4RG6A

Crystal structure of apc3-apc16 complex
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
498
structure length
474
Chain Sequence
QEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an APC3-APC16 Complex: Insights into Assembly of the Anaphase-Promoting Complex/Cyclosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cell division cycle protein 27 homolog
total genus 160
structure length 474
sequence length 498
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg6A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg6A03
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg6A04
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg6A02
2MHKA 4WNEA 2FF4A 5FJYA 4AY5A 3JYSA 3QKYA 4I9EA 3LY8A 1QZ2A 2LSVA 2JLBA 3LKUA 3Q15A 4J8DA 5CHEE 5G05J 3UUXA 2BUGA 2VGYA 2NC9A 4UI9K 4I9CA 3BEEA 3PDNA 1IHGA 2LNIA 2Y4TA 4G1TA 4J8FA 3ASHA 4KXKB 5EKQD 3TAXA 2OOEA 4GYYA 3QWWA 3MEKA 2WQHA 3VTYA 2PQRA 5BNWA 3QWVA 3ZN3A 3UPVA 3CK8A 3RO2A 1A17A 4IN3B 5CCLA 4RG6A 5LCWJ 4GYOA 5CCMA 2VQ2A 4CDRA 3MKRA 4GCNA 3S7BA 4I2ZA 4J0UA 2XPIA 4CGWA 3LCAA 2FBNA 2J9QA 2YHCA 5D0QD 5AYWD 1ELRA 5EX3A 5ARGA 4B94A 4G24A 2UWJG 4KYOB 4N2SA 4AM9A 1W3BA 4Y6WA 3LY9A 5FZQA 3S7DA 4APOA 3QWPA 5JJTA 3OXGA 3CKBA 2QFCA 3O48A 4JA9A 4YNDA 3KS2A 2HR2A 3AS4A 3KD7A 3RKVA 5FT9A 4BTBA 3LY7A 3TG5A 5G05C 2LSUA 4F3VA 2XCCA 3RO3A 3CVQA 3TGOA 3SF4A 4HORA 1B89A 4GZ5A 5M72A 2XGOA 1NZNA 4GYWA 4U0UA 4YVOA 4BT8A 1ZBPA 3ESKA 5KJKA 4I1AA 5D0OD 2VSNA 4N2QA 2P58C 3QOUA 2L6JA 2AVPA 3CK9A 3FWVA 1Y8MA 4G2VA 4UI9C 3RIBA 3WXXA 3U3WA 4HOSA 2Y4UA 5FZSA 4YVQC 3IEGA 4WNDA 3S7JA 1KT1A 2IF4A 3LPZA 3ZPJA 2KCKA 1E96B 2XGMA 5JJ6A 4W9RA 1FCHA 2PL2A 3CK7A 2PQNA 4U07A 3OXLA 5A7DB 5A6CA 2KATA 3ZFWA 4WUYA 4BTAA 5C1DA 5KJNA 4KBQA 3MV3B 2YQ8A 5DBKA 4U0SA 5BT1A 4O6FA 4JHRA 4GZ3A 3ZHEA 2E2EA 5JJ7A 4GCOA 4I2WA 2VSYA 2HO1A 3GZ2A 4UQZA 3NF1A 1TJCA 4UQYA 1ELWA 1NA3A 1WM5A 3FP3A 3GZ1A 3PE3A 4CGVA 3CVLA 3KAEA 4GA0A 4N3CA 4BT9A 4AY6A 4G23A 4AIFA 5HI7A 5KJMA 2FO7A 5BW8C 3Q47B 4UQXA 3ASDA 5DIZA 1HXIA 4NRHB 3FFLA 4XIFA 4ABNA 2VGXA 1XNFA 3PE4A 4JL0A 1IYGA 1QQEA 1HZ4A 4N5CA 1WAO1 5EX0A 2C0MA 5HQ8A 5FZRA 3CVPA 3OXFA 3VTXA 2GW1A 4H7XA 2IFUA 3ZGQA 3CEQA 1OUVA 3CV0A 4N39A 2UY1A 3AS8A 4WNGA 3RU0A 5G04J 2ONDA 3CKCA 3E4BA 4J8EA 2DBAA 3UQ3A 2C2LA 4EQFA 3CVNA 2VYIA 4GPKA 4GZ6A 4N3BA 1YA0A 3LYAA 3EDTB 4UI9J 3SZ7A 2C0LA 1HH8A 5LCWC 4A1SA 3HYMB 3ASFA 4GA1A 4U04A 2KCLA 4U0ZA 1NA0A 2R5SA 4G25A 5G04C 4HOUA 2VGXB 4HOTA 3K9IA 1KT0A 2XEVA 2I6HA 2V5FA 4GA2A 4Y6CA 3URZA 2Q7FA 3GW4A 2KCVA 4XI0A 2WPVA 2FI7A 3MV2B 4G26A 4I17A 3Q49B 4WNFA 1P5QA 3AS5A 4JA7A 3R9AB 2PZIA 3U4TA 3S7FA 4H7YA 4LEUA 1ZU2A 3Q5MA 3ULQA 4ME2A 5KJLA 3TG4A 1KLXA 1PC2A 3GYZA 4BWRA 2HYZA 4NQ0A 2XGSA 4XI9A 2KC7A 2UY1B 2FEZA 4RG9A 5ARFA 3ASGA 3QDNA 5FTPA 3ZHEB 3N71A 4HOQA 3RJVA 3Q4AB 4N3AA 3MA5A 2XCBA
chains in the Genus database with same CATH superfamily
4D10C 4I9EA 5J08A 2LSVA 3JUIA 2JLBA 4J8DA 5KJKA 2Y4TA 2LNIA 5AIJA 4PH4B 2OV8A 4GYYA 4HFGA 2JEKA 1SZAA 1A17A 3ZVVA 1SZ9A 4URKA 4U8HA 2WXLA 3FUNA 3KEAA 4UWFA 3T9KA 5LFAA 4FA6A 3FU5A 4I2ZA 5AYWD 3TWXA 3J5QB 2Y0BG 4HNAD 2UWJG 2NYJA 3TWQA 3G2TA 5KNHD 1FPPA 3PS6A 4EECA 3DSXA 3ULYA 4U0UA 3I4RB 3PVLA 4I1AA 2QY7A 3QOUA 3U3WA 2LAIA 4K03A 2Y4UA 1OCRE 2AWIA 5C1DA 4WUYA 1K3ZD 3Q7FA 1SW6A 3FP3A 3UTMA 1N4RA 5AARA 5BW8C 1N52A 4XIFA 2H6IA 4DX7D 5JHBA 3L22A 1UJKA 2GW1A 5B3SE 4FC8A 4O1PA 3CHRA 1K1AA 4XI0A 4OVVA 1LD8A 4YDEA 4ANVA 3Q78A 1TN8A 4RVBA 4LRZA 3TJPA 3QDNA 1U3DA 3IBEA 2J4DA 2Y69E 3LY8A 5G05J 2F37A 3ZYMA 2VGYA 3DSWA 4I6JA 5HS0A 2WXPA 4F6RD 3UX4A 2L9BA 1L5JA 1JPLA 3DPDA 3UINC 1ELRA 3TL5A 4G24A 2WXGA 1X5BA 4N2QA 2NXPA 5FT9A 5BUZA 4ILGA 1NL4A 1VDYA 4FJYA 3J5PA 4FLBA 3RIBA 1E96B 1H0AA 2KATA 3DEPA 4RQIA 5T4YA 4BX8A 5JJ7A 4TXPA 3SGHA 1MZCA 4GTMA 2EQXA 4GPMA 2CFUA 5DIZA 2QYUA 4M3OA 4PDXA 3ZGQA 3E30A 3AS8A 3PUKA 2ONDA 2DBAA 4BFRA 2EIME 4GTPA 3TWVA 3FH8A 2GRNB 3PZ3A 2R5SA 2HE0A 1U3CA 4QFVA 3JQ1A 5EIDA 2IO2C 2PZIA 3AG2E 3L82A 1LF8A 4JXTA 3QC1A 4N3AA 2IU1A 5JA4D 4UI9K 3T5VA 3CVYA 3TAXA 4E85A 3MEKA 4J6IA 1FT2A 2AXUA 3FTXA 1HFAA 2X3MA 5ENRD 4CGWA 2OCCE 3X2QE 2L0TB 3HXEA 4HLLA 2X38A 3LY9A 3ZYKA 4F3VA 5JHAA 4GZ5A 1UJJA 1LTXA 4ANXA 3LJNA 4G8KA 2RFAA 2L6JA 2AVPA 4BX9A 3MZLB 3U66A 2LAHA 1FCHA 4LUNU 2J08A 4A63B 3LJ3A 3LVRE 3Q9UC 2XEEA 3C3OA 1RW2A 3RRUA 5AJDA 4GA0A 4AV7A 4AIFA 2ZIRA 3D3MA 3CVUA 5FZRA 4GTSA 4N3BA 4Q96A 5J90A 3ABKE 4EHMA 1YMPA 4Y6CA 4B0ZA 4L7TA 3MV2B 1S0PA 3NOGD 3FUEA 1E7VA 2LO6A 4R7LA 1ELKA 5E75A 2B6CA 2WXOA 4DLOA 2WXIA 3G2WA 3FUFA 4WWPA 4NQ0A 3UT4A 4AY5A 4DK5A 5CHEE 2EILE 3HVEB 3FDHA 4K0RA 3UUXA 3VLEA 2AW6A 1UOHA 3ASHA 2OOEA 1SVXA 4KMOA 3QWWA 3V31A 2DWZA 3PRZA 4HXIA 5G55A 1QNFA 5ANRA 4GMLA 1HO8A 3L6AA 5KCMA 5ITZF 3G2VA 4Y6WA 2DYSE 4HI8A 3KD7A 3RKVA 3LY7A 1EDUA 3FY4A 2XGOA 3NB2A 2BF0X 3UMVA 2VTBA 2VSNA 3E34A 3TWRA 5JMND 5AN8A 4U0SA 1N4PA 1E8WA 3SFXA 2WM9A 3PE3A 2ZGGA 3FTZA 2P9IG 3AG3E 1HXIA 4C0MA 3Q79A 1EPUA 4GTTA 4B8CB 1JCRA 3EU9A 4GB9A 1WY6A 5T8IA 1GW6A 2KBXA 4G26A 4I17A 4EZKA 4JA7A 3U4TA 5FQ4A 4A1GA 1QBQA 3LXUX 5D2MC 3RJVA 3CQCB 4HI9A 2EIKE 5ENSD 4G1TA 5KNGA 1G3NB 4LNBA 1MQSA 2ETAA 4RG6A 5CCMA 2XS1A 4FULA 3UKRG 2XPIA 3ZW3A 4BY6A 3NZUA 4AVXA 4B89A 4GAAA 4KYOB 4PS8A 3ONKA 3DRAA 4BTBA 1TN6A 2XQ0A 2LSUA 4DI3A 2ZXWE 1N11A 3U9WA 3FU3A 3DXMG 2VGEA 3B7SA 2P9NG 2IONA 2ILRA 3CHQA 4KZ0A 5KJNA 2YNQA 2WMNA 2CHXA 1LD7A 3Q73A 3ASNE 2GRLA 1TNYA 4G23A 3ABLE 4UQXA 3UKUG 1HZ4A 4N5CA 1WAO1 4H7XA 5CECB 3DPYA 2B0OE 4ATGA 4I1OB 3G2UA 1KT0A 1BPOA 4IULA 3SY2A 3APDA 2IOSA 3IHVA 1OCCE 3PUJA 3HHMA 1OWNA 3V30A 2M63A 3FUKA 4TXQA 4KZCA 5BNWA 2FF4A 1O1RA 3LKUA 2NC9A 4ANUA 2A5EA 5AQ9A 3SBSA 3QWVA 1OY3D 1INZA 4I1MA 3CHOA 5LCWJ 3UT7A 5FIOA 3MYVA 3HVEA 2R05A 5BV1A 3W9FA 2V4LA 5B1BE 4ACKA 4N2SA 3ULEG 3FEXA 4JA9A 4YNDA 4F7AA 1H2TC 3UM0A 3CHMA 3P2BA 4UI9C 3V2OA 5LP0A 2V5QC 3S7JA 2I2OA 4XEIG 3DSSA 4HLEA 1HU3A 3HXFA 2ZU6B 3NF1A 4K5AB 3HXCA 1NA3A 3FUJA 2X6HA 4UUCA 3UM2A 4BT9A 2LXLA 3UI2A 3ZIMA 2XENA 3DXKG 1O1SA 3IHYA 3RK6A 1TEZA 3GZSA 2A4ZA 4FHJA 4UWGA 4GA1A 3D9HA 2KZTB 3CR3A 2H6HA 3GW4A 3L08A 1UW4B 2E0IA 2J8SD 1SQMA 4EZLA 4WAFA 1O1TA 2UY1B 1MX6A 1N4QA 4BESA 4LNUD 4I9CA 5ANLA 1E90A 1HS6A 4LCTA 2WQHA 2XPYA 3NZSA 2GRQB 5EYPF 1D8DA 4MKTA 3HG0D 1TYQG 5ARGA 3TWUA 1W3BA 2HM8A 3OXGA 1Q2ZA 3D9KA 3FUHA 3TG5A 3PH0C 4HORA 3FU0A 4AOFA 3NOCD 3APFA 4JC8A 4YVOA 3EHQA 3CIAA 1UN9A 3DSTA 3PZ1A 3RAUA 3BU8A 4DLQA 5A7DB 2WQ6A 4BTAA 3KEZA 1H6OA 5CERB 2EINE 4JEHA 5CRUA 4JVSA 2WXFA 3ASDA 4JL0A 4AJWA 3EUVA 2UY1A 4AP2A 3FUMA 4EBAA 2VYIA 1DCEA 5ENOD 1N9AA 3D9MA 4U04A 1FVHA 2VGXB 3CVXA 2WMOA 4FHKA 2WXJA 2GRMA 4U8YD 3UIPC 4BWRA 2BKGA 3AU4A 4EBAG 4RG9A 1TN7A 2MHKA 5FINA 5ENNA 3VLDA 4ILIA 3QKYA 1N0QA 5FWQA 4WWOA 3D9NA 3FHEA 3CK8A 3CSFA 1IKND 2PM6A 4JZYA 4DX2A 3MKRA 4GCNA 4XX5A 1KZPA 3SBTB 4UWHA 3ISMC 3TXNA 4J8YA 1OWPA 3CKBA 2WB2A 3EIJA 5G05C 5EILA 3G2SA 4HS2A 3R7RA 4AXHA 4LSZE 3D9PA 3AU5A 3D9OA 3ZPJA 5KWDA 1KPSB 3CK7A 3ENEA 4O6FA 2E2EA 1DCQA 4ZHBA 3ML8A 4AEZC 1TJCA 3CVLA 1TNZA 3B7UX 2RFMA 4ILHB 3PEVB 4ABNA 3JQ0A 1XNFA 1QQEA 3HXBA 4V3IA 1OUVA 3CV0A 1H2UA 3CVNA 4NURA 4DX6D 1PAQA 1A5EA 2V5FA 4RSYA 1BI8B 3PZ2A 4HRMB 4GZCA 1O5MA 4B8AA 3ESLA 4JHJA 3JYSA 5EDSA 2GRRB 3UM1A 4I6EA 2X6JA 2WXRA 3SHFA 1BD8A 3I4GA 1JWFA 4EPZA 1N95A 1E8ZA 3B13A 1HG5A 5A23A 1DC2A 2FO1E 3IXEA 4AY6A 2QFCA 2ZISA 2OEVA 3CVQA 1B89A 2XPZA 4BT8A 5CMWA 2L6BA 4YVQC 4WNDA 1YYHA 3PNLB 4HRNA 1OCZE 4U8VD 2AXVA 2PL2A 4I43A 5A6CA 3MX3A 4YDOA 5DBKA 3T8KA 3FTSA 5AQAA 4UQYA 4CGVA 4XKBA 5D66A 4UWKA 2P9SG 5HI7A 3RSEG 2WXKA 4GMRA 3PE4A 5EX0A 4NIKA 1SA4A 1IXVA 5BV0A 2QYJA 4G25A 3V2XA 1EF1C 3MCXA 2Q7FA 3UM3A 4YDWA 3Q5MA 4FJZA 3GYZA 1JCSA 3QK0A 5C2YA 3CSTA 3U64A 1QYMA 2R2LA 4APFA 3HIZA 2VQ2A 3LCAA 4GMJA 2WXMA 3AG4E 4GTQA 2QZAA 5HRYA 2KZTA 3B95A 2R17C 3SF4A 3OAWA 4BETA 4E6HA 3MJWA 1HE8A 1UN8A 2I1JA 2P58C 3CK9A 2LXMA 3WXXA 4DI4A 1KT1A 4M7CA 3MKQA 2CHZA 4LG6A 4OYSA 3OXLA 4CEMA 5BT1A 4DJAA 3L9TA 1ELWA 4OAUC 3ZEFA 4CCAA 1EYHA 3BUAA 3O4ZA 2P9UG 4U7EB 5LCWC 4C9BB 1S63A 3QJZA 1NI1A 1HH8A 3D9LA 2CG2A 4TRQA 3NAWA 1ZB1A 4N5QA 1MYOA 3B7BA 4HRLA 3LEWA 1TR4A 5E76A 4GTVA 2WVIA 3ULQA 1FVFA 1K8KG 2KC7A 1UG3A 3BG0B 1TJFA 1SA5A 2RG8A 4MRUA 4A3TA 2BUGA 5EIBE 2J07A 4KVOA 3RO2A 4GYOA 1BLXB 5H7PA 2I9CA 3EIQC 3R7QA 5AJLA 2XHEA 3EU5A 2IOLA 5LOZA 5CEDB 4Q69A 3DWLG 3JUEA 4MBGA 2A5UA 3SFYA 2V0PA 3D9IA 5FZSA 4K5CA 2VJ8A 2VSOE 3BG1B 3LPZA 4W9RA 2L0IA 3I3NA 4FU3A 4DX5D 4JHRA 1DNPA 2VSYA 5B1AE 1U2VG 3ZU7B 1Z5SC 3KAEA 2VGXA 2C0MA 3VTXA 2V8SE 3FTWA 2OVBA 4DX1A 3L17A 2C2LA 4GZ6A 2NSZA 4L2YA 3TWSA 2P9KG 3HYMB 4U0ZA 4HOUA 3L13A 3K9IA 3DSVA 3AS5A 4ANWA 1OXJA 1TNUA 1ZU2A 4L1BA 3V79K 2XGSA 1HF8A 4HOQA 2WQ7A 1V55E 2XZDG 4CZ2D 3QARA 4HB5A 1KZOA 1QZ2A 4UWLA 4GU5A 5IY5E 3PDNA 3C98A 3MGBA 1Y6IA 1PY1A 5BPPA 4JW1A 1OWMA 1OWOA 4B94A 4JPSA 3ZYQA 4AM9A 5JJTA 1H6PA 4CYMD 3ZYLA 3IV0A 4A3VA 3PREA 3TGOA 1TNBA 3T8MA 5D0OD 3FWVA 3PZ4A 4HOSA 3C5RA 3C72A 3E37A 1MHQA 5HKPA 1K1BA 3ZXPA 2X6IA 2MRIA 5EN5D 4I2WA 4CRWA 3EHRA 3AAAC 3ABME 4JB8P 1WM5A 3GZ1A 3Q47B 1IYGA 1H2VC 5HQ8A 5ENTD 3CEQA 4WNGA 2F8XK 3TXMA 4RLYA 3TWWA 4PS7A 1BI7B 2KM4A 2I6HA 3URZA 2ETCA 4XKCA 2FI7A 5ENPD 1JCQA 3R9AB 3TWTA 4NACA 2HYZA 4ZFHA 2R59A 5FTPA 3W9GA 4L9PA 1OWLA 3ZKJA 4TXRA 3Q15A 4G11A 3LVQE 3FH7A 1AWCB 1V54E 5FQ6A 4KXKB 2VTBB 4L2LA 4HVBA 4YDYA 1FT1A 4CDRA 3ASOE 3S7BA 2J9QA 4CT4A 1NP7A 2YHCA 3UT8A 5D0QD 1BU9A 3OTNA 4XE0A 2XEHA 4APOA 4IRUA 5CMYA 4KT6B 3VLFA 3RO3A 1WDYA 3CHSA 1HX8A 1NZNA 3ESKA 3LDZA 3SNXA 1Z6TA 3CVWA 1H6KA 2IF4A 4BSXA 2PQNA 5KBAA 4F53A 4OVUA 4UQZA 2VSXE 4N3CA 2CG3A 3KSQA 2PM7A 5ENQD 3ZNGA 1E8XA 2XS8A 3FTVA 4DRXE 3RU0A 4N39A 4GZDA 5G04J 4X8QA 3FEYA 3ML9A 4EQFA 1WG0A 1Z3XA 5T3RA 4A1SA 3UXGA 2KCLA 2F0YA 3SI5A 2IJGX 3KSLA 3FULA 3CVVA 4BSZB 3Q49B 2GGFA 2J49A 3S7FA 3WG7E 4LEUA 5CRVA 4ME2A 1MX4A 3TG4A 1KLXA 1PC2A 2DIWA 2R02A 2FEZA 3E32A 1D9SA 4Z68A 5FJYA 3Q7AA 4WWNA 3JXJA 3PNTB 3PZDA 3F6QA 2V4HC 3BEEA 4J8FA 3UPVA 2OVFA 2PQRA 5FQ7A 3ZN3A 3T5XA 4IN3B 1RZ4A 1S70B 2P9PG 2CFZA 3FU6A 3C3RA 2FBNA 4LERA 2J09A 2J4BA 1D8EA 4DPRA 1E8YA 1YCSB 3KS2A 2HR2A 2XCCA 3EJNA 1S64A 1X81A 4GTRA 3IKOB 4XZ4A 2XRZA 3C3QA 4P29A 4U07A 1JWGA 3MV3B 1MX2A 2IEJA 3ZHEA 3APCA 4GZ3A 4CDNA 2DZOA 4FP7A 3UIOC 3P1UA 4J7WA 3SFZA 1JUQA 4TUMA 2YHEA 3FFLA 4BEPA 3OXFA 5AENA 2P9LG 2Y3AA 4J8EA 4GPKA 2X6KA 2IQCA 3EDTB 4UI9J 3QNKA 2JABA 4EZJA 3ZXSA 5G04C 4HOTA 1HG2A 3AG1E 1N0RA 4WNFA 1H19A 2WXNA 4H7YA 3CHPA 2QC9A 5KJLA 1TNOA 3QAQA 3EHNA 3N71A 3B7TA 2XCBA 4WNEA 4BERA 3PEUB 3LS8A 4B93B 2KXPC 2LUHA 4GTOA 4JHKA 5EKQD 4JD2G 5AAOA 4F1PA 4FLHA 4IYPA 1N94A 5CCLA 3CQGB 1MJ0A 4FADA 1XGWA 4J0UA 3R9MA 4U63A 1IQRA 3Q9NC 3Q75A 2DCPA 3RRMB 5EX3A 2MYOA 5FZQA 3S7DA 4L23A 3O48A 5CEAA 3AS4A 3NBNB 5M72A 4MS6A 3I5PA 1NFIE 4DUIA 4ATZD 2BKKB 1Z3YA 1Y8MA 3HRAA 3IEGA 5BXOA 2KCKA 3JXIA 3SD5A 2XGMA 4JEUA 3ZFWA 2AJAA 2CHWA 2YQ8A 2OEWA 4O1OA 2HO1A 3GZ2A 4A55A 4I6GA 1DVPA 4J8SA 2FO7A 2MOWA 5CBNA 3DBSA 3QB2A 1IQUA 3CVPA 2RKKA 2IFUA 2GROB 2EIJE 3UQ3A 3SO8A 5BXUA 2DZNA 3B7RL 3E4BA 5G2NA 1YA0A 3LYAA 3SZ7A 4U96D 1N54A 5EYLA 3RRNB 3ASFA 4CDMA 1NA0A 2P2CP 3DSUA 4HBDA 2XEVA 2GRPB 3SQVA 2WPVA 2XZTG 4Q94A 2FULA 4PUCA 4PS3A 2R03A 3CLJA 3ZUVB 4OAVB 3ONLA 5FQ8A 3L16A 2BEDA 3ZHEB 2ETBA 3Q4AB 3MA5A 4C48B 2YINA 4C0EA 2PNNA 2RD0A 5AQBA 1IHGA 2H6FA 3VTYA 4O60A 2DYRE 5LX8A 2Y1LE 2H6GA 2F8YA 3MKQB 3QWPA 5AQ7A 2WXQA 3HXDA 4U95D 2IY0C 1N4SA 4GYWA 1ZBPA 4G2VA 1OT8A 5CBOA 3E33A 5JJ6A 2BTDA 1IHBA 3L54A 3ZRHA 3FUDA 4GCOA 3D9JA 3EHMA 4G8LA 5KJMA 4NRHB 4K5BA 2DVWA 2ZGDA 3AJIA 2IO3C 2I1KA 3S2AA 1E7UA 2WXHA 2XRYA 4F1SA 3CKCA 4MLPA 2C0LA 3FH5A 4QQIA 3FUIA 4CT0A 3HDXA 4ACLA 2X6FA 4HQDA 3FTYA 4GA2A 4TV3A 2KCVA 1AP7A 1OCOE 3BQOA 2AXZA 3NQPA 4TUUA 1P5QA 3JCKC 4KVMA 3CGHA 4LNGA 5ARFA 3ASGA 3DEOA 3FTUA 4XI9A 4KBQA
chains in the Genus database with same CATH topology
3ESLA 1OWLA 4JHJA 3CQCB 4D10C 3JYSA 4I9EA 5J08A 2LSVA 3JUIA 2JLBA 3Q15A 4G11A 4J8DA 3LVQE 3FH7A 5EDSA 5FQ6A 4G1TA 4KXKB 2Y4TA 2LNIA 4I6EA 5KJKA 5AIJA 4PH4B 2X6JA 2OV8A 4GYYA 4HFGA 2VTBB 2JEKA 2WXRA 4L2LA 3SHFA 1SZAA 4HVBA 1A17A 3ZVVA 1SZ9A 1MQSA 4RG6A 4URKA 4U8HA 5CCMA 2WXLA 3I4GA 4FULA 1JWFA 3FUNA 4UWFA 4CDRA 4EPZA 5LFAA 4FA6A 3S7BA 1E8ZA 3FU5A 4I2ZA 2XPIA 3ZW3A 2J9QA 4BY6A 1NP7A 2YHCA 3UT8A 3B13A 3NZUA 5D0QD 5AYWD 1HG5A 4AVXA 3OTNA 4XE0A 4GAAA 4B89A 5A23A 2UWJG 4KYOB 3G2TA 4APOA 4AY6A 2QFCA 4IRUA 3ONKA 4PS8A 5CMYA 4BTBA 4KT6B 2XQ0A 3VLFA 2LSUA 3RO3A 3CVQA 3PS6A 1B89A 2XPZA 4EECA 3CHSA 1HX8A 4DI3A 1NZNA 4U0UA 3I4RB 4BT8A 3ESKA 5CMWA 3PVLA 3LDZA 4I1AA 2QY7A 3SNXA 3QOUA 1Z6TA 3U9WA 3CVWA 3U3WA 2LAIA 4K03A 2Y4UA 3FU3A 4YVQC 4WNDA 1H6KA 2IF4A 3PNLB 3B7SA 2AXVA 2PL2A 2IONA 2ILRA 2PQNA 3CHQA 4I43A 2AWIA 4BSXA 5A6CA 4KZ0A 5C1DA 4WUYA 5KJNA 3MX3A 5DBKA 2YNQA 2WMNA 3FTSA 4F53A 4OVUA 2CHXA 4UQZA 4UQYA 3FP3A 2VSXE 4CGVA 4N3CA 2CG3A 2GRLA 4XKBA 2PM7A 4UWKA 4G23A 5HI7A 5BW8C 4UQXA 2WXKA 1N52A 4XIFA 3PE4A 5EX0A 1HZ4A 4N5CA 1WAO1 1E8XA 5JHBA 3L22A 1UJKA 2GW1A 4H7XA 3FTVA 3RU0A 4N39A 4GZDA 5G04J 3FEYA 3ML9A 4EQFA 1Z3XA 5T3RA 4FC8A 5BV0A 4A1SA 4ATGA 2KCLA 4I1OB 3CHRA 4G25A 3G2UA 1EF1C 1KT0A 3MCXA 3SI5A 2IJGX 1BPOA 2Q7FA 4XI0A 3FULA 4IULA 4OVVA 3CVVA 3APDA 3Q49B 2GGFA 4ANVA 2J49A 2IOSA 3IHVA 3PUJA 3S7FA 3HHMA 4LEUA 3Q5MA 1OWNA 4ME2A 4FJZA 4RVBA 2M63A 1KLXA 1PC2A 3GYZA 2DIWA 3TG4A 4LRZA 2FEZA 3FUKA 3TJPA 3QDNA 1U3DA 4KZCA 5BNWA 3IBEA 2FF4A 5FJYA 2J4DA 3LY8A 3QK0A 3LKUA 5G05J 4WWNA 3ZYMA 3PNTB 2VGYA 3PZDA 2NC9A 3CSTA 4I6JA 5C2YA 3BEEA 4ANUA 3U64A 2WXPA 4J8FA 3SBSA 3UPVA 2OVFA 2PQRA 3QWVA 5FQ7A 3T5XA 3ZN3A 4APFA 1INZA 4I1MA 4IN3B 3CHOA 3HIZA 3UX4A 5LCWJ 2L9BA 1L5JA 2CFZA 2VQ2A 3FU6A 3UT7A 3MYVA 1JPLA 3DPDA 3HVEA 3LCAA 2FBNA 5BV1A 4LERA 4GMJA 2WXMA 2V4LA 1ELRA 3TL5A 2J09A 4G24A 4ACKA 2J4BA 4N2SA 2WXGA 1X5BA 4DPRA 1E8YA 3FEXA 4N2QA 4JA9A 4YNDA 2KZTA 2HR2A 3KS2A 2NXPA 5FT9A 2R17C 2XCCA 3SF4A 4F7AA 5BUZA 1H2TC 3EJNA 3CHMA 3OAWA 4ILGA 1VDYA 4E6HA 4FJYA 3MJWA 1HE8A 1UN8A 2I1JA 3P2BA 2P58C 3IKOB 4FLBA 3CK9A 4UI9C 4XZ4A 3RIBA 3WXXA 4DI4A 5LP0A 2XRZA 3S7JA 2I2OA 1KT1A 1E96B 3MKQA 4P29A 1H0AA 2CHZA 4OYSA 4U07A 3OXLA 1JWGA 4HLEA 2KATA 1HU3A 4CEMA 3MV3B 5T4YA 5BT1A 4BX8A 3ZHEA 3APCA 4GZ3A 4DJAA 4CDNA 5JJ7A 2ZU6B 3NF1A 1ELWA 1NA3A 3FUJA 4FP7A 3SGHA 2X6HA 3P1UA 2EQXA 4BT9A 2CFUA 3ZEFA 3SFZA 4CCAA 1JUQA 1EYHA 5DIZA 3ZIMA 2YHEA 3FFLA 3O4ZA 4M3OA 3IHYA 3RK6A 4PDXA 3OXFA 3ZGQA 5AENA 2Y3AA 5LCWC 1TEZA 3AS8A 3PUKA 2ONDA 4C9BB 4J8EA 3GZSA 2DBAA 2X6KA 4GPKA 4BFRA 2IQCA 3QJZA 3EDTB 4UI9J 3QNKA 1HH8A 2A4ZA 3FH8A 4FHJA 3D9LA 4UWGA 4GA1A 2CG2A 3ZXSA 4EZJA 4TRQA 2R5SA 5G04C 4HOTA 1HG2A 3CR3A 2KZTB 1U3CA 3GW4A 4QFVA 3JQ1A 3L08A 3LEWA 1UW4B 4WNFA 1H19A 4CT4A 5E76A 2E0IA 2PZIA 1SQMA 2WVIA 2WXNA 4H7YA 3ULQA 3CHPA 4EZLA 1FVFA 5KJLA 4WAFA 2KC7A 1UG3A 2UY1B 3BG0B 3QAQA 1LF8A 3EHNA 3N71A 4JXTA 3QC1A 3B7TA 4N3AA 1TJFA 2XCBA 2IU1A 4WNEA 2RG8A 3PEUB 4MRUA 3LS8A 4A3TA 2BUGA 3RJVA 4UI9K 4I9CA 4JHKA 5ANLA 3T5VA 5EKQD 3CVYA 1E90A 3TAXA 1HS6A 4LCTA 2J07A 3MEKA 2WQHA 4J6IA 4E85A 4KVOA 2AXUA 2XPYA 3NZSA 4FLHA 3RO2A 4IYPA 3FTXA 5CCLA 1HFAA 3CQGB 4MKTA 4GYOA 4FADA 2X3MA 1XGWA 4J0UA 4CGWA 4U63A 1IQRA 2DCPA 2L0TB 2I9CA 5ARGA 5EX3A 3RRMB 3EIQC 3R7QA 2X38A 5AJLA 2XHEA 1W3BA 3LY9A 5FZQA 2HM8A 3S7DA 3OXGA 4L23A 3O48A 3ZYKA 3AS4A 3D9KA 2IOLA 5LOZA 3FUHA 3TG5A 4F3VA 4Q69A 5JHAA 3PH0C 4HORA 3FU0A 4GZ5A 5M72A 4MS6A 1UJJA 4AOFA 2A5UA 3APFA 4JC8A 4YVOA 3I5PA 4ANXA 3CIAA 2V0PA 3D9IA 1UN9A 2L6JA 2AVPA 1Z3YA 1Y8MA 5FZSA 2VJ8A 3IEGA 4BX9A 2VSOE 3BG1B 3LPZA 2KCKA 3SD5A 2XGMA 3MZLB 3U66A 4DLQA 4W9RA 2LAHA 1FCHA 2L0IA 3I3NA 4FU3A 5A7DB 2WQ6A 4LUNU 2J08A 4JEUA 3ZFWA 4BTAA 3KEZA 2CHWA 2YQ8A 4JHRA 3LJ3A 3LVRE 1DNPA 2VSYA 2HO1A 3GZ2A 4A55A 4JEHA 3RRUA 5AJDA 3KAEA 4GA0A 4I6GA 4AV7A 1DVPA 4JVSA 4AIFA 4J8SA 2FO7A 2MOWA 2WXFA 3D3MA 3ASDA 3CVUA 2VGXA 4JL0A 3DBSA 3QB2A 2C0MA 4AJWA 5FZRA 1IQUA 3CVPA 3VTXA 2IFUA 2V8SE 2UY1A 3UQ3A 4AP2A 3FUMA 3FTWA 2OVBA 3B7RL 3E4BA 3L17A 2C2LA 5G2NA 4EBAA 2VYIA 4GZ6A 4N3BA 1YA0A 3LYAA 2NSZA 3SZ7A 4L2YA 4Q96A 1N54A 3D9MA 3HYMB 5J90A 3RRNB 3ASFA 4CDMA 4U04A 4U0ZA 1NA0A 1FVHA 4HOUA 2VGXB 3CVXA 3L13A 3K9IA 2XEVA 4Y6CA 2WMOA 4FHKA 4B0ZA 2WXJA 4L7TA 2WPVA 3MV2B 1S0PA 3FUEA 4Q94A 2FULA 1E7VA 2LO6A 4PUCA 4PS3A 4R7LA 1ELKA 3AS5A 3CLJA 5E75A 2GRMA 4ANWA 2WXOA 3ONLA 1ZU2A 5FQ8A 4DLOA 4L1BA 2WXIA 4BWRA 3G2WA 3FUFA 4WWPA 4NQ0A 2XGSA 4EBAG 3AU4A 3L16A 4RG9A 3UT4A 3ZHEB 1HF8A 4HOQA 4AY5A 4DK5A 3Q4AB 5CHEE 2WQ7A 3MA5A 2MHKA 5ENNA 3VLDA 3QARA 3HVEB 3QKYA 4ILIA 2YINA 1QZ2A 3FDHA 4UWLA 4C0EA 4K0RA 3UUXA 3VLEA 4GU5A 2RD0A 2AW6A 3PDNA 1IHGA 3C98A 5FWQA 3ASHA 3MGBA 4WWOA 2OOEA 3D9NA 3FHEA 4KMOA 3QWWA 3VTYA 1Y6IA 3CK8A 3CSFA 1PY1A 2PM6A 5BPPA 3PRZA 4HXIA 4JZYA 1QNFA 5ANRA 5G55A 4GMLA 5LX8A 1HO8A 3MKRA 4GCNA 4XX5A 3L6AA 4JW1A 3SBTB 1OWMA 1OWOA 4UWHA 3TXNA 5KCMA 4B94A 4JPSA 3G2VA 3ZYQA 4AM9A 1OWPA 4Y6WA 3MKQB 3QWPA 5JJTA 3CKBA 2WB2A 2WXQA 3KD7A 3RKVA 3EIJA 3LY7A 3ZYLA 3IV0A 5G05C 4A3VA 3PREA 3G2SA 4HS2A 3TGOA 3R7RA 1EDUA 3FY4A 2XGOA 4AXHA 3D9PA 4GYWA 2BF0X 1ZBPA 3UMVA 2VTBA 3T8MA 5D0OD 2VSNA 3AU5A 3FWVA 4G2VA 3D9OA 4HOSA 3ZPJA 5JJ6A 2BTDA 3CK7A 3L54A 1MHQA 3ENEA 4U0SA 4O6FA 3ZRHA 3FUDA 2E2EA 2X6IA 2MRIA 4GCOA 1E8WA 4I2WA 4CRWA 3ML8A 4AEZC 2WM9A 1TJCA 1WM5A 3D9JA 3EHMA 3GZ1A 3PE3A 3CVLA 3FTZA 3B7UX 5KJMA 3Q47B 4ILHB 1HXIA 3PEVB 4NRHB 4ABNA 4C0MA 3JQ0A 1XNFA 1IYGA 1QQEA 1H2VC 5HQ8A 1EPUA 2I1KA 4V3IA 3CEQA 1OUVA 3CV0A 1E7UA 2WXHA 4WNGA 1H2UA 2XRYA 3S2AA 4F1SA 3CKCA 3TXMA 3CVNA 4MLPA 4NURA 4B8CB 2C0LA 3FH5A 4PS7A 1PAQA 3FUIA 4CT0A 2KM4A 3HDXA 4ACLA 2X6FA 4GB9A 1WY6A 3FTYA 5T8IA 4GA2A 2I6HA 2V5FA 4RSYA 4TV3A 3URZA 1GW6A 4XKCA 2KCVA 2FI7A 3NQPA 2AXZA 4G26A 4I17A 4TUUA 4EZKA 1P5QA 3JCKC 4JA7A 4GZCA 4KVMA 3CGHA 3R9AB 3U4TA 5FQ4A 4A1GA 4NACA 2HYZA 5ARFA 2R59A 3LXUX 3ASGA 5FTPA 3FTUA 4XI9A 4B8AA 4KBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHK A;  4WNE A;  2FF4 A;  5FJY A;  4AY5 A;  3JYS A;  3QKY A;  4I9E A;  3LY8 A;  1QZ2 A;  2LSV A;  2JLB A;  3LKU A;  3Q15 A;  4J8D A;  5CHE E;  5G05 J;  3UUX A;  2BUG A;  2VGY A;  2NC9 A;  4UI9 K;  4I9C A;  3BEE A;  3PDN A;  1IHG A;  2LNI A;  2Y4T A;  4G1T A;  4J8F A;  3ASH A;  4KXK B;  5EKQ D;  3TAX A;  2OOE A;  4GYY A;  3QWW A;  3MEK A;  2WQH A;  3VTY A;  2PQR A;  5BNW A;  3QWV A;  3ZN3 A;  3UPV A;  3CK8 A;  3RO2 A;  1A17 A;  4IN3 B;  5CCL A;  4RG6 A;  5LCW J;  4GYO A;  5CCM A;  2VQ2 A;  4CDR A;  3MKR A;  4GCN A;  3S7B A;  4I2Z A;  4J0U A;  2XPI A;  4CGW A;  3LCA A;  2FBN A;  2J9Q A;  2YHC A;  5D0Q D;  5AYW D;  1ELR A;  5EX3 A;  5ARG A;  4B94 A;  4G24 A;  2UWJ G;  4KYO B;  4N2S A;  4AM9 A;  1W3B A;  4Y6W A;  3LY9 A;  5FZQ A;  3S7D A;  4APO A;  3QWP A;  5JJT A;  3OXG A;  3CKB A;  2QFC A;  3O48 A;  4JA9 A;  4YND A;  3KS2 A;  2HR2 A;  3AS4 A;  3KD7 A;  3RKV A;  5FT9 A;  4BTB A;  3LY7 A;  3TG5 A;  5G05 C;  2LSU A;  4F3V A;  2XCC A;  3RO3 A;  3CVQ A;  3TGO A;  3SF4 A;  4HOR A;  1B89 A;  4GZ5 A;  5M72 A;  2XGO A;  1NZN A;  4GYW A;  4U0U A;  4YVO A;  4BT8 A;  1ZBP A;  3ESK A;  5KJK A;  4I1A A;  5D0O D;  2VSN A;  4N2Q A;  2P58 C;  3QOU A;  2L6J A;  2AVP A;  3CK9 A;  3FWV A;  1Y8M A;  4G2V A;  4UI9 C;  3RIB A;  3WXX A;  3U3W A;  4HOS A;  2Y4U A;  5FZS A;  4YVQ C;  3IEG A;  4WND A;  3S7J A;  1KT1 A;  2IF4 A;  3LPZ A;  3ZPJ A;  2KCK A;  1E96 B;  2XGM A;  5JJ6 A;  4W9R A;  1FCH A;  2PL2 A;  3CK7 A;  2PQN A;  4U07 A;  3OXL A;  5A7D B;  5A6C A;  2KAT A;  3ZFW A;  4WUY A;  4BTA A;  5C1D A;  5KJN A;  4KBQ A;  3MV3 B;  2YQ8 A;  5DBK A;  4U0S A;  5BT1 A;  4O6F A;  4JHR A;  4GZ3 A;  3ZHE A;  2E2E A;  5JJ7 A;  4GCO A;  4I2W A;  2VSY A;  2HO1 A;  3GZ2 A;  4UQZ A;  3NF1 A;  1TJC A;  4UQY A;  1ELW A;  1NA3 A;  1WM5 A;  3FP3 A;  3GZ1 A;  3PE3 A;  4CGV A;  3CVL A;  3KAE A;  4GA0 A;  4N3C A;  4BT9 A;  4AY6 A;  4G23 A;  4AIF A;  5HI7 A;  5KJM A;  2FO7 A;  5BW8 C;  3Q47 B;  4UQX A;  3ASD A;  5DIZ A;  1HXI A;  4NRH B;  3FFL A;  4XIF A;  4ABN A;  2VGX A;  1XNF A;  3PE4 A;  4JL0 A;  1IYG A;  1QQE A;  1HZ4 A;  4N5C A;  1WAO 1;  5EX0 A;  2C0M A;  5HQ8 A;  5FZR A;  3CVP A;  3OXF A;  3VTX A;  2GW1 A;  4H7X A;  2IFU A;  3ZGQ A;  3CEQ A;  1OUV A;  3CV0 A;  4N39 A;  2UY1 A;  3AS8 A;  4WNG A;  3RU0 A;  5G04 J;  2OND A;  3CKC A;  3E4B A;  4J8E A;  2DBA A;  3UQ3 A;  2C2L A;  4EQF A;  3CVN A;  2VYI A;  4GPK A;  4GZ6 A;  4N3B A;  1YA0 A;  3LYA A;  3EDT B;  4UI9 J;  3SZ7 A;  2C0L A;  1HH8 A;  5LCW C;  4A1S A;  3HYM B;  3ASF A;  4GA1 A;  4U04 A;  2KCL A;  4U0Z A;  1NA0 A;  2R5S A;  4G25 A;  5G04 C;  4HOU A;  2VGX B;  4HOT A;  3K9I A;  1KT0 A;  2XEV A;  2I6H A;  2V5F A;  4GA2 A;  4Y6C A;  3URZ A;  2Q7F A;  3GW4 A;  2KCV A;  4XI0 A;  2WPV A;  2FI7 A;  3MV2 B;  4G26 A;  4I17 A;  3Q49 B;  4WNF A;  1P5Q A;  3AS5 A;  4JA7 A;  3R9A B;  2PZI A;  3U4T A;  3S7F A;  4H7Y A;  4LEU A;  1ZU2 A;  3Q5M A;  3ULQ A;  4ME2 A;  5KJL A;  3TG4 A;  1KLX A;  1PC2 A;  3GYZ A;  4BWR A;  2HYZ A;  4NQ0 A;  2XGS A;  4XI9 A;  2KC7 A;  2UY1 B;  2FEZ A;  4RG9 A;  5ARF A;  3ASG A;  3QDN A;  5FTP A;  3ZHE B;  3N71 A;  4HOQ A;  3RJV A;  3Q4A B;  4N3A A;  3MA5 A;  2XCB A; 
#chains in the Genus database with same CATH topology
 4D10 C;  4I9E A;  5J08 A;  2LSV A;  3JUI A;  2JLB A;  4J8D A;  5KJK A;  2Y4T A;  2LNI A;  5AIJ A;  4PH4 B;  2OV8 A;  4GYY A;  4HFG A;  2JEK A;  1SZA A;  1A17 A;  3ZVV A;  1SZ9 A;  4URK A;  4U8H A;  2WXL A;  3FUN A;  3KEA A;  4UWF A;  3T9K A;  5LFA A;  4FA6 A;  3FU5 A;  4I2Z A;  5AYW D;  3TWX A;  3J5Q B;  2Y0B G;  4HNA D;  2UWJ G;  2NYJ A;  3TWQ A;  3G2T A;  5KNH D;  1FPP A;  3PS6 A;  4EEC A;  3DSX A;  3ULY A;  4U0U A;  3I4R B;  3PVL A;  4I1A A;  2QY7 A;  3QOU A;  3U3W A;  2LAI A;  4K03 A;  2Y4U A;  1OCR E;  2AWI A;  5C1D A;  4WUY A;  1K3Z D;  3Q7F A;  1SW6 A;  3FP3 A;  3UTM A;  1N4R A;  5AAR A;  5BW8 C;  1N52 A;  4XIF A;  2H6I A;  4DX7 D;  5JHB A;  3L22 A;  1UJK A;  2GW1 A;  5B3S E;  4FC8 A;  4O1P A;  3CHR A;  1K1A A;  4XI0 A;  4OVV A;  1LD8 A;  4YDE A;  4ANV A;  3Q78 A;  1TN8 A;  4RVB A;  4LRZ A;  3TJP A;  3QDN A;  1U3D A;  3IBE A;  2J4D A;  2Y69 E;  3LY8 A;  5G05 J;  2F37 A;  3ZYM A;  2VGY A;  3DSW A;  4I6J A;  5HS0 A;  2WXP A;  4F6R D;  3UX4 A;  2L9B A;  1L5J A;  1JPL A;  3DPD A;  3UIN C;  1ELR A;  3TL5 A;  4G24 A;  2WXG A;  1X5B A;  4N2Q A;  2NXP A;  5FT9 A;  5BUZ A;  4ILG A;  1NL4 A;  1VDY A;  4FJY A;  3J5P A;  4FLB A;  3RIB A;  1E96 B;  1H0A A;  2KAT A;  3DEP A;  4RQI A;  5T4Y A;  4BX8 A;  5JJ7 A;  4TXP A;  3SGH A;  1MZC A;  4GTM A;  2EQX A;  4GPM A;  2CFU A;  5DIZ A;  2QYU A;  4M3O A;  4PDX A;  3ZGQ A;  3E30 A;  3AS8 A;  3PUK A;  2OND A;  2DBA A;  4BFR A;  2EIM E;  4GTP A;  3TWV A;  3FH8 A;  2GRN B;  3PZ3 A;  2R5S A;  2HE0 A;  1U3C A;  4QFV A;  3JQ1 A;  5EID A;  2IO2 C;  2PZI A;  3AG2 E;  3L82 A;  1LF8 A;  4JXT A;  3QC1 A;  4N3A A;  2IU1 A;  5JA4 D;  4UI9 K;  3T5V A;  3CVY A;  3TAX A;  4E85 A;  3MEK A;  4J6I A;  1FT2 A;  2AXU A;  3FTX A;  1HFA A;  2X3M A;  5ENR D;  4CGW A;  2OCC E;  3X2Q E;  2L0T B;  3HXE A;  4HLL A;  2X38 A;  3LY9 A;  3ZYK A;  4F3V A;  5JHA A;  4GZ5 A;  1UJJ A;  1LTX A;  4ANX A;  3LJN A;  4G8K A;  2RFA A;  2L6J A;  2AVP A;  4BX9 A;  3MZL B;  3U66 A;  2LAH A;  1FCH A;  4LUN U;  2J08 A;  4A63 B;  3LJ3 A;  3LVR E;  3Q9U C;  2XEE A;  3C3O A;  1RW2 A;  3RRU A;  5AJD A;  4GA0 A;  4AV7 A;  4AIF A;  2ZIR A;  3D3M A;  3CVU A;  5FZR A;  4GTS A;  4N3B A;  4Q96 A;  5J90 A;  3ABK E;  4EHM A;  1YMP A;  4Y6C A;  4B0Z A;  4L7T A;  3MV2 B;  1S0P A;  3NOG D;  3FUE A;  1E7V A;  2LO6 A;  4R7L A;  1ELK A;  5E75 A;  2B6C A;  2WXO A;  4DLO A;  2WXI A;  3G2W A;  3FUF A;  4WWP A;  4NQ0 A;  3UT4 A;  4AY5 A;  4DK5 A;  5CHE E;  2EIL E;  3HVE B;  3FDH A;  4K0R A;  3UUX A;  3VLE A;  2AW6 A;  1UOH A;  3ASH A;  2OOE A;  1SVX A;  4KMO A;  3QWW A;  3V31 A;  2DWZ A;  3PRZ A;  4HXI A;  5G55 A;  1QNF A;  5ANR A;  4GML A;  1HO8 A;  3L6A A;  5KCM A;  5ITZ F;  3G2V A;  4Y6W A;  2DYS E;  4HI8 A;  3KD7 A;  3RKV A;  3LY7 A;  1EDU A;  3FY4 A;  2XGO A;  3NB2 A;  2BF0 X;  3UMV A;  2VTB A;  2VSN A;  3E34 A;  3TWR A;  5JMN D;  5AN8 A;  4U0S A;  1N4P A;  1E8W A;  3SFX A;  2WM9 A;  3PE3 A;  2ZGG A;  3FTZ A;  2P9I G;  3AG3 E;  1HXI A;  4C0M A;  3Q79 A;  1EPU A;  4GTT A;  4B8C B;  1JCR A;  3EU9 A;  4GB9 A;  1WY6 A;  5T8I A;  1GW6 A;  2KBX A;  4G26 A;  4I17 A;  4EZK A;  4JA7 A;  3U4T A;  5FQ4 A;  4A1G A;  1QBQ A;  3LXU X;  5D2M C;  3RJV A;  3CQC B;  4HI9 A;  2EIK E;  5ENS D;  4G1T A;  5KNG A;  1G3N B;  4LNB A;  1MQS A;  2ETA A;  4RG6 A;  5CCM A;  2XS1 A;  4FUL A;  3UKR G;  2XPI A;  3ZW3 A;  4BY6 A;  3NZU A;  4AVX A;  4B89 A;  4GAA A;  4KYO B;  4PS8 A;  3ONK A;  3DRA A;  4BTB A;  1TN6 A;  2XQ0 A;  2LSU A;  4DI3 A;  2ZXW E;  1N11 A;  3U9W A;  3FU3 A;  3DXM G;  2VGE A;  3B7S A;  2P9N G;  2ION A;  2ILR A;  3CHQ A;  4KZ0 A;  5KJN A;  2YNQ A;  2WMN A;  2CHX A;  1LD7 A;  3Q73 A;  3ASN E;  2GRL A;  1TNY A;  4G23 A;  3ABL E;  4UQX A;  3UKU G;  1HZ4 A;  4N5C A;  1WAO 1;  4H7X A;  5CEC B;  3DPY A;  2B0O E;  4ATG A;  4I1O B;  3G2U A;  1KT0 A;  1BPO A;  4IUL A;  3SY2 A;  3APD A;  2IOS A;  3IHV A;  1OCC E;  3PUJ A;  3HHM A;  1OWN A;  3V30 A;  2M63 A;  3FUK A;  4TXQ A;  4KZC A;  5BNW A;  2FF4 A;  1O1R A;  3LKU A;  2NC9 A;  4ANU A;  2A5E A;  5AQ9 A;  3SBS A;  3QWV A;  1OY3 D;  1INZ A;  4I1M A;  3CHO A;  5LCW J;  3UT7 A;  5FIO A;  3MYV A;  3HVE A;  2R05 A;  5BV1 A;  3W9F A;  2V4L A;  5B1B E;  4ACK A;  4N2S A;  3ULE G;  3FEX A;  4JA9 A;  4YND A;  4F7A A;  1H2T C;  3UM0 A;  3CHM A;  3P2B A;  4UI9 C;  3V2O A;  5LP0 A;  2V5Q C;  3S7J A;  2I2O A;  4XEI G;  3DSS A;  4HLE A;  1HU3 A;  3HXF A;  2ZU6 B;  3NF1 A;  4K5A B;  3HXC A;  1NA3 A;  3FUJ A;  2X6H A;  4UUC A;  3UM2 A;  4BT9 A;  2LXL A;  3UI2 A;  3ZIM A;  2XEN A;  3DXK G;  1O1S A;  3IHY A;  3RK6 A;  1TEZ A;  3GZS A;  2A4Z A;  4FHJ A;  4UWG A;  4GA1 A;  3D9H A;  2KZT B;  3CR3 A;  2H6H A;  3GW4 A;  3L08 A;  1UW4 B;  2E0I A;  2J8S D;  1SQM A;  4EZL A;  4WAF A;  1O1T A;  2UY1 B;  1MX6 A;  1N4Q A;  4BES A;  4LNU D;  4I9C A;  5ANL A;  1E90 A;  1HS6 A;  4LCT A;  2WQH A;  2XPY A;  3NZS A;  2GRQ B;  5EYP F;  1D8D A;  4MKT A;  3HG0 D;  1TYQ G;  5ARG A;  3TWU A;  1W3B A;  2HM8 A;  3OXG A;  1Q2Z A;  3D9K A;  3FUH A;  3TG5 A;  3PH0 C;  4HOR A;  3FU0 A;  4AOF A;  3NOC D;  3APF A;  4JC8 A;  4YVO A;  3EHQ A;  3CIA A;  1UN9 A;  3DST A;  3PZ1 A;  3RAU A;  3BU8 A;  4DLQ A;  5A7D B;  2WQ6 A;  4BTA A;  3KEZ A;  1H6O A;  5CER B;  2EIN E;  4JEH A;  5CRU A;  4JVS A;  2WXF A;  3ASD A;  4JL0 A;  4AJW A;  3EUV A;  2UY1 A;  4AP2 A;  3FUM A;  4EBA A;  2VYI A;  1DCE A;  5ENO D;  1N9A A;  3D9M A;  4U04 A;  1FVH A;  2VGX B;  3CVX A;  2WMO A;  4FHK A;  2WXJ A;  2GRM A;  4U8Y D;  3UIP C;  4BWR A;  2BKG A;  3AU4 A;  4EBA G;  4RG9 A;  1TN7 A;  2MHK A;  5FIN A;  5ENN A;  3VLD A;  4ILI A;  3QKY A;  1N0Q A;  5FWQ A;  4WWO A;  3D9N A;  3FHE A;  3CK8 A;  3CSF A;  1IKN D;  2PM6 A;  4JZY A;  4DX2 A;  3MKR A;  4GCN A;  4XX5 A;  1KZP A;  3SBT B;  4UWH A;  3ISM C;  3TXN A;  4J8Y A;  1OWP A;  3CKB A;  2WB2 A;  3EIJ A;  5G05 C;  5EIL A;  3G2S A;  4HS2 A;  3R7R A;  4AXH A;  4LSZ E;  3D9P A;  3AU5 A;  3D9O A;  3ZPJ A;  5KWD A;  1KPS B;  3CK7 A;  3ENE A;  4O6F A;  2E2E A;  1DCQ A;  4ZHB A;  3ML8 A;  4AEZ C;  1TJC A;  3CVL A;  1TNZ A;  3B7U X;  2RFM A;  4ILH B;  3PEV B;  4ABN A;  3JQ0 A;  1XNF A;  1QQE A;  3HXB A;  4V3I A;  1OUV A;  3CV0 A;  1H2U A;  3CVN A;  4NUR A;  4DX6 D;  1PAQ A;  1A5E A;  2V5F A;  4RSY A;  1BI8 B;  3PZ2 A;  4HRM B;  4GZC A;  1O5M A;  4B8A A;  3ESL A;  4JHJ A;  3JYS A;  5EDS A;  2GRR B;  3UM1 A;  4I6E A;  2X6J A;  2WXR A;  3SHF A;  1BD8 A;  3I4G A;  1JWF A;  4EPZ A;  1N95 A;  1E8Z A;  3B13 A;  1HG5 A;  5A23 A;  1DC2 A;  2FO1 E;  3IXE A;  4AY6 A;  2QFC A;  2ZIS A;  2OEV A;  3CVQ A;  1B89 A;  2XPZ A;  4BT8 A;  5CMW A;  2L6B A;  4YVQ C;  4WND A;  1YYH A;  3PNL B;  4HRN A;  1OCZ E;  4U8V D;  2AXV A;  2PL2 A;  4I43 A;  5A6C A;  3MX3 A;  4YDO A;  5DBK A;  3T8K A;  3FTS A;  5AQA A;  4UQY A;  4CGV A;  4XKB A;  5D66 A;  4UWK A;  2P9S G;  5HI7 A;  3RSE G;  2WXK A;  4GMR A;  3PE4 A;  5EX0 A;  4NIK A;  1SA4 A;  1IXV A;  5BV0 A;  2QYJ A;  4G25 A;  3V2X A;  1EF1 C;  3MCX A;  2Q7F A;  3UM3 A;  4YDW A;  3Q5M A;  4FJZ A;  3GYZ A;  1JCS A;  3QK0 A;  5C2Y A;  3CST A;  3U64 A;  1QYM A;  2R2L A;  4APF A;  3HIZ A;  2VQ2 A;  3LCA A;  4GMJ A;  2WXM A;  3AG4 E;  4GTQ A;  2QZA A;  5HRY A;  2KZT A;  3B95 A;  2R17 C;  3SF4 A;  3OAW A;  4BET A;  4E6H A;  3MJW A;  1HE8 A;  1UN8 A;  2I1J A;  2P58 C;  3CK9 A;  2LXM A;  3WXX A;  4DI4 A;  1KT1 A;  4M7C A;  3MKQ A;  2CHZ A;  4LG6 A;  4OYS A;  3OXL A;  4CEM A;  5BT1 A;  4DJA A;  3L9T A;  1ELW A;  4OAU C;  3ZEF A;  4CCA A;  1EYH A;  3BUA A;  3O4Z A;  2P9U G;  4U7E B;  5LCW C;  4C9B B;  1S63 A;  3QJZ A;  1NI1 A;  1HH8 A;  3D9L A;  2CG2 A;  4TRQ A;  3NAW A;  1ZB1 A;  4N5Q A;  1MYO A;  3B7B A;  4HRL A;  3LEW A;  1TR4 A;  5E76 A;  4GTV A;  2WVI A;  3ULQ A;  1FVF A;  1K8K G;  2KC7 A;  1UG3 A;  3BG0 B;  1TJF A;  1SA5 A;  2RG8 A;  4MRU A;  4A3T A;  2BUG A;  5EIB E;  2J07 A;  4KVO A;  3RO2 A;  4GYO A;  1BLX B;  5H7P A;  2I9C A;  3EIQ C;  3R7Q A;  5AJL A;  2XHE A;  3EU5 A;  2IOL A;  5LOZ A;  5CED B;  4Q69 A;  3DWL G;  3JUE A;  4MBG A;  2A5U A;  3SFY A;  2V0P A;  3D9I A;  5FZS A;  4K5C A;  2VJ8 A;  2VSO E;  3BG1 B;  3LPZ A;  4W9R A;  2L0I A;  3I3N A;  4FU3 A;  4DX5 D;  4JHR A;  1DNP A;  2VSY A;  5B1A E;  1U2V G;  3ZU7 B;  1Z5S C;  3KAE A;  2VGX A;  2C0M A;  3VTX A;  2V8S E;  3FTW A;  2OVB A;  4DX1 A;  3L17 A;  2C2L A;  4GZ6 A;  2NSZ A;  4L2Y A;  3TWS A;  2P9K G;  3HYM B;  4U0Z A;  4HOU A;  3L13 A;  3K9I A;  3DSV A;  3AS5 A;  4ANW A;  1OXJ A;  1TNU A;  1ZU2 A;  4L1B A;  3V79 K;  2XGS A;  1HF8 A;  4HOQ A;  2WQ7 A;  1V55 E;  2XZD G;  4CZ2 D;  3QAR A;  4HB5 A;  1KZO A;  1QZ2 A;  4UWL A;  4GU5 A;  5IY5 E;  3PDN A;  3C98 A;  3MGB A;  1Y6I A;  1PY1 A;  5BPP A;  4JW1 A;  1OWM A;  1OWO A;  4B94 A;  4JPS A;  3ZYQ A;  4AM9 A;  5JJT A;  1H6P A;  4CYM D;  3ZYL A;  3IV0 A;  4A3V A;  3PRE A;  3TGO A;  1TNB A;  3T8M A;  5D0O D;  3FWV A;  3PZ4 A;  4HOS A;  3C5R A;  3C72 A;  3E37 A;  1MHQ A;  5HKP A;  1K1B A;  3ZXP A;  2X6I A;  2MRI A;  5EN5 D;  4I2W A;  4CRW A;  3EHR A;  3AAA C;  3ABM E;  4JB8 P;  1WM5 A;  3GZ1 A;  3Q47 B;  1IYG A;  1H2V C;  5HQ8 A;  5ENT D;  3CEQ A;  4WNG A;  2F8X K;  3TXM A;  4RLY A;  3TWW A;  4PS7 A;  1BI7 B;  2KM4 A;  2I6H A;  3URZ A;  2ETC A;  4XKC A;  2FI7 A;  5ENP D;  1JCQ A;  3R9A B;  3TWT A;  4NAC A;  2HYZ A;  4ZFH A;  2R59 A;  5FTP A;  3W9G A;  4L9P A;  1OWL A;  3ZKJ A;  4TXR A;  3Q15 A;  4G11 A;  3LVQ E;  3FH7 A;  1AWC B;  1V54 E;  5FQ6 A;  4KXK B;  2VTB B;  4L2L A;  4HVB A;  4YDY A;  1FT1 A;  4CDR A;  3ASO E;  3S7B A;  2J9Q A;  4CT4 A;  1NP7 A;  2YHC A;  3UT8 A;  5D0Q D;  1BU9 A;  3OTN A;  4XE0 A;  2XEH A;  4APO A;  4IRU A;  5CMY A;  4KT6 B;  3VLF A;  3RO3 A;  1WDY A;  3CHS A;  1HX8 A;  1NZN A;  3ESK A;  3LDZ A;  3SNX A;  1Z6T A;  3CVW A;  1H6K A;  2IF4 A;  4BSX A;  2PQN A;  5KBA A;  4F53 A;  4OVU A;  4UQZ A;  2VSX E;  4N3C A;  2CG3 A;  3KSQ A;  2PM7 A;  5ENQ D;  3ZNG A;  1E8X A;  2XS8 A;  3FTV A;  4DRX E;  3RU0 A;  4N39 A;  4GZD A;  5G04 J;  4X8Q A;  3FEY A;  3ML9 A;  4EQF A;  1WG0 A;  1Z3X A;  5T3R A;  4A1S A;  3UXG A;  2KCL A;  2F0Y A;  3SI5 A;  2IJG X;  3KSL A;  3FUL A;  3CVV A;  4BSZ B;  3Q49 B;  2GGF A;  2J49 A;  3S7F A;  3WG7 E;  4LEU A;  5CRV A;  4ME2 A;  1MX4 A;  3TG4 A;  1KLX A;  1PC2 A;  2DIW A;  2R02 A;  2FEZ A;  3E32 A;  1D9S A;  4Z68 A;  5FJY A;  3Q7A A;  4WWN A;  3JXJ A;  3PNT B;  3PZD A;  3F6Q A;  2V4H C;  3BEE A;  4J8F A;  3UPV A;  2OVF A;  2PQR A;  5FQ7 A;  3ZN3 A;  3T5X A;  4IN3 B;  1RZ4 A;  1S70 B;  2P9P G;  2CFZ A;  3FU6 A;  3C3R A;  2FBN A;  4LER A;  2J09 A;  2J4B A;  1D8E A;  4DPR A;  1E8Y A;  1YCS B;  3KS2 A;  2HR2 A;  2XCC A;  3EJN A;  1S64 A;  1X81 A;  4GTR A;  3IKO B;  4XZ4 A;  2XRZ A;  3C3Q A;  4P29 A;  4U07 A;  1JWG A;  3MV3 B;  1MX2 A;  2IEJ A;  3ZHE A;  3APC A;  4GZ3 A;  4CDN A;  2DZO A;  4FP7 A;  3UIO C;  3P1U A;  4J7W A;  3SFZ A;  1JUQ A;  4TUM A;  2YHE A;  3FFL A;  4BEP A;  3OXF A;  5AEN A;  2P9L G;  2Y3A A;  4J8E A;  4GPK A;  2X6K A;  2IQC A;  3EDT B;  4UI9 J;  3QNK A;  2JAB A;  4EZJ A;  3ZXS A;  5G04 C;  4HOT A;  1HG2 A;  3AG1 E;  1N0R A;  4WNF A;  1H19 A;  2WXN A;  4H7Y A;  3CHP A;  2QC9 A;  5KJL A;  1TNO A;  3QAQ A;  3EHN A;  3N71 A;  3B7T A;  2XCB A;  4WNE A;  4BER A;  3PEU B;  3LS8 A;  4B93 B;  2KXP C;  2LUH A;  4GTO A;  4JHK A;  5EKQ D;  4JD2 G;  5AAO A;  4F1P A;  4FLH A;  4IYP A;  1N94 A;  5CCL A;  3CQG B;  1MJ0 A;  4FAD A;  1XGW A;  4J0U A;  3R9M A;  4U63 A;  1IQR A;  3Q9N C;  3Q75 A;  2DCP A;  3RRM B;  5EX3 A;  2MYO A;  5FZQ A;  3S7D A;  4L23 A;  3O48 A;  5CEA A;  3AS4 A;  3NBN B;  5M72 A;  4MS6 A;  3I5P A;  1NFI E;  4DUI A;  4ATZ D;  2BKK B;  1Z3Y A;  1Y8M A;  3HRA A;  3IEG A;  5BXO A;  2KCK A;  3JXI A;  3SD5 A;  2XGM A;  4JEU A;  3ZFW A;  2AJA A;  2CHW A;  2YQ8 A;  2OEW A;  4O1O A;  2HO1 A;  3GZ2 A;  4A55 A;  4I6G A;  1DVP A;  4J8S A;  2FO7 A;  2MOW A;  5CBN A;  3DBS A;  3QB2 A;  1IQU A;  3CVP A;  2RKK A;  2IFU A;  2GRO B;  2EIJ E;  3UQ3 A;  3SO8 A;  5BXU A;  2DZN A;  3B7R L;  3E4B A;  5G2N A;  1YA0 A;  3LYA A;  3SZ7 A;  4U96 D;  1N54 A;  5EYL A;  3RRN B;  3ASF A;  4CDM A;  1NA0 A;  2P2C P;  3DSU A;  4HBD A;  2XEV A;  2GRP B;  3SQV A;  2WPV A;  2XZT G;  4Q94 A;  2FUL A;  4PUC A;  4PS3 A;  2R03 A;  3CLJ A;  3ZUV B;  4OAV B;  3ONL A;  5FQ8 A;  3L16 A;  2BED A;  3ZHE B;  2ETB A;  3Q4A B;  3MA5 A;  4C48 B;  2YIN A;  4C0E A;  2PNN A;  2RD0 A;  5AQB A;  1IHG A;  2H6F A;  3VTY A;  4O60 A;  2DYR E;  5LX8 A;  2Y1L E;  2H6G A;  2F8Y A;  3MKQ B;  3QWP A;  5AQ7 A;  2WXQ A;  3HXD A;  4U95 D;  2IY0 C;  1N4S A;  4GYW A;  1ZBP A;  4G2V A;  1OT8 A;  5CBO A;  3E33 A;  5JJ6 A;  2BTD A;  1IHB A;  3L54 A;  3ZRH A;  3FUD A;  4GCO A;  3D9J A;  3EHM A;  4G8L A;  5KJM A;  4NRH B;  4K5B A;  2DVW A;  2ZGD A;  3AJI A;  2IO3 C;  2I1K A;  3S2A A;  1E7U A;  2WXH A;  2XRY A;  4F1S A;  3CKC A;  4MLP A;  2C0L A;  3FH5 A;  4QQI A;  3FUI A;  4CT0 A;  3HDX A;  4ACL A;  2X6F A;  4HQD A;  3FTY A;  4GA2 A;  4TV3 A;  2KCV A;  1AP7 A;  1OCO E;  3BQO A;  2AXZ A;  3NQP A;  4TUU A;  1P5Q A;  3JCK C;  4KVM A;  3CGH A;  4LNG A;  5ARF A;  3ASG A;  3DEO A;  3FTU A;  4XI9 A;  4KBQ A; 
#chains in the Genus database with same CATH homology
 3ESL A;  1OWL A;  4JHJ A;  3CQC B;  4D10 C;  3JYS A;  4I9E A;  5J08 A;  2LSV A;  3JUI A;  2JLB A;  3Q15 A;  4G11 A;  4J8D A;  3LVQ E;  3FH7 A;  5EDS A;  5FQ6 A;  4G1T A;  4KXK B;  2Y4T A;  2LNI A;  4I6E A;  5KJK A;  5AIJ A;  4PH4 B;  2X6J A;  2OV8 A;  4GYY A;  4HFG A;  2VTB B;  2JEK A;  2WXR A;  4L2L A;  3SHF A;  1SZA A;  4HVB A;  1A17 A;  3ZVV A;  1SZ9 A;  1MQS A;  4RG6 A;  4URK A;  4U8H A;  5CCM A;  2WXL A;  3I4G A;  4FUL A;  1JWF A;  3FUN A;  4UWF A;  4CDR A;  4EPZ A;  5LFA A;  4FA6 A;  3S7B A;  1E8Z A;  3FU5 A;  4I2Z A;  2XPI A;  3ZW3 A;  2J9Q A;  4BY6 A;  1NP7 A;  2YHC A;  3UT8 A;  3B13 A;  3NZU A;  5D0Q D;  5AYW D;  1HG5 A;  4AVX A;  3OTN A;  4XE0 A;  4GAA A;  4B89 A;  5A23 A;  2UWJ G;  4KYO B;  3G2T A;  4APO A;  4AY6 A;  2QFC A;  4IRU A;  3ONK A;  4PS8 A;  5CMY A;  4BTB A;  4KT6 B;  2XQ0 A;  3VLF A;  2LSU A;  3RO3 A;  3CVQ A;  3PS6 A;  1B89 A;  2XPZ A;  4EEC A;  3CHS A;  1HX8 A;  4DI3 A;  1NZN A;  4U0U A;  3I4R B;  4BT8 A;  3ESK A;  5CMW A;  3PVL A;  3LDZ A;  4I1A A;  2QY7 A;  3SNX A;  3QOU A;  1Z6T A;  3U9W A;  3CVW A;  3U3W A;  2LAI A;  4K03 A;  2Y4U A;  3FU3 A;  4YVQ C;  4WND A;  1H6K A;  2IF4 A;  3PNL B;  3B7S A;  2AXV A;  2PL2 A;  2ION A;  2ILR A;  2PQN A;  3CHQ A;  4I43 A;  2AWI A;  4BSX A;  5A6C A;  4KZ0 A;  5C1D A;  4WUY A;  5KJN A;  3MX3 A;  5DBK A;  2YNQ A;  2WMN A;  3FTS A;  4F53 A;  4OVU A;  2CHX A;  4UQZ A;  4UQY A;  3FP3 A;  2VSX E;  4CGV A;  4N3C A;  2CG3 A;  2GRL A;  4XKB A;  2PM7 A;  4UWK A;  4G23 A;  5HI7 A;  5BW8 C;  4UQX A;  2WXK A;  1N52 A;  4XIF A;  3PE4 A;  5EX0 A;  1HZ4 A;  4N5C A;  1WAO 1;  1E8X A;  5JHB A;  3L22 A;  1UJK A;  2GW1 A;  4H7X A;  3FTV A;  3RU0 A;  4N39 A;  4GZD A;  5G04 J;  3FEY A;  3ML9 A;  4EQF A;  1Z3X A;  5T3R A;  4FC8 A;  5BV0 A;  4A1S A;  4ATG A;  2KCL A;  4I1O B;  3CHR A;  4G25 A;  3G2U A;  1EF1 C;  1KT0 A;  3MCX A;  3SI5 A;  2IJG X;  1BPO A;  2Q7F A;  4XI0 A;  3FUL A;  4IUL A;  4OVV A;  3CVV A;  3APD A;  3Q49 B;  2GGF A;  4ANV A;  2J49 A;  2IOS A;  3IHV A;  3PUJ A;  3S7F A;  3HHM A;  4LEU A;  3Q5M A;  1OWN A;  4ME2 A;  4FJZ A;  4RVB A;  2M63 A;  1KLX A;  1PC2 A;  3GYZ A;  2DIW A;  3TG4 A;  4LRZ A;  2FEZ A;  3FUK A;  3TJP A;  3QDN A;  1U3D A;  4KZC A;  5BNW A;  3IBE A;  2FF4 A;  5FJY A;  2J4D A;  3LY8 A;  3QK0 A;  3LKU A;  5G05 J;  4WWN A;  3ZYM A;  3PNT B;  2VGY A;  3PZD A;  2NC9 A;  3CST A;  4I6J A;  5C2Y A;  3BEE A;  4ANU A;  3U64 A;  2WXP A;  4J8F A;  3SBS A;  3UPV A;  2OVF A;  2PQR A;  3QWV A;  5FQ7 A;  3T5X A;  3ZN3 A;  4APF A;  1INZ A;  4I1M A;  4IN3 B;  3CHO A;  3HIZ A;  3UX4 A;  5LCW J;  2L9B A;  1L5J A;  2CFZ A;  2VQ2 A;  3FU6 A;  3UT7 A;  3MYV A;  1JPL A;  3DPD A;  3HVE A;  3LCA A;  2FBN A;  5BV1 A;  4LER A;  4GMJ A;  2WXM A;  2V4L A;  1ELR A;  3TL5 A;  2J09 A;  4G24 A;  4ACK A;  2J4B A;  4N2S A;  2WXG A;  1X5B A;  4DPR A;  1E8Y A;  3FEX A;  4N2Q A;  4JA9 A;  4YND A;  2KZT A;  2HR2 A;  3KS2 A;  2NXP A;  5FT9 A;  2R17 C;  2XCC A;  3SF4 A;  4F7A A;  5BUZ A;  1H2T C;  3EJN A;  3CHM A;  3OAW A;  4ILG A;  1VDY A;  4E6H A;  4FJY A;  3MJW A;  1HE8 A;  1UN8 A;  2I1J A;  3P2B A;  2P58 C;  3IKO B;  4FLB A;  3CK9 A;  4UI9 C;  4XZ4 A;  3RIB A;  3WXX A;  4DI4 A;  5LP0 A;  2XRZ A;  3S7J A;  2I2O A;  1KT1 A;  1E96 B;  3MKQ A;  4P29 A;  1H0A A;  2CHZ A;  4OYS A;  4U07 A;  3OXL A;  1JWG A;  4HLE A;  2KAT A;  1HU3 A;  4CEM A;  3MV3 B;  5T4Y A;  5BT1 A;  4BX8 A;  3ZHE A;  3APC A;  4GZ3 A;  4DJA A;  4CDN A;  5JJ7 A;  2ZU6 B;  3NF1 A;  1ELW A;  1NA3 A;  3FUJ A;  4FP7 A;  3SGH A;  2X6H A;  3P1U A;  2EQX A;  4BT9 A;  2CFU A;  3ZEF A;  3SFZ A;  4CCA A;  1JUQ A;  1EYH A;  5DIZ A;  3ZIM A;  2YHE A;  3FFL A;  3O4Z A;  4M3O A;  3IHY A;  3RK6 A;  4PDX A;  3OXF A;  3ZGQ A;  5AEN A;  2Y3A A;  5LCW C;  1TEZ A;  3AS8 A;  3PUK A;  2OND A;  4C9B B;  4J8E A;  3GZS A;  2DBA A;  2X6K A;  4GPK A;  4BFR A;  2IQC A;  3QJZ A;  3EDT B;  4UI9 J;  3QNK A;  1HH8 A;  2A4Z A;  3FH8 A;  4FHJ A;  3D9L A;  4UWG A;  4GA1 A;  2CG2 A;  3ZXS A;  4EZJ A;  4TRQ A;  2R5S A;  5G04 C;  4HOT A;  1HG2 A;  3CR3 A;  2KZT B;  1U3C A;  3GW4 A;  4QFV A;  3JQ1 A;  3L08 A;  3LEW A;  1UW4 B;  4WNF A;  1H19 A;  4CT4 A;  5E76 A;  2E0I A;  2PZI A;  1SQM A;  2WVI A;  2WXN A;  4H7Y A;  3ULQ A;  3CHP A;  4EZL A;  1FVF A;  5KJL A;  4WAF A;  2KC7 A;  1UG3 A;  2UY1 B;  3BG0 B;  3QAQ A;  1LF8 A;  3EHN A;  3N71 A;  4JXT A;  3QC1 A;  3B7T A;  4N3A A;  1TJF A;  2XCB A;  2IU1 A;  4WNE A;  2RG8 A;  3PEU B;  4MRU A;  3LS8 A;  4A3T A;  2BUG A;  3RJV A;  4UI9 K;  4I9C A;  4JHK A;  5ANL A;  3T5V A;  5EKQ D;  3CVY A;  1E90 A;  3TAX A;  1HS6 A;  4LCT A;  2J07 A;  3MEK A;  2WQH A;  4J6I A;  4E85 A;  4KVO A;  2AXU A;  2XPY A;  3NZS A;  4FLH A;  3RO2 A;  4IYP A;  3FTX A;  5CCL A;  1HFA A;  3CQG B;  4MKT A;  4GYO A;  4FAD A;  2X3M A;  1XGW A;  4J0U A;  4CGW A;  4U63 A;  1IQR A;  2DCP A;  2L0T B;  2I9C A;  5ARG A;  5EX3 A;  3RRM B;  3EIQ C;  3R7Q A;  2X38 A;  5AJL A;  2XHE A;  1W3B A;  3LY9 A;  5FZQ A;  2HM8 A;  3S7D A;  3OXG A;  4L23 A;  3O48 A;  3ZYK A;  3AS4 A;  3D9K A;  2IOL A;  5LOZ A;  3FUH A;  3TG5 A;  4F3V A;  4Q69 A;  5JHA A;  3PH0 C;  4HOR A;  3FU0 A;  4GZ5 A;  5M72 A;  4MS6 A;  1UJJ A;  4AOF A;  2A5U A;  3APF A;  4JC8 A;  4YVO A;  3I5P A;  4ANX A;  3CIA A;  2V0P A;  3D9I A;  1UN9 A;  2L6J A;  2AVP A;  1Z3Y A;  1Y8M A;  5FZS A;  2VJ8 A;  3IEG A;  4BX9 A;  2VSO E;  3BG1 B;  3LPZ A;  2KCK A;  3SD5 A;  2XGM A;  3MZL B;  3U66 A;  4DLQ A;  4W9R A;  2LAH A;  1FCH A;  2L0I A;  3I3N A;  4FU3 A;  5A7D B;  2WQ6 A;  4LUN U;  2J08 A;  4JEU A;  3ZFW A;  4BTA A;  3KEZ A;  2CHW A;  2YQ8 A;  4JHR A;  3LJ3 A;  3LVR E;  1DNP A;  2VSY A;  2HO1 A;  3GZ2 A;  4A55 A;  4JEH A;  3RRU A;  5AJD A;  3KAE A;  4GA0 A;  4I6G A;  4AV7 A;  1DVP A;  4JVS A;  4AIF A;  4J8S A;  2FO7 A;  2MOW A;  2WXF A;  3D3M A;  3ASD A;  3CVU A;  2VGX A;  4JL0 A;  3DBS A;  3QB2 A;  2C0M A;  4AJW A;  5FZR A;  1IQU A;  3CVP A;  3VTX A;  2IFU A;  2V8S E;  2UY1 A;  3UQ3 A;  4AP2 A;  3FUM A;  3FTW A;  2OVB A;  3B7R L;  3E4B A;  3L17 A;  2C2L A;  5G2N A;  4EBA A;  2VYI A;  4GZ6 A;  4N3B A;  1YA0 A;  3LYA A;  2NSZ A;  3SZ7 A;  4L2Y A;  4Q96 A;  1N54 A;  3D9M A;  3HYM B;  5J90 A;  3RRN B;  3ASF A;  4CDM A;  4U04 A;  4U0Z A;  1NA0 A;  1FVH A;  4HOU A;  2VGX B;  3CVX A;  3L13 A;  3K9I A;  2XEV A;  4Y6C A;  2WMO A;  4FHK A;  4B0Z A;  2WXJ A;  4L7T A;  2WPV A;  3MV2 B;  1S0P A;  3FUE A;  4Q94 A;  2FUL A;  1E7V A;  2LO6 A;  4PUC A;  4PS3 A;  4R7L A;  1ELK A;  3AS5 A;  3CLJ A;  5E75 A;  2GRM A;  4ANW A;  2WXO A;  3ONL A;  1ZU2 A;  5FQ8 A;  4DLO A;  4L1B A;  2WXI A;  4BWR A;  3G2W A;  3FUF A;  4WWP A;  4NQ0 A;  2XGS A;  4EBA G;  3AU4 A;  3L16 A;  4RG9 A;  3UT4 A;  3ZHE B;  1HF8 A;  4HOQ A;  4AY5 A;  4DK5 A;  3Q4A B;  5CHE E;  2WQ7 A;  3MA5 A;  2MHK A;  5ENN A;  3VLD A;  3QAR A;  3HVE B;  3QKY A;  4ILI A;  2YIN A;  1QZ2 A;  3FDH A;  4UWL A;  4C0E A;  4K0R A;  3UUX A;  3VLE A;  4GU5 A;  2RD0 A;  2AW6 A;  3PDN A;  1IHG A;  3C98 A;  5FWQ A;  3ASH A;  3MGB A;  4WWO A;  2OOE A;  3D9N A;  3FHE A;  4KMO A;  3QWW A;  3VTY A;  1Y6I A;  3CK8 A;  3CSF A;  1PY1 A;  2PM6 A;  5BPP A;  3PRZ A;  4HXI A;  4JZY A;  1QNF A;  5ANR A;  5G55 A;  4GML A;  5LX8 A;  1HO8 A;  3MKR A;  4GCN A;  4XX5 A;  3L6A A;  4JW1 A;  3SBT B;  1OWM A;  1OWO A;  4UWH A;  3TXN A;  5KCM A;  4B94 A;  4JPS A;  3G2V A;  3ZYQ A;  4AM9 A;  1OWP A;  4Y6W A;  3MKQ B;  3QWP A;  5JJT A;  3CKB A;  2WB2 A;  2WXQ A;  3KD7 A;  3RKV A;  3EIJ A;  3LY7 A;  3ZYL A;  3IV0 A;  5G05 C;  4A3V A;  3PRE A;  3G2S A;  4HS2 A;  3TGO A;  3R7R A;  1EDU A;  3FY4 A;  2XGO A;  4AXH A;  3D9P A;  4GYW A;  2BF0 X;  1ZBP A;  3UMV A;  2VTB A;  3T8M A;  5D0O D;  2VSN A;  3AU5 A;  3FWV A;  4G2V A;  3D9O A;  4HOS A;  3ZPJ A;  5JJ6 A;  2BTD A;  3CK7 A;  3L54 A;  1MHQ A;  3ENE A;  4U0S A;  4O6F A;  3ZRH A;  3FUD A;  2E2E A;  2X6I A;  2MRI A;  4GCO A;  1E8W A;  4I2W A;  4CRW A;  3ML8 A;  4AEZ C;  2WM9 A;  1TJC A;  1WM5 A;  3D9J A;  3EHM A;  3GZ1 A;  3PE3 A;  3CVL A;  3FTZ A;  3B7U X;  5KJM A;  3Q47 B;  4ILH B;  1HXI A;  3PEV B;  4NRH B;  4ABN A;  4C0M A;  3JQ0 A;  1XNF A;  1IYG A;  1QQE A;  1H2V C;  5HQ8 A;  1EPU A;  2I1K A;  4V3I A;  3CEQ A;  1OUV A;  3CV0 A;  1E7U A;  2WXH A;  4WNG A;  1H2U A;  2XRY A;  3S2A A;  4F1S A;  3CKC A;  3TXM A;  3CVN A;  4MLP A;  4NUR A;  4B8C B;  2C0L A;  3FH5 A;  4PS7 A;  1PAQ A;  3FUI A;  4CT0 A;  2KM4 A;  3HDX A;  4ACL A;  2X6F A;  4GB9 A;  1WY6 A;  3FTY A;  5T8I A;  4GA2 A;  2I6H A;  2V5F A;  4RSY A;  4TV3 A;  3URZ A;  1GW6 A;  4XKC A;  2KCV A;  2FI7 A;  3NQP A;  2AXZ A;  4G26 A;  4I17 A;  4TUU A;  4EZK A;  1P5Q A;  3JCK C;  4JA7 A;  4GZC A;  4KVM A;  3CGH A;  3R9A B;  3U4T A;  5FQ4 A;  4A1G A;  4NAC A;  2HYZ A;  5ARF A;  2R59 A;  3LXU X;  3ASG A;  5FTP A;  3FTU A;  4XI9 A;  4B8A A;  4KBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...