A;  4JLG A;  3A8O B;  1DJ7 B;  1FMV A;  1WPY A;  5IH2 A;  2ZCF B;  7AT1 B;  2CH4 A;  1E7O A;  4M7A F;  3BDU A;  4LDV A;  1U1S A;  3M4G A;  1KC8 C;  5GAO p;  1NG2 A;  1O75 A;  1BIA A;  1JB0 E;  2EGC A;  4QVC A;  3F70 A;  4LXC A;  2VGN A;  5CVI A;  1QP2 A;  2RH2 A;  4C0D B;  2KQW A;  3L1A A;  2VAS A;  4C0Z A;  4Z88 A;  1QCO A;  1UGV A;  2COY A;  3EFO B;  5GMK m;  1W2B S;  4PFO A;  2DIQ A;  3LGL A;  3OYF A;  5CKD A;  1H8K A;  3L42 A;  3FRN A;  1V29 B;  1WHG A;  2A3L A;  4BE2 A;  1WHH A;  4JJB A;  4M75 D;  2BKD N;  2DL7 A;  1RI0 A;  5HK3 A;  2AHJ B;  4ZTJ A;  2K6D A;  5CQY A;  3CBM A;  1UUE A;  1NEG A;  2HEQ A;  4C92 G;  1FYN A;  3EG0 A;  3JB9 F;  1QVF S;  5LJ3 e;  1M90 R;  2EYW A;  2LT1 A;  4KRT A;  4BI8 B;  2CZ1 B;  3OMG A;  1WHM A;  2XID A;  3EHQ A;  2D1X A;  1VQ7 T;  1QVP A;  3MKD A;  5HCK A;  3OYM A;  2E70 A;  4KUD K;  4DBQ A;  4QKU A;  3CCV A;  1KC8 U;  3M55 A;  5D6X A;  4Z8A A;  1D3B A;  2DL4 A;  3EGD B;  3OA6 A;  1YCY A;  5AYF A;  2RJC A;  1IXD A;  1YIJ T;  3EGX B;  4M7D F;  1Q86 U;  2KMT A;  1G3S A;  4F7U B;  5LJ5 e;  2XI9 A;  2OTJ T;  1AWX A;  2FPE A;  5CKB A;  1NJI R;  3ER0 A;  2GGR A;  1K0S A;  2LTO A;  1VQ4 A;  1KFZ A;  4J7F A;  2QXF A;  1K73 R;  3SDZ A;  3U23 A;  2AIR B;  1OPK A;  2HL5 C;  2Y90 A;  3FC3 A;  2KEA A;  5D6W A;  1MUZ A;  2B86 A;  4OGE A;  2L8D A;  3C12 A;  2DXU A;  1OZ3 A;  1MV3 A;  4KH0 B;  3QII A;  4A4H A;  3I56 Q;  1K8A R;  2QDL A;  2DTH A;  4N4H A;  3OYB A;  1OI1 A;  3VS6 A;  2ROT A;  2EJF A;  1G8X A;  4J9F A;  3IQL A;  1HJD A;  1YNZ A;  2KYB A;  5KH6 A;  1JU5 C;  1WIE A;  1AOJ A; 
#chains in the Genus database with same CATH homology
 1U1T A;  3A8L B;  4MDW A;  1H64 1;  5GMK h;  1N8R U;  4M77 G;  5FLX E;  2JTM A;  4IKF A;  2KK4 A;  3G71 T;  1MHN A;  2LC4 A;  4PJO D;  3QJ6 A;  2K3Y A;  4J5Y A;  1VQP A;  2GQV A;  4HA8 A;  4M77 A;  1YI2 A;  2YRV A;  2OTL T;  1M4Z A;  1M5Q 1;  4XU0 A;  3X25 B;  4PJO F;  4HCZ A;  1G3Y A;  1FWZ A;  3MEU A;  3CC2 A;  4M77 B;  3PMI A;  4N4G A;  3CXC A;  5GAO l;  1ZHI A;  3JCM Q;  2F5T X;  3EFR A;  2LQ8 A;  3M57 A;  3QG1 A;  4C92 B;  5C6S A;  1VQM T;  2EQU A;  3DB4 A;  4A53 A;  1YHQ A;  2XDB A;  3OS5 A;  1OYX A;  3LW5 E;  4JS5 A;  3FJP A;  3JRZ A;  5DLQ E;  2FVU A;  2RK2 A;  4O6J A;  1M1K C;  4PJO A;  4QVD A;  1M90 C;  2E64 A;  2BIV A;  4PNO A;  3MP1 A;  3CCQ A;  3CCS T;  3RKW A;  2CYZ B;  2QQS A;  3ASK A;  3GOX A;  2GCX A;  2JTF A;  3SWN A;  3VYH B;  1K8A C;  1LJO A;  2LT4 A;  3OQ5 A;  3PIO A;  4M75 A;  3GF5 A;  2EJG A;  2K5F A;  4ZGE B;  2HNI A;  2FL7 A;  2M9U A;  1ZQ1 A;  2JOY A;  3FEO A;  3C4S A;  4JRQ A;  1Q81 C;  3MEV A;  2K57 A;  2VXE A;  2EJ9 A;  3M59 A;  1N9S A;  4E7H A;  1Q86 U;  5FU6 C;  4M77 D;  3X28 B;  4BI4 A;  2L5Q A;  5LJ5 f;  2FHD A;  2PVO B;  4C92 E;  4M7D D;  1SSF A;  3I55 T;  1N8R C;  4J6W A;  2F69 A;  1TH7 A;  4N4I A;  3OS2 A;  2EQK A;  2RI5 A;  3DLM A;  4M75 C;  2JN0 A;  4C0D C;  2MAM A;  3DLL A;  1VQ6 T;  1X75 C;  3MET A;  1YJ9 A;  1PSE A;  1NE8 A;  1VQO A;  3L2U A;  2BUD A;  5GMK l;  5A0D A;  4A4G A;  4OGC A;  3VJP A;  2DD4 A;  5KCH A;  4BDY A;  4O5V A;  4B9X A;  1UGP B;  1JRI A;  4L59 A;  4IUQ A;  2R58 A;  3MP6 A;  3JCM c;  3X20 B;  2R5M A;  3QO3 A;  4RG2 A;  4LDY A;  3OYC A;  2DTI A;  4RG8 A;  3C95 A;  4XTW A;  5CKF A;  2X4X A;  1D3B B;  5FRM A;  2CZ0 B;  3QUI A;  2PVG B;  3BW1 A;  2DKG A;  4OVA A;  2LCC A;  4PJO B;  4ME7 A;  4QQ6 A;  1XTD A;  2DXB A;  3HRS A;  4F7U A;  3L2W A;  3J80 E;  3QSU A;  1BKB A;  4PJO E;  4C5G A;  3SWN B;  3QHS A;  2OTJ A;  4M7A D;  3X26 B;  4C92 F;  3QXE B;  3JCM h;  3RIR A;  5GAM g;  1B34 A;  4E7K A;  2P0Q A;  1BI2 A;  5GAM d;  2D6F A;  2GFU A;  3TCJ A;  1UGR B;  3HRU A;  3QJY A;  2K5L A;  2EWN A;  3JSC A;  2RO0 A;  2VV5 A;  3C94 A;  3G7Z A;  5LJ3 f;  3DKM A;  3OS0 A;  4M7D B;  5J3B A;  5GAO q;  5GAM f;  5DM7 R;  3CCQ T;  4LDX A;  2FB7 A;  4XTY A;  2L89 A;  4C5I A;  4M7A G;  5A0L A;  2P0K A;  3N5B B;  3CME T;  4JRP A;  4M7D A;  5GMK e;  3CCS A;  2IG0 A;  1NJI U;  4ATO A;  3S3O A;  5LJ3 g;  3OYD A;  1VQ7 A;  4OB3 B;  2DIG A;  2DO3 A;  3V8K A;  5GAN 8;  3MCA B;  5FU6 B;  1WQW A;  2DZC A;  2NLU A;  4CRI A;  5GAN 5;  3CMA T;  3TRE A;  1JJ2 A;  3S6W A;  5GAO m;  3JB9 G;  1H3Z A;  4XK8 E;  2GF7 A;  2XIC A;  1KHI A;  2RJD A;  3L2Z A;  3QYH B;  4XTU A;  2QEX T;  3M53 A;  1WJQ A;  2DAQ A;  3CPF A;  3G71 A;  4XTZ A;  4BE1 A;  5GAN h;  3OYL A;  1N9R A;  2CGH A;  4XU3 A;  3OYI A;  2CS7 A;  4TVR A;  2XD0 A;  2QTX A;  4JJN K;  2DVE A;  1WJR A;  2KY9 A;  3BDL A;  3FLG A;  3QZ5 B;  3QZ9 B;  1UB4 A;  4DOV A;  4EMK B;  3V8J A;  5A0G A;  1VIF A;  1IZ6 A;  1QW1 A;  3M56 A;  5GAN 4;  2E12 A;  5IT9 E;  3S3N A;  2XDD A;  2LQK A;  3OSV A;  4HCC A;  3JB9 H;  5HY6 A;  1VQK T;  2RA2 A;  3RUX A;  3CCE T;  2VC8 A;  1X6O A;  5FU7 B;  5GAN 7;  5GAO n;  3E19 A;  3R6O A;  3JB9 J;  3NFC A;  4JRI A;  2EKO A;  2DJZ A;  2PUO B;  3VUZ A;  3KBG A;  1EIF A;  3VU3 C;  3JCM P;  4FIB A;  4IUR A;  2E1H A;  3G4S T;  5GAO r;  2RHZ A;  2X4W A;  3GP8 A;  2QA4 A;  4BAC A;  1R8O B;  3JCM W;  4M7D E;  2XHC A;  3CCU T;  5DY9 A;  4IUT A;  1P92 A;  2I2L A;  2XK0 A;  2K2V A;  1XNI A;  3PMT A;  1ZBX A;  4Y91 A;  3URG A;  3CCR A;  5KCO A;  3J7A F;  1XQH A;  2RI2 A;  2RHY A;  3MEA A;  3SD4 A;  5LJ3 d;  1Q7Y U;  1K9M U;  4R56 A;  4LD9 K;  4ELY C;  3VYG A;  4L5G A;  2LCL A;  4QQD A;  3CBP A;  5GAN 2;  3KUF A;  4M78 F;  3LH0 A;  5GAN f;  3HFN A;  2ZPB B;  1JBM A;  3OBY A;  2E6N A;  4JRK A;  5J26 A;  4MZT A;  1KQ1 A;  3GNG A;  1KD1 U;  2EQJ A;  2E10 A;  3S3M A;  4NOY A;  1VQ8 T;  3I56 A;  2R57 A;  4JS4 A;  3OSS C;  3Q1J A;  4J6X A;  4C8Q A;  3BFM A;  2XKO C;  5CKE A;  4EMK A;  4OMF B;  1YHQ T;  3HRT A;  2FYK A;  3QKJ A;  2MWP A;  2YLB A;  3P8B B;  4C8Q G;  1BYM A;  2M1H A;  2HQX A;  3DB3 A;  3HFO A;  2A7Y A;  3OW2 A;  1YJN T;  3RES A;  3OYY A;  4C0F A;  2QEX A;  5GMK j;  4M7A C;  1FXX A;  2JUF A;  4IUP A;  2HD0 A;  2OTL A;  5CQX A;  4M75 E;  3I55 A;  2MI6 A;  2O4X B;  2QQR A;  3E9F A;  2RI3 A;  2VYT A;  2CKK A;  3SWN C;  4CI0 C;  3H6Z A;  4GY5 A;  2R5A A;  2G3R A;  2E41 A;  4X9C A;  3HHT B;  3A5Z B;  3I56 T;  4M77 E;  4QQG A;  4BE0 A;  3TU4 K;  2Y4Y A;  1X01 A;  2LRQ A;  4OB1 B;  1JJ2 S;  4XQ3 A;  3OYH A;  5CIU A;  5M9O A;  3CCJ T;  3OY9 A;  5LJ5 h;  3CMA A;  3CCV T;  1M90 U;  3OYK A;  4R55 A;  4C92 D;  4N0A C;  4BUG A;  1AHJ B;  3PFS A;  2CZ6 B;  2EFI A;  5LJ3 h;  3V8L A;  3M54 A;  3OYN A;  2RJE A;  1WJS A;  2ZGW A;  1S72 A;  1YJW T;  4DOW A;  4ZGJ B;  2RK1 A;  2XG8 D;  4M78 C;  2QDY B;  4QVZ A;  3X24 B;  5KE3 A;  3CCJ A;  1M8V A;  3MP8 A;  3FB9 A;  2P4T A;  1W4S A;  4M7D C;  1Q7Y C;  5CO7 A;  1Q82 U;  1WNL A;  4KBM B;  3CC7 A;  4IUU A;  1Y7X A;  2JVV A;  2PU9 B;  4NS5 A;  3P8H A;  1KD1 C;  4JDS A;  3EAE A;  1KQ2 A;  3RER A;  4MDX A;  2ZPH B;  4A4E A;  4M78 G;  4F7U E;  2WAC A;  3H8Z A;  4C8Q E;  3JCM e;  2LVM A;  1YJN A;  4OB2 B;  1NZ9 A;  3PT9 A;  2RD1 A;  2RHI A;  4M78 A;  1KHC A;  4KUI A;  2V8I A;  3WVD B;  2DK3 A;  2LNV A;  2PVD B;  3RKX A;  3CXC S;  2HAX A;  2O4X A;  2WSF E;  4RMO A;  4YTL A;  3CCM A;  4C92 A;  3A8G B;  4Y28 E;  4II1 A;  4M78 B;  4C8Q D;  5I2S A;  1Y96 A;  1O9S A;  4MZP A;  3L2R A;  2F5K A;  3GLX A;  3ZBD A;  5I21 A;  4X9D A;  3HL8 A;  3JCM b;  3QPH A;  4C8Q F;  2E65 A;  1VQ9 T;  3JCM J;  4J8O A;  4A4F A;  4HKE A;  1VUB A;  2K5I A;  3ZFJ A;  3PTA A;  2CZ7 B;  4ZTF A;  4Q5W A;  4C0G A;  1I8F A;  4HCB A;  2X4Y A;  5CCA A;  3CC7 T;  3MEW A;  2JZ2 A;  3OA6 A;  4M7A E;  1VIE A;  3GNF B;  3QYG B;  4OF1 A;  3NTH A;  4J7I A;  2MMP A;  4A54 A;  1Q82 C;  1KQS A;  4C5E A;  1IRE B;  1HK9 A;  2XU8 A;  2K3X A;  4MZM A;  5J39 A;  3LWI A;  4FSX A;  4E7L A;  3CCU A;  1YJW A;  4ZN3 A;  3JCM X;  3NTI A;  2QA4 T;  4MMK A;  3L2V A;  4M7A B;  3CCL T;  2DXC A;  1VQ5 A;  1K73 C;  4E7I A;  1G3W A;  2ZPI B;  1Y71 A;  1N6A A;  1PSF A;  3E1S A;  5GAN 3;  3CCE A;  4M7D F;  4WF2 A;  2E5Q A;  4M78 D;  5LJ5 j;  2KVQ G;  3HP9 A;  2WSE E;  1G3T A;  4JLG A;  1NJI C;  1Y96 B;  4FU6 A;  4FT2 A;  5KE2 A;  5DLO A;  2IVW A;  3A8O B;  3MHX A;  5L8R E;  3CC4 A;  1DJ7 B;  4JUV A;  1WPY A;  3RMQ A;  5CAI A;  3JCM f;  3OS1 A;  2ZCF B;  2HQE A;  2ZZD A;  3HSB A;  2KDS A;  4PJO C;  4F7U F;  2EQM A;  1KG1 A;  3ZEH A;  4M7A F;  3BDU A;  4LDV A;  3G4S A;  1U1S A;  5GAN 6;  3VV0 A;  1YIT T;  1N27 A;  2GFA A;  3M4G A;  3M9Q A;  5GAO p;  4XAX B;  1KC8 C;  2YHT A;  4LDU A;  1O75 A;  1JB0 E;  1BIA A;  2LDM A;  2KSS A;  4EMK C;  2RHX A;  3GIB A;  3JCM V;  4QVC A;  3F70 A;  5CKH A;  4DQ2 A;  2VGN A;  5CVI A;  2MF2 A;  1I81 A;  2RHU A;  4RCC A;  1VQL A;  3KXT A;  1QP2 A;  2RH2 A;  1VQ8 A;  4C0D B;  3CME A;  2C06 A;  2KQW A;  3L1A A;  4C8Q B;  1UEB A;  2MWO A;  4C0Z A;  4XTX A;  3CD6 A;  3CCL A;  1BI3 A;  2L3R A;  4XU1 A;  1OZ2 A;  2V8K A;  2PUK B;  4BI3 A;  3OB9 A;  3OBW A;  1I5L A;  2EYQ A;  3AHU A;  4L6V 5;  2RM4 A;  3BY7 A;  1YBY A;  5GMK m;  1W2B S;  1FX7 A;  2DEQ A;  5LJ3 j;  1B34 B;  1K73 U;  4OP0 A;  5GAM j;  2VGM A;  1Y07 A;  2P0P A;  2XDP A;  2DIQ A;  1BI0 A;  4ELZ C;  4HT8 A;  3LGL A;  3OMC A;  5CKD A;  3OYF A;  3LX7 A;  2RB6 A;  4VUB A;  2QI2 A;  4M75 F;  5GMK i;  4FM4 B;  5IN1 A;  3L42 A;  2B8A A;  3FRN A;  5GAN g;  5A2Q E;  1V29 B;  4V2S A;  2A3L A;  4BE2 A;  3JCM g;  4M75 D;  5GAM h;  3JB9 I;  4HT9 A;  2BKD N;  2OAU A;  3CPW A;  5LJ5 d;  3OYJ A;  2DZ9 A;  3VKI A;  2DTO A;  4D6W A;  1RL2 A;  3QDR B;  1RI0 A;  5HK3 A;  4NL2 A;  2KAF A;  2AHJ B;  4PL6 A;  3UT1 A;  5EG2 A;  4ZTJ A;  3PNW C;  3PIP A;  3G6E T;  3OW2 S;  2DPP B;  2D0Q B;  5CQY A;  3CBM A;  1K8A U;  4C92 G;  2QQA A;  3JB9 F;  1I4K 1;  2ZPE B;  2D9T A;  2O01 E;  5GAM e;  4NL3 A;  4PLI A;  1M1F A;  1HXD A;  2VUB A;  4KT0 E;  5C0M A;  5LJ3 e;  2E6Z A;  3J81 E;  1VQO T;  3UDC A;  1YJ9 T;  3JB9 D;  3M4Y A;  2LT1 A;  1YIJ A;  3CC2 T;  4QW2 A;  1VQ4 T;  1UGQ B;  4BI8 B;  3WVE B;  3FDR A;  2QQ9 A;  2CZ1 B;  3OMG A;  3RKY A;  1YIT A;  3A8H B;  3QBY A;  4N0A A;  4BY6 C;  2K4Y A;  3OYA A;  3MO8 A;  4P5N A;  4EPC A;  2ZPF B;  3LWH A;  2XID A;  3V7R A;  1Q86 C;  4OB0 B;  2Y4X A;  1S72 T;  4RCB A;  3WXM B;  3CC4 T;  2M16 A;  5HKC A;  1QVP A;  1VQ7 T;  4M7D G;  2EAY A;  3SFM A;  3O8V A;  4XTV A;  1BI1 A;  2WSC E;  5LJ5 g;  3HKS A;  4M75 G;  3RMS A;  1W2B A;  3VUB A;  1WGS A;  2DD5 A;  2ZPG B;  3CEY A;  3M5A A;  5FRO A;  5GAN e;  1KQS S;  1G5V A;  4C5H A;  4J83 A;  4LD6 A;  4XU2 A;  3GPL A;  3OYM A;  1QVF S;  2QQB A;  2E70 A;  4GLK A;  5I2M A;  1GXI E;  4KUD K;  2LX9 A;  4B9W A;  1XOV A;  3CCV A;  3PGG A;  1KC8 U;  3M55 A;  5D6X A;  1D3B A;  3A8M B;  3JAM E;  4M77 F;  1YCY A;  3LGF A;  3P8D A;  4J6Y A;  2RJF A;  4KUL A;  5AYF A;  4EDU A;  5GAN j;  2RJC A;  2H3J A;  1YIJ T;  1M1G A;  1WQ7 A;  2KMT A;  1G3S A;  1LNX A;  3OYE A;  4IUV A;  3SB2 A;  3TEE A;  3OYG A;  3CPW S;  2VXF A;  1BIB A;  1MGQ A;  4F7U B;  5LJ5 e;  2XI9 A;  1VQN T;  2OTJ T;  5GAN d;  4UC4 A;  5IAY A;  5CK9 A;  4JLI A;  5CR2 A;  3FIF A;  4BD3 A;  1VQ9 A;  4PLL A;  5CKB A;  3ER0 A;  3E9G A;  3V7C A;  2LTO A;  2HBP A;  4PKC C;  1VQ4 A;  1YI2 T;  2JNG A;  2EIF A;  4EMH A;  1VQP T;  3M58 A;  4J7F A;  4Z02 A;  1QVF A;  2QXF A;  3G6E A;  1QP3 A;  3SDZ A;  3L2Q A;  3V7S A;  3EFS A;  4FL6 A;  3T9N A;  5LL6 S;  4E7J A;  4PJO G;  4DA4 A;  3CCM T;  3INZ A;  1VQ6 A;  4E47 A;  2Y90 A;  3FC3 A;  1K9M C;  2PQW A;  5D6W A;  4M78 E;  4F7U G;  3LYI A;  1VQN A;  1NPR A;  3UPU A;  2V8J A;  5FU7 C;  1VQ5 T;  3LLR A;  4OGE A;  5HK0 A;  1QVG A;  2X35 A;  2YLC A;  2L8D A;  4BY6 B;  2X4J A;  3C12 A;  2DXU A;  1OZ3 A;  3HPW A;  2M0O A;  4MML A;  4RKU E;  3CCR T;  4C92 C;  5FRN A;  3QII A;  3ME9 A;  3NTK A;  4LDW A;  4A4H A;  2DTH A;  4ZN1 A;  4N4H A;  3OYB A;  1OI1 A;  1M1K U;  4A4K A;  4C8Q C;  1M9S A;  2EJF A;  4FT4 A;  4M75 B;  4M77 C;  1Q81 U;  1VQL T;  1QVG S;  1LOJ A;  1NPP A;  4M7A A;  5KH6 A;  3UWN A;  4EMG A;  3JCM d;  1U8R A;  4BB7 A;  1UGS B;  3CD6 T;  3CBO A;  5D6Y A;  4ZGD B;  2DXT A;  4BDZ A;  4X34 A;  1VQK A;  1VQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...