4RGBA

Crystal structure of a putative carveol dehydrogenase from mycobacterium avium bound to nad
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
274
structure length
274
Chain Sequence
GSLDGRVVFITGAARGQGRSHAVMCAEQGANIVGVDICEDIDIVPYKLGTYEELEETARLVEKTGQEMLFRKADVRDKAVLQEVFDAGVEQFGHIDTVIANAGVVLTNPDERDASEALRLGLDIMLIGVWNTFQVAIPHMKERGQGGNLIATSSMIALLDLTDGRGGTDAYLTSKLAITGLVRSYALMLAADRIRVNGVAPTNCSTPMITENPALFKVIEENPHLVNAMSTALPDFPMIEPRDVSNAILFLISDAGRSFTGSVLKVDAGMDVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Oxidoreductase
molecule keywords Carveol dehydrogenase
total genus 101
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.1.1.275: (+)-trans-carveol dehydrogenase.
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rgbA00
1GU7A 7ADHA 1WNTA 2I6TA 3NDIA 5CPBA 3NEPX 5KTKA 1I0ZA 2EG9A 4MVJE 5ER6A 3SLKA 2HJSA 4ILKA 4BHTA 2WM3A 1A7KA 1AN9A 1R37A 4J9UE 2E49A 2ZQYA 4JLWA 2QX7A 1SOWA 4A03A 1DHTA 1ZNQO 4JXKA 3ASUA 4IJKA 3HSKA 1IHYA 1PGQA 4ALJA 2BGLA 2HKIA 1YBVA 5DP2A 2Q2QA 4CM7A 3WGZA 1V6AA 1Q0LA 3QHAA 1S6YA 4KDEA 2C54A 3I3OA 2I9PA 5DZSA 4NH4A 3JTMA 3U4HA 4BKQA 4YCAA 1PWXA 3OSUA 5G4KA 5A4DA 2X9GA 3G1UA 2VTDA 2X0JA 5ILOA 1EUZA 3ENNA 1QMGA 1H6DA 2J6IA 2PNFA 4DBVO 4UEJA 5JAQA 3DHYA 1NR1A 1I8TA 3GNTA 3CEAA 4U6SA 3V2HA 2Q1UA 3SXPA 3KXDA 3ZNQA 4CMIB 3TL2A 3NYWA 1YKFA 1WMAA 4TVBA 2NACA 3LU1A 3Q9UA 3MTGA 3ZU5A 2CUKA 1R4MB 4NBRA 1DFIA 1DEHA 1X15A 1XU7A 4ALKA 5GZ3A 3WSVA 5JCJA 1DIHA 2HDHA 3ZWPA 4M55A 4PLZA 5A5EA 4G5HA 2B0JA 4GSKA 3RUIA 3DHEA 1FDTA 3VPSA 3OBBA 3WOHA 1ZW1A 4Q3EA 1DC3A 4QT0A 3H4VA 4TKLA 1W6UA 4UVIA 1GCOA 3KO8A 1U4SA 3VPXA 1QG6A 4R3NA 3FCOA 2E48A 3GDOA 1HDZA 3F9IA 4Z0PA 1BHSA 1XG5A 1EVIA 4ND4A 4HBGA 1N5DA 1WDMA 1RYDA 3GUYA 4F6LA 4JROA 3GUCA 3GPDG 4P4NA 5TJHA 3AK4A 1M67A 3HDJA 1KEPA 1E0DA 4K9DA 4FFLA 5DDIP 1K5HA 4MIYA 4BKPA 4NFSA 5CDSA 5I7EA 4ALNA 4ZICA 1I32A 3BMQB 1ZBQA 2WD8A 5JLAA 2QIOA 3F4LA 4PVDA 3A28A 3DMYA 1WXDA 4BUCA 4OJNA 2I65A 1X7DA 3BXXA 1BXZA 4DREA 4YJDA 1HYGA 3IMFA 1PJ2A 3SX2A 1PZEA 3UFXA 1PZFA 1W4ZA 3O38A 2C2XA 1C1DA 3TZHA 3K6JA 3WSWA 2YFQA 2Y1CA 1YQGA 2W2LD 1RM4A 3UUWA 4CMEC 2PH5A 4J3FA 4E2ZA 2DBVO 5KJFA 3AM3A 5IDQA 4FDAA 4E5KA 4II3A 2RH8A 1C1XA 4CMBA 4W7IA 1IHXA 1T2AA 1EUCA 1ENZA 3WLEA 3I9JA 2G76A 5A9SB 5EERA 3DZBA 4LMRA 3ZWWA 2EKQA 4KP7A 3TL3A 3ZWYA 4ESOA 2FPPA 1GZ4A 4RORA 4NJMB 4RVUA 4KUHA 4WJZA 4EUHA 3RC9A 4EW6A 2ZTMA 2D8AA 1E3LA 2GNAA 5T6BA 1C14A 3HJAA 4Y98A 1QORA 1SBYA 2CMDA 4GLLA 4Y8VA 5A06A 1YVEI 4DLAA 4CUJA 5IN5A 4L4SA 2ZJ1A 1CIVA 1N9GB 3HDYA 2IYPA 4FIZA 1U7HA 3SJUA 5C5IA 4EEZA 5KVQA 4G2NA 3NKLA 4HFMA 4BO5A 2GZ3A 2CDCA 1LUAA 3D7LA 3QE3A 4QECA 4D0RA 3WQRA 2FN7A 2EKPA 4L4RA 3P7MA 2HMWA 1E3JA 5JFOA 3MCVA 4GLOA 1PGPA 4NMHA 5JE8A 4DIBA 4CLEA 4HFNA 1MFPA 4Z9YA 4XYLA 1DDOA 1AE1A 4QUKA 4YWJA 1PL8A 2PKQO 4E4YA 5L40A 2B35A 3H3JA 2BELA 3NT4A 2GZ2A 1KYQA 1ZK0A 4FSHA 1K89A 1BTOA 2DC1A 1YONA 2O48X 1DFGA 3IIEA 3ENKA 3HNPA 4MVJD 3OF2A 4QTZA 1EK5A 4E32A 2J3HA 1NNUA 1C1DB 1Z82A 1BVUA 2VHYA 1XQ6A 5DBFA 1MA0A 2EJWA 4BNJA 1MFZA 2GERA 3LK7A 4NBTA 2DPHA 5FYDA 5JYDA 2BD0A 2VOJA 5K6AC 3SVTA 4BNKA 2NM0A 3BIOA 1H5QA 2BI8A 5DBGA 1V0JA 1V8BA 2OMEA 2AG5A 4OKIA 1RYEA 4I1IA 3WIDA 1UP7A 1N1EA 2I76A 4WCDA 3EDMA 5A9SA 3ZWXA 1PTJA 3OJFA 2PKQP 3WJ7A 2DLDA 2PKRA 3GRKA 1HETA 4F46A 2C5AA 3VPGA 1DJQA 1VPDA 3QQPA 2Z1MA 1P1HA 4PZEA 1MV8A 1DIAA 3BTOA 3WBFA 4RF4A 1H6CA 3TFOA 1T2EA 2IE0A 2VZ0A 4IINA 3WWZA 2Y99A 3DZKA 5F1PA 4GH5A 4MP3A 2YHIB 2WE7A 5TGDA 1N9GA 2FR0A 3L4SO 4GX0A 2JKVA 1XA0A 4OOEA 4IMRA 4WGGA 3S55A 3H9UA 4UREA 5JS6A 2PWZA 2GF2A 6ADHA 1WZIA 4IJVA 5AVOA 4YDRA 4AICA 3QWHA 2BRUA 3M1AA 2X1HA 4MVJG 1HSZA 3B20A 2HO5A 1HWYA 1YWGO 1PQUA 3OJLA 3VPHA 3ZWVA 4RVGA 1D8AA 2B4TO 1Y81A 4IPTA 2JHGA 4J43A 4J4TA 5ES3A 1LDMA 3NUGA 1WPQA 4XX0A 2Y93A 5TLSA 5CG1A 4IXWA 2PD4A 5IZCC 1E7RA 4BGVA 1P33A 3ZU4A 1MUUA 2Z95A 3PWKA 3DBRA 3JQ7B 1P1JA 2DKNA 3LF1A 1RWBA 5KVVA 1QLJA 4XIYA 3VC7A 4K1LA 4F6CA 1CEQA 1HE3A 4KUGA 1DBVO 4LW8A 4OXYA 4YAGA 1CWUA 1GV0A 2FHSA 2QYTA 4MP6A 2YHUA 4ND5A 3GRPA 4IDDA 4N5LA 2YV1A 1G0OA 1ORRA 1JLLA 4WOKA 3TRIA 1R16A 1EE2A 4O1MA 3RUAA 4C4OA 1HT0A 5IZCA 3L6DA 1UAGA 1YDWA 3RUHA 1B2LA 3PGXA 1A72A 4CM4B 5L9AA 2EXXA 1ZJYA 5LC1A 3RI3A 3GNSA 3GNQA 1CRWG 5T67A 3TF5A 4HNGA 1TVEA 1PJ4A 2Q2VA 4WK6A 4DWVA 2A92A 1KVRA 3VH1A 1SB8A 2O3SA 3OQBA 5IZ4A 3G3EA 3E03A 3MWDB 5G0VA 4GKBA 4ZHSA 1XQ1A 4I5FA 4N7RA 4WOJA 3MJVA 4TVOA 5TQVA 1WWKA 3VVCA 2EF1A 3HN7A 4B3IA 4E5NA 4Z9XA 3JQEA 3CH6A 3JCZA 1ISIA 1PGNA 1F8FA 4RDIA 1KVUA 5DF1A 4PRKA 4BO4A 2Q1SA 3DBHA 4QSMA 4UUNA 3WFJA 3TN7A 1SAYA 3ZWMA 4MO2A 2DAPA 3W8EA 2D4AA 1ISFA 3CMMA 4BNGA 3MJCA 3F47A 4L76A 4CMCA 3BMQA 3GMSA 2AA3A 3S2GA 3PJDA 4D43A 2XXJA 3BTSA 3EC7A 5ICSA 4KZPA 5F5LA 4E12A 3BYZA 2ZYAA 4GX1A 3TPCA 1R4NB 2X58A 3FNEA 4BQRA 3OH8A 4LRTB 4BIIA 5A5FA 1R4MA 4PLYA 2C0CA 1BXGA 1C0IA 1GYQA 5CEFA 3JQ7A 5COQA 3A06A 3WLFA 3JYPA 3JQAD 4J4HA 4KUEA 1VJTA 3LLVA 1C3VA 5EPOA 3S2EA 4J1QA 1LTHR 1KC3A 3UGKA 4FFRA 1CQJA 4FGWA 3UAGA 4DQXA 1DLJA 3KUXA 3DZJA 5GMOA 3WMXA 1R66A 3WGHA 3AY3A 5U4QA 3ZHZA 3QJ5A 2J3KA 3TQHA 1HDGO 1L7EA 4FJ0A 4MKXA 2ZTVA 3GHHA 3I23A 4PLPA 4NJMA 4XD2A 2AQIA 2IZZA 4ZVVA 5CPFA 4ZU3A 3G1TA 5I9LA 3LVFO 2CVQA 3HN2A 5JPIA 2W4QA 3IUPA 3KEOA 1FDVA 1HSOA 4EGFA 1XKQA 1ZZEA 5BNTA 3NDJA 1JQBA 3H8VA 2CFCA 3HADA 1LLCA 4BNMA 4LVUA 1C0LA 1DAPA 1ZEJA 2QRJA 2DTDA 4LSWA 4PLVA 3BMOA 2JCVA 4TWRA 4BV9A 5TC4A 4YRBA 4BNIA 1WW8A 3AUTA 1JN0A 1Y7TA 1AHIA 3R3JA 4A73A 3M2TA 3JQ9A 4LMPA 1NQ5A 4UVGA 1Q7GA 3ANLA 4UVHA 1W0CA 3PIDA 5F1KA 4D3SA 3D5QA 4B7XA 3QRWA 1KEWA 1KEVA 2YYYA 3TDKA 2WWRA 1KVTA 4OQZA 4W82A 1PJTA 3A4VA 2IDZA 2NVWA 4XR4A 3RSHA 2RIRA 3ST7A 1Q7BA 4QX6A 1R6DA 2FP4A 1PZHA 3DOJA 4R16A 1EDZA 2NTJA 4IS3A 1NPDA 2AEFA 1ONPA 4IQ8A 1BXGB 4RL6A 4N5NA 2Y1EA 1GDHA 2Q4EA 4MIEA 4TRRA 1JDJA 5ILGA 1TXGA 5IFLA 2BI7A 3QW2A 4MVJI 1M2WA 3G49A 4GMFA 3K8ZA 3DOCA 3GY0A 3KRTA 5C7OO 2RBEA 4FW8A 5G0UA 4R1TA 3KSZO 3GF4A 1KY5A 4K28A 4TZTA 5DCUA 4NJOA 5B4VA 4NIMA 2V6FA 3RC7A 4J49A 3ONEA 2AEJA 2P2SA 3DBHB 2V65A 1ML3A 1HKUA 3W6ZA 1F8GA 3AM4A 3AOGA 3PQDA 1EVJA 4GMGA 3WTCA 4D3FA 3BAZA 1HRDA 1PU2A 4J2OA 2B5VA 1YQDA 3LC2O 3V2GA 3LYLA 4YAEA 2NU7A 3OEWA 3W8FA 2Y1GA 3K92A 1DRUA 4D41A 4MVJA 4YT4A 3WS7A 1E3IA 4D7AA 4CL8A 3WGTA 3G17A 3PP8A 3QA9A 3P2OA 1NXQA 1A7AA 1SZJG 4YJFB 3B1JA 4I9UA 1CQIA 3L9XA 1PX0A 1BW9A 4GGPA 1T26A 2Y67A 4CLDA 2A35A 4I9NA 1GYRA 2EGGA 1RKXA 5IJZA 1E7YA 4TRJA 1ISHA 2JD2A 3UN1A 2C2YA 1ISGA 2UUPA 2VYVD 4EYEA 5TT0A 4DMMA 1UZNA 4O59O 3TOXA 5JO0A 3EGOA 2GN8A 3GFBA 1LBEA 3RFTA 1P1RA 1PS0A 4N5MA 3AOEA 5BR7A 3QIVA 5JDCA 1IPEA 3S8MA 4J1SA 2EP5A 2Q46A 5HBRA 1UJMA 2IEBA 1OC4A 3DTYA 1A71A 1GV1A 2HSDA 1GUYA 1BDBA 3FHLA 4RQTA 1ONNA 4DTIA 5GY7A 2O23A 2QHXA 3GOHA 4CR6A 1GZ3A 5B12A 4R54A 3RD5A 1F0YA 2Y0DA 1GEGA 3HQ4O 4RVSA 1I2BA 2HLPA 4XJTA 4C7JA 1ZFNA 2VT2A 3QY9A 3NRCA 5I9NA 4DQVA 3SLGA 4L73A 1I3KA 5G2OA 4AFNA 3PJEA 5G4LA 1KERA 4IXTA 3HB5X 1MB4A 3PDJA 3WGGA 3LC7O 2JL1A 1LDGA 1NYTA 3Q2IA 2P68A 4OMUA 2UUOA 3I6IA 1TEHA 5EQFA 2CD9A 3TWOA 5CG2A 1EVZA 2VWGA 4BNLA 1V3TA 3KETA 4PG5A 3K9QO 5TNXA 2R6JA 4HUJA 1K6XA 2B4RO 3MJTA 1ZSVA 4Q3BA 3NTRA 2X86A 2AW5A 3ZHXA 3VDRA 3CTMA 5KVCA 1E92A 2OHXA 4DPMA 4WUVA 1OAAA 1S7CA 1WP4A 3G79A 5C3MA 5EJ2A 1Y9AA 3RJ5A 4J2HA 4A5OA 5AQ1A 1ZMTA 2BGKA 3ASVA 4ROSA 1VJ1A 1E1MA 3RU9A 1PJ3A 1CJCA 1KVSA 2CDAA 2D3TA 3PYMA 3ZU3A 4IGEA 3NV9A 4RVDA 5A3JA 1F14A 5FI3A 4AJKA 4AJ4A 2X5KO 4FFOA 1JW9B 3RBZA 3D4OA 2CF5A 2O2SA 2J3JA 1UH5A 3DHNA 4XYMA 4BMNA 1E7MA 4BO8A 5CHEA 5KKAA 1GPJA 1N7HA 1U3UA 2ZCVA 4QQRA 4A2CA 1DC6A 4FQ8A 3D3EA 4NI5A 3EZYA 3HUDA 3VH4A 3BHJA 1DRWA 4BO1A 3TJRA 1ID1A 3GAFA 3AW9A 1DIGA 1U2GA 1K2WA 3GG2A 1A9YA 1YE3A 3L9WA 1XELA 1AXGA 1DRVA 3UKOA 3PWZA 1BWSA 3RUDA 4NDNE 4HX5A 4ND1A 3RCBA 3KHUA 2YDXA 6LDHA 4BMVA 3Q1LA 1PJLA 3DBRB 2YJZA 4R1NA 4YTEA 4MVJH 1EFLA 1HDRA 4PZCA 1LSJA 3UCXA 5G0WA 4XDYA 3PYLA 1JAXA 4B79A 3WYEA 4DIFA 3KYBA 1LJ8A 2VOEA 2H6EA 4L4XA 4XQ9A 2ZK7A 5TIIA 3GVIA 2Y0EA 1ZIDA 3ZNPA 1GQQA 1P9LA 2VT3A 2WYWA 3KOUA 3RUFA 4B8ZA 2WD7A 1R0SA 1X14A 3GHYA 4OKNA 2GCGA 1Z7EA 2YUTA 1V35A 3I4FA 3QLJA 1P44A 4XGKA 1X0XA 3PEFA 4WLVA 5L45A 2J5QA 2RCYA 2VRCA 5C7IO 3NTOA 5FI5A 3IUSA 2QYSA 1EE9A 4KTVE 5KNLA 4D79A 1TT5B 3OECA 1JWAB 2IYOA 2LDBA 4CODB 3DAGA 2JFFA 1PL7A 4FOSA 3O26A 4EUFA 1N1GA 1P1KA 4PG8A 4BO0A 2HUNA 2NSDA 2X7HA 3INTA 4L9RA 3I1JA 1DC4A 4RV9A 1Z45A 3M1LA 4AJJA 1AGNA 2Q49A 4YR9A 5I7SA 2PY6A 3ZHYA 1P1FA 3PGJA 2OFPA 5ENDA 5JSFA 3FNHA 1G0NA 5AYVA 4BNWA 5JAZA 4DLBA 2E6UX 3GEDA 1TB4A 3TOZA 4DXHA 2ZCUA 4BGUA 4DYVA 2CZCA 1KBZA 2PLAA 2AG8A 3PHHA 4FD3A 1O95A 3HDHA 2V7PA 3DXFA 1ZMOA 3BMNA 1M6HA 3OP4A 4P38A 5U1PA 5G0SA 3CSDA 4UVDA 4R51A 3ZN2A 3PZBA 1GR0A 1CF2O 2HK8A 1LC3A 3H9JA 1QXSA 1FDWA 2OP0A 4CMGA 4BNTA 4CM8B 1YL6A 4W4TA 4XWYA 5IDWA 3ADOA 1UZLA 5A02A 3Q6IA 1PGOA 3JQCA 4OO3A 4FR5A 3F5QA 3JYQA 1U2DA 1NFRA 4IIVA 3ZI0A 1UXGA 2VNAA 1UP6A 4HKTA 3LC1O 3WYBA 2X6TA 2GASA 3AY6A 3JQFC 2P9EA 4ND3A 3H2ZA 1IUKA 3I9OA 3ONFA 3PDUA 3RFVA 4DC1A 1T2DA 3IP1A 4XQCA 3ZCXA 3LQFA 3JQGA 1E7SA 4TKMA 2DT5A 3JSAA 4RPLA 1K0UA 1X1TA 3HE3A 4PLWA 1H6BA 1QP8A 1KETA 3KLMX 2O3UA 2IXBA 4Y6SA 3AUSA 4QFCA 2P91A 2LDXA 1I10A 2ZQZA 4Q3AA 3KTDA 2H1SA 2J3IA 1HDXA 2PZMA 2O50A 2RH4A 2VUTA 3ZW8A 4F45A 3RASA 2F00A 3GLQA 4YA6A 1WAMA 5DCYA 2NVBA 3DWFA 4YACA 5HWSA 1K6IA 1MC5A 1LX6A 1VKNA 3G0OA 4JX8A 4RZHA 5HRUA 4HADA 2HMVA 2B37A 4BOYA 2D2IA 3IJRA 2Q45A 2E4AA 4P8RA 3ROPA 2P5YA 3H3FA 3S1LA 3H9EO 2RAFA 3I83A 5DBIA 5CEJA 2Z1NA 4UEOA 4CPDA 2C7VA 2GD1O 3U9LA 4CLXA 3ORFA 1U28A 3ZH2A 2P9CA 1CDOA 3VTFA 2YY7A 1UZMA 2BH9A 1YDEA 4RPJA 4XYBA 2Y1OA 4KMSA 1IYZA 2TMDA 2W8ZA 2XF8A 3OIDA 1U5AA 4J90A 4M1QA 2FY8A 4LN1A 4CLRA 2X5JO 4R01A 3N7UA 5G0TA 1M6WA 1Y8RA 1ZJZA 4YPOA 1ISJA 4ZA2A 4PCVA 1LDBA 3CZRA 3JQ8A 3K30A 4IDCA 4LISA 9LDBA 4U6QA 3V1YA 3DAFA 4CV2A 3OIFA 3RUCA 5JAMA 4WPGA 2G0TA 4BB6A 4BQPA 1UDBA 5EINA 3F4BA 4BO9A 3ZNNA 1ZXBA 2EJVA 4AL4A 1N92A 1L1FA 1GFSA 3GPIA 2GN6A 1GY8A 1SB9A 3E9MA 5DN9A 3WQSB 3MZ0A 4LVCA 1ZK4A 4B8WA 1T1RA 3JQ9C 3D1LA 4NFHA 3PLNA 2ZATA 2OOSA 4JQCA 4AJOA 4NK5A 4XIJA 4J1TA 4E2YA 1O8CA 2B36A 4U8GA 2VYVA 3W1VA 3WBBA 5BNIA 1LQUA 3JQDA 3I9LA 4CM4A 1U5CA 4D0SA 4R41A 1H6AA 2DUUA 4WECA 3IKTA 3RBVA 2ZTUA 4J0FA 2PGLA 3T4EA 3GGPA 1X1EA 1QYCA 2Q3EA 2BKAA 2JCYA 2PD3A 2B4QA 3IJPA 4FBGA 1X13A 4CLOA 4JJGA 3RC2A 4Z0TA 3GGGA 4MOWA 4QO8A 4UUPA 2A9FA 3VH3A 1PQPA 3PXXA 3AI3A 4M8SA 1LDYA 3MWEB 2Y05A 2FSVA 3DBLA 3VZRA 4ID9A 4OHUA 3KYDB 4Z0HO 5JC8A 2D59A 3QWBA 3QVWA 4FFNA 4D3DA 1ULSA 1GCUA 3SC4A 3P19A 3GEMA 4HWKA 1EMDA 4CM1A 4JCOA 5CDGA 5LDHA 3OMLA 3D4NA 4OXNA 2NLOA 1HZZA 2BFAA 2D5CA 2DUWA 2JJYA 4M87A 4FB5A 4GVLA 2X4GA 1V9LA 3FWNA 4ITUA 2W90A 5IAAA 4B7CA 1QYVA 2F1KA 5JAIA 3M2PA 1M76A 5F1OA 3OEYA 3H65A 4WKGA 3PK0A 1IY8A 1LRJA 1FDUA 4X54A 2YW9A 4EJ6A 4FCCA 3SEFA 1PR9A 2O7QA 4RCVA 1NVMB 2WSBA 1U4OA 3TZKA 3CMCO 5FEUA 3F46A 1GTMA 4HNHA 4CUKA 5F5NA 5L4NA 4NHEA 4BNNA 3DB2A 1WLYA 5DCWA 4J16A 1HDOA 1PL6A 2EEZA 3ZGYA 4I8XA 5MGBA 1C0KA 1EFKA 1ZCJA 3PWSA 2Q2WA 1YO6A 1ZUD1 1SC6A 3INGA 2OP1A 3L07A 4MVJP 4TZKA 4WCFC 1SNYA 4I5DA 5KJ6A 3FD8A 2PZLA 1U1IA 1YB4A 4OXKA 5TRTA 2WYUA 4PZDA 1BMDA 5F21A 1JU9A 2GZ1A 3H7AA 2AQKA 5F3RA 3W4IA 3PQFA 4DQUA 5CDUA 5HTOA 2Y1DA 5BSEA 2IEDA 1LEHA 4IS2A 2BLLA 3ITKA 3WGIA 4Y6PA 3GZNA 3H5RA 5DNAA 3HZZA 2GN9A 4II2A 2P5UA 2DTEA 2GYYA 3E5RA 1PS8A 4RJTA 2H63A 3ITDA 1KS9A 1U3VA 1FJHA 1ONOA 4P4GA 1JVSA 2OZPA 4OL9A 4UULA 5ITVA 2Q50A 2YQ5A 1E1NA 3X2EA 5KIAA 1E6EA 4GWKA 5ITWA 1NBOA 2FWMX 3AWDA 3O9ZA 1LSUA 1VI2A 1DFHA 2BFOA 4E0BA 3LSYA 3VPFA 3F3SA 5HS4A 1MLDA 4KWHA 3E1KA 5JCJD 2O4CA 3HFSA 1HF3A 3EW7A 2CDBA 1O9BA 3KEQA 4RPGA 4KDFA 3BTUA 4O6VA 4XEHA 4LRSB 3JYOA 4TMFA 3ANNA 1YOVB 4HXYA 1ADFA 4GI2A 5JMPA 1NQAO 1T2CA 2VTEA 1U3WA 4P22A 3ROMA 4B4UA 3UCEA 3IS3A 1LNQA 1W8DA 4RQUA 3C85A 1E1KA 4YRAA 4WNCA 3PI7A 2ZJ0A 3WGYA 1VKOA 5L53A 3GGOA 1KC1A 4H15A 1P0FA 2FR1A 3ETDA 3W6UA 2J5RA 5B37A 1ZSNA 3EAGA 4R1UA 5EESA 5KKCA 3T7EA 2NU6A 4JNKA 1OI7A 3C1AA 5ICMA 2GR9A 3FNGA 5BSFA 1VL6A 4Q3NA 3GA0A 2Y1FA 1FXSA 4IDFA 4D45A 1LA2A 1FMCA 5CEEA 4FN4A 3KYCB 4CMAA 1P31A 4CQMD 2XOXA 1HL3A 4YT2A 2UDPA 2B83A 3H6KA 3GR6A 3OA2A 3WIEA 4B3JA 4AG3A 4XB2A 4XRRA 3WNVA 5T64A 1ENPA 2FZWA 3NJ8A 4NU6A 3ABIA 3NX4A 5JO9A 2V6BA 2FPIA 4GSLA 4IQ0A 4E5PA 1I30A 1SEVA 4Q3CA 2UYYA 4BV8A 5EIOA 3C24A 4CQMA 1NWHA 3N74A 5JDCC 3IL2A 5EQDA 1E7QA 2FMUA 4FJ1A 1EZ4A 3ZV3A 4DLLA 3EY4A 4YAKA 1DIRA 3F5SA 1ADBA 2VUUA 1Y5RA 2ZIZA 4CR7A 1BG6A 4E3ZA 3BZUA 3PIIA 4LCEA 1ADGA 4KQXA 3DDNA 5CDYA 1GEEA 2PK3A 2IZ1A 3NGLA 3GFGA 1XGKA 4Q9NA 3WR5A 1Z75A 1LLDA 3O8QA 5K6AA 2YFHA 4E33A 3GZ4A 1ZKMA 2B5WA 3HDQA 3JQBA 2BMAA 2Z5LA 1SEPA 2BFPA 5T5QA 4N18A 2VWPA 2X0RA 2VHZA 3JD0A 1ENYA 2VZ9A 2OXIA 3AI2A 4I5EA 5T8KC 4BL5A 4ZGWA 1GPDG 4NU5A 3PRJA 3GVXA 5U9CA 3FR8A 1ADCA 3OHSX 2WYVA 2VWHA 5COAA 2GGSA 3PYXA 1PIWA 4JJIA 4A10A 2GO1A 4CM6A 4YXFA 2XAAA 3IDSA 1Q0HA 1Q1NA 1TT5A 1O5IA 1BRMA 3EK2A 1F17A 3B1KA 4I5GA 2VQ3A 3TZQA 4JJFA 1QKIA 3GEGA 1XDWA 1Y9EA 1EQUA 4WE3A 3NDRA 3Q3CA 4XYEA 4JP2A 4TRNA 4YYZA 2X0IA 3E6AA 3I6QA 2QZ9A 3CXRA 4HP8A 4J1NA 2HRBA 3WJAA 3WGQA 3ZWCA 1E1LA 1ZK2A 4GVXA 1XEAA 4MVJM 3RC1A 3FPCA 3VZPA 4BKRA 2P9GA 4OOFA 1RM5A 3PPIA 1VJ0A 4PIVA 1JKFA 3LF2A 4HFJA 4M86A 1DO8A 4BNUA 1I24A 2NTVA 5A3VA 3FBTA 4PN3A 3DAPA 2ZKLA 2D5AA 4IY1A 1GZ6A 1LSOA 1O89A 2YV3A 3E82A 1J5PA 3GMDA 4MKRA 1M66A 3DMTC 3V1UA 3VTZA 3ETGA 3N58A 2E82A 2WE8A 1RM3A 3ETEA 4G81A 4PG7A 1B16A 2C20A 4CM5A 4DBZA 5H81A 4L74A 4LSMA 3AU9A 3UHAA 4E13A 3FNFA 3V5NA 3GH3A 3ZWBA 4YT8A 3RKRA 1MG0A 5CP8A 3CPSA 4O0LA 3MTJA 4NG5A 5GZ1A 1FK8A 1VL8A 5K0ZA 1WZEA 2PTGA 3K2BA 2CF6A 5KWEA 3IKVA 3JQAB 3PHJA 1VL0A 3ZWNA 4PLGA 5H83A 1PR3A 4ALMA 2E37A 4H7PA 3AUUA 4TSKA 3S2IA 3R1IA 3PLRA 2EW8A 2XXBA 4I9HA 3E5MA 1F12A 2GN4A 4IGFA 5JXWA 2HJRA 4M89A 3A1NA 1PQWA 4YJGB 1HLDA 1PEDA 1BVRA 4QFDA 3TSCA 3PJFA 3RJ9A 1NHWA 1Y8QB 2Q1WA 2AQ8A 5TS3A 3ZV6A 2GPTA 3L6OO 1QLHA 4Y67A 3UF0A 3CE6A 4CQLB 1K3TA 3AM5A 3V1TC 1R12A 4U0JA 3V2UA 1U3TA 5ADHA 3B70A 3K31A 4YQZA 2C5EA 3BMOB 4OIMA 1GAEO 2WD7B 3D3WA 1B26A 3DMTA 3GG9A 3K73O 4D46A 5EMHA 4A7PA 1H93A 3VZQA 4GGOA 3T7CA 9LDTA 2JAHA 4W9NC 4W9NA 1GL3A 1NASA 1YB5A 3E18A 3KM0A 3GQVA 4WLFA 1GUZA 5TJ9A 3W4KA 4IUYA 2BGMA 3WYCA 4CLRB 1T25A 3E9QA 1E3SA 3FN4A 1HXHA 3GAZA 1Y6JA 3QWIA 1Y8RB 4AVYA 1Z6ZA 4B4WA 3DZGA 1X0VA 2JFGA 2WMDA 1NFFA 4OSPA 4E21A 2VWQA 4AJEA 5JC1A 4IMPA 2FR8A 4E2XA 2PGDA 2CVZA 4Z3KA 2H9IA 1B0AA 3DOOA 1U8FO 4HY3A 5AXBA 2QG4A 3X2FA 1XIVA 1B8VA 1NFQA 3DC2A 3F1LA 1ULUA 1ZK1A 3AOEC 4GPD1 3FBGA 4J7UA 4A27A 5DULA 5H82A 5T8KA 2YV2A 5L7WA 1ZSYA 3GK3A 3H5AA 2DPGA 2C7GA 1I3MA 4CJXA 1E3WA 4PLFA 5A03A 4JP3A 1GADO 1PWZA 1RPNA 1EUDA 2Q1TA 3JYNA 1KVQA 4WNIA 1AXEA 2NWQA 1LDNA 3D0OA 4G65A 5JCXA 1ZVMA 3VH2A 1TT7A 4GKVA 3VZSA 2OUIA 4E5MA 1T4DA 4PLCA 1MGOA 2PA3A 3WX0A 1NPTO 1A4UA 3NTQA 1EK6A 2I67A 1I33A 3NJ4A 1HE4A 3S2FA 1Z73A 4EJMA 4I08A 4NR0A 3PJGA 3K5PA 3C7DB 1H0KA 4ZQGA 2GSDA 1PJCA 5HS6A 3I9NA 1VLLA 4JBIA 4WEOA 1NQTA 3PVZA 1WVGA 1L7DA 1E6UA 1OFGA 1P0CA 4IBOA 3ZHBA 4ZRMA 2FSSA 2O3QA 1GUFA 4BNZA 4GQAA 4KWIA 2W2LA 4NBWA 2X8LA 8ADHA 4WASA 1E5LA 4ZQEA 4AJNA 1DHRA 1ARZA 2YDYA 5TF4A 1UXHA 3IOYA 3NT2A 4IIUA 3P5SA 1BGVA 3ANMA 1ZH8A 5HM8A 3UOGA 4RF5A 2AXQA 1PJSA 2UVDA 1Q7CA 5CAEA 3WB9A 2JAPA 1LXCA 1VM6A 5IF3A 3UH1A 3GN1A 5A04A 1LDEA 1LU9A 4GL4A 3H2SA 3AY7A 4YVFA 5L4SA 3I4CA 4JK3A 3FWZA 1NVTA 4YJHB 1EBFA 1JKIA 2FOIA 3DZIA 1I01A 1QYWA 2NQTA 1EBUA 1U7TA 4J0EA 1SO8A 2PV7A 4UAGA 1CYDA 1J6UA 3ULKA 4MINA 5JYEA 5BQFA 3EZLA 2HMSA 3Q11A 1K6JA 1KIFA 2NVUA 1DIBA 1NWCA 3WGOA 4WLNA 4B7UA 1J49A 4M54A 5KOIA 4S3MA 4DIOA 2EWMA 3OM9A 4GBJA 5AXDA 2A94A 3IC5A 1YL5A 3ICPA 4OSOA 4HV4A 1F06A 4BKOA 2VHWA 3DL2A 1PZGA 3I5MA 1E77A 5JDIA 2FPGA 4XB1A 1YRLA 2J5KA 2OO5A 1UAYA 3ZV4A 3RFXA 3WMWA 1I3LA 1YS4A 2V6GA 2G17A 3OICA 2HU2A 4CLHA 4PLHA 1NR7A 1O6ZA 1I2CA 3OQ6A 1PJQA 3UVEA 3C3XA 5KJ1A 5COBA 5I7FA 3INRA 4E30A 1B8PA 3DR3A 3VDQA 4MPDA 5KCZA 1QV7A 3L77A 4R68A 2I3GA 2V6MA 2NU8A 1UUFA 4D42A 3C1TA 3ON5A 3R3SA 3UW3A 3JD3A 3TFQA 1H2HA 4EJ0A 2JD1A 4CR8A 4DL9A 4LCJA 4W6ZA 5EN4A 1QR6A 1CERA 4PFJA 4J7CA 3OJEA 4W99A 5TX7A 3EVTA 5L3ZA 2QRLA 1P3DA 1NHGA 3PHGA 4IDGA 5L95A 4QO7A 2ZB4A 4E5YA 3CINA 3SBOA 4CUZA 4TQGA 2D0IA 3RUEA 4PLTA 4EBFA 2DQ4A 4UEKA 4CMHA 4YT5A 3STHA 1JTVA 2X0NA 4J91A 5T57A 3JD2A 5TSDA 1D3AA 5ENVA 2PFGA 1DLIA 1P1IA 4J4BA 4DRYA 4GWGA 1OC2A 5DOZA 1ZXLA 1JVBA 3FI9A 4CM8A 5KVSA 3CUKA 4BO7A 4R9RA 1R0LA 2UAGA 3TZ6A 4BGEA 2NVUB 1X7HA 1BXKA 4MP8A 1Q0QA 1LC0A 2O4UX 3DFUA 4NPCA 3V8BA 1I2ZA 2HMUA 1PS9A 1DPGA 1TLTA 4OH1A 4YB8A 3K2EA 5AOVA 3RROA 4CM3A 3VKVA 4RLSA 4IJUA 1DOHA 1W73A 3WICA 2VN8A 3DTTA 3D5TA 3QVTA 2HAEA 2EGHA 3RU7A 4E31A 4BNHA 1LQTA 3ICCA 2BF7A 3M6IA 1QRRA 2OBYA 2ET6A 3DONA 4YEDA 4E2WA 1HYHA 4XDZA 5L51A 4R5HA 4MJLA 1HE2A 1PJBA 2G1UA 2WTBA 4EEXA 2DBZA 2OGUA 3OA0A 4R5MA 4RO0A 4KTTE 1DC5A 2DFVA 1JWBB 4RPHA 1T4BA 4XQEA 5J23A 3I9KA 4MDHA 1UXKA 1XR3A 1O0SA 1WDLA 2C29D 2P4HX 2W98A 3EUWA 3MOGA 3OJ0A 3WXBA 2GRAA 1MX3A 3JQ8B 2O3TA 1IULA 3EYWA 1GQYA 1I3NA 4Q39A 3RWBA 3E48A 4IDBA 4L8VA 1HDYA 1FDSA 2RHCA 2GLXA 3FTPA 4RLHA 1AUPA 4UUOA 5FFFA 4DVJA 1YL7A 4YAJA 3LT1A 2WJPA 2BHLA 1UR5A 4IZHA 3HWRA 1J0XO 3I52A 3SC6A 1YGYA 3VVBA 2OBNA 3GVPA 3KV3O 4UUMA 4AJLA 1QV6A 4CMEA 5IG2A 3WG9A 4Z6KA 3CZMA 3OIGA 4WLUA 2IRWA 1SCUA 3OJOA 1G6KA 1Y1PA 1IZ9A 1XWFA 2G5CA 1LLUA 3DBVO 1A4IA 1I36A 1IPFA 3KYCA 4YJFA 1XCBA 2FRDA 2SCUA 4EDFA 2VUSA 2Q99A 4S1VA 4QEDA 4CMIA 2IZ0A 4JIGA 3JQGB 1A9ZA 4OQYA 5EL0A 3KBOA 5TT1A 3LZ6A 3VAZA 4BKUA 4NNJA 3MEQA 2CNBA 1H94A 2VRBA 4CM9A 1E3WB 2PH3A 5BT9A 3WDSA 1ZO8A 2DTXA 4K6FA 2NV6A 4BVAA 5JBIA 1P45A 2ZB3A 3MJSA 3Q9NA 3RVDA 1LLQA 1ZK3A 2RHRA 2VZ8A 4KQWA 2EIHA 2C82A 2X5OA 4CQMB 1U8XX 3OFSA 4ZQBA 5IDYA 3A14A 3E9NA 4DGSA 1D1SA 1SPXA 4FJ2A 1NAIA 2EKLA 3OQ1A 4R3WA 4WCFA 3SJ7A 2AQHA 2NU9A 4XGIA 1WMBA 5ER9A 3QWAA 2EV9A 1XSEA 1G1AA 3NT5A 5L7TA 3KLPX 3KZVA 4DPLA 3WNQA 3R0IA 3A9WA 2Q4BA 1MC4A 2JCXA 4JBHA 3ZWAA 1QYXA 2HQ1A 2J8ZA 4K26A 1QSGA 2NUAA 2X9NA 3RAJA 3W4JA 3D3WB 3B6ZA 2I99A 2CSUA 4IDEA 5CDTA 4ZQFA 3BHIA 1MXFA 4WLEA 1N2SA 3UXYA 1Q2XA 3GC6A 3GT0A 4ND2A 8LDHA 4Q3DA 3MJEA 1RM0A 4R9SA 3JQAA 3TZCA 2EHDA 2R00C 3L4BC 4FC7A 4OAQA 2NADA 3FPLA 3JV7A 3JD1A 3DZFA 1YOVA 5DP1A 2Y68A 1ISMA 1PSDA 2ZYDA 3U62A 3KYDA 4AJIA 5CFZA 3L6EA 5JY1A 1E3EA 1OMOA 3W8DA 2PR2A 3PTZA 1H9BA 4U5QA 2O3JA 4DMLA 4W7HA 4L0QA 3KSUA 2ZTLA 4ZQHA 3Q0EA 4DUPA 3DEYX 3ROQA 1N8KA 3FSRA 4MIOA 3LT2A 1YXMA 2WEKA 2AE2A 1NX6A 2EW2A 3BMNB 3O8QB 3P2YA 4XJSA 5JNLA 4U0KA 5K9ZA 2DM6A 3HG7A 4YRDA 2NQ8A 4WEQA 3EMKA 2DBQA 2X22A 4AJHA 3O03A 1GD1O 2VYNA 2DBRA 4CMKA 2X9VA 3AI1A 4M49A 2PGJA 1O94A 1T1SA 1E6WA 5KJEA 1OZAA 3ZZNA 1C0PA 4R69A 3UICA 3C8MA 4ZJUA 5IDXA 4KOAA 4QXMA 1D4FA 4CQLA 1NQOA 3NAQA 4H3VA 1LRKA 2P4QA 4Y9DA 1NVGA 1V3VA 3KB6A 3DFZA 2HRZA 3B1FA 4NK4A 4OM8A 2VRCD 3DBLB 5KJCA 1U9JA 1LI4A 4JGBA 4OGWA 3BHMA 3ADPA 1M75A 1PGJA 1V3UA 1XLTA 1VE9A 5BSHA 1BDMA 3AFMA 3OETA 3O4RA 4ZRNA 3FRJA 1T2FA 1LRLA 2CY0A 1B3RA 1ENOA 3FF4A 3ROKA 1B7GO 1R15A 2VHXA 3QVOA 2NTNA 3BA1A 5A1TA 4IQGA 2HK7A 4YJHA 3EVNA 2OORA 1D7OA 1HLPA 3GZNB 3C7AA 3FTNA 4U7WA 3PQEA 3AJRA 1KOLA 1R0KA 4EZBA 1RJWA 3GVHA 1KEUA 4AJPA 1NTOA 3U4DA 2YQ4A 2HK9A 4BS9A 5LDGA 3BTVA 3K96A 2OL4A 5I9MA 3CKYA 2R00A 3L4BA 2X23A 3H5NA 3ZW9A 4XR9A 3Q2KA 4E6PA 2AHRA 1MP0A 2QQ5A 3U49A 4INAA 1BSVA 2I66A 3WTBA 4FC6A 1AHHA 2C59A 7MDHA 3JYLA 3JQ6A 4PGFA 4RVHA 3LDHA 4NZ9A 1OBFO 5I8WA 3U09A 2NNLD 4NFYA 1OOEA 2HMTA 2VCYA 4WCFB 1DJNA 1NAHA 2D1YA 4ONEA 3PFWO 2TMGA 1LSSA 5L7YA 2B69A 5FF9A 3FR7A 4XRGA 1C1XB 3KVOA 1UP4A 4Z9FA 1H9AA 4UVEA 3U4CA 3C1OA 1XHLA 1A27A 3U3XA 2CVOA 3COSA 3VKUA 5C37A 5IXSA 4BO2A 1Z7BA 4RGBA 5A9RA 1VRWA 2PZKA 4OYRA 5IN4A 1Y5MA 2W2KB 1YBAA 3AUAA 3IP3A 4A0SA 4DC0A 3ZV5A 3PHLA 4Y6RA 4EI2A 4XZ3A 4DYDA 5JW6A 4MKZA 1XYGA 3JD4A 4O5OA 3EHEA 1VSUA 3QP9A 5A05A 4D44A 3BMCB 1DB3A 2VNSA 3T4XA 4JN6B 3QWFA 1GQ2A 3AU8A 1R4NA 2AEMA 2I3AA 1T24A 1JAYA 4WLOA 5I7VA 5IXYA 1VSVA 2PZJA 5DT9A 4BB5A 1NM5A 2FZEA 1YJ8A 1YBMA 1WDKA 4J7XA 4XYGA 1HDCA 1I5RA 1TA4A 4RPKA 4URFA 1JA9A 4B4VA 4CV0A 1DXYA 1DAOA 2A4KA 1UDAA 3QVXA 4NBVA 1EQ2A 4IDAA 4RF2A 4XA8A 5AXCA 3F6YA 3VHRA 4XKJA 4GX2A 5A9TA 4NBUA 3ZU2A 2Y66A 1YQXA 4R1SA 1EVYA 1IB6A 5B1YA 5JMWA 4GX5A 1NP3A 1QYDA 4J6FA 4RZIA 5DOVA 4DA9A 1CETA 4PVCA 4AJ1A 5GZ6A 3WWYA 1YH3A 4MVJF 2POQX 1HTBA 5AXAA 3U0BA 2ZB8A 4RDHA 4BGIA 1X7GA 2H5LA 2ZYGA 4P4LA 3JQBC 4A26A 2GUGA 1P74A 3MJ4A 4JBGA 1B8UA 1ZEMA 1XU9A 3LT0A 4XCVA 1SMKA 1UXIA 1NPYA 3DQPA 1J4AA 2GDZA 2QW8A 2JD0A 1DSSG 3ZNOA 4CV3A 2YZ7A 5C7LO 1FF9A 3TNLA 5BSGA 4TRMA 4LGVA 2ZB7A 4IM7A 4AJ2A 1IOLA 1HEUA 4BNFA 2R2GA 4PG6A 4PRLA 5G4KB 1UDCA 3LT4A 1Y8QA 2AE1A 4XQGA 4K6CA 2O3RA 1UXJA 2DU8A 2IXAA 4CM9D 4BO6A 4J9VA 3U4IA 1GYPA 4ZN6A 4PG4A 4EUEA 5THQA 3PHIA 3PFFA 3I9MA 3R6DA 3ZDFA 3L0DA 1B15A 4TROA 4YBZA 3RKUA 3QVSA 3GDGA 4BO3A 1IL0A 1JKJA 5B4UA 5LCXA 2W2KA 3U5TA 5JDIC 5HA5A 2UV8A 1IZ0A 4FOOA 3RIHA 3WQQA 4XGNA 4NQZA 4CL3A 5B4TA 1HE5A 2O2YA 5I8ZA 5BNFA 3JQFA 4DPKA 4BNXA 1D1TA 2C07A 3DO5A 4IJWA 4CV1A 5MDHA 3C7CB 3D4PA 2DFDA 4RF3A 4FPXA 3VOSA 2WDZA 4ALIA 4CMJA 1P77A 2Y0CA 2O7SA 1MXHA 2JFHA 4FFPA 3HB4X 4CLOB 1E5QA 3IAHA 3F1KA 4GAEA 3ZWOA 2IODA 1YB1A 2YHIA 4O63O 4IZIA 4L75A 4N54A 3GVCA 5L4LA 1IE3A 3AFNA 1A5ZA 1MG5A 1YJQA 3WFIA 4R4JA 2EERA 2G82A 2QZZA 4B4OA 3LLSA 4C7KA 4F3YA 5FWNA 2HCTA 4FFMA 3QV1A 4H16A 2BFMA 1B14A 2QRKA 2VHVA 4YAIA 3DZHA 1N7GA 3NGXA 1HZJA 3UCFA 4BNYA 4FGSA 2PD6A 1EDOA 3GN2A 1E7WA 3H9GA 2DVMA 4LK3A 3GDFA 1H2BA 4ZD6A 3E8XA 4FS3A 2ILTA 1EEHA 2EP7A 5JY6A 1SOVA 4YJGA 1VC2A 3ONDA 3D64A 1TI7A 1KY4A 3CIFA 3H9QA 1HYEA 4EITA 3BMCA 3RQSA 4BNVA 2JHFA 3KSDO 1Z74A 2I5PO 4Z3DA 2AMFA 1B3BA 3PZRA 4RVFA 4ALLA 3RBXA 4B3HA 2VYND 3IQDB 5THKA 4BMSA 3MOIA 4HFRA 4YQYA 3HFGA 3QSGA 1BW9B 2XPCA 3HHPA
chains in the Genus database with same CATH superfamily
5LZ8A 4RK0A 5FNZA 3LPCA 1RWOA 1PT5A 2Q2OA 3NDIA 3SBXA 3HV0A 1UFKA 3L43A 4PNHA 4BVBA 5AKKA 1WB4A 2OO5C 3K1AA 3G82C 3I2IA 2HJSA 2ODNA 3K8YA 4OFZA 4LQCA 5K8TA 4BCBA 1WHSB 1R37A 5J2TA 2FUG6 4QA9A 2ZQYA 1SOWA 3UK0A 5AW0A 3P2KA 2PRKA 4WBNA 3FETA 3HSKA 1IHYA 4M7RA 2BGLA 1QQ6A 2XQVA 4HEA6 2I78A 5FOWA 1S89A 4AZSA 1W0JA 4DT1A 1EXDA 4YRGA 4HYYA 1ZIPA 1FTQA 7REQB 3BSFA 1ATIA 2AOTA 3EMBA 4RKRA 2XZTA 5FT9A 5DZSA 1IN6A 4P3OA 4NH4A 3MHPA 1ZUNA 3PVSA 3CSSA 4M1KA 1MAHA 2WJJA 1ND5A 2ACVA 3JALA 4UHKA 2Z3WA 1VHQA 4XH9B 2OSVA 4XCXA 1O57A 2VTDA 2XYPA 4CQNA 5ILOA 2VF5X 1LY1A 3NDPA 1U2PA 2ID7A 4AUMA 2JH8A 1JFLA 1FNSA 4PBSA 4C1NA 1TTPB 2II6A 1SBQA 2VR1A 3ROFA 4K6OA 4P3NA 1MZVA 3VU8A 5FWXA 2V7TA 2SKCA 2XB8A 2P6MA 3C43A 3RS9A 4CEJB 3KXDA 1B1AA 1QHIA 3HVIA 1C3OB 1JHAA 3NYWA 1YKFA 3AILA 3S8YA 2O2EA 1T91A 3LU1A 4UM9D 5K20A 2KE5A 2XKBA 4W6QA 2PAAA 5FTJA 1XEWY 4NBRA 5GZ3A 1MO2A 3G0IA 1T3SA 1VKHA 4WOBA 1NT2A 1WV0A 2HDHA 2Q3MA 3M7IA 1Q15A 1YU9A 4GGMX 4C0JA 1NVEA 3WADA 4QTTB 1TEZA 4HN4B 4QLAA 3FPBA 1ETHA 4GSKA 4TTSA 3RUIA 3DHEA 3FCAA 1MOPA 3CJQA 2Y9MB 3E58A 4RQAA 2E4WA 1HV8A 1YFLA 4B9AA 1WNFA 4INZA 1J21A 1ICIA 3VPXA 1QYRA 4R3NA 3L0ZA 5E3IA 4ECAA 1HZZC 2QQFA 5D3MB 2I8LA 1XG5A 1Z0IA 3VNUA 2X0KA 2HSEA 3M5DA 4HBGA 3LGSA 4ND4A 4G25A 3RYCB 1A04A 3W1WA 5L6MB 4X9XA 2RONA 1TVMA 4MUJA 3V7YA 2CSXA 4ZHQF 1KI7A 2P9ZA 4XFJA 1MO6A 2BFEB 1P0IA 4J8PA 4UE6A 2OC9A 3KQTA 1M67A 1NF8A 1KEPA 4K9DA 4YMLA 5CLLA 5DDIP 4D97A 4MIYA 4OLFA 5B55A 4GMHA 2IF0A 1XRQA 2V7XA 1CG6A 2PUEA 1OE0A 3QX9A 2WP8J 1HG1A 1V5FA 3B8EA 3D4LA 5AM1A 1KYTA 5JLAA 2QIOA 2F9FA 4MJXA 4HAVA 2BGNA 4MQLA 3JASA 4JKIA 4N6NA 5BPFA 1YDHA 5CM9C 4D3YA 2XY4A 2FZVA 1CB7A 4YJDA 5MFZA 3IMFA 3UMVA 1PJ2A 3RB8A 2GD6A 4I1YA 3HBFA 5F64A 2YMLA 4CDNA 4TKUA 3ISTA 2PUBA 1I14A 1Z4JA 2HTEA 1D5CA 1TCVA 2Y1CA 3WSWA 3OU2A 5AD1A 4AO7A 2WWXA 1RM4A 2JGAA 3OPYI 4K6KA 1CDEA 4MW5A 2HOQA 5IDQA 3EA5A 3FGNA 2QAGA 3PQ6A 2B61A 2GVNA 3TTWA 4L57A 3UV6A 4MWSA 1C1XA 2FSUA 2EZ9A 3P9ZA 4BMCA 1GNQA 3B3QA 1V1JA 2XB6A 2VPWA 3HPRA 5TVKA 3STXA 1SD2A 3JPYA 2VP6A 1E9DA 2QW1A 2Q5LA 4G09A 2DP4E 1ZLYA 4UW9A 3DUFA 3ZWYA 2FW9A 2R7NA 3ESCA 3FDZA 4AECA 3KQVA 4II7A 3D6NB 3WV4A 4B31A 1G9XA 4EH1A 1B0PA 1Z4KA 2GRUA 3HGMA 3PBKA 2QE6A 3OPVA 4KUHA 2GH1A 4WJZA 1KAGA 3QG5A 4BE4A 3VR6A 3I32A 1WPGA 3IESA 2D8AA 2IX3A 3TSWA 4XX1A 4KIWA 2TRSB 4EGSA 2OHOA 4Y98A 3KFLA 1FYWA 3DJYA 3F6CA 4GLLA 4LJ5A 4Y8VA 5C8YB 4LF9B 2Q21A 1G21B 1LJUA 3QXXA 4CUJA 2Q29A 1N2JA 3UB2A 5ABPA 2ZJ1A 1CIVA 3STVA 1QZXA 1C3XA 3G9ZA 1XU4A 1WF3A 1DMSA 4G3XA 4J16C 4EEZA 4G2NA 5JSQA 1O0CA 4HFMA 4YCLA 4BO5A 2CDCA 3JTEA 3QE3A 4CTJA 2J6HA 1QJCA 4QECA 1W85A 2DQZA 5CX1B 1X6VA 4PICA 3FOZA 4GECA 4U00A 3LOPA 1QUEA 5KQSA 2YV5A 3MCVA 4S04A 1MIHA 3F4KA 1TKCA 1BVHA 4CLEA 2XKKA 1WCIB 2HA3A 3DDZX 4LBWA 2ONJA 4XYLA 1W59A 1AE1A 3NXSA 4GC9A 1PL8A 5JNUA 4L5AA 5L40A 1SFRA 5JCOC 2GZ2A 2QU8A 4K88A 1GJRA 3OZFA 5EJ7A 1YONA 3JX9A 2ALJA 5E1BA 1PNVA 5CVTA 2YS7A 3AMVA 3DFMA 5JAOA 5JNTA 1T8RA 1I1NA 3VUFA 4ENVA 4LMBA 5DGDA 4MVJD 1Z5OA 4PXYA 2FU5C 5DMHA 4W5WA 1EK5A 3HDTA 1NNUA 1WD5A 5K0JA 1Z82A 1BVUA 2WMNB 1XQ6A 2XMDA 1FIUA 2BHSA 1T1GA 2Z6VA 3B5IA 3F67A 1MFZA 1HL7A 3CNEA 1XTIA 2DPHA 3QXSA 4L72A 5H3HA 4QQ8A 4B46A 4KN8A 5JYDA 3DJFA 2VOJA 4BWYA 1L4MA 4BNKA 2JI7A 2BGIA 3DULA 4KN5A 3SVTA 2IS2A 3VUEA 2BI8A 3QGMA 1VLQA 1OV6A 2ON6A 5DBGA 3ZHUA 3RG8A 4KQKA 4O5AA 1BYUA 3HZOA 4O4IF 3ZCPA 1USWA 1RYEA 4I1IA 4IWNA 4TWZA 2ZFUA 4ZC8A 3WBKA 5E3HA 1O87A 4KR2A 3FRIA 4DIDA 2J4FA 3GLKA 3OAAA 4BFVA 3ZWXA 3FPGA 1DG1G 4JC0A 4P92A 2AJBA 2XTZA 2CBZA 4CGZA 3DGEC 3K9WA 1COWD 2OFOA 2GBPA 3BUSA 4GNKA 5LPNA 1DJQA 3QQPA 4UU8A 2Z1MA 3AEUB 1CUDA 1QUFA 1QRSA 1MV8A 5B3JA 2WTNA 3NYQA 3TFOA 2KLBA 2C00A 3V8NA 2QL6A 4D25A 2IE0A 1FMLA 1NRXA 5LMCA 1YTUA 4H3SA 2CNOA 4IINA 3MQ2A 5J5AA 1TZKA 1JEAA 5KYYA 2A1TS 3IEXA 1ESZA 3KT3A 1D4OA 2B7BA 4GFDA 2CE2X 5JATA 1P2BA 3L4SO 4KIGA 4W1SA 5DYNA 3AKCA 1TQ2A 3ENVA 2QSJA 3H9UA 4KXQA 4DVGA 3RM3A 3V6MA 1ULTA 4QJIA 4AICA 4BTLA 1WBDA 1KBOA 3EUAA 3M1AA 1O58A 1R0BA 3MLEA 1ZRNA 3VR5H 3B20A 3IIIA 3L7MA 4YX9A 3NVKI 3MCWA 5C7YA 2XUAA 2DUMA 1YWGO 1PFYA 1U1GA 3ZCRA 2AG1A 2IHZA 2HADA 1ZM2A 3AB8A 4BFUA 3IV7A 4Y0AA 3VI3B 4X6YA 4XWTA 5BN3A 3U16A 1YI8A 1B41A 5AUPB 2HJWA 1GRNA 3B1ZA 5IJWA 5K45A 3NUGA 1A9RA 2E6KA 4LJ6A 5EVJA 2YJ6A 3AG5A 1X7YB 5TLSA 2PD4A 2JIBA 4B6GA 3ZU4A 3HL0A 2C4HA 5EGNA 1IN1A 1P1JA 1K86A 2PXHA 3OEHA 5KVVA 2CGEA 4B45A 3L4KA 3QLVA 2DUNA 5FUYA 5KTSA 3RT7A 4F6CA 2EX4A 4EY3A 4OB8A 1DBVO 1E6LA 1I4DD 1PWYE 2NYAA 3TVTA 4OXYA 4OD0A 2XLBA 3DWEX 2H18A 2PHZA 1CWUA 4HXGA 3TTXA 3GLFE 3ENQA 3RVRA 1DL5A 2OYCA 2YHUA 5K8JB 3GRPA 1N6HA 4A5SA 4UMDA 4EJFA 5J58A 2Y0PA 1ORRA 2WF9A 1JLLA 2FEWB 4OLHA 4R7TA 3TRIA 1R16A 1B0UA 1EE2A 2PJUA 3SC3A 3TSOA 1DBPA 1EFVA 3L6DA 2GESA 2QP4A 3O92A 1GRVA 4JSYA 4RKFA 3RUHA 4PPGA 4BXOB 4UDXX 3GRCA 3M3HA 4EUNA 2NXJA 1I2MA 5DH9A 1KI2A 4ZAGA 4Q1BA 3QELA 4ZOLB 3GNSA 4EY5A 4DJJA 1TUEA 3B36A 3GNQA 5T67A 3TLJA 4I7EA 3Q9SA 1PJ4A 3OOYA 1QFXA 4K9MA 4WK6A 5IZ4A 3IERA 2R6GA 3OQBA 2CXSA 1SH7A 3JWEA 4QHYA 1KI4A 1EM8A 3LQYA 3MWDB 3N8DA 1NF2A 1PR6A 1JMVA 1YKGA 3ZOZA 2FKAA 1RQLA 4ZVLA 1NYQA 3DLCA 5JCZA 4OUDB 3TLCA 5TQVA 2BEVB 1X9HA 4EM6A 5L3SB 2L17A 4UQLA 4B3IA 5TEWA 4BE7B 4ZI7F 3JQEA 1YBFA 4TT3D 5CDHA 5HIKA 5K2OA 3M49A 1PGNA 4NOJA 2OZVA 5HR5A 1F8FA 1AVTA 4X6LA 4W5TA 1AJEA 4C7MA 4ZYXA 3FNBA 4AQ7A 3FMOB 4DDUA 4ZXFA 3HCEA 2V7WA 4M0LA 4QSMA 3SSOA 3X43A 2I2WA 1SOAA 2ZPAA 1AM4D 2EATA 4TWIA 1TRKA 4D8YA 2IY9A 2N3ZA 1RC8A 4RMIA 3PRKE 2C9CA 5CDFA 2I34A 2CXHA 4KQ6A 4XVQA 2IITA 3AI7A 3GLIB 1XZLA 1E2UA 4BNGA 1J8MF 3MJCA 2FOLA 1E0KA 1L7RA 4GP7A 1KS2A 2BMDA 1Q0SA 4LWZA 4PIMA 1U6IA 2AA3A 3PFCA 1E1CA 2O2XA 2GTIA 3BTSA 1KDTA 2OAEA 3WK7A 1U9IC 1U0JA 1R4NB 4NLLA 2X58A 3DG9A 3OH8A 4R9UC 2DQYA 4LRTB 2F1JA 3WB0A 5LZ4A 5A5FA 1IEWA 4DHEA 1ZS9A 4LV5B 1BXGA 4EHLA 2ONZA 1LI5A 4MQFA 5K3FA 3WLFA 1FSPA 1L4BA 1OZGA 3AFIA 2D1FA 3I09A 1QGUA 4J4HA 4Y2VA 4LRYA 4MKFA 3W3ZB 1UJ5A 2Z2YA 3WHPA 5H3LA 3OMXA 4IDOA 2HCFA 3EHDA 4J1QA 4KFTA 1W5TA 4L8FA 1OYWA 2R4QA 4ZO7A 5H16A 1ZU4A 1CQJA 2CDRA 2EDCA 3CNNA 3NVAA 4FGWA 3TZBA 4CVNA 4DQXA 1T9CA 1ISRA 1J97A 3HNOA 1QIHA 2GZHA 3K5IA 3WMXA 4AMBA 3ZDDA 4C22A 3AY3A 3OAAD 2OUKA 3ZHZA 3ICQB 2EFJA 1ZNWA 2J31A 2Y1LA 3N28A 2J3KA 2WF5A 1U1DA 3H8SA 5A2QA 2PYZA 1ZUIA 1L7EA 2A5GA 2PX8A 5KTTA 3LTNC 3GHHA 2AN5A 3K15A 4XD2A 4M1SA 5EP1A 1XQWA 2FMIA 1DINA 1ODFA 1V8DA 3NOOA 3O2SB 2BKVA 1ZMRA 4YO8A 1QK5A 2RG1A 3CLKA 1Z8HA 2QT0A 5E9WA 4ZVVA 2Q3JA 3N7TA 4QXRA 4EPTA 1XJ5A 3G8YA 1G20E 4C29A 4ZU1X 1LNZA 5EP3A 1T8TA 3LVFO 4H6WA 2B30A 5JPIA 1ZOPA 2EKZA 2FPWA 1JAIA 3KEOA 4BZXA 3EIWA 1M2NA 1V11A 1KR2A 4XX0B 3T99A 3WHKA 3HC7A 5TQ0A 2FCAA 3DVRX 5B2FA 1ZZEA 4KYTA 3B2NA 5B58T 1JQBA 5HUJA 5BN5A 4I2VA 4DLNA 1N3YA 3A2LA 4IOLA 1SVLA 1I94B 6REQA 5ALFA 2DTDA 2EKDA 4LSWA 1WOYA 1GQFA 4PLVA 5F2KA 3WKDA 4IIEA 4BNIA 4JA2A 1WW8A 3C5HA 2NUBA 2G8LA 1K4YA 2FH5B 3HMQA 3R3JA 4LHZA 3AR9A 3UT0A 4RK1A 4A73A 4AK9A 3GPLA 3JQ9A 3KWJA 3OQHA 2ZVDA 4HGNA 1QNFA 4RFSB 1FL9A 2HA6A 5DNEA 1JMKC 4L07A 3A9CA 1IZ8A 1BE1A 3PGLA 1L8XA 2OXCA 3X2SA 4D3SA 1PHRA 3D5QA 1N0WA 3QRWA 4UU1A 4ASUA 1RPTA 2QNRA 3ESZA 5JPDA 3CYFA 1E0SA 4MRNA 2PU7A 2WWRA 3MWLA 1KVTA 3RSHA 4W82A 1PJTA 2IDZA 4WZBE 4D4LA 2D1RA 1Q7BA 5AJWA 4DDKA 4RHEA 1Z28A 1KMHA 3DUFB 1D8TA 1QIFA 1EDZA 4HXEB 3HWX1 4WVFA 4EPXA 1BE0A 2ZBRA 1ONPA 4F71A 1JX6A 1SVOA 4ZZ2A 2O7RA 3GJ4A 4RL6A 4RNDB 1JKXA 2DPXA 1KJQA 1KEKA 2GB4A 4D8XA 2C1XA 4X8MA 2Y3IA 2O8FA 5ILGA 4F2WA 3EARA 3V4ZA 3OBIA 3FX2A 2IPXA 1KK1A 1M2WA 5T6MA 3NIDB 1VSBA 4OHVA 4RW0A 3HXQA 5MGNA 1EIZA 4UXIA 3HA2A 5C7OO 1WXHA 3N5CA 2RH9B 4FW8A 2VG8A 4KPYA 4H3KB 1JUDA 4HN9A 1YRYE 4I0WB 4R1TA 3V4LA 3N6RA 5DCUA 1HY3A 1QVVA 2QMOA 3PDWA 3TG2A 3OCWA 5B4VA 2H0QA 3WZMA 1TTQB 5E0KB 4BLSA 3ZQUA 3ECCA 3VOTA 4YDHB 4FWIB 5HGXA 2PE5A 1NXPA 2EGUA 3DBHB 1ML3A 4REMA 4MVYA 1F8GA 3AOGA 3WTCA 1PW5A 1M8KA 5AK5A 3ZOKA 4J2OA 1YQDA 5LKRA 2I3ZA 1OPRA 4UPDA 4YAEA 1NBIA 1IM8A 3OEWA 4QFBA 3ZCSA 1EFUA 4JJ7A 3AR5A 4BBJA 2EHJA 2X2EA 1B8NA 3DMFA 5EZYF 1R0YA 4FGJA 1H4TA 1U65A 1DRUA 3K92A 4L9SA 4WBXC 2COEA 2WUEA 3IPLA 4D41A 5I45A 3F6BX 4YT4A 1FUIA 3KZKA 5KTNA 3WS7A 3F3YA 5KI6A 2JFZA 1OXKB 5IXJA 3PC8C 1ATZA 4BEJA 1Z4MA 2GFHA 3P2OA 1SZJG 3D8SA 3B1JA 4YP0A 1CQIA 4P98A 3KQHA 3LY8A 4L5JA 4BNDB 1EVLA 3OCCA 2JBWA 2Z56A 4I9NA 4RFVA 5BMVB 1RKXA 5LUAA 4PTZA 3BRQA 4TRJA 3RVLA 1U5BB 1RVDA 1ISHA 2A67A 3RNOA 2JD2A 4D9MA 2C2YA 3P96A 2VYVD 4EYEA 5CX4A 5IJ0B 1NVBA 4QDKA 3EGOA 1Z07A 1L5FA 1OIVA 2GN8A 1LBEA 2AZMA 3DKKA 5L8VA 2D1SA 3CT4A 1W8IA 4ARIA 2GKGA 2WWYA 2YL2A 3D8NA 4WN3A 2P41A 2UXDB 2IEBA 1SHTX 3DTYA 1A71A 1GUYA 1GRRA 3MG9A 3SQWA 2G40A 3H1EA 4AG6A 2XSZA 1Q21A 2ZWVA 3BJEA 2VO1A 3PE4A 4MS4B 1K3UB 1EK1A 3FOBA 5FI0B 3NP7A 4KLAA 1K06A 4OHBA 4M9XA 5F5XA 1BHQ1 5C4MA 5B12A 3VR2A 2XTNA 1F0YA 3HDVA 3T7RA 4EYGA 1O7JA 4C7JA 5BWBA 2ECQA 1KP9A 5I9NA 1W2GA 3G2HA 1OI3A 4ZEVA 1QP0A 4MR9B 1P18A 2GM5A 1I3KA 4IHJA 5K8CA 2Z8ZA 3FOWA 1YC5A 4O3FA 3QVGA 5F52A 3UGJA 3NIFB 3HB5X 1K63A 3UXHA 3WGGA 1S4MA 2JJQA 2FQ1A 1K92A 1NYTA 4Z9BA 2HF8A 1A3CA 5EQFA 1Z4NA 1I1OA 3WAKA 1XCLA 4XM1A 4MRAA 1B6TA 2X1MA 3TWOA 4N8EA 3JQQA 2Q0XA 3AQIA 5DSXA 3PXCX 4NAUA 4HDCA 3ANXA 3U62A 4PG5A 5FIUA 5JI3E 3FJYA 3U26A 3K32A 2FSIA 5IC5A 4F60A 3HI6A 3NTRA 3E84A 2AW5A 3NAZA 4D1YA 2IL1A 4O2BF 4WFQA 2XOKD 4C9BA 5EKSA 1E92A 4D74A 4WTOA 4DPMA 4EG1A 1S7CA 1PDVA 3FYUB 1A76A 3G79A 5EJ2A 2H2DA 1R0RE 3NUQA 2VATA 5B1IA 4ZEWA 3RJ5A 1YA6A 5AM0A 4BRZA 5AQ1A 3ASVA 3NFRA 4ROSA 4RAOA 1VJ1A 3A10A 2B78A 4J0QA 2XKAA 3PYMA 1CJCA 1KVSA 4KJXA 1NUUA 5FLYA 4IGEA 2OO7A 4RVDA 1O5TA 2WYHA 3P9CA 1YS7A 1K0FA 4AJ4A 3UK6A 2XYRA 4MV9A 1BHJA 2XNKA 5CFOA 2QPOA 1KOGA 2V5VA 1NDHA 3MB8A 2CF5A 2WUDA 1KJJA 3HO6A 2NU8B 2O2SA 2C92A 1W6RA 4Q4AB 1MR3F 3DHNA 2CLHB 1YE5A 2CLEB 4HGQA 4XYMA 5FNVB 4BMNA 1U3UA 4QQRA 4A2CA 4FQ8A 4JLBA 4Y1EA 2NZJA 2Q7OE 1IHPA 3BHJA 1SBZA 5JR3A 1VJCA 2P6RA 3PEUA 3MTAA 3B3AA 3GQBB 3N8GA 3SHQA 1U2GA 1EZZA 3B13B 1KDZA 2PNJA 1T8YA 2PAFA 2J9FA 4URXR 1DRVA 4RTOA 4GNRA 2YC4C 5KWSA 2V55B 3KZCA 5E6RB 2F3PA 3IPCA 4HX5A 4WRRA 3T5DA 2VJYA 3ZGNA 4WDRA 3I62A 3IALA 1NUSA 5BSUA 5IJ9B 4JXXA 5HGJA 1R3UA 3DBRB 3CZAA 4KBFA 4M7PA 4QPCA 4YTEA 3INYA 4M7WA 2HD4A 5J40A 1HDRA 1WJGA 1U0FA 1YDMA 3PYLA 1RT9A 4EWLA 3WYEA 1UXOA 1QZ3A 2QNBA 2XECA 3FTDA 3KYBA 1QIMA 2VOEA 3PSAA 1Q0UA 3D1JA 4JELA 4L4XA 2WIBA 2DWPA 3O2QB 2PZBA 4BECA 2Y0EA 3TKYA 1Z62A 5CH3A 1P0QA 4JP1A 1P9LA 4ZCQA 4P86A 4R1QA 4DTCA 3JAMA 5DM2A 2XNSA 4UATA 1CF9A 2DCMA 1X14A 3HBJA 3DBIA 4FDUA 5ADUS 2YUTA 5CITA 1V35A 3QLJA 2IVZA 3OD1A 3L0SA 5L45A 2NO0A 2Q5OA 2RCYA 4IFTA 5K01A 2W2QA 3A6ZA 5B7QA 5C7IO 4B35A 4RWZA 2Y92A 4LZJA 3VR0A 1P5FA 1QHHB 2YOFA 3AX6A 4D79A 3CF2A 1IZZA 2J59A 1OF1A 4MLDA 1JDBC 1G3IA 1Q17A 2LDBA 4TTVA 2FEPA 3WYDA 1N33B 2FX5A 2FN3A 2Y71A 2K4MA 1TMGE 3IHKA 4JB2A 4B4KA 1NBME 3INTA 4XIIA 2QGFA 4AJJA 4RV9A 4BNVA 5AW9A 4EKNB 1EE1A 2RG7A 5BO5A 3L05A 1QVZA 2OLKA 2CLDX 2PS0A 3PPVA 3KUCA 5I7SA 4ZV9A 2UXBB 3ZHYA 3L7OA 3R3YA 1OROA 3RPEA 2OFPA 1ZITA 1EM6A 2P5SA 2IOYA 2PH7A 3DQZA 3PFGA 3Q4GA 5ENDA 3FNHA 1G0NA 5HDQA 1SOUA 3U31A 3FOAA 5DWDA 3VR4D 1TB4A 4B44A 4BJ5A 5A06A 5B1SA 4OFBA 5G41A 4DYVA 2A1TR 5E7QA 5TXGA 5F3WB 3BXGA 3PHHA 5LJLA 3ZIDA 3DXFA 4Q9IA 3N3BC 5B6PA 3BMNA 2VDMB 4KWEA 4MW9A 3ZTTA 3ICWA 4R51A 3PZBA 3NWBA 2VT7A 3SIPA 3F5MA 1KZGB 4JU8A 3LUCA 2WPDA 1QXSA 1KRHA 4CMGA 3CEMA 2ZSIA 1FYDA 2PKCA 3BG5A 1ZHHA 4QJ4A 5F35A 4CM8B 3ADBA 2NP7A 2IIQA 3UWOA 4AURA 1FNCA 3FMGA 1X1QA 3LP5A 3Q6IA 2MIIA 1I4WA 4OO3A 5CM8B 3WIOA 1L4EA 2C97A 1ZUHA 3I8OA 4FX2A 5BN4A 4IIYA 4TYPA 1E2DA 3RS4A 3CR8A 1BDIA 3JRXA 1CK4A 4HKTA 1DC8A 5ICCA 2V5UA 2G0NA 3V7NA 3JSXA 4ZJYA 2A7QA 5K0FA 2O19A 1SC9A 3I9OA 4DC1A 4ZDKA 3WWEA 1HFEL 1MQ9A 5CVEA 3CX8A 3SKXA 3DP7A 1OYYA 1ZWKA 1FTSA 5HIIA 2UZ4A 3LQFA 3RR2A 4JYAB 4PF1A 2JAXA 1AB6A 2ZU6A 2XDQA 2E5FA 1II8A 1Y4DE 4ETIA 5BV0A 3JSAA 1AG9A 2XVZA 1TC2A 5L3QA 3T0FA 1NATA 5ALVA 1X1TA 5AVJA 3C5CA 2DJIA 2QUIA 3NAMA 1Q3HA 2TSYB 1KETA 3R24A 4JZYA 4M1TA 5FA8A 3TIFA 4KR6A 3SPXA 3AC0A 1QFJA 3AUSA 4Y6SA 1JQAA 2X42A 5IMBA 4CFSA 1VP9A 2P91A 3JZMA 2ZJ5A 3K0AA 4M88A 4QDZA 2GBCA 3LJKA 4M8NE 3FGPA 3WDKA 5AW8A 1CR4A 2YINC 3T94A 2QIPA 4LCBA 2RH4A 4RTSA 3MXTA 4YA6A 1LGYA 1GPAA 1WAMA 5DCYA 2NSLA 4YACA 1R1DA 5ITSA 1KYIA 5HWSA 4JCCA 1CZNA 1VKNA 4J1TC 1A9PA 1E3DA 4Z1MD 3K70B 4KFCA 2X14A 4OBBA 3KG2A 3UENA 5CB6A 5HRUA 3H5VA 2WQ6A 3FWPA 2B37A 1Z0KA 1EFPB 4B5LA 4XGRA 4H0CA 1YZHA 2Q45A 1UBTS 2E4AA 3G13A 2RGBA 1GVNB 3DNFA 3FNQA 4R0NA 1L5GB 3ZGXA 1HOXA 3DCYA 1HT3A 3S1LA 5J5CA 2AOWA 2NPFA 3CX7A 2VP0A 2H17A 1VPVA 2P7HA 1RI2A 3TW6A 4IG4A 1U0GA 4HNQA 4EGQA 2GD1O 1YJBA 3N0VA 4HYQA 1NOIA 3U9LA 3AFGA 2JGJA 1OBHA 2FMXA 2P9CA 3VTFA 2YY7A 3RH0A 1EUCB 1KO7A 3IR7A 4ND8A 3ZYZA 4F9EA 3VMFA 4DCTA 3FI0A 4BP1A 4K9RA 4KMSA 4JBLA 4J90A 2FY8A 3EASA 1DAGA 4R2WA 1GCAA 5G0TA 2GFIA 2IH4A 2RHLA 4PANA 3RJMA 4ZA2A 1PT7A 1UFQA 1IEVA 2FK7A 4IDCA 4LISA 3ZDQA 5F98A 1XUOA 2OAGA 2W6PA 2NZVG 2WSSD 5A5DA 3OIFA 3RUCA 1VE3A 1J2TA 3DEAA 1QBGA 1YVPA 3B38A 4H31A 1WUJS 5DM70 1I7PA 2GUWA 4BQPA 5GVRA 1UDBA 2CL0X 2QG6A 4BO9A 4HLUC 4WACA 4X6XA 3ZNNA 4P33A 3DCIA 4HB3A 3BEDA 2W6MA 4FBLA 1M6EX 2LIVA 1L7QA 4DUGD 3W78A 1GY8A 3E9MA 3DEJA 5DN9A 2BMVA 4BGDA 4A6DA 4KR7A 4LVCA 3V3KA 2ID9A 1ML4A 2M32A 2H7YA 3KXIA 3ZE8A 2FCRA 1T1RA 1S3SA 3AM1A 5FNVF 2D1TA 2AFRA 2RHTA 2XOEA 4GXNA 1Q22A 2ZRMA 2QX4A 3HR8A 1TEXA 5FHQA 4HDKA 4XIJA 3GBSA 3IHLA 4E2YA 2R1VA 2QTGA 4LWQA 3KLNA 4O29A 1YHZA 5BNIA 5J4HA 1LQUA 4N12A 1RMQA 2C2GA 1Z15A 4AP5A 1H6AA 1E58A 3TM5A 2DUUA 2BDEA 2DKFA 2VSXA 1G66A 4PONA 4QDTA 5E6UB 4DNQA 4N7MA 3EZFA 4GZLA 1N8TA 1SUSA 5DGIA 4ARVA 5DI3A 2Q3EA 4WZAE 2OHJA 2BKAA 2DOKA 1T5BA 2OZKA 3BWXA 3LFHA 4G0QA 5EUCA 5C1PA 4G24A 4ZREA 1I9CA 2EFGA 4JJGA 3RIEA 2H2GA 1GIAA 3GGGA 2PQ0A 2XUIA 3PEYA 1PEKE 4R7ZA 1L8OA 4G8BA 3AI3A 4LE0A 4M8SA 2RGNA 2OLJA 2C58A 3A1DA 4ID9A 4OQPA 3HP4A 4OHUA 4FCVA 1HORA 1NUTA 4C01A 5JC8A 1UBJS 4RIGA 4EJSB 1TZ2A 2CL6X 4X41A 1QQ5A 1YDGA 1GCUA 4DABA 3DLHA 2W00A 3SR4A 2YMPA 1AGXA 2Q3DA 1Y48E 2NZUG 2JZOA 2JIDA 1U0BB 1OXVA 3D4NA 4NYJQ 3JATA 2DUWA 1HZZA 1IOZA 1UBHS 1UJBA 2JJYA 2NLOA 4M87A 5AMXA 3M3DA 4FB5A 3ZVNA 4L3OA 3ZJUA 2AFVA 4L8WB 3FWNA 3RHSA 2WF6A 3A1VA 3HRIA 3L40A 5BOVA 4B7CA 4GC5A 4NQRA 3PTAA 2V8BA 1EG7A 5L3SA 3M2PA 3O2JA 3KOXA 3QNMA 5JVDB 4GMDA 5AI9A 2Q62A 4RPCA 4EJ6A 3D0QA 4FCCA 6YASA 2O7QA 1NW4A 4KMRA 4RCVA 3UQYS 4PSCA 4C0AC 1SKAA 5BV2P 3L46A 1NRJB 2XGOA 1U4OA 3ORYA 2O2DA 3C8UA 4Y0NA 4KE7A 3I0ZA 1C0EA 1B73A 5CJPA 3ZC3A 3NBMA 2GEDA 4AG5A 2ZBEA 5DBHX 3WDLA 5B3LA 1CY4A 1C0KA 1LTKA 2GS9A 1WMFA 1ESMA 2I7DA 2DSNA 3PS9A 3PWSA 3K4PA 3L07A 3M6MD 4TV9F 4TZKA 3VHQA 3WJ2A 2O0KA 2QQEA 4I5DA 3VU0A 4MUNA 2BFCA 3UJ7A 1EK0A 1U1IA 1SUEA 2H1CA 2WBLC 1HNWB 3K0BA 1BMDA 1FBTA 2QSYA 3PNSA 4B3MB 1GUDA 2AQKA 3RRYA 4OGGA 4Y9SA 3SZOA 3KUUA 5JSZB 3W4IA 2R47A 1SXQA 4IZOA 2XMSA 4RA6B 5HTOA 1JYEA 4I4LA 1W88A 2WHRA 2OHGA 2IEDA 1LEHA 3G8DA 5FNVA 2O0MA 1AK1A 4KVFA 3RT1A 2BLLA 3ZHVA 3ICVA 3UK7A 2J0SA 1C8VB 3FLEA 3GZNA 2QENA 2AL7A 5DNAA 2FWNA 3CLUC 4AKIA 1DQZA 2GN9A 1RR6A 3R23A 4MQ5A 1WVIA 5F23A 2IXTA 4IIBA 1XMOB 2WTAA 4B73A 5LD2C 1RKUA 3UAYA 2J0UB 2GYYA 3E5RA 1EFRA 2PKEA 4CIDA 4RJTA 3N6XA 3NFYA 5EA2A 4ZK6A 3OWXA 2H63A 1KS9A 2MSLA 3O91A 4AO6A 1JVSA 3QFRA 4UULA 1VZ2A 2Q50A 2FHPA 3NAGA 2FRDC 1E1NA 1QRAA 2JC3A 5F76A 1RP1A 3PNKA 1UQTA 2LGJA 1E6EA 3MFQA 4LSZA 1LSUA 1DKOA 2B25A 4I5IA 2FE4A 2WYOA 3C5EA 3I8XA 4E0BA 4WT7A 3LSYA 3QK7A 1NURA 1PN3A 2PRIA 3AONB 2IX9A 4B7AA 5HS4A 4X7BA 3WKCA 4KIFA 3M5WA 2QL9A 3NYRA 4KWHA 3QKRA 5KSPA 3GO4A 2JLQA 5JCPA 2IDJA 2B20A 4GLJA 5FTWA 5AR1A 3OE7D 2BFEA 2BFDA 3URMA 2EJUA 1O9BA 1PF7E 4DR7B 2M2IA 1XMXA 2V7BA 3GJSA 4KDFA 4LJ9A 4XEHA 1WX1A 3JYOA 3UNXA 3JWJA 1Q0ZA 4MGHA 3GOQA 2C94A 3Q7TA 4HXYA 3WK9A 1J23A 5JMPA 1W1WA 2JAUA 1NQAO 2OQVA 4YPFA 3B51X 3ZBPA 3ZEIA 3WYAA 4WNCA 4Y6OA 1J0EA 1FCJA 1VKOA 3HCNA 4F97A 1KC1A 5L53A 1IM2A 1P0FA 1AY0A 1MO5A 1XN1A 3W6UA 5B3AA 4PX2A 2AKYA 2W8BB 1FFEA 4FZJA 4N0QA 1A4XA 1FYXA 3HBLA 3EAGA 5EESA 4R1UA 3UFXB 1KEZA 1MQ8B 2H1FA 3BH7A 4F4HA 4F4IA 5KKCA 4FKBA 4CXMA 3OCUA 1J39A 1OI7A 3HPQA 5IM5A 5FADA 1XXHB 2P3OA 3GA0A 4OYHA 2WWHA 1V4NA 2ETXA 2WZDA 3EWIA 4AX8A 5CEEA 3HY4A 3EVBA 1N0HA 3KYCB 2H4HA 3F97A 3I04M 2J45A 3LBHA 3PV0A 5ELXA 2EQ5A 3OC6A 4RJJA 2QN1A 3OA2A 3GR6A 1SUCA 2YZMA 1ZICA 1ZJ6A 1UF9A 3WNVA 2V0CA 3B9BA 2FZWA 1G7SA 1SHKA 1IAVA 3NJ8A 5IX8A 1SULA 1Z25A 3B6EA 5CT8A 5HKKD 1GFIA 3F73A 2OM2A 4DDMA 2DLCX 4B6RA 4Q0MA 4Q9DA 4QE3A 1JR3D 1BHO1 1X7XB 2AK3A 3TAXA 1Z6XA 2WIJA 2OILA 4MCJA 4NBSA 1C9KA 2EP8A 4JA0A 1Y42X 3FFXA 3W2GA 1G41A 5EIOA 4OI1A 1N6RA 3DAHA 4Y2UA 4BQOA 5KX5A 3X44A 1DEXA 1Z12A 3KPVA 3N74A 2QD2A 1TF7A 1O97D 5JDCC 5JI2E 1Q77A 4O4IA 3W90A 2XRFA 2V58A 3EPJA 1X1RA 4QBKA 5KO2A 1X9IA 2W43A 4UFPA 3ZV3A 4LYAA 2FMFA 4XASA 2AOXA 4DLLA 5KNCH 2GTPA 4MQUA 1QO9A 1PJ8A 3T3NA 3EGEA 4CR7A 4KV7A 4OPMA 3H97A 4PQEA 3X1YA 1R7RA 3BH6A 4E3ZA 4V1CA 4JLDA 3CX3A 4LCEA 3UWDA 3DDNA 4K46A 5CDYA 3B7PA 3KSBC 3FMVA 3K8QA 4BV2A 4ZJPA 3O8QA 4X8OA 3RS3A 2ROQA 4E33A 1V4VA 3L41A 1W94A 3ILXA 4DB2A 1PWEA 2Z5LA 3SHOA 2GM9A 2VHZA 2Q8QA 4UBMA 1WMDA 3JD0A 2BFDB 4TLEA 2VZ9A 4DOMA 4R9VA 4MJ3A 5C46F 2FMHA 4I50F 3OZSA 4EB6A 3A1SA 2GARA 1WA5A 5T8KC 4BL5A 1L8LA 1LS1A 4KW7A 4M38A 4ZGWA 3LG2A 1II0A 2XQIA 1E79D 3GA7A 5B6IA 2QTFA 1DJOA 4X92A 3ONVA 3MW8A 1J8VA 1NY6A 4RACA 3PNQA 3V4SA 1OW3B 4ZOLA 2R8EA 4MDEA 4AMYA 5COAA 4CKYA 2CUTA 2DQSA 1R18A 4YXFA 3LX6A 1W35A 1NYRA 3IDSA 5EIBC 2BM8A 4KPUA 3L1IA 3SHWA 1TT5A 2NT4A 1FQOA 3CSUA 1BRMA 1F17A 4U7TB 4I5GA 3UK2A 3F7MA 4RXTA 5CT6A 3RVOA 3AKZA 4TL9A 1DZIA 2GT1A 3GLSA 2I2AA 2ZIAA 1TFUA 3ODPA 4OXXA 4NYIR 1I7SB 1P0PA 4HWTA 1H2ZA 4UEWA 4GZMA 1KGDA 1PR2A 3N0WA 5J1TB 3EUEA 2D74A 2CL7X 2J5BA 2NXCA 4TV8F 2QZ9A 4HP8A 1NUAA 1WZCA 1JG3A 2HRBA 1VMDA 1ZK2A 4K6GA 3ZVRA 2BLNA 2QUJA 3N3AC 4AZ0B 4B8YA 3AVWA 2HHHB 3AEUA 3BWBA 5ALUA 2DSTA 4EVSA 3AHJA 1VJ0A 2ZYSA 1VE5A 2BVNA 4KR3A 2G1KA 4AUEA 4E12A 1KWGA 1G1MA 2NTVA 3EVGA 2NPOA 1R3DA 3FBTA 1I6KA 3E7DA 5A3VA 1LSOA 5JHHB 3WKAA 1CXZA 4GE0A 2WJ4A 5AI4A 1T2UA 1OZHA 4NX2A 3NHFA 4HSGA 4PWYA 3LO8A 3ETEA 4HDSA 3BE5A 2WIAA 2JS7A 2VT6A 4ENUA 4DUGA 2W48A 2C2HA 4L74A 4DJFC 1C7ZA 2WAAA 3NEJA 3DBOB 3RC3A 3UO8B 2FFHA 3VYWA 3AU9A 4CCYB 5A6VA 1IMOA 3V5NA 3ZWBA 4YT8A 3RKRA 3QMWA 1NOJA 3EWNA 1D4ZA 3IRVA 3B3JA 3WRYC 4B3RB 1IBSA 1VL8A 4G01B 3K2BA 4FFDA 1V6CA 2DY1A 2JGKA 4C5BA 3G2PA 3PHJA 1MVOA 3FFTA 5H80A 5EPUA 4EBBA 5BSKA 3P0JA 1MF7A 1JEQB 1YQWA 1BRTA 4J0DA 4CIBA 3S2IA 3R1IA 4I6GA 4CEHA 5F1YA 1ORDA 2IHKA 2QEQA 5C3UA 2XXBA 1CNFA 4P35A 5B53A 4BMPB 1U98A 3MWFA 1KMCA 3QUCA 5DBOA 4M89A 5JXWA 5AICA 3RDPA 1YRQA 4IUDS 3PGVA 1ZIYA 1XXLA 1NA5A 5MFPA 2VHUA 1NUHA 3DO8A 3QKTA 4L4YA 2HPHA 1Y8QB 3H9BA 3BE6A 3M5PA 4I14A 3GYBA 1BX1A 3ENZA 3ZV6A 4OJKA 1FVXA 1U9YA 2GPTA 3OFNA 2A9VA 1QLHA 3OKPA 2DFPA 2OESA 2BGTA 1DX4A 3CE6A 3RK0A 4OB7A 4A16A 1K3TA 1KI8A 4DC9A 4OMCA 5HBGA 3WNBA 1COWA 3V1TC 4IQFA 1RWKA 5EKUA 4U0JA 1PJRA 3RV3A 3V2UA 4NWIA 4KLNA 1Z2DA 4BKMA 1U3TA 5CXUA 3UMMA 3Q8KA 1GSIA 2VQ6A 3K0AB 1KAMA 1B26A 1HURA 1T3TA 3D2CA 2AR0A 2IXDA 3K73O 3OZGA 1VMKA 2C4KA 4YNBA 5D3QA 4D46A 4ZVQA 2GWRA 3LS2A 2B8WA 3ZDZB 5KTYA 4J76A 4P34A 5DNYB 2L18A 4C3OB 4C6RA 1NNSA 4B0PA 4KX3A 4Q34A 3BGOS 3OZWA 2HHLA 3GQVA 4H6PA 4R8SA 1UIMA 4WLFA 4JU9A 4H7JA 4YJ2F 2ATIA 2ST1A 4WXPA 3ROXA 2F17A 5TJ9A 4ZI7A 2P6OA 1QV9A 2WIGA 4Q16A 3ZK7A 4JYZA 2BGMA 4CLRB 4YQEA 3GAZA 1JZQ