4RG6A

Crystal structure of apc3-apc16 complex
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
498
structure length
474
Chain Sequence
QEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an APC3-APC16 Complex: Insights into Assembly of the Anaphase-Promoting Complex/Cyclosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cell division cycle protein 27 homolog
total genus 160
structure length 474
sequence length 498
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg6A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg6A03
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg6A04
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg6A02
4KYOB 3FFLA 4EQFA 4XI9A 5EX0A 1A17A 4U0SA 4JHRA 3LY8A 5KJKA 3BEEA 4YVQC 1ZBPA 4HOTA 4XIFA 5BW8C 2FBNA 3VTYA 5LCWJ 5BNWA 3CEQA 3ASDA 2C0MA 2VGXB 3AS8A 3MKRA 4UQYA 3O48A 4GCOA 4H7XA 5FZSA 4JA9A 3Q15A 2OOEA 5D0QD 2BUGA 1FCHA 2IFUA 3GW4A 3KS2A 4GYOA 5DBKA 2UY1A 2WPVA 4J8DA 5A7DB 3S7BA 3VTXA 2PZIA 2UY1B 3UPVA 1KT0A 3LY9A 3LYAA 3PE3A 4WUYA 5JJ7A 3ULQA 3Q4AB 2XPIA 3GZ1A 2P58C 3KAEA 1KT1A 4Y6WA 4N2QA 2IF4A 3AS5A 4J8EA 3UQ3A 3MEKA 5HI7A 2C2LA 2Q7FA 3CK8A 3OXLA 3S7JA 1HZ4A 1ELRA 2YHCA 4G2VA 4GYYA 3CVNA 1QQEA 3CVLA 4IN3B 4BWRA 4GA0A 5BT1A 4GA1A 1B89A 3LY7A 3GYZA 3OXFA 4I2WA 4KXKB 4UI9C 2J9QA 3MA5A 4YVOA 3LKUA 2KCKA 4YNDA 5A6CA 1W3BA 2I6HA 4UQXA 3ZFWA 3OXGA 2FI7A 1NA3A 3UUXA 4Y6CA 3TG5A 2VSYA 4UI9K 2LSVA 5FZQA 2XGOA 1KLXA 3K9IA 2KCLA 3LPZA 4G1TA 5FJYA 3ZHEB 3URZA 3TG4A 2FF4A 5G04J 2L6JA 3CVQA 2DBAA 3Q47B 4UQZA 2PL2A 1PC2A 4J0UA 5G05J 1IHGA 4I9EA 3ASGA 3SZ7A 3S7DA 3WXXA 2UWJG 2VSNA 4JL0A 4A1SA 4BTBA 5HQ8A 3E4BA 5EX3A 4CGWA 3AS4A 3EDTB 3GZ2A 4AM9A 1NA0A 2KATA 4N3CA 4CGVA 4U07A 4N3AA 3U4TA 3ZHEA 3PDNA 5AYWD 2PQNA 3R9AB 3CKBA 3SF4A 1HXIA 3RJVA 4GYWA 3MV3B 2XCCA 4BTAA 4W9RA 2YQ8A 4NRHB 1IYGA 4GA2A 5M72A 3ZN3A 3NF1A 4APOA 5FTPA 2VQ2A 2NC9A 3QOUA 4G24A 5ARGA 2VYIA 3QWWA 4N5CA 2FEZA 4AIFA 5KJLA 4LEUA 1WAO1 1NZNA 1Y8MA 4ME2A 3CV0A 5CHEE 3ZGQA 4GPKA 2HYZA 3QWPA 4WNDA 5C1DA 2WQHA 4O6FA 2KCVA 4UI9J 2VGYA 1WM5A 2HO1A 2JLBA 2KC7A 2XEVA 3QDNA 4N39A 5G05C 3S7FA 4WNFA 4I9CA 4RG9A 4BT9A 5JJ6A 4GZ5A 3N71A 3ZPJA 3CK9A 5KJMA 3CKCA 2XGMA 2V5FA 2Y4UA 4B94A 5FZRA 1ELWA 4G23A 4CDRA 4F3VA 5CCMA 2PQRA 3QWVA 1XNFA 4JA7A 4I17A 3HYMB 4ABNA 2E2EA 2Y4TA 4GZ3A 1P5QA 4RG6A 3Q49B 4H7YA 4U04A 4WNEA 4J8FA 4N3BA 2AVPA 3TGOA 4U0UA 1TJCA 2ONDA 2XCBA 3CK7A 4KBQA 5ARFA 4HORA 2FO7A 1OUVA 3FWVA 2LNIA 4WNGA 4GZ6A 3ASFA 3RO2A 3RO3A 4NQ0A 3LCAA 2R5SA 5KJNA 5LCWC 4GCNA 1QZ2A 3TAXA 4AY5A 3MV2B 1HH8A 3ASHA 3IEGA 3PE4A 4HOQA 5D0OD 5DIZA 3RKVA 1E96B 3U3WA 5FT9A 4XI0A 3RIBA 2MHKA 4I2ZA 4U0ZA 2GW1A 2XGSA 3Q5MA 3ESKA 4HOUA 3RU0A 2QFCA 3FP3A 2C0LA 3QKYA 4G26A 4G25A 4I1AA 1YA0A 2HR2A 4AY6A 4BT8A 5CCLA 4N2SA 2VGXA 3CVPA 3KD7A 5G04C 4HOSA 1ZU2A 3JYSA 5EKQD 2LSUA 5JJTA
chains in the Genus database with same CATH superfamily
2XEHA 2X6IA 1TNYA 3E30A 3ASDA 3IKOB 3UM2A 3BU8A 2WXIA 3S2AA 2OOEA 4GYOA 1OXJA 5A7DB 4APFA 3T5XA 3AS5A 3ML8A 2LUHA 5HI7A 3ZXSA 3OXLA 5HS0A 5BXUA 3U66A 2CG3A 2AXVA 3HXFA 4CDNA 5A23A 1W3BA 4J6IA 1E7VA 1N52A 1PC2A 4QQIA 1ZU2A 4CGWA 4GTMA 2F37A 4OAUC 3LXUX 1XGWA 3TL5A 4BTAA 2AWIA 5M72A 3L17A 3ZRHA 3CHMA 1WAO1 4DI4A 3MKQB 4GPKA 2HYZA 5H7PA 4MKTA 5KJMA 4OVVA 4B8CB 1N4QA 3HYMB 1TYQG 4U04A 1OCZE 1H19A 3UXGA 4HNAD 3RO2A 4BSXA 3HG0D 2P9SG 3IEGA 2GW1A 3ZIMA 3FP3A 4TXQA 3EUVA 2VGXA 3L13A 2CFZA 3UT4A 4X8QA 4HOTA 3O4ZA 4FHJA 3AS8A 4JA9A 2IFUA 3E33A 4J8DA 3P2BA 4K0RA 5JJ7A 4DI3A 2L0TB 2AXUA 3TWQA 2Q7FA 2GRRB 1BD8A 4DLQA 3ISMC 2HE0A 2XGOA 4BESA 2WXGA 3HVEA 4I9EA 4A1SA 4BY6A 4EPZA 2CFUA 2PQNA 4FULA 1E7UA 1MX4A 1H6OA 4ZFHA 2LAIA 4G24A 3ZU7B 4N5CA 3EHRA 3CGHA 3DSTA 3CHRA 3CQGB 2XPZA 1K1BA 2AXZA 4RG9A 4GZ5A 3N71A 1K8KG 1DCEA 4RSYA 3PRZA 4LNUD 4ABNA 4RG6A 2WXNA 4KBQA 1E8YA 4K5AB 4M3OA 4NQ0A 1N9AA 1V54E 3RRMB 4HOUA 3ULEG 4N2SA 4RQIA 3CVPA 3ZKJA 5G04C 4CT0A 2GRLA 4U0SA 5KJKA 2PNNA 2RG8A 4C48B 3VTYA 1H2TC 4AV7A 1D8DA 1SQMA 3MKRA 4U8HA 1FCHA 1MX6A 3LVQE 3UPVA 3EIQC 3GZ1A 4K5BA 2IJGX 1YMPA 3CK8A 3EHMA 2V5QC 5T3RA 4GA1A 4I2WA 4FADA 3MA5A 2VSOE 4I1MA 3W9FA 2KCLA 3ZHEB 3QARA 1ELKA 5G04J 4ACKA 3RK6A 4HBDA 4ANXA 4DX6D 4JVSA 2NSZA 2IOSA 1Z3XA 4JEHA 2I1JA 3TWTA 2ETAA 1UOHA 3NZUA 2WXFA 1H0AA 3QWWA 4ZHBA 3CR3A 4HFGA 4LUNU 3FU5A 4KZCA 2KCVA 1UN8A 1WM5A 2HO1A 4N39A 1D8EA 3UI2A 4UWFA 4CDRA 5FINA 1MJ0A 3TGOA 1SW6A 2KXPC 4RVBA 4B93B 4YDEA 4G8LA 3HVEB 3HXBA 4FJZA 3U3WA 5B3SE 4OYSA 4HXIA 1G3NB 3D9HA 2R03A 4JPSA 3P1UA 3B7RL 3L08A 4BX9A 3LY8A 4AXHA 2VTBB 3FTSA 4KZ0A 3V79K 3ML9A 3L82A 2H6GA 4AJWA 2AW6A 5AQ7A 2DCPA 2WXRA 3AG1E 1DC2A 4Q94A 3TWRA 5CBNA 1UJJA 2KCKA 4CGVA 3C98A 5EIDA 3PUKA 3Q47B 4J0UA 2ZU6B 4N3CA 2DWZA 3SF4A 3IXEA 3Q7AA 4HRLA 1IYGA 3ZN3A 2IONA 4HI8A 5EILA 3T8KA 4F1SA 2WXMA 3S7FA 5J90A 3ULYA 3G2UA 2BKKB 3C5RA 4NACA 5FQ4A 1BI7B 4EBAG 3PZDA 3D9LA 1TNZA 2KZTB 3LCAA 1E8ZA 4KVMA 1HH8A 3V31A 1OWLA 4CEMA 4DX7D 2F0YA 1KZPA 3G2VA 3RU0A 2XZDG 3Q9NC 4IRUA 4BT8A 1RW2A 3D9NA 2EILE 3KD7A 1EPUA 3RRUA 2GRMA 1N94A 2X6FA 2DYSE 5BW8C 2C0MA 3MGBA 5FZSA 4GTSA 4OAVB 3SFYA 5KNHD 4JEUA 1TN7A 1O1TA 2YHCA 4GYYA 4E6HA 3KEZA 3SFZA 4GMJA 5A6CA 2OVFA 4IYPA 2LSVA 5AAOA 3ZYMA 1OY3D 3CVQA 3IV0A 4PS8A 1IHGA 1OWPA 5HQ8A 3AS4A 4G8KA 4GU5A 1HG5A 4FLBA 4UWLA 3HXEA 4JB8P 3FUKA 2FEZA 3LS8A 1HFAA 1TNOA 1MYOA 3FUNA 3UT8A 3NOGD 1SVXA 5ENPD 4IULA 4EZLA 3Q49B 4J8FA 2FO1E 3CK7A 1OUVA 5CMWA 4B89A 2V4HC 1YCSB 3RO3A 3PZ3A 2EIME 1V55E 1FVFA 1MHQA 2X6KA 4HOQA 3FUFA 3FULA 2Y0BG 1QBQA 3PEUB 2H6HA 4I1AA 3E37A 4AIFA 4KYOB 3FFLA 3U9WA 1ZBPA 3I3NA 1AWCB 1SZ9A 2B6CA 4WUYA 4F7AA 4Y6WA 3FY4A 5EIBE 3TWVA 3BUAA 3UQ3A 2A4ZA 2J07A 3FTVA 3E34A 2WQ6A 4B8AA 2DZNA 1E90A 4IN3B 2MRIA 1KPSB 1S0PA 4YVOA 4UQXA 1JUQA 1NA3A 3UUXA 2BEDA 1WDYA 4UI9K 2VSXE 4DK5A 4GZCA 1VDYA 2WB2A 3U4TA 1L5JA 3T8MA 4GPMA 4GB9A 5AQAA 1MX2A 2P9UG 3D3MA 2VQ2A 2J09A 4WWPA 4F53A 1WY6A 4WNDA 2WQ7A 1ELWA 3U64A 1NI1A 1H2UA 4C9BB 1A5EA 4C0MA 4H7YA 2RD0A 3VLDA 4EHMA 5KJNA 5EDSA 2GRPB 1BU9A 3CHPA 2HM8A 5FWQA 4TRQA 3FTYA 5ANLA 3G2WA 4I2ZA 3SD5A 3ASNE 3HDXA 3JYSA 4XI9A 2GGFA 4YVQC 3AG4E 5BNWA 3FTWA 4UWGA 2QYUA 4O1OA 2E0IA 3OAWA 5D0QD 1QYMA 4OVUA 1PAQA 2XEEA 5AJDA 2UY1B 3EHQA 2DYRE 3PE3A 2P58C 1OCOE 4A63B 3NAWA 2CHWA 2C2LA 4J7WA 4BERA 5HRYA 3R7RA 1JWGA 2DVWA 3GYZA 4KXKB 2WXLA 4HS2A 2I6HA 2JABA 1KLXA 4L2LA 4ATZD 4D10C 3DSUA 1H2VC 2X6JA 3S7DA 4MS6A 3FH5A 1NA0A 5CERB 3B7UX 4I43A 2M63A 3R9AB 2H6FA 3RAUA 5D66A 5FQ7A 3B7TA 1LD7A 4GA2A 3NF1A 5FTPA 2J08A 2NC9A 3DWLG 2CHZA 3DXKG 5LFAA 4A3VA 5T4YA 4TXPA 4HI9A 3Q78A 2Y4TA 4HQDA 2RFMA 4KT6B 2PM6A 2AVPA 3ZEFA 2Y3AA 2ONDA 2EIKE 4FHKA 4DLOA 3SHFA 4JHJA 2YHEA 2IQCA 5LCWC 4EZJA 1E96B 4XI0A 3PVLA 4U0ZA 3ZYLA 3ESKA 4HRMB 5EKQD 3DEOA 3APCA 3EIJA 3LJNA 2FBNA 4I6JA 3CEQA 4XKBA 2PM7A 4H7XA 3Q15A 2WXOA 4K5CA 3SBTB 4O1PA 4Q96A 3B7BA 1EF1C 4J8EA 3AAAC 4HB5A 4JW1A 2IU1A 3UM3A 4PS3A 5KCMA 1DCQA 1UN9A 2F8YA 1EYHA 5FIOA 4YNDA 2FULA 2F8XK 1IHBA 4Y6CA 3I4RB 4I1OB 5JA4D 1H6KA 4RLYA 1JCRA 3FU3A 2DIWA 3PEVB 1FVHA 4YDYA 4MRUA 1QNFA 4DX5D 2DZOA 2P9KG 4AP2A 5BV0A 3MV3B 3UT7A 4HVBA 2QYJA 4APOA 5E75A 4ANWA 2ZISA 1NZNA 1Z6TA 1O5MA 4GAAA 3SNXA 2J4DA 4DPRA 2X38A 1S64A 5EYLA 3L16A 1X5BA 4LCTA 3QJZA 5BPPA 3AG2E 4U0UA 3UMVA 3D9IA 2FO7A 3FWVA 3ONKA 2A5EA 4GTOA 4DUIA 4UUCA 5FT9A 1HU3A 3Q75A 1TN8A 2NXPA 3F6QA 4L7TA 2WM9A 4JHRA 1OCCE 3DPDA 4ANVA 4U95D 2CG2A 4GCOA 5CEDB 5DBKA 3FUDA 1TEZA 3Q4AB 3KAEA 2IF4A 2IO2C 2XQ0A 2I1KA 5LX8A 1QQEA 3FEXA 3CVLA 1U2VG 3OXFA 2R02A 2XHEA 2J9QA 3ZFWA 2MOWA 4K03A 3ZGQA 4BX8A 2FF4A 2L6JA 2L0IA 2DBAA 5FQ8A 4LNBA 2LXMA 4BTBA 3LJ3A 4BFRA 3GZ2A 2IEJA 3MKQA 4ATGA 2I9CA 3RJVA 3TWXA 3V2XA 2H6IA 3CIAA 1Y8MA 5CHEE 5ANRA 3QWPA 5T8IA 4O6FA 2JLBA 5AJLA 3SFXA 3X2QE 3CKCA 4GTQA 2XGMA 2Y4UA 3VLFA 3MYVA 3QWVA 2YNQA 2E2EA 2X3MA 4N3BA 3UTMA 2IO3C 3TXNA 4FLHA 3JXJA 3G2SA 3CVVA 3DSXA 3ASFA 1GW6A 3V30A 2ZGGA 1AP7A 1TN6A 4ACLA 4DRXE 3SGHA 1H6PA 1K3ZD 4AY6A 3ESLA 5J08A 2LSUA 2LAHA 1UG3A 1N0RA 3ABKE 4PDXA 2ETBA 5LP0A 2NYJA 3QNKA 4MBGA 3DSSA 1Z5SC 2VGXB 5BV1A 3O48A 4LG6A 4JC8A 4XKCA 2UY1A 2WPVA 1S70B 2OV8A 4G2VA 5CRUA 2OVBA 3AU4A 2WXJA 2CHXA 2VGEA 2XRZA 5B1BE 3FEYA 3K9IA 2J4BA 4JZYA 1X81A 5EN5D 4UQZA 3HXCA 3ASGA 2VSNA 3FUHA 2AJAA 2V0PA 4AM9A 5KNGA 4N3AA 3UKUG 4A55A 4U63A 2XCCA 2IY0C 3QOUA 5KJLA 4LEUA 4ME2A 3B13A 2XEVA 2VTBA 2WMNA 4I9CA 4BT9A 3APFA 4F6RD 1JPLA 5CCMA 4HRNA 4L2YA 1XNFA 2L6BA 3PNTB 2QC9A 2BKGA 4TV3A 4U8YD 1QZ2A 3CVUA 3PZ4A 4BEPA 3L22A 4HLLA 3JQ0A 4B0ZA 4XIFA 3LDZA 1FT1A 3SY2A 1HX8A 5AN8A 1ZB1A 1PY1A 2PZIA 3JXIA 1KT0A 1Z3YA 4A1GA 1KT1A 1DNPA 4P29A 1HO8A 5AQBA 3CVNA 5ENNA 2X6HA 3LY7A 1N4PA 4R7LA 2WXHA 2WXQA 2VSYA 4PS7A 4CDMA 3URZA 3HXDA 3WXXA 5CEAA 5ITZF 4WAFA 4U07A 3ZHEA 3KSLA 1OWMA 1JWFA 4NRHB 2P9PG 2VYIA 1BPOA 3AU5A 5B1AE 2WQHA 4UI9J 5G05C 2BF0X 3CK9A 4N5QA 4FC8A 3HRAA 4BSZB 4ILIA 3E32A 4I17A 4GTVA 1INZA 3CHOA 2XCBA 4FP7A 1EDUA 2A5UA 4Q69A 3ASHA 1N0QA 3FHEA 3L6AA 3Q5MA 4ILGA 4LNGA 3IHYA 4G25A 3ENEA 3QAQA 2I2OA 1BLXB 3FTUA 4AEZC 5LCWJ 3UM0A 1JCSA 4UQYA 1Y6IA 2R59A 5CRVA 2XPYA 4EZKA 3LY9A 3NBNB 5HKPA 2BTDA 3EU5A 2ZXWE 1NP7A 4A3TA 2WMOA 3D9PA 2GRNB 4U7EB 5CBOA 1SA4A 3SI5A 2XS8A 3CVWA 5ENTD 4G1TA 4BETA 3CHQA 3PH0C 5EX3A 1LD8A 2LXLA 1OT8A 1IKND 2XENA 3RSEG 1NFIE 1HXIA 3CVYA 3FUIA 1YYHA 1HG2A 4WNFA 3ONLA 4CT4A 4B94A 5FZRA 4MLPA 1JCQA 4JA7A 1P5QA 1TNUA 4XX5A 5JHBA 5ARFA 4WWNA 2R05A 2P9NG 1FT2A 2WXPA 2OCCE 3UINC 3SQVA 5JHAA 4LERA 3RIBA 2MHKA 2QFCA 3QKYA 3UM1A 1YA0A 2HR2A 4UWHA 3NZSA 1N4SA 4HOSA 1D9SA 5AQ9A 1IQUA 3BG1B 4DX1A 3NOCD 3APDA 4L1BA 2BUGA 1RZ4A 3GW4A 3ZUVB 4QFVA 1NL4A 1N95A 2XPIA 1SZAA 4N2QA 3CVXA 5LOZA 3CLJA 4TUMA 2P9IG 4L9PA 4I6EA 4GTTA 1OWOA 3LPZA 4V3IA 4GZDA 4FA6A 3T9KA 4JD2G 2RFAA 4LSZE 1TJFA 2GROB 3J5QB 4GYWA 3ZXPA 3T5VA 2EQXA 2LO6A 3ABME 4EBAA 4URKA 2VGYA 4XZ4A 3QDNA 4AVXA 2KC7A 5JJ6A 5ENQD 3DSWA 4GTPA 4F3VA 3EJNA 4G23A 3TJPA 2IOLA 2KBXA 1HF8A 5AIJA 5ENSD 2OEWA 2OEVA 1TJCA 5AARA 4O60A 4LRZA 4GCNA 4AY5A 1LTXA 2WVIA 3KEAA 3B95A 3RKVA 3GZSA 3TWSA 1Q2ZA 4JXTA 2XGSA 3ASOE 4J8SA 3TWUA 1KZOA 2XS1A 5CMYA 3W9GA 3Q79A 4EQFA 3BEEA 3D9OA 5BXOA 4CYMD 4DJAA 5EX0A 3KS2A 3S7BA 4YDWA 1E8XA 3SBSA 3LYAA 1TNBA 3WG7E 3CSFA 1N4RA 1N54A 3LEWA 4JHKA 4GA0A 4KVOA 4F1PA 3CSTA 5C2YA 3FTZA 3LKUA 2FI7A 3TG5A 2B0OE 3C72A 3SO8A 5FZQA 4HORA 3TG4A 2QZAA 3FUJA 2PL2A 3DPYA 5G05J 3SZ7A 1WG0A 2MYOA 2KZTA 3FH8A 3I5PA 2KATA 5AYWD 3ZVVA 4TXRA 1FPPA 3C3RA 3MJWA 3I4GA 3DEPA 5ARGA 3CV0A 3BG0B 5C1DA 3IHVA 2J49A 3ZYQA 4Z68A 1S63A 2Y1LE 1MZCA 4WNEA 3JQ1A 3BQOA 3UX4A 2XZTG 3Q7FA 3R7QA 3FUEA 3L54A 3MV2B 5DIZA 3PS6A 5KWDA 3QC1A 4L23A 2C0LA 2JEKA 3HIZA 3NQPA 2GRQB 3JUIA 1IXVA 2P2CP 4DX2A 1A17A 3FDHA 4WWOA 3HHMA 2L9BA 3QK0A 4J8YA 3VTXA 3IBEA 3FU6A 1MQSA 5FQ6A 3VLEA 2V8SE 3R9MA 3RRNB 3LVRE 5AENA 5G2NA 4CRWA 4BWRA 1OWNA 3J5PA 5ENRD 3FTXA 4KMOA 1O1SA 1SA5A 3CHSA 3DRAA 4XEIG 2ZGDA 3UIOC 1HS6A 2WXKA 3DBSA 4C0EA 3OTNA 2ZIRA 4JL0A 4CZ2D 3CQCB 3E4BA 3EDTB 2EINE 4U96D 3D9JA 4PUCA 2QY7A 2ILRA 3PNLB 2YQ8A 5EYPF 3ZYKA 4GTRA 3AJIA 3D9MA 1K1AA 1N11A 3V2OA 3D9KA 4GMRA 1U3CA 5KBAA 1OCRE 1O1RA 2V5FA 3PUJA 3L9TA 5E76A 5IY5E 4GZ3A 4U8VD 4NURA 4WNGA 3PZ2A 3UIPC 2VJ8A 4ANUA 5BUZA 3EHNA 3JUEA 1E8WA 3PE4A 1UJKA 3FUMA 3Q9UC 4PH4B 3MCXA 4YDOA 4G26A 5JMND 1HE8A 4E85A 4EECA 3QB2A 4M7CA 4GMLA 3ZNGA 1DVPA 2V4LA 5D2MC 4FJYA 4HLEA 1U3DA 2XRYA 2ETCA 2Y69E 1BI8B 4TUUA 3ULQA 4ILHB 3FU0A 3MEKA 3S7JA 3KSQA 1HZ4A 1ELRA 3UKRG 5BT1A 1B89A 4UI9C 1IQRA 3JCKC 3B7SA 3OXGA 2R2LA 2EIJE 5FJYA 3ZW3A 5CECB 3DSVA 4UWKA 3TXMA 4NIKA 3NB2A 3Q73A 2UWJG 3PREA 2YINA 3G2TA 3PDNA 2J8SD 3CKBA 3AG3E 5G55A 2R17C 3EU9A 4W9RA 5ENOD 1LF8A 2KM4A 4CCAA 2RKKA 3C3OA 1UW4B 3ZPJA 3FH7A 4XE0A 3ABLE 3C3QA 4I6GA 2PQRA 3PZ1A 2P9LG 2LNIA 4GZ6A 2R5SA 3TAXA 5D0OD 3MZLB 3MX3A 1TR4A 3DXMG 4G11A 4FU3A 3TWWA 5CCLA 4AOFA 5JJTA
chains in the Genus database with same CATH topology
2GRMA 2X6FA 2X6IA 4JHRA 1IQUA 3BG1B 3DPDA 5BW8C 4ANVA 3APDA 3ASDA 2C0MA 4L1BA 3IKOB 2CG2A 3MGBA 4GCOA 5FZSA 2WXIA 3S2AA 2OOEA 2BUGA 3GW4A 4GYOA 5DBKA 5A7DB 3FUDA 4APFA 1TEZA 4QFVA 3Q4AB 2XPIA 3T5XA 1SZAA 3KAEA 4JEUA 4N2QA 2IF4A 3AS5A 3ML8A 2XQ0A 5HI7A 3ZXSA 3CVXA 3OXLA 5LOZA 2YHCA 4GYYA 2I1KA 3CLJA 5LX8A 1QQEA 3FEXA 3CVLA 3U66A 4E6HA 3KEZA 3SFZA 2CG3A 2AXVA 3OXFA 2XHEA 2J9QA 4GMJA 4CDNA 5A6CA 4I6EA 5A23A 1W3BA 3ZFWA 4J6IA 2OVFA 4IYPA 2MOWA 1E7VA 2LSVA 4K03A 3ZYMA 1OWOA 3LPZA 3ZGQA 4V3IA 4BX8A 2FF4A 4GZDA 2L6JA 2L0IA 2DBAA 3CVQA 4FA6A 1N52A 5FQ8A 3IV0A 1PC2A 4PS8A 1IHGA 1OWPA 4BTBA 3LJ3A 5HQ8A 4BFRA 4CGWA 3AS4A 3GZ2A 1TJFA 4GU5A 3MKQA 4ATGA 1HG5A 3LXUX 2I9CA 1XGWA 4FLBA 4UWLA 3RJVA 4GYWA 3TL5A 4BTAA 2AWIA 3T5VA 4GPKA 5M72A 2EQXA 3L17A 2LO6A 3FUKA 2FEZA 3ZRHA 3CHMA 1WAO1 1Y8MA 3CIAA 3LS8A 3MKQB 5CHEE 5ANRA 4DI4A 1HFAA 4EBAA 2HYZA 3QWPA 5T8IA 4O6FA 4URKA 2VGYA 4XZ4A 3QDNA 2JLBA 2KC7A 4AVXA 5AJLA 3FUNA 5JJ6A 3UT8A 4MKTA 5KJMA 3CKCA 4OVVA 2XGMA 2Y4UA 3VLFA 4F3VA 3EJNA 4G23A 4IULA 3TJPA 3MYVA 4B8CB 4EZLA 3QWVA 2IOLA 2YNQA 1HF8A 3HYMB 2E2EA 5AIJA 2X3MA 4U04A 3Q49B 4J8FA 4N3BA 3TXNA 1H19A 1TJCA 3CK7A 4FLHA 3G2SA 1OUVA 5CMWA 4B89A 3CVVA 3ASFA 3RO2A 3RO3A 4LRZA 4BSXA 4GCNA 4AY5A 1FVFA 1GW6A 1MHQA 2WVIA 3IEGA 2X6KA 4HOQA 3RKVA 3FUFA 3GZSA 4ACLA 4JXTA 2GW1A 3FULA 2XGSA 3SGHA 3ZIMA 3PEUB 3FP3A 4J8SA 4I1AA 4AY6A 5CMYA 2VGXA 3ESLA 3L13A 2CFZA 4AIFA 5J08A 2LSUA 4KYOB 3FFLA 2LAHA 3UT4A 1UG3A 4EQFA 4PDXA 3U9WA 5LP0A 3BEEA 4HOTA 1ZBPA 3I3NA 3O4ZA 3QNKA 4FHJA 3D9OA 2VGXB 3AS8A 5BV1A 3O48A 4JA9A 4JC8A 4DJAA 5EX0A 3KS2A 2IFUA 1SZ9A 4XKCA 2UY1A 2WPVA 4J8DA 3P2BA 2OV8A 3S7BA 1E8XA 3SBSA 3LYAA 4K0RA 4WUYA 5JJ7A 4F7AA 3CSFA 4Y6WA 3FY4A 4DI3A 2L0TB 2AXUA 3UQ3A 2A4ZA 2J07A 2Q7FA 3FTVA 1N54A 4G2VA 2WQ6A 2OVBA 3LEWA 3AU4A 4B8AA 1E90A 4JHKA 4IN3B 4DLQA 2WXJA 2CHXA 2MRIA 4GA0A 1S0PA 4KVOA 3CSTA 5C2YA 2XRZA 4YVOA 3FTZA 3LKUA 4UQXA 2FI7A 1JUQA 1NA3A 3UUXA 3TG5A 4UI9K 3FEYA 5FZQA 2XGOA 3K9IA 2J4BA 4HORA 4JZYA 2WXGA 3HVEA 3TG4A 3FUJA 4UQZA 2VSXE 4DK5A 2PL2A 5G05J 4I9EA 3ASGA 3SZ7A 4A1SA 2VSNA 3FUHA 4BY6A 2KZTA 4GZCA 3FH8A 3I5PA 2V0PA 4AM9A 1VDYA 2KATA 4EPZA 2WB2A 4N3AA 3U4TA 2CFUA 5AYWD 2PQNA 3ZVVA 4A55A 4FULA 1E7UA 1L5JA 4U63A 3T8MA 2XCCA 3MJWA 4GB9A 3I4GA 2LAIA 3D3MA 2VQ2A 4G24A 2J09A 3QOUA 5ARGA 4N5CA 5KJLA 4LEUA 4WWPA 4ME2A 4F53A 3CV0A 3CGHA 3BG0B 5C1DA 1WY6A 3B13A 4WNDA 3IHVA 3CHRA 2XEVA 2VTBA 3CQGB 2WMNA 2XPZA 2AXZA 2J49A 4I9CA 4RG9A 4GZ5A 3N71A 3ZYQA 4BT9A 2WQ7A 3APFA 1ELWA 4RSYA 1JPLA 3U64A 5CCMA 1H2UA 3PRZA 4L2YA 1XNFA 3PNTB 4ABNA 4C9BB 4RG6A 4C0MA 2WXNA 4H7YA 4WNEA 2RD0A 3VLDA 4KBQA 3JQ1A 1E8YA 3UX4A 4TV3A 4M3OA 4NQ0A 3R7QA 5KJNA 5EDSA 1QZ2A 3CHPA 3CVUA 3FUEA 3L54A 2HM8A 3MV2B 5FWQA 5DIZA 4TRQA 3FTYA 3PS6A 3L22A 3G2WA 4I2ZA 5ANLA 3SD5A 3QC1A 3RRMB 4L23A 4HOUA 2C0LA 2JEKA 3HIZA 3NQPA 4N2SA 3CVPA 5G04C 4CT0A 3JQ0A 3JUIA 3HDXA 3JYSA 4XI9A 2GRLA 4B0ZA 1A17A 3FDHA 4U0SA 2GGFA 4WWOA 5KJKA 4YVQC 3HHMA 2RG8A 4XIFA 3LDZA 3VTYA 1H2TC 3FTWA 4UWGA 4AV7A 5BNWA 1SQMA 3MKRA 2L9BA 3QK0A 4U8HA 2E0IA 3OAWA 5D0QD 1FCHA 1HX8A 4OVUA 3VTXA 1PAQA 1PY1A 3IBEA 3FU6A 2PZIA 1MQSA 2UY1B 3LVQE 5AJDA 3UPVA 1KT0A 5FQ6A 2V8SE 3EIQC 3PE3A 3VLEA 1Z3YA 4A1GA 3GZ1A 2P58C 1KT1A 3RRNB 1DNPA 2IJGX 3LVRE 4P29A 2CHWA 2C2LA 3CK8A 5AENA 1HO8A 3EHMA 5G2NA 3CVNA 4CRWA 5ENNA 5T3RA 2X6HA 1JWGA 3R7RA 1OWNA 4BWRA 4GA1A 3LY7A 4I2WA 3GYZA 4KXKB 4FADA 3FTXA 3MA5A 4KMOA 2WXLA 3CHSA 4HS2A 4R7LA 2I6HA 2VSOE 2WXHA 4I1MA 2WXQA 2VSYA 4PS7A 4CDMA 1KLXA 4L2LA 2KCLA 3ZHEB 4D10C 3QARA 1ELKA 5G04J 3URZA 4ACKA 3RK6A 1HS6A 2WXKA 3DBSA 1H2VC 2X6JA 3OTNA 4C0EA 3S7DA 4MS6A 4JL0A 3WXXA 3CQCB 3E4BA 4ANXA 3EDTB 4JVSA 2NSZA 3FH5A 4WAFA 1NA0A 2IOSA 3B7UX 4I43A 4U07A 1Z3XA 4JEHA 2M63A 3ZHEA 2I1JA 3D9JA 3R9AB 1OWMA 4PUCA 2QY7A 2ILRA 1JWFA 3PNLB 2YQ8A 4NRHB 5FQ7A 3B7TA 4GA2A 3NZUA 3ZYKA 2WXFA 3NF1A 5FTPA 2J08A 2NC9A 1H0AA 2VYIA 3D9MA 3QWWA 3CR3A 1BPOA 4HFGA 2CHZA 4LUNU 3AU5A 3FU5A 4KZCA 2WQHA 4UI9J 2KCVA 5G05C 5LFAA 1UN8A 1WM5A 2HO1A 2BF0X 4N39A 5T4YA 3D9KA 4A3VA 3CK9A 1U3CA 4UWFA 2V5FA 3PUJA 4FC8A 4CDRA 5E76A 4ILIA 4I17A 1INZA 2Y4TA 4GZ3A 4KT6B 2PM6A 4NURA 2AVPA 3TGOA 3ZEFA 2Y3AA 2ONDA 2XCBA 3CHOA 4FP7A 4FHKA 4RVBA 4DLOA 4WNGA 3SHFA 4JHJA 1EDUA 2YHEA 2VJ8A 2A5UA 2IQCA 4ANUA 4Q69A 5LCWC 5BUZA 3EHNA 3ASHA 1E8WA 3HVEB 3PE4A 4EZJA 1E96B 4FJZA 3U3WA 3FHEA 4XI0A 1UJKA 3L6AA 3FUMA 3PVLA 4OYSA 4PH4B 4U0ZA 3ZYLA 3MCXA 3Q5MA 4HXIA 3ESKA 4ILGA 3IHYA 4G25A 4G26A 1HE8A 4JPSA 3ENEA 3P1UA 4E85A 3QAQA 5EKQD 4EECA 3QB2A 2I2OA 3B7RL 3L08A 4GMLA 3FTUA 4BX9A 1DVPA 3APCA 3LY8A 4AXHA 3FTSA 2V4LA 2VTBB 3EIJA 4KZ0A 4FJYA 4AEZC 2FBNA 5LCWJ 4I6JA 3CEQA 3ML9A 4XKBA 4HLEA 2PM7A 4UQYA 1Y6IA 4H7XA 3Q15A 2WXOA 1U3DA 2XRYA 2R59A 3SBTB 2XPYA 4AJWA 4EZKA 4Q96A 3LY9A 2AW6A 4TUUA 3ULQA 1EF1C 2DCPA 2BTDA 2WXRA 4J8EA 4ILHB 3FU0A 3MEKA 4JW1A 3S7JA 2IU1A 1HZ4A 1ELRA 4PS3A 5KCMA 1UN9A 4Q94A 1EYHA 1NP7A 5BT1A 1B89A 4UI9C 1IQRA 3JCKC 1UJJA 4A3TA 3B7SA 2WMOA 2KCKA 3D9PA 4YNDA 2FULA 3OXGA 3SI5A 4Y6CA 3I4RB 4I1OB 3CVWA 4CGVA 4G1TA 5FJYA 3C98A 3ZW3A 1H6KA 4UWKA 3TXMA 3PUKA 3Q47B 4J0UA 3FU3A 3CHQA 3PH0C 2UWJG 3PREA 2DIWA 5EX3A 3PEVB 1FVHA 2ZU6B 4N3CA 2YINA 4MRUA 1QNFA 3G2TA 3PDNA 3SF4A 3CKBA 4AP2A 1HXIA 5BV0A 3CVYA 5G55A 3MV3B 2R17C 3FUIA 4W9RA 3UT7A 4HVBA 1LF8A 2KM4A 1IYGA 3ZN3A 4CCAA 4APOA 5E75A 2IONA 4ANWA 1NZNA 1Z6TA 4GAAA 4F1SA 3SNXA 2WXMA 1HG2A 2J4DA 3S7FA 4DPRA 4WNFA 2X38A 1UW4B 3ONLA 3ZPJA 5J90A 4CT4A 3FH7A 3G2UA 4XE0A 4B94A 5FZRA 3L16A 4MLPA 4I6GA 2PQRA 1X5BA 4JA7A 4LCTA 3QJZA 5BPPA 5FQ4A 4NACA 1P5QA 4XX5A 5JHBA 4U0UA 5ARFA 4WWNA 3UMVA 3D9IA 2FO7A 4EBAG 3FWVA 3PZDA 3ONKA 2LNIA 3D9LA 4GZ6A 2KZTB 3LCAA 2R5SA 1E8ZA 4KVMA 3TAXA 2WXPA 1HH8A 5D0OD 1OWLA 5JHAA 4LERA 3MZLB 3MX3A 5FT9A 1HU3A 2MHKA 3RIBA 4CEMA 2NXPA 3G2VA 4G11A 4FU3A 3RU0A 2QFCA 4AOFA 4IRUA 3QKYA 1YA0A 2HR2A 4BT8A 4UWHA 3D9NA 4L7TA 2WM9A 3NZSA 5CCLA 3KD7A 1EPUA 4HOSA 1ZU2A 3RRUA 5JJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYO B;  3FFL A;  4EQF A;  4XI9 A;  5EX0 A;  1A17 A;  4U0S A;  4JHR A;  3LY8 A;  5KJK A;  3BEE A;  4YVQ C;  1ZBP A;  4HOT A;  4XIF A;  5BW8 C;  2FBN A;  3VTY A;  5LCW J;  5BNW A;  3CEQ A;  3ASD A;  2C0M A;  2VGX B;  3AS8 A;  3MKR A;  4UQY A;  3O48 A;  4GCO A;  4H7X A;  5FZS A;  4JA9 A;  3Q15 A;  2OOE A;  5D0Q D;  2BUG A;  1FCH A;  2IFU A;  3GW4 A;  3KS2 A;  4GYO A;  5DBK A;  2UY1 A;  2WPV A;  4J8D A;  5A7D B;  3S7B A;  3VTX A;  2PZI A;  2UY1 B;  3UPV A;  1KT0 A;  3LY9 A;  3LYA A;  3PE3 A;  4WUY A;  5JJ7 A;  3ULQ A;  3Q4A B;  2XPI A;  3GZ1 A;  2P58 C;  3KAE A;  1KT1 A;  4Y6W A;  4N2Q A;  2IF4 A;  3AS5 A;  4J8E A;  3UQ3 A;  3MEK A;  5HI7 A;  2C2L A;  2Q7F A;  3CK8 A;  3OXL A;  3S7J A;  1HZ4 A;  1ELR A;  2YHC A;  4G2V A;  4GYY A;  3CVN A;  1QQE A;  3CVL A;  4IN3 B;  4BWR A;  4GA0 A;  5BT1 A;  4GA1 A;  1B89 A;  3LY7 A;  3GYZ A;  3OXF A;  4I2W A;  4KXK B;  4UI9 C;  2J9Q A;  3MA5 A;  4YVO A;  3LKU A;  2KCK A;  4YND A;  5A6C A;  1W3B A;  2I6H A;  4UQX A;  3ZFW A;  3OXG A;  2FI7 A;  1NA3 A;  3UUX A;  4Y6C A;  3TG5 A;  2VSY A;  4UI9 K;  2LSV A;  5FZQ A;  2XGO A;  1KLX A;  3K9I A;  2KCL A;  3LPZ A;  4G1T A;  5FJY A;  3ZHE B;  3URZ A;  3TG4 A;  2FF4 A;  5G04 J;  2L6J A;  3CVQ A;  2DBA A;  3Q47 B;  4UQZ A;  2PL2 A;  1PC2 A;  4J0U A;  5G05 J;  1IHG A;  4I9E A;  3ASG A;  3SZ7 A;  3S7D A;  3WXX A;  2UWJ G;  2VSN A;  4JL0 A;  4A1S A;  4BTB A;  5HQ8 A;  3E4B A;  5EX3 A;  4CGW A;  3AS4 A;  3EDT B;  3GZ2 A;  4AM9 A;  1NA0 A;  2KAT A;  4N3C A;  4CGV A;  4U07 A;  4N3A A;  3U4T A;  3ZHE A;  3PDN A;  5AYW D;  2PQN A;  3R9A B;  3CKB A;  3SF4 A;  1HXI A;  3RJV A;  4GYW A;  3MV3 B;  2XCC A;  4BTA A;  4W9R A;  2YQ8 A;  4NRH B;  1IYG A;  4GA2 A;  5M72 A;  3ZN3 A;  3NF1 A;  4APO A;  5FTP A;  2VQ2 A;  2NC9 A;  3QOU A;  4G24 A;  5ARG A;  2VYI A;  3QWW A;  4N5C A;  2FEZ A;  4AIF A;  5KJL A;  4LEU A;  1WAO 1;  1NZN A;  1Y8M A;  4ME2 A;  3CV0 A;  5CHE E;  3ZGQ A;  4GPK A;  2HYZ A;  3QWP A;  4WND A;  5C1D A;  2WQH A;  4O6F A;  2KCV A;  4UI9 J;  2VGY A;  1WM5 A;  2HO1 A;  2JLB A;  2KC7 A;  2XEV A;  3QDN A;  4N39 A;  5G05 C;  3S7F A;  4WNF A;  4I9C A;  4RG9 A;  4BT9 A;  5JJ6 A;  4GZ5 A;  3N71 A;  3ZPJ A;  3CK9 A;  5KJM A;  3CKC A;  2XGM A;  2V5F A;  2Y4U A;  4B94 A;  5FZR A;  1ELW A;  4G23 A;  4CDR A;  4F3V A;  5CCM A;  2PQR A;  3QWV A;  1XNF A;  4JA7 A;  4I17 A;  3HYM B;  4ABN A;  2E2E A;  2Y4T A;  4GZ3 A;  1P5Q A;  4RG6 A;  3Q49 B;  4H7Y A;  4U04 A;  4WNE A;  4J8F A;  4N3B A;  2AVP A;  3TGO A;  4U0U A;  1TJC A;  2OND A;  2XCB A;  3CK7 A;  4KBQ A;  5ARF A;  4HOR A;  2FO7 A;  1OUV A;  3FWV A;  2LNI A;  4WNG A;  4GZ6 A;  3ASF A;  3RO2 A;  3RO3 A;  4NQ0 A;  3LCA A;  2R5S A;  5KJN A;  5LCW C;  4GCN A;  1QZ2 A;  3TAX A;  4AY5 A;  3MV2 B;  1HH8 A;  3ASH A;  3IEG A;  3PE4 A;  4HOQ A;  5D0O D;  5DIZ A;  3RKV A;  1E96 B;  3U3W A;  5FT9 A;  4XI0 A;  3RIB A;  2MHK A;  4I2Z A;  4U0Z A;  2GW1 A;  2XGS A;  3Q5M A;  3ESK A;  4HOU A;  3RU0 A;  2QFC A;  3FP3 A;  2C0L A;  3QKY A;  4G26 A;  4G25 A;  4I1A A;  1YA0 A;  2HR2 A;  4AY6 A;  4BT8 A;  5CCL A;  4N2S A;  2VGX A;  3CVP A;  3KD7 A;  5G04 C;  4HOS A;  1ZU2 A;  3JYS A;  5EKQ D;  2LSU A;  5JJT A; 
#chains in the Genus database with same CATH topology
 2XEH A;  2X6I A;  1TNY A;  3E30 A;  3ASD A;  3IKO B;  3UM2 A;  3BU8 A;  2WXI A;  3S2A A;  2OOE A;  4GYO A;  1OXJ A;  5A7D B;  4APF A;  3T5X A;  3AS5 A;  3ML8 A;  2LUH A;  5HI7 A;  3ZXS A;  3OXL A;  5HS0 A;  5BXU A;  3U66 A;  2CG3 A;  2AXV A;  3HXF A;  4CDN A;  5A23 A;  1W3B A;  4J6I A;  1E7V A;  1N52 A;  1PC2 A;  4QQI A;  1ZU2 A;  4CGW A;  4GTM A;  2F37 A;  4OAU C;  3LXU X;  1XGW A;  3TL5 A;  4BTA A;  2AWI A;  5M72 A;  3L17 A;  3ZRH A;  3CHM A;  1WAO 1;  4DI4 A;  3MKQ B;  4GPK A;  2HYZ A;  5H7P A;  4MKT A;  5KJM A;  4OVV A;  4B8C B;  1N4Q A;  3HYM B;  1TYQ G;  4U04 A;  1OCZ E;  1H19 A;  3UXG A;  4HNA D;  3RO2 A;  4BSX A;  3HG0 D;  2P9S G;  3IEG A;  2GW1 A;  3ZIM A;  3FP3 A;  4TXQ A;  3EUV A;  2VGX A;  3L13 A;  2CFZ A;  3UT4 A;  4X8Q A;  4HOT A;  3O4Z A;  4FHJ A;  3AS8 A;  4JA9 A;  2IFU A;  3E33 A;  4J8D A;  3P2B A;  4K0R A;  5JJ7 A;  4DI3 A;  2L0T B;  2AXU A;  3TWQ A;  2Q7F A;  2GRR B;  1BD8 A;  4DLQ A;  3ISM C;  2HE0 A;  2XGO A;  4BES A;  2WXG A;  3HVE A;  4I9E A;  4A1S A;  4BY6 A;  4EPZ A;  2CFU A;  2PQN A;  4FUL A;  1E7U A;  1MX4 A;  1H6O A;  4ZFH A;  2LAI A;  4G24 A;  3ZU7 B;  4N5C A;  3EHR A;  3CGH A;  3DST A;  3CHR A;  3CQG B;  2XPZ A;  1K1B A;  2AXZ A;  4RG9 A;  4GZ5 A;  3N71 A;  1K8K G;  1DCE A;  4RSY A;  3PRZ A;  4LNU D;  4ABN A;  4RG6 A;  2WXN A;  4KBQ A;  1E8Y A;  4K5A B;  4M3O A;  4NQ0 A;  1N9A A;  1V54 E;  3RRM B;  4HOU A;  3ULE G;  4N2S A;  4RQI A;  3CVP A;  3ZKJ A;  5G04 C;  4CT0 A;  2GRL A;  4U0S A;  5KJK A;  2PNN A;  2RG8 A;  4C48 B;  3VTY A;  1H2T C;  4AV7 A;  1D8D A;  1SQM A;  3MKR A;  4U8H A;  1FCH A;  1MX6 A;  3LVQ E;  3UPV A;  3EIQ C;  3GZ1 A;  4K5B A;  2IJG X;  1YMP A;  3CK8 A;  3EHM A;  2V5Q C;  5T3R A;  4GA1 A;  4I2W A;  4FAD A;  3MA5 A;  2VSO E;  4I1M A;  3W9F A;  2KCL A;  3ZHE B;  3QAR A;  1ELK A;  5G04 J;  4ACK A;  3RK6 A;  4HBD A;  4ANX A;  4DX6 D;  4JVS A;  2NSZ A;  2IOS A;  1Z3X A;  4JEH A;  2I1J A;  3TWT A;  2ETA A;  1UOH A;  3NZU A;  2WXF A;  1H0A A;  3QWW A;  4ZHB A;  3CR3 A;  4HFG A;  4LUN U;  3FU5 A;  4KZC A;  2KCV A;  1UN8 A;  1WM5 A;  2HO1 A;  4N39 A;  1D8E A;  3UI2 A;  4UWF A;  4CDR A;  5FIN A;  1MJ0 A;  3TGO A;  1SW6 A;  2KXP C;  4RVB A;  4B93 B;  4YDE A;  4G8L A;  3HVE B;  3HXB A;  4FJZ A;  3U3W A;  5B3S E;  4OYS A;  4HXI A;  1G3N B;  3D9H A;  2R03 A;  4JPS A;  3P1U A;  3B7R L;  3L08 A;  4BX9 A;  3LY8 A;  4AXH A;  2VTB B;  3FTS A;  4KZ0 A;  3V79 K;  3ML9 A;  3L82 A;  2H6G A;  4AJW A;  2AW6 A;  5AQ7 A;  2DCP A;  2WXR A;  3AG1 E;  1DC2 A;  4Q94 A;  3TWR A;  5CBN A;  1UJJ A;  2KCK A;  4CGV A;  3C98 A;  5EID A;  3PUK A;  3Q47 B;  4J0U A;  2ZU6 B;  4N3C A;  2DWZ A;  3SF4 A;  3IXE A;  3Q7A A;  4HRL A;  1IYG A;  3ZN3 A;  2ION A;  4HI8 A;  5EIL A;  3T8K A;  4F1S A;  2WXM A;  3S7F A;  5J90 A;  3ULY A;  3G2U A;  2BKK B;  3C5R A;  4NAC A;  5FQ4 A;  1BI7 B;  4EBA G;  3PZD A;  3D9L A;  1TNZ A;  2KZT B;  3LCA A;  1E8Z A;  4KVM A;  1HH8 A;  3V31 A;  1OWL A;  4CEM A;  4DX7 D;  2F0Y A;  1KZP A;  3G2V A;  3RU0 A;  2XZD G;  3Q9N C;  4IRU A;  4BT8 A;  1RW2 A;  3D9N A;  2EIL E;  3KD7 A;  1EPU A;  3RRU A;  2GRM A;  1N94 A;  2X6F A;  2DYS E;  5BW8 C;  2C0M A;  3MGB A;  5FZS A;  4GTS A;  4OAV B;  3SFY A;  5KNH D;  4JEU A;  1TN7 A;  1O1T A;  2YHC A;  4GYY A;  4E6H A;  3KEZ A;  3SFZ A;  4GMJ A;  5A6C A;  2OVF A;  4IYP A;  2LSV A;  5AAO A;  3ZYM A;  1OY3 D;  3CVQ A;  3IV0 A;  4PS8 A;  1IHG A;  1OWP A;  5HQ8 A;  3AS4 A;  4G8K A;  4GU5 A;  1HG5 A;  4FLB A;  4UWL A;  3HXE A;  4JB8 P;  3FUK A;  2FEZ A;  3LS8 A;  1HFA A;  1TNO A;  1MYO A;  3FUN A;  3UT8 A;  3NOG D;  1SVX A;  5ENP D;  4IUL A;  4EZL A;  3Q49 B;  4J8F A;  2FO1 E;  3CK7 A;  1OUV A;  5CMW A;  4B89 A;  2V4H C;  1YCS B;  3RO3 A;  3PZ3 A;  2EIM E;  1V55 E;  1FVF A;  1MHQ A;  2X6K A;  4HOQ A;  3FUF A;  3FUL A;  2Y0B G;  1QBQ A;  3PEU B;  2H6H A;  4I1A A;  3E37 A;  4AIF A;  4KYO B;  3FFL A;  3U9W A;  1ZBP A;  3I3N A;  1AWC B;  1SZ9 A;  2B6C A;  4WUY A;  4F7A A;  4Y6W A;  3FY4 A;  5EIB E;  3TWV A;  3BUA A;  3UQ3 A;  2A4Z A;  2J07 A;  3FTV A;  3E34 A;  2WQ6 A;  4B8A A;  2DZN A;  1E90 A;  4IN3 B;  2MRI A;  1KPS B;  1S0P A;  4YVO A;  4UQX A;  1JUQ A;  1NA3 A;  3UUX A;  2BED A;  1WDY A;  4UI9 K;  2VSX E;  4DK5 A;  4GZC A;  1VDY A;  2WB2 A;  3U4T A;  1L5J A;  3T8M A;  4GPM A;  4GB9 A;  5AQA A;  1MX2 A;  2P9U G;  3D3M A;  2VQ2 A;  2J09 A;  4WWP A;  4F53 A;  1WY6 A;  4WND A;  2WQ7 A;  1ELW A;  3U64 A;  1NI1 A;  1H2U A;  4C9B B;  1A5E A;  4C0M A;  4H7Y A;  2RD0 A;  3VLD A;  4EHM A;  5KJN A;  5EDS A;  2GRP B;  1BU9 A;  3CHP A;  2HM8 A;  5FWQ A;  4TRQ A;  3FTY A;  5ANL A;  3G2W A;  4I2Z A;  3SD5 A;  3ASN E;  3HDX A;  3JYS A;  4XI9 A;  2GGF A;  4YVQ C;  3AG4 E;  5BNW A;  3FTW A;  4UWG A;  2QYU A;  4O1O A;  2E0I A;  3OAW A;  5D0Q D;  1QYM A;  4OVU A;  1PAQ A;  2XEE A;  5AJD A;  2UY1 B;  3EHQ A;  2DYR E;  3PE3 A;  2P58 C;  1OCO E;  4A63 B;  3NAW A;  2CHW A;  2C2L A;  4J7W A;  4BER A;  5HRY A;  3R7R A;  1JWG A;  2DVW A;  3GYZ A;  4KXK B;  2WXL A;  4HS2 A;  2I6H A;  2JAB A;  1KLX A;  4L2L A;  4ATZ D;  4D10 C;  3DSU A;  1H2V C;  2X6J A;  3S7D A;  4MS6 A;  3FH5 A;  1NA0 A;  5CER B;  3B7U X;  4I43 A;  2M63 A;  3R9A B;  2H6F A;  3RAU A;  5D66 A;  5FQ7 A;  3B7T A;  1LD7 A;  4GA2 A;  3NF1 A;  5FTP A;  2J08 A;  2NC9 A;  3DWL G;  2CHZ A;  3DXK G;  5LFA A;  4A3V A;  5T4Y A;  4TXP A;  4HI9 A;  3Q78 A;  2Y4T A;  4HQD A;  2RFM A;  4KT6 B;  2PM6 A;  2AVP A;  3ZEF A;  2Y3A A;  2OND A;  2EIK E;  4FHK A;  4DLO A;  3SHF A;  4JHJ A;  2YHE A;  2IQC A;  5LCW C;  4EZJ A;  1E96 B;  4XI0 A;  3PVL A;  4U0Z A;  3ZYL A;  3ESK A;  4HRM B;  5EKQ D;  3DEO A;  3APC A;  3EIJ A;  3LJN A;  2FBN A;  4I6J A;  3CEQ A;  4XKB A;  2PM7 A;  4H7X A;  3Q15 A;  2WXO A;  4K5C A;  3SBT B;  4O1P A;  4Q96 A;  3B7B A;  1EF1 C;  4J8E A;  3AAA C;  4HB5 A;  4JW1 A;  2IU1 A;  3UM3 A;  4PS3 A;  5KCM A;  1DCQ A;  1UN9 A;  2F8Y A;  1EYH A;  5FIO A;  4YND A;  2FUL A;  2F8X K;  1IHB A;  4Y6C A;  3I4R B;  4I1O B;  5JA4 D;  1H6K A;  4RLY A;  1JCR A;  3FU3 A;  2DIW A;  3PEV B;  1FVH A;  4YDY A;  4MRU A;  1QNF A;  4DX5 D;  2DZO A;  2P9K G;  4AP2 A;  5BV0 A;  3MV3 B;  3UT7 A;  4HVB A;  2QYJ A;  4APO A;  5E75 A;  4ANW A;  2ZIS A;  1NZN A;  1Z6T A;  1O5M A;  4GAA A;  3SNX A;  2J4D A;  4DPR A;  2X38 A;  1S64 A;  5EYL A;  3L16 A;  1X5B A;  4LCT A;  3QJZ A;  5BPP A;  3AG2 E;  4U0U A;  3UMV A;  3D9I A;  2FO7 A;  3FWV A;  3ONK A;  2A5E A;  4GTO A;  4DUI A;  4UUC A;  5FT9 A;  1HU3 A;  3Q75 A;  1TN8 A;  2NXP A;  3F6Q A;  4L7T A;  2WM9 A;  4JHR A;  1OCC E;  3DPD A;  4ANV A;  4U95 D;  2CG2 A;  4GCO A;  5CED B;  5DBK A;  3FUD A;  1TEZ A;  3Q4A B;  3KAE A;  2IF4 A;  2IO2 C;  2XQ0 A;  2I1K A;  5LX8 A;  1QQE A;  3FEX A;  3CVL A;  1U2V G;  3OXF A;  2R02 A;  2XHE A;  2J9Q A;  3ZFW A;  2MOW A;  4K03 A;  3ZGQ A;  4BX8 A;  2FF4 A;  2L6J A;  2L0I A;  2DBA A;  5FQ8 A;  4LNB A;  2LXM A;  4BTB A;  3LJ3 A;  4BFR A;  3GZ2 A;  2IEJ A;  3MKQ A;  4ATG A;  2I9C A;  3RJV A;  3TWX A;  3V2X A;  2H6I A;  3CIA A;  1Y8M A;  5CHE E;  5ANR A;  3QWP A;  5T8I A;  4O6F A;  2JLB A;  5AJL A;  3SFX A;  3X2Q E;  3CKC A;  4GTQ A;  2XGM A;  2Y4U A;  3VLF A;  3MYV A;  3QWV A;  2YNQ A;  2E2E A;  2X3M A;  4N3B A;  3UTM A;  2IO3 C;  3TXN A;  4FLH A;  3JXJ A;  3G2S A;  3CVV A;  3DSX A;  3ASF A;  1GW6 A;  3V30 A;  2ZGG A;  1AP7 A;  1TN6 A;  4ACL A;  4DRX E;  3SGH A;  1H6P A;  1K3Z D;  4AY6 A;  3ESL A;  5J08 A;  2LSU A;  2LAH A;  1UG3 A;  1N0R A;  3ABK E;  4PDX A;  2ETB A;  5LP0 A;  2NYJ A;  3QNK A;  4MBG A;  3DSS A;  1Z5S C;  2VGX B;  5BV1 A;  3O48 A;  4LG6 A;  4JC8 A;  4XKC A;  2UY1 A;  2WPV A;  1S70 B;  2OV8 A;  4G2V A;  5CRU A;  2OVB A;  3AU4 A;  2WXJ A;  2CHX A;  2VGE A;  2XRZ A;  5B1B E;  3FEY A;  3K9I A;  2J4B A;  4JZY A;  1X81 A;  5EN5 D;  4UQZ A;  3HXC A;  3ASG A;  2VSN A;  3FUH A;  2AJA A;  2V0P A;  4AM9 A;  5KNG A;  4N3A A;  3UKU G;  4A55 A;  4U63 A;  2XCC A;  2IY0 C;  3QOU A;  5KJL A;  4LEU A;  4ME2 A;  3B13 A;  2XEV A;  2VTB A;  2WMN A;  4I9C A;  4BT9 A;  3APF A;  4F6R D;  1JPL A;  5CCM A;  4HRN A;  4L2Y A;  1XNF A;  2L6B A;  3PNT B;  2QC9 A;  2BKG A;  4TV3 A;  4U8Y D;  1QZ2 A;  3CVU A;  3PZ4 A;  4BEP A;  3L22 A;  4HLL A;  3JQ0 A;  4B0Z A;  4XIF A;  3LDZ A;  1FT1 A;  3SY2 A;  1HX8 A;  5AN8 A;  1ZB1 A;  1PY1 A;  2PZI A;  3JXI A;  1KT0 A;  1Z3Y A;  4A1G A;  1KT1 A;  1DNP A;  4P29 A;  1HO8 A;  5AQB A;  3CVN A;  5ENN A;  2X6H A;  3LY7 A;  1N4P A;  4R7L A;  2WXH A;  2WXQ A;  2VSY A;  4PS7 A;  4CDM A;  3URZ A;  3HXD A;  3WXX A;  5CEA A;  5ITZ F;  4WAF A;  4U07 A;  3ZHE A;  3KSL A;  1OWM A;  1JWF A;  4NRH B;  2P9P G;  2VYI A;  1BPO A;  3AU5 A;  5B1A E;  2WQH A;  4UI9 J;  5G05 C;  2BF0 X;  3CK9 A;  4N5Q A;  4FC8 A;  3HRA A;  4BSZ B;  4ILI A;  3E32 A;  4I17 A;  4GTV A;  1INZ A;  3CHO A;  2XCB A;  4FP7 A;  1EDU A;  2A5U A;  4Q69 A;  3ASH A;  1N0Q A;  3FHE A;  3L6A A;  3Q5M A;  4ILG A;  4LNG A;  3IHY A;  4G25 A;  3ENE A;  3QAQ A;  2I2O A;  1BLX B;  3FTU A;  4AEZ C;  5LCW J;  3UM0 A;  1JCS A;  4UQY A;  1Y6I A;  2R59 A;  5CRV A;  2XPY A;  4EZK A;  3LY9 A;  3NBN B;  5HKP A;  2BTD A;  3EU5 A;  2ZXW E;  1NP7 A;  4A3T A;  2WMO A;  3D9P A;  2GRN B;  4U7E B;  5CBO A;  1SA4 A;  3SI5 A;  2XS8 A;  3CVW A;  5ENT D;  4G1T A;  4BET A;  3CHQ A;  3PH0 C;  5EX3 A;  1LD8 A;  2LXL A;  1OT8 A;  1IKN D;  2XEN A;  3RSE G;  1NFI E;  1HXI A;  3CVY A;  3FUI A;  1YYH A;  1HG2 A;  4WNF A;  3ONL A;  4CT4 A;  4B94 A;  5FZR A;  4MLP A;  1JCQ A;  4JA7 A;  1P5Q A;  1TNU A;  4XX5 A;  5JHB A;  5ARF A;  4WWN A;  2R05 A;  2P9N G;  1FT2 A;  2WXP A;  2OCC E;  3UIN C;  3SQV A;  5JHA A;  4LER A;  3RIB A;  2MHK A;  2QFC A;  3QKY A;  3UM1 A;  1YA0 A;  2HR2 A;  4UWH A;  3NZS A;  1N4S A;  4HOS A;  1D9S A;  5AQ9 A;  1IQU A;  3BG1 B;  4DX1 A;  3NOC D;  3APD A;  4L1B A;  2BUG A;  1RZ4 A;  3GW4 A;  3ZUV B;  4QFV A;  1NL4 A;  1N95 A;  2XPI A;  1SZA A;  4N2Q A;  3CVX A;  5LOZ A;  3CLJ A;  4TUM A;  2P9I G;  4L9P A;  4I6E A;  4GTT A;  1OWO A;  3LPZ A;  4V3I A;  4GZD A;  4FA6 A;  3T9K A;  4JD2 G;  2RFA A;  4LSZ E;  1TJF A;  2GRO B;  3J5Q B;  4GYW A;  3ZXP A;  3T5V A;  2EQX A;  2LO6 A;  3ABM E;  4EBA A;  4URK A;  2VGY A;  4XZ4 A;  3QDN A;  4AVX A;  2KC7 A;  5JJ6 A;  5ENQ D;  3DSW A;  4GTP A;  4F3V A;  3EJN A;  4G23 A;  3TJP A;  2IOL A;  2KBX A;  1HF8 A;  5AIJ A;  5ENS D;  2OEW A;  2OEV A;  1TJC A;  5AAR A;  4O60 A;  4LRZ A;  4GCN A;  4AY5 A;  1LTX A;  2WVI A;  3KEA A;  3B95 A;  3RKV A;  3GZS A;  3TWS A;  1Q2Z A;  4JXT A;  2XGS A;  3ASO E;  4J8S A;  3TWU A;  1KZO A;  2XS1 A;  5CMY A;  3W9G A;  3Q79 A;  4EQF A;  3BEE A;  3D9O A;  5BXO A;  4CYM D;  4DJA A;  5EX0 A;  3KS2 A;  3S7B A;  4YDW A;  1E8X A;  3SBS A;  3LYA A;  1TNB A;  3WG7 E;  3CSF A;  1N4R A;  1N54 A;  3LEW A;  4JHK A;  4GA0 A;  4KVO A;  4F1P A;  3CST A;  5C2Y A;  3FTZ A;  3LKU A;  2FI7 A;  3TG5 A;  2B0O E;  3C72 A;  3SO8 A;  5FZQ A;  4HOR A;  3TG4 A;  2QZA A;  3FUJ A;  2PL2 A;  3DPY A;  5G05 J;  3SZ7 A;  1WG0 A;  2MYO A;  2KZT A;  3FH8 A;  3I5P A;  2KAT A;  5AYW D;  3ZVV A;  4TXR A;  1FPP A;  3C3R A;  3MJW A;  3I4G A;  3DEP A;  5ARG A;  3CV0 A;  3BG0 B;  5C1D A;  3IHV A;  2J49 A;  3ZYQ A;  4Z68 A;  1S63 A;  2Y1L E;  1MZC A;  4WNE A;  3JQ1 A;  3BQO A;  3UX4 A;  2XZT G;  3Q7F A;  3R7Q A;  3FUE A;  3L54 A;  3MV2 B;  5DIZ A;  3PS6 A;  5KWD A;  3QC1 A;  4L23 A;  2C0L A;  2JEK A;  3HIZ A;  3NQP A;  2GRQ B;  3JUI A;  1IXV A;  2P2C P;  4DX2 A;  1A17 A;  3FDH A;  4WWO A;  3HHM A;  2L9B A;  3QK0 A;  4J8Y A;  3VTX A;  3IBE A;  3FU6 A;  1MQS A;  5FQ6 A;  3VLE A;  2V8S E;  3R9M A;  3RRN B;  3LVR E;  5AEN A;  5G2N A;  4CRW A;  4BWR A;  1OWN A;  3J5P A;  5ENR D;  3FTX A;  4KMO A;  1O1S A;  1SA5 A;  3CHS A;  3DRA A;  4XEI G;  2ZGD A;  3UIO C;  1HS6 A;  2WXK A;  3DBS A;  4C0E A;  3OTN A;  2ZIR A;  4JL0 A;  4CZ2 D;  3CQC B;  3E4B A;  3EDT B;  2EIN E;  4U96 D;  3D9J A;  4PUC A;  2QY7 A;  2ILR A;  3PNL B;  2YQ8 A;  5EYP F;  3ZYK A;  4GTR A;  3AJI A;  3D9M A;  1K1A A;  1N11 A;  3V2O A;  3D9K A;  4GMR A;  1U3C A;  5KBA A;  1OCR E;  1O1R A;  2V5F A;  3PUJ A;  3L9T A;  5E76 A;  5IY5 E;  4GZ3 A;  4U8V D;  4NUR A;  4WNG A;  3PZ2 A;  3UIP C;  2VJ8 A;  4ANU A;  5BUZ A;  3EHN A;  3JUE A;  1E8W A;  3PE4 A;  1UJK A;  3FUM A;  3Q9U C;  4PH4 B;  3MCX A;  4YDO A;  4G26 A;  5JMN D;  1HE8 A;  4E85 A;  4EEC A;  3QB2 A;  4M7C A;  4GML A;  3ZNG A;  1DVP A;  2V4L A;  5D2M C;  4FJY A;  4HLE A;  1U3D A;  2XRY A;  2ETC A;  2Y69 E;  1BI8 B;  4TUU A;  3ULQ A;  4ILH B;  3FU0 A;  3MEK A;  3S7J A;  3KSQ A;  1HZ4 A;  1ELR A;  3UKR G;  5BT1 A;  1B89 A;  4UI9 C;  1IQR A;  3JCK C;  3B7S A;  3OXG A;  2R2L A;  2EIJ E;  5FJY A;  3ZW3 A;  5CEC B;  3DSV A;  4UWK A;  3TXM A;  4NIK A;  3NB2 A;  3Q73 A;  2UWJ G;  3PRE A;  2YIN A;  3G2T A;  3PDN A;  2J8S D;  3CKB A;  3AG3 E;  5G55 A;  2R17 C;  3EU9 A;  4W9R A;  5ENO D;  1LF8 A;  2KM4 A;  4CCA A;  2RKK A;  3C3O A;  1UW4 B;  3ZPJ A;  3FH7 A;  4XE0 A;  3ABL E;  3C3Q A;  4I6G A;  2PQR A;  3PZ1 A;  2P9L G;  2LNI A;  4GZ6 A;  2R5S A;  3TAX A;  5D0O D;  3MZL B;  3MX3 A;  1TR4 A;  3DXM G;  4G11 A;  4FU3 A;  3TWW A;  5CCL A;  4AOF A;  5JJT A; 
#chains in the Genus database with same CATH homology
 2GRM A;  2X6F A;  2X6I A;  4JHR A;  1IQU A;  3BG1 B;  3DPD A;  5BW8 C;  4ANV A;  3APD A;  3ASD A;  2C0M A;  4L1B A;  3IKO B;  2CG2 A;  3MGB A;  4GCO A;  5FZS A;  2WXI A;  3S2A A;  2OOE A;  2BUG A;  3GW4 A;  4GYO A;  5DBK A;  5A7D B;  3FUD A;  4APF A;  1TEZ A;  4QFV A;  3Q4A B;  2XPI A;  3T5X A;  1SZA A;  3KAE A;  4JEU A;  4N2Q A;  2IF4 A;  3AS5 A;  3ML8 A;  2XQ0 A;  5HI7 A;  3ZXS A;  3CVX A;  3OXL A;  5LOZ A;  2YHC A;  4GYY A;  2I1K A;  3CLJ A;  5LX8 A;  1QQE A;  3FEX A;  3CVL A;  3U66 A;  4E6H A;  3KEZ A;  3SFZ A;  2CG3 A;  2AXV A;  3OXF A;  2XHE A;  2J9Q A;  4GMJ A;  4CDN A;  5A6C A;  4I6E A;  5A23 A;  1W3B A;  3ZFW A;  4J6I A;  2OVF A;  4IYP A;  2MOW A;  1E7V A;  2LSV A;  4K03 A;  3ZYM A;  1OWO A;  3LPZ A;  3ZGQ A;  4V3I A;  4BX8 A;  2FF4 A;  4GZD A;  2L6J A;  2L0I A;  2DBA A;  3CVQ A;  4FA6 A;  1N52 A;  5FQ8 A;  3IV0 A;  1PC2 A;  4PS8 A;  1IHG A;  1OWP A;  4BTB A;  3LJ3 A;  5HQ8 A;  4BFR A;  4CGW A;  3AS4 A;  3GZ2 A;  1TJF A;  4GU5 A;  3MKQ A;  4ATG A;  1HG5 A;  3LXU X;  2I9C A;  1XGW A;  4FLB A;  4UWL A;  3RJV A;  4GYW A;  3TL5 A;  4BTA A;  2AWI A;  3T5V A;  4GPK A;  5M72 A;  2EQX A;  3L17 A;  2LO6 A;  3FUK A;  2FEZ A;  3ZRH A;  3CHM A;  1WAO 1;  1Y8M A;  3CIA A;  3LS8 A;  3MKQ B;  5CHE E;  5ANR A;  4DI4 A;  1HFA A;  4EBA A;  2HYZ A;  3QWP A;  5T8I A;  4O6F A;  4URK A;  2VGY A;  4XZ4 A;  3QDN A;  2JLB A;  2KC7 A;  4AVX A;  5AJL A;  3FUN A;  5JJ6 A;  3UT8 A;  4MKT A;  5KJM A;  3CKC A;  4OVV A;  2XGM A;  2Y4U A;  3VLF A;  4F3V A;  3EJN A;  4G23 A;  4IUL A;  3TJP A;  3MYV A;  4B8C B;  4EZL A;  3QWV A;  2IOL A;  2YNQ A;  1HF8 A;  3HYM B;  2E2E A;  5AIJ A;  2X3M A;  4U04 A;  3Q49 B;  4J8F A;  4N3B A;  3TXN A;  1H19 A;  1TJC A;  3CK7 A;  4FLH A;  3G2S A;  1OUV A;  5CMW A;  4B89 A;  3CVV A;  3ASF A;  3RO2 A;  3RO3 A;  4LRZ A;  4BSX A;  4GCN A;  4AY5 A;  1FVF A;  1GW6 A;  1MHQ A;  2WVI A;  3IEG A;  2X6K A;  4HOQ A;  3RKV A;  3FUF A;  3GZS A;  4ACL A;  4JXT A;  2GW1 A;  3FUL A;  2XGS A;  3SGH A;  3ZIM A;  3PEU B;  3FP3 A;  4J8S A;  4I1A A;  4AY6 A;  5CMY A;  2VGX A;  3ESL A;  3L13 A;  2CFZ A;  4AIF A;  5J08 A;  2LSU A;  4KYO B;  3FFL A;  2LAH A;  3UT4 A;  1UG3 A;  4EQF A;  4PDX A;  3U9W A;  5LP0 A;  3BEE A;  4HOT A;  1ZBP A;  3I3N A;  3O4Z A;  3QNK A;  4FHJ A;  3D9O A;  2VGX B;  3AS8 A;  5BV1 A;  3O48 A;  4JA9 A;  4JC8 A;  4DJA A;  5EX0 A;  3KS2 A;  2IFU A;  1SZ9 A;  4XKC A;  2UY1 A;  2WPV A;  4J8D A;  3P2B A;  2OV8 A;  3S7B A;  1E8X A;  3SBS A;  3LYA A;  4K0R A;  4WUY A;  5JJ7 A;  4F7A A;  3CSF A;  4Y6W A;  3FY4 A;  4DI3 A;  2L0T B;  2AXU A;  3UQ3 A;  2A4Z A;  2J07 A;  2Q7F A;  3FTV A;  1N54 A;  4G2V A;  2WQ6 A;  2OVB A;  3LEW A;  3AU4 A;  4B8A A;  1E90 A;  4JHK A;  4IN3 B;  4DLQ A;  2WXJ A;  2CHX A;  2MRI A;  4GA0 A;  1S0P A;  4KVO A;  3CST A;  5C2Y A;  2XRZ A;  4YVO A;  3FTZ A;  3LKU A;  4UQX A;  2FI7 A;  1JUQ A;  1NA3 A;  3UUX A;  3TG5 A;  4UI9 K;  3FEY A;  5FZQ A;  2XGO A;  3K9I A;  2J4B A;  4HOR A;  4JZY A;  2WXG A;  3HVE A;  3TG4 A;  3FUJ A;  4UQZ A;  2VSX E;  4DK5 A;  2PL2 A;  5G05 J;  4I9E A;  3ASG A;  3SZ7 A;  4A1S A;  2VSN A;  3FUH A;  4BY6 A;  2KZT A;  4GZC A;  3FH8 A;  3I5P A;  2V0P A;  4AM9 A;  1VDY A;  2KAT A;  4EPZ A;  2WB2 A;  4N3A A;  3U4T A;  2CFU A;  5AYW D;  2PQN A;  3ZVV A;  4A55 A;  4FUL A;  1E7U A;  1L5J A;  4U63 A;  3T8M A;  2XCC A;  3MJW A;  4GB9 A;  3I4G A;  2LAI A;  3D3M A;  2VQ2 A;  4G24 A;  2J09 A;  3QOU A;  5ARG A;  4N5C A;  5KJL A;  4LEU A;  4WWP A;  4ME2 A;  4F53 A;  3CV0 A;  3CGH A;  3BG0 B;  5C1D A;  1WY6 A;  3B13 A;  4WND A;  3IHV A;  3CHR A;  2XEV A;  2VTB A;  3CQG B;  2WMN A;  2XPZ A;  2AXZ A;  2J49 A;  4I9C A;  4RG9 A;  4GZ5 A;  3N71 A;  3ZYQ A;  4BT9 A;  2WQ7 A;  3APF A;  1ELW A;  4RSY A;  1JPL A;  3U64 A;  5CCM A;  1H2U A;  3PRZ A;  4L2Y A;  1XNF A;  3PNT B;  4ABN A;  4C9B B;  4RG6 A;  4C0M A;  2WXN A;  4H7Y A;  4WNE A;  2RD0 A;  3VLD A;  4KBQ A;  3JQ1 A;  1E8Y A;  3UX4 A;  4TV3 A;  4M3O A;  4NQ0 A;  3R7Q A;  5KJN A;  5EDS A;  1QZ2 A;  3CHP A;  3CVU A;  3FUE A;  3L54 A;  2HM8 A;  3MV2 B;  5FWQ A;  5DIZ A;  4TRQ A;  3FTY A;  3PS6 A;  3L22 A;  3G2W A;  4I2Z A;  5ANL A;  3SD5 A;  3QC1 A;  3RRM B;  4L23 A;  4HOU A;  2C0L A;  2JEK A;  3HIZ A;  3NQP A;  4N2S A;  3CVP A;  5G04 C;  4CT0 A;  3JQ0 A;  3JUI A;  3HDX A;  3JYS A;  4XI9 A;  2GRL A;  4B0Z A;  1A17 A;  3FDH A;  4U0S A;  2GGF A;  4WWO A;  5KJK A;  4YVQ C;  3HHM A;  2RG8 A;  4XIF A;  3LDZ A;  3VTY A;  1H2T C;  3FTW A;  4UWG A;  4AV7 A;  5BNW A;  1SQM A;  3MKR A;  2L9B A;  3QK0 A;  4U8H A;  2E0I A;  3OAW A;  5D0Q D;  1FCH A;  1HX8 A;  4OVU A;  3VTX A;  1PAQ A;  1PY1 A;  3IBE A;  3FU6 A;  2PZI A;  1MQS A;  2UY1 B;  3LVQ E;  5AJD A;  3UPV A;  1KT0 A;  5FQ6 A;  2V8S E;  3EIQ C;  3PE3 A;  3VLE A;  1Z3Y A;  4A1G A;  3GZ1 A;  2P58 C;  1KT1 A;  3RRN B;  1DNP A;  2IJG X;  3LVR E;  4P29 A;  2CHW A;  2C2L A;  3CK8 A;  5AEN A;  1HO8 A;  3EHM A;  5G2N A;  3CVN A;  4CRW A;  5ENN A;  5T3R A;  2X6H A;  1JWG A;  3R7R A;  1OWN A;  4BWR A;  4GA1 A;  3LY7 A;  4I2W A;  3GYZ A;  4KXK B;  4FAD A;  3FTX A;  3MA5 A;  4KMO A;  2WXL A;  3CHS A;  4HS2 A;  4R7L A;  2I6H A;  2VSO E;  2WXH A;  4I1M A;  2WXQ A;  2VSY A;  4PS7 A;  4CDM A;  1KLX A;  4L2L A;  2KCL A;  3ZHE B;  4D10 C;  3QAR A;  1ELK A;  5G04 J;  3URZ A;  4ACK A;  3RK6 A;  1HS6 A;  2WXK A;  3DBS A;  1H2V C;  2X6J A;  3OTN A;  4C0E A;  3S7D A;  4MS6 A;  4JL0 A;  3WXX A;  3CQC B;  3E4B A;  4ANX A;  3EDT B;  4JVS A;  2NSZ A;  3FH5 A;  4WAF A;  1NA0 A;  2IOS A;  3B7U X;  4I43 A;  4U07 A;  1Z3X A;  4JEH A;  2M63 A;  3ZHE A;  2I1J A;  3D9J A;  3R9A B;  1OWM A;  4PUC A;  2QY7 A;  2ILR A;  1JWF A;  3PNL B;  2YQ8 A;  4NRH B;  5FQ7 A;  3B7T A;  4GA2 A;  3NZU A;  3ZYK A;  2WXF A;  3NF1 A;  5FTP A;  2J08 A;  2NC9 A;  1H0A A;  2VYI A;  3D9M A;  3QWW A;  3CR3 A;  1BPO A;  4HFG A;  2CHZ A;  4LUN U;  3AU5 A;  3FU5 A;  4KZC A;  2WQH A;  4UI9 J;  2KCV A;  5G05 C;  5LFA A;  1UN8 A;  1WM5 A;  2HO1 A;  2BF0 X;  4N39 A;  5T4Y A;  3D9K A;  4A3V A;  3CK9 A;  1U3C A;  4UWF A;  2V5F A;  3PUJ A;  4FC8 A;  4CDR A;  5E76 A;  4ILI A;  4I17 A;  1INZ A;  2Y4T A;  4GZ3 A;  4KT6 B;  2PM6 A;  4NUR A;  2AVP A;  3TGO A;  3ZEF A;  2Y3A A;  2OND A;  2XCB A;  3CHO A;  4FP7 A;  4FHK A;  4RVB A;  4DLO A;  4WNG A;  3SHF A;  4JHJ A;  1EDU A;  2YHE A;  2VJ8 A;  2A5U A;  2IQC A;  4ANU A;  4Q69 A;  5LCW C;  5BUZ A;  3EHN A;  3ASH A;  1E8W A;  3HVE B;  3PE4 A;  4EZJ A;  1E96 B;  4FJZ A;  3U3W A;  3FHE A;  4XI0 A;  1UJK A;  3L6A A;  3FUM A;  3PVL A;  4OYS A;  4PH4 B;  4U0Z A;  3ZYL A;  3MCX A;  3Q5M A;  4HXI A;  3ESK A;  4ILG A;  3IHY A;  4G25 A;  4G26 A;  1HE8 A;  4JPS A;  3ENE A;  3P1U A;  4E85 A;  3QAQ A;  5EKQ D;  4EEC A;  3QB2 A;  2I2O A;  3B7R L;  3L08 A;  4GML A;  3FTU A;  4BX9 A;  1DVP A;  3APC A;  3LY8 A;  4AXH A;  3FTS A;  2V4L A;  2VTB B;  3EIJ A;  4KZ0 A;  4FJY A;  4AEZ C;  2FBN A;  5LCW J;  4I6J A;  3CEQ A;  3ML9 A;  4XKB A;  4HLE A;  2PM7 A;  4UQY A;  1Y6I A;  4H7X A;  3Q15 A;  2WXO A;  1U3D A;  2XRY A;  2R59 A;  3SBT B;  2XPY A;  4AJW A;  4EZK A;  4Q96 A;  3LY9 A;  2AW6 A;  4TUU A;  3ULQ A;  1EF1 C;  2DCP A;  2BTD A;  2WXR A;  4J8E A;  4ILH B;  3FU0 A;  3MEK A;  4JW1 A;  3S7J A;  2IU1 A;  1HZ4 A;  1ELR A;  4PS3 A;  5KCM A;  1UN9 A;  4Q94 A;  1EYH A;  1NP7 A;  5BT1 A;  1B89 A;  4UI9 C;  1IQR A;  3JCK C;  1UJJ A;  4A3T A;  3B7S A;  2WMO A;  2KCK A;  3D9P A;  4YND A;  2FUL A;  3OXG A;  3SI5 A;  4Y6C A;  3I4R B;  4I1O B;  3CVW A;  4CGV A;  4G1T A;  5FJY A;  3C98 A;  3ZW3 A;  1H6K A;  4UWK A;  3TXM A;  3PUK A;  3Q47 B;  4J0U A;  3FU3 A;  3CHQ A;  3PH0 C;  2UWJ G;  3PRE A;  2DIW A;  5EX3 A;  3PEV B;  1FVH A;  2ZU6 B;  4N3C A;  2YIN A;  4MRU A;  1QNF A;  3G2T A;  3PDN A;  3SF4 A;  3CKB A;  4AP2 A;  1HXI A;  5BV0 A;  3CVY A;  5G55 A;  3MV3 B;  2R17 C;  3FUI A;  4W9R A;  3UT7 A;  4HVB A;  1LF8 A;  2KM4 A;  1IYG A;  3ZN3 A;  4CCA A;  4APO A;  5E75 A;  2ION A;  4ANW A;  1NZN A;  1Z6T A;  4GAA A;  4F1S A;  3SNX A;  2WXM A;  1HG2 A;  2J4D A;  3S7F A;  4DPR A;  4WNF A;  2X38 A;  1UW4 B;  3ONL A;  3ZPJ A;  5J90 A;  4CT4 A;  3FH7 A;  3G2U A;  4XE0 A;  4B94 A;  5FZR A;  3L16 A;  4MLP A;  4I6G A;  2PQR A;  1X5B A;  4JA7 A;  4LCT A;  3QJZ A;  5BPP A;  5FQ4 A;  4NAC A;  1P5Q A;  4XX5 A;  5JHB A;  4U0U A;  5ARF A;  4WWN A;  3UMV A;  3D9I A;  2FO7 A;  4EBA G;  3FWV A;  3PZD A;  3ONK A;  2LNI A;  3D9L A;  4GZ6 A;  2KZT B;  3LCA A;  2R5S A;  1E8Z A;  4KVM A;  3TAX A;  2WXP A;  1HH8 A;  5D0O D;  1OWL A;  5JHA A;  4LER A;  3MZL B;  3MX3 A;  5FT9 A;  1HU3 A;  2MHK A;  3RIB A;  4CEM A;  2NXP A;  3G2V A;  4G11 A;  4FU3 A;  3RU0 A;  2QFC A;  4AOF A;  4IRU A;  3QKY A;  1YA0 A;  2HR2 A;  4BT8 A;  4UWH A;  3D9N A;  4L7T A;  2WM9 A;  3NZS A;  5CCL A;  3KD7 A;  1EPU A;  4HOS A;  1ZU2 A;  3RRU A;  5JJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...