4RGBA

Crystal structure of a putative carveol dehydrogenase from mycobacterium avium bound to nad
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
274
structure length
274
Chain Sequence
GSLDGRVVFITGAARGQGRSHAVMCAEQGANIVGVDICEDIDIVPYKLGTYEELEETARLVEKTGQEMLFRKADVRDKAVLQEVFDAGVEQFGHIDTVIANAGVVLTNPDERDASEALRLGLDIMLIGVWNTFQVAIPHMKERGQGGNLIATSSMIALLDLTDGRGGTDAYLTSKLAITGLVRSYALMLAADRIRVNGVAPTNCSTPMITENPALFKVIEENPHLVNAMSTALPDFPMIEPRDVSNAILFLISDAGRSFTGSVLKVDAGMDVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Oxidoreductase
molecule keywords Carveol dehydrogenase
total genus 101
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.1.1.275: (+)-trans-carveol dehydrogenase.
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rgbA00
2JFFA 3ZN2A 4CV2A 1Q7BA 2CDBA 3D64A 4PLPA 4QO7A 2QX7A 1KEWA 4M55A 1L1FA 3QA9A 4HADA 2HMVA 1XCBA 3B1FA 3WS7A 5IAAA 4IDEA 4KUHA 4OQYA 3GNQA 5G0SA 3W4IA 1C1DA 4N5LA 3D0OA 1M66A 1IL0A 3EZYA 3WYCA 4CR6A 3I9OA 5BNFA 3OJ0A 1OBFO 3ZH2A 4B8WA 1VKOA 4BO8A 1P1RA 2GN8A 2O3QA 2YHIA 2YV1A 1R0SA 1ZVMA 4IIUA 3ZWAA 4O6VA 3WJ7A 4AICA 2X23A 3I9MA 1GUZA 3GF4A 4PN3A 3C7CB 5K6AC 3AUTA 2UV8A 4BNJA 4OSOA 1YWGO 2IXBA 4EBFA 4B8ZA 3WGHA 4K1LA 1LBEA 1XEAA 1X14A 1O95A 3NX4A 3K6JA 4EJMA 2QZZA 1V3UA 4RPLA 3JYQA 4JN6B 2HJRA 4EUEA 1W8DA 3LU1A 4IINA 4B3HA 4RCVA 4BGUA 5AQ1A 1U1IA 4J1NA 3TZKA 3FCOA 3UN1A 5A9RA 3QJ5A 4LMRA 4DIOA 4IPTA 2V6BA 4BO5A 2AA3A 3U62A 4IDCA 4XGIA 4A27A 2ZK7A 3KYCA 3OBBA 4LISA 3CXRA 3KSDO 3OMLA 4J0EA 1CETA 4Q9NA 3K31A 1N9GB 3O26A 4MKZA 3PRJA 4BKPA 4DBZA 1E1NA 4YTEA 4B7CA 4KDFA 2I3GA 1PGQA 4BNVA 1NPDA 1YJQA 2RAFA 5C3MA 1UDBA 2VWPA 3ZV5A 4EEZA 3CZRA 4BO4A 5AXDA 3OQ6A 2B0JA 4QO8A 4ESOA 1MUUA 1T24A 3P19A 1SB8A 1P1IA 4CQMA 4HV4A 3ADOA 4IS3A 4RO0A 1ZIDA 5DDIP 2BGKA 3RWBA 5KIAA 2FHSA 4BGEA 5DP1A 3DTTA 3NYWA 2YYYA 2PD6A 1HDZA 1XQ1A 1C0KA 4XX0A 3WGZA 4PLVA 1ISHA 4QEDA 1H2HA 5CP8A 3QWFA 3GZ4A 3HADA 4FC6A 2HK9A 4MVJM 5C7OO 3PVZA 1XKQA 4BNKA 2DC1A 2YHIB 4OH1A 2C59A 3P2YA 2FY8A 3TL3A 5GZ6A 3FD8A 4HFNA 4XD2A 1E77A 4JBGA 3NT5A 5B4TA 1F06A 1E92A 2AEMA 5TJHA 4WASA 4D44A 3AUUA 3ONFA 1G0NA 3AWDA 4YJGA 4UEJA 1LRLA 1HEUA 1QG6A 3QRWA 4CM9D 1NQTA 1A72A 1UP7A 2Y99A 3HDJA 4IJWA 4NK4A 5HA5A 1H2BA 3PI7A 1LQUA 5COAA 2HCTA 2Q2WA 4I8XA 4LMPA 1HKUA 3JQAD 1Y8QB 1B14A 4F3YA 3UH1A 3ULKA 4XGNA 1NVMB 1QYCA 3A4VA 3C8MA 4MINA 1A71A 1ZSYA 4PFJA 2WYWA 3ROMA 2VZ8A 2OXIA 1WZEA 3GNTA 1QYDA 2UDPA 3GUYA 1YOVB 2VRCA 2DVMA 1UJMA 3H9JA 4WNCA 2I6TA 4ZQEA 1ZK1A 3DDNA 1E7YA 4Q3BA 1H94A 1SOVA 5I9MA 5HWSA 1NPYA 1W6UA 1TT5A 3R6DA 3MWDB 1KY4A 4I5FA 4JX8A 4UVHA 4UVGA 1PR3A 3PPIA 3H3FA 3WMXA 5G0TA 4JNKA 4W4TA 4BO2A 2D0IA 4HFRA 1ML3A 4M87A 3HDYA 3VOSA 4PRKA 1BRMA 5BSFA 1PU2A 4E5MA 4NBWA 3KTDA 1HE3A 1I2ZA 3H3JA 1DIRA 1LEHA 3DBVO 3EW7A 2PA3A 3PYLA 1T25A 2PZMA 3DZHA 5JO9A 4PLCA 1F12A 4R4JA 4IJKA 3COSA 1ENPA 1YRLA 2PH3A 3E8XA 5HBRA 3TZHA 1Y8RB 3OECA 3QWBA 1R0LA 4ZA2A 3PGXA 2BMAA 4CUJA 4NMHA 4BO3A 2VWHA 3HQ4O 3HFSA 5BQFA 3D4PA 7MDHA 4OJNA 3NDRA 4OHUA 2BLLA 4IDGA 4DQVA 2AG8A 1LDYA 2Y0EA 4DGSA 4RF5A 1QYXA 1HYGA 4IZHA 3WXBA 3UXYA 2AQKA 4EEXA 4DIBA 1SC6A 3ZU4A 1WDLA 2RCYA 3F3SA 2DQ4A 3BMCA 5EL0A 1EVZA 2Q50A 1JVSA 5JC1A 1R4NB 1BMDA 3H5NA 1HETA 1VKNA 3MEQA 4XQGA 1I3LA 4E5KA 4JXKA 1HZZA 2J3KA 1KERA 3G79A 3OQ1A 4OO3A 3ROPA 4BHTA 2DBQA 2A9FA 1DPGA 4R1TA 4YBZA 1CEQA 3ZHZA 3CMMA 3G49A 4PG8A 4J0FA 3VVBA 5BSEA 1GEEA 4BNIA 2LDBA 2NWQA 4DLAA 3BMNB 1ORRA 2NLOA 3CE6A 4WOJA 4OXKA 2A4KA 1JAYA 3E03A 4WLFA 4CM8A 3KOUA 5A9SB 5CDSA 2Q1WA 1NYTA 2WD7A 3FWZA 3HE3A 1CF2O 3PQEA 1E6EA 1VM6A 3BMNA 3HZZA 5DOZA 2FSVA 3HUDA 5L9AA 4A2CA 3PEFA 2PV7A 4XJSA 3EMKA 4OOEA 4OXYA 2VOEA 4N7RA 3L9XA 4PLFA 2I9PA 3WQSB 3GDGA 1EUCA 1Q1NA 4EYEA 3GPIA 3UVEA 5JNLA 3RFXA 3UGKA 1F14A 1DC4A 3X2EA 2LDXA 3KLPX 3LC1O 1SAYA 3H5AA 1DHRA 1PZEA 3GVCA 5TJ9A 4AJLA 1J49A 4EW6A 1PJTA 3RU7A 1E7RA 5CEEA 2E4AA 4FOSA 2PR2A 3TL2A 2GCGA 1BDMA 2O3UA 5ER6A 3I5MA 1GQQA 5JMWA 5I9LA 5JCJA 3RQSA 1I33A 3JSAA 4S1VA 5TLSA 3M6IA 4BB6A 1LTHR 4GWGA 4O63O 3ZW8A 5I7EA 4KDEA 2DBRA 1K0UA 4WCFB 4CM4A 5JPIA 5CPFA 1SBYA 2P68A 3WLEA 3CSDA 2RBEA 4ZQBA 2IDZA 2V65A 5KWEA 1E3SA 1T1RA 5JCJD 3P7MA 3F4BA 2R2GA 4GMFA 4XYMA 4YB8A 3RD5A 1F8GA 3K73O 2EXXA 2Q1SA 3NEPX 3L6EA 5DCUA 4U6SA 3PDJA 1CYDA 4XR4A 2C7VA 3UAGA 1F17A 4R01A 1TT5B 1PR9A 4NDNE 4WJZA 4XYLA 5K9ZA 3DAFA 4CUZA 3TZQA 2B5VA 3I83A 3K2BA 5DF1A 4FJ2A 4WUVA 1O94A 2YFHA 4NJOA 3ADPA 2Y67A 2VNAA 1Q7CA 2BKAA 1M6WA 1YH3A 1I8TA 1B16A 2E49A 2Q1TA 2XPCA 4J4HA 3C1OA 2V6GA 3EC7A 3GT0A 2PGJA 3IP1A 2GD1O 2OBYA 2GSDA 3DBLB 3NTQA 1B15A 2O7SA 1K6XA 4G5HA 3U4CA 1DXYA 1BW9A 3ZDFA 3TZ6A 2IEBA 5F5NA 3DAPA 1GTMA 5EESA 4CLOB 3F9IA 1E7MA 3FWNA 1DFIA 5K0ZA 2RHCA 1WDKA 4FPXA 1LC0A 1AHIA 1WLYA 3VKVA 1WVGA 2WE7A 1ZJYA 2IYOA 3ASVA 2ZB3A 2C2YA 4AJKA 3VPFA 2VHZA 1NQOA 4CQMD 4R5HA 1IULA 4ZN6A 1MXHA 1U7HA 4CM4B 5JAMA 2I3AA 4CJXA 1RPNA 2X0RA 2NACA 1MX3A 3QVWA 2DAPA 1PS8A 3HG7A 3D4NA 3WICA 1WDMA 4G65A 4GLOA 2HJSA 4RPGA 3MWEB 2GUGA 3WWZA 2P5YA 4KQXA 4UUOA 1Q2XA 1VSUA 3IC5A 2Q3EA 2RHRA 1AN9A 2X0IA 3IKTA 1L7DA 2NQTA 2WJPA 2D5AA 5IF3A 3KHUA 1XU9A 3TOXA 4IDBA 4OKIA 4R68A 3B70A 1XA0A 1S6YA 3R1IA 4QX6A 1H5QA 3JQDA 3KXDA 1JTVA 3P5SA 3KZVA 4W7HA 5IXYA 3O9ZA 1EK6A 4CV3A 3U3XA 4HP8A 5AXAA 4KMSA 5A5FA 1X0VA 2J6IA 3Q11A 1UDAA 1JU9A 4BNZA 1U5CA 2CZCA 3K30A 2PKQO 4O59O 4ALMA 4AJ2A 1DRVA 1Y9EA 2W2KB 3S2FA 2NTNA 3O03A 4NK5A 1J6UA 4OXNA 1ONOA 4L0QA 1K2WA 3WG9A 3TFOA 1DOHA 2Z1MA 3PLRA 4CM8B 4CL8A 4NI5A 3CMCO 4IY1A 3B1JA 4WLNA 3LK7A 2QG4A 3PIDA 3ZNNA 1JLLA 2EEZA 1KVUA 2BH9A 1E3EA 1ZW1A 4O0LA 4NU6A 2E82A 1NWCA 2EJVA 3EHEA 3ETDA 3ZV4A 1Y6JA 4GGOA 4E32A 4AJHA 4IQ8A 2DFVA 4LK3A 1SB9A 1KVSA 2W2LA 1U2GA 1BSVA 4F6LA 5AXCA 3UKOA 4JLWA 4CMEC 4YAKA 2OO5A 5AVOA 3U4DA 3QWIA 3DMYA 3WGGA 2R00C 6LDHA 1UDCA 2GGSA 3DHYA 3QV1A 2DFDA 4FGWA 4R1SA 3VZPA 1HDXA 5U1PA 1WXDA 2Y0DA 1X0XA 3DZBA 1Q0HA 5IG2A 3TFQA 1P0CA 3JQBA 2VYVA 3QW2A 1D3AA 1Y1PA 2J5RA 4GL4A 5KVSA 1JWAB 1R6DA 5ILOA 3L07A 2EKQA 4BO0A 1J4AA 1NBOA 3T7CA 2EGGA 1KIFA 1JVBA 4AL4A 5T6BA 2FPIA 4E12A 2HDHA 1LDBA 5F1PA 2NM0A 1H0KA 2ZQYA 3ANLA 3Q2IA 4I5GA 1PJCA 4PZEA 4BIIA 2WSBA 3HN2A 2PY6A 3K92A 4JP3A 1E0DA 1EEHA 4IBOA 4YAJA 4PG5A 3VHRA 1ISMA 3H5RA 1U7TA 3WYEA 4YT5A 3DFUA 1YL5A 3IIEA 1DB3A 1ZJZA 4L9RA 2A35A 1R37A 3GFGA 3JQFC 4BL5A 5KVVA 4CM1A 3K5PA 1JAXA 2CUKA 1W4ZA 1IB6A 2I67A 2P5UA 2Q2VA 4Z3KA 3QVTA 3RUCA 3WYBA 1RWBA 3LQFA 1U3TA 3OHSX 4NJMB 1ZK3A 1QYVA 3F1LA 2J5KA 5COBA 4ZJUA 2PNFA 2X1HA 1U8XX 3AU8A 4BQRA 1NASA 1E1LA 1FK8A 1ZEJA 3DZIA 5I8WA 1HYEA 3C1AA 3PIIA 1JDJA 2FR1A 1U28A 1UH5A 3ZHBA 2BGLA 3DR3A 1VRWA 4EZBA 2O7QA 5LC1A 4JJGA 2CMDA 1OC2A 1GYPA 4UUNA 5A03A 2RH4A 3GK3A 4WLEA 5IDWA 2CY0A 5GZ3A 4XZ3A 2ZKLA 3WR5A 1ENZA 4M54A 3KLMX 5CG1A 1R4MA 1NX6A 3GLQA 1EBUA 3QWHA 4FDAA 4YQZA 1KS9A 4BNFA 4CR7A 4BNLA 3AOEA 4IUYA 1B8UA 4UREA 1O5IA 5DNAA 4CM6A 4R9SA 5A06A 5CEJA 4MIOA 3PHHA 1HTBA 5B37A 2G0TA 2CVOA 1N8KA 1JW9B 1UXKA 4QTZA 5MDHA 5JS6A 4KWHA 2IE0A 4OKNA 5TT1A 1MFPA 3NDJA 2O2YA 4A73A 1I01A 3AM5A 1H6AA 2CF5A 2EP7A 1LNQA 2X5JO 3CTMA 3JYPA 4B7UA 1LLQA 2W90A 3WWYA 4BGVA 1YDWA 3VH3A 3GN1A 1GADO 3JD2A 3OJLA 4GMGA 4PLWA 2WTBA 1P77A 2AXQA 2UUOA 3F5SA 3F4LA 4I5DA 1XIVA 4PLGA 3RUIA 4BNMA 2GN9A 5CG2A 1TI7A 4W7IA 1O0SA 2GO1A 3K2EA 5C5IA 1GDHA 4E31A 3D3WA 2JJYA 3B6ZA 2DBZA 4FW8A 1SCUA 4GI2A 5G0WA 2GPTA 4JROA 4XEHA 1Y81A 2VRBA 3VPSA 4DBVO 5L7WA 4XIYA 5TRTA 3ZWVA 1IYZA 3DMTC 3RC1A 1PS0A 4ID9A 4HNGA 3C85A 2QZ9A 2OP1A 3NGXA 4AJIA 3D3WB 2YV2A 1PWXA 1P0FA 3AUAA 4CQLB 1DLJA 4J7UA 3O4RA 4CV1A 1XWFA 3O8QA 3DXFA 3W6ZA 4MO2A 1DHTA 5IN5A 5TGDA 1D8AA 1GAEO 2Q4EA 2Q1UA 3CINA 2VCYA 2WE8A 5A9TA 3R0IA 1XR3A 1NQAO 4XQ9A 2VN8A 3D5QA 1LDEA 3Q9NA 2JKVA 5KJEA 1V3TA 1T1SA 4IDFA 1GPDG 3JD4A 3UCXA 5JBIA 4IGEA 5EJ2A 1Z45A 3VPGA 1UXIA 4NU5A 3PQDA 1D7OA 2JCVA 4KUGA 2C20A 2E48A 4A7PA 4B4UA 3AY6A 3KSUA 4Y8VA 1H6DA 4YDRA 4WLUA 1GUYA 1AXEA 1E3IA 2VTDA 1VL0A 1QRRA 1PJSA 3VVCA 2Z1NA 1P1HA 4YJHB 3QSGA 1A4IA 4HXYA 3RVDA 4CMIB 3JCZA 1QXSA 2RH8A 1EBFA 5A02A 1C1XB 3HN7A 2NU8A 3EAGA 3PJFA 3CEAA 2C54A 3AI1A 5AOVA 3BTSA 5T5QA 5DN9A 3DHEA 4L75A 1E1MA 4WEOA 3PHGA 5JXWA 2OUIA 3QVXA 1MV8A 1VL8A 4CMBA 3I9NA 4CUKA 1ZKMA 4DC0A 5BSHA 4KQWA 3FPLA 1SNYA 1EE2A 1HLDA 2UAGA 3ZWBA 3LT1A 4B4WA 4EGFA 1J0XO 1UXGA 4ILKA 4IJVA 1ISFA 1KETA 1NWHA 4CQLA 3NGLA 2CVQA 4JJFA 3VZSA 1DJQA 4YEDA 4BB5A 1V0JA 5EIOA 1Z74A 2BI8A 2NU6A 3FRJA 3EVTA 4PG4A 2J3JA 5A4DA 3BIOA 5TF4A 4ND1A 4CLOA 4BUCA 4FC7A 4NFSA 2HQ1A 2F00A 2A92A 3UHAA 3U0BA 4UVIA 5A3JA 1NHWA 3I6IA 3WNVA 3UICA 2JFGA 3GVIA 2PH5A 1CRWG 2WWRA 2ZYGA 4MVJI 3QWAA 1ADFA 1DIAA 5JDCC 3GGPA 2ZCUA 3ZV3A 3JV7A 3QVOA 4KZPA 3WOHA 1CWUA 2P9CA 1EUDA 4CLDA 1Y7TA 3BMQB 1ZNQO 3V1TC 4RVSA 4WLVA 4RVFA 4CM7A 4CM3A 3HJAA 1MC4A 4U5QA 4CLHA 3ON5A 1KC1A 5IJZA 2HKIA 4E6PA 1T26A 1ARZA 2B4RO 1DLIA 1XU7A 2BD0A 4J3FA 1NVTA 3H2ZA 2IZ0A 3FI9A 2D2IA 4NFHA 1PQWA 2VHXA 4ND2A 1B3BA 4UEOA 4OQZA 2FR8A 1DIBA 1MG5A 5A3VA 4MPDA 2G1UA 2PZJA 4MVJE 1DC5A 1R16A 3AY3A 3FPCA 1ZXLA 4J49A 2OBNA 3INGA 4C7KA 2EIHA 2Q45A 3NTRA 1V3VA 3LLSA 1IHYA 2GZ2A 1CIVA 1GV1A 3WFIA 4XYBA 2NUAA 4C4OA 2X9NA 1UP6A 3OIGA 2QIOA 2Y93A 3BMOA 4LW8A 4CM9A 4YYZA 2GN4A 5TSDA 1A4UA 2OORA 3FR8A 2QHXA 3H2SA 4M8SA 4ALNA 4RJTA 1ZK4A 2YY7A 5B4VA 2ZQZA 3FNFA 3GZNB 2O2SA 3KB6A 4IDDA 1OC4A 4D3FA 4BNHA 3VH1A 2HK8A 5DCYA 3GEMA 3ST7A 1PGNA 2P4QA 2P9EA 4L74A 2WD7B 1IPFA 2PD3A 3RSHA 4NH4A 3S2EA 3PZRA 2CD9A 1MC5A 2PFGA 3PWZA 1E3LA 4NHEA 3M2TA 4IXTA 4CODB 3NRCA 4LVUA 2ZYAA 1KYQA 2W2KA 3S8MA 1MGOA 1YB5A 3I3OA 3AI2A 3MOGA 1PS9A 1RYEA 4RQUA 1HRDA 2X9VA 3DONA 4XQEA 3AU9A 2HRBA 1H93A 1M2WA 1OAAA 4K6CA 1ZFNA 4RPHA 2BFMA 5U4QA 4MVJD 4GVXA 3BTVA 1ZUD1 4L4RA 1C1XA 5KJ1A 2G17A 3GMSA 4U0KA 4OM8A 1PWZA 1EK5A 4FOOA 3E6AA 4Y6RA 4FGSA 2DUUA 3JD1A 5JAIA 3V1YA 2PTGA 1ZSNA 2W8ZA 1T2DA 1T4BA 3ZW9A 2FPGA 4TMFA 1U3VA 4RVGA 1GL3A 4AFNA 1CQIA 1PL6A 5ES3A 1XQ6A 4OSPA 4ALLA 3V8BA 3D5TA 3JQFA 3T4XA 4E2ZA 1PQPA 4DIFA 2SCUA 2HU2A 4DPKA 5HM8A 3O8QB 2C07A 4R3WA 4EI2A 2BHLA 4B3JA 3BTOA 3ETEA 3JQ8A 4ALKA 6ADHA 4HFJA 2GYYA 4FFNA 2BF7A 3LDHA 3OA2A 3I4CA 3M1LA 4Y6SA 2JFHA 3D3EA 4RORA 4PVDA 1DRUA 3ZNOA 3HB4X 2FN7A 3BYZA 3DB2A 4MIYA 1HE2A 3IDSA 3RBVA 3RROA 3INTA 4IJUA 4J4TA 1NFFA 1LXCA 4D42A 4HWKA 5L40A 3DZFA 1ZK2A 2B5WA 3VTFA 1XYGA 2PLAA 3L0DA 3OEWA 1LRJA 2NTJA 7ADHA 4Q3CA 3S2IA 1VSVA 1UXJA 2Q4BA 2Y05A 1VL6A 4W9NC 4RVUA 5JAZA 2O4CA 2ZCVA 3RC7A 3ZU2A 1LU9A 4DLBA 2DT5A 2YJZA 1EDOA 3N7UA 4Q3EA 3PGJA 3S55A 3QLJA 1PJ4A 1X13A 1GZ4A 1WW8A 3RUFA 3X2FA 4M1QA 1KBZA 1Z7BA 2J3IA 3ZHYA 1EVIA 1P9LA 1OOEA 4Y6PA 4BNUA 4BNXA 2VOJA 4EITA 4JCOA 4RGBA 4PG6A 1PEDA 4R1UA 3F46A 3KYDA 2JAPA 1GU7A 1A7AA 3JQEA 3EYWA 1RJWA 1DO8A 3DFZA 3TRIA 4DWVA 3OJEA 5BT9A 1ISJA 1R12A 3JQGB 3CPSA 5ICSA 4Z9XA 3OP4A 1GQYA 4J2OA 3RASA 2VYND 1R4MB 3KEQA 4YAGA 5DT9A 3QVSA 2UVDA 4WE3A 3ONEA 3FSRA 5FYDA 2C0CA 1N1EA 1YB1A 3FBTA 1LDMA 1WZIA 5CDYA 2R00A 4BO9A 4P4GA 3LC7O 1K6IA 2CVZA 1UR5A 1GZ6A 5HS6A 1LLUA 4YPOA 3R3JA 5A04A 1EUZA 5KJCA 2HMSA 4MVJP 1ADBA 4U8GA 1GYRA 5DCWA 2VWQA 4HFMA 3KBOA 2XXJA 4TVBA 1Z75A 2O3RA 5DZSA 1BW9B 4D45A 4BKQA 1NXQA 5L53A 5LDHA 4GWKA 1M67A 3DEYX 4MVJH 4TVOA 1G1AA 4KOAA 4CQMB 1A7KA 2XOXA 4JQCA 1LLCA 2UYYA 2AQIA 1ENYA 4FFPA 4XGKA 5CHEA 1X7HA 4E13A 4BNNA 1DAPA 4RF2A 1I10A 4K9DA 3GGGA 4RPJA 3ZWMA 4E3ZA 3O38A 4XB2A 5T57A 2H5LA 3VKUA 3I4FA 1DIHA 5A5EA 4NBRA 3GOHA 4EJ0A 2YV3A 1C0PA 3RFTA 2QRKA 1H6BA 1NHGA 4YJDA 3A06A 2Z95A 3DZGA 3OEYA 1I3KA 3FNGA 4IM7A 2GNAA 5H82A 1GD1O 5L4NA 1I5RA 4PRLA 4MVJA 3RKRA 4JK3A 4R16A 5C7LO 4FCCA 3IJRA 4R69A 2DBVO 3DO5A 3BMCB 3AOEC 4ZD6A 4YT8A 3WB9A 3IQDB 1FF9A 1I3NA 3EDMA 5DULA 3EZLA 1EFLA 1T2AA 4UAGA 5ENDA 1FDTA 4PCVA 5KNLA 5FI5A 4NZ9A 2CDAA 4DRYA 4RQTA 1HYHA 3GDFA 4H16A 1Z73A 2VWGA 4UVDA 5F21A 4FFOA 1BDBA 5ENVA 4G81A 3FHLA 4N5NA 3ZCXA 2P2SA 1LA2A 4FN4A 3ZWNA 4KTVE 4YJFB 4WEQA 2OFPA 3ZU5A 1P1FA 1UZNA 1K89A 1HSZA 4R9RA 4AJEA 2D5CA 2I66A 4JP2A 3DQPA 1U5AA 1UAGA 1C0LA 3OFSA 3GG9A 4II2A 3ZWYA 1DDOA 2X6TA 3D7LA 2DTXA 2A94A 1LDNA 1G6KA 1O9BA 3RBXA 5TS3A 2W98A 3LSYA 1UZLA 4FJ1A 3ZU3A 1D1SA 4U6QA 1AGNA 1NAHA 1U9JA 4NBUA 4ROSA 1HDCA 5DBFA 4PLYA 4BO7A 1Y5RA 2H6EA 4GX5A 4QFDA 4L4XA 1PSDA 2JHGA 1YL7A 1P44A 3ROQA 4G2NA 4PIVA 3PYMA 3JQBC 4BNTA 2B37A 2QQ5A 2HK7A 4Q3DA 3LF1A 5TT0A 3ANMA 1SZJG 5BR7A 1ZK0A 5EN4A 2AEJA 4TZKA 4FBGA 3DC2A 4Z0PA 1GV0A 3DOCA 4CR8A 1A27A 3BAZA 4PGFA 1YXMA 1P45A 3IS3A 4IQGA 2ZB8A 3I9KA 2IODA 5IDXA 1ULSA 2PGDA 1H6CA 1PL7A 2WYUA 4GGPA 1DAOA 3RBZA 4A26A 2D1YA 1K6JA 4W99A 5DBIA 5T67A 1DFGA 4N54A 4XYEA 1KC3A 1WNTA 3M1AA 1X1EA 2EP5A 1Q0QA 1KVRA 3RUHA 4FIZA 3IUSA 4DQXA 3W4JA 3ZWOA 1CJCA 2H1SA 1LSSA 1AXGA 1Z6ZA 4YAEA 5ITVA 4XJTA 1EQ2A 4XRRA 4FFRA 1LSUA 1LSOA 1GEGA 4LSWA 1NM5A 2DU8A 1ONNA 5JDIA 3F6YA 1BWSA 1ZMOA 4J91A 4QUKA 4EJ6A 3JQGA 4WKGA 4WPGA 4OIMA 1NTOA 2VHVA 5IZ4A 1YVEI 4ZVVA 4FFLA 1B7GO 4GLLA 3GEGA 4RDIA 1IZ0A 1N7GA 5L4LA 2Y68A 4BGIA 1BG6A 3ITKA 3BMQA 3OA0A 1RYDA 1N5DA 4FR5A 1JKFA 2EJWA 5EPOA 4Z6KA 5CEFA 4TRMA 3E48A 3A14A 2IXAA 4CMJA 2I99A 3IP3A 3RU9A 2NNLD 1PGOA 2WMDA 1VE9A 3JYLA 4GX1A 4P4NA 3WGQA 4E0BA 4I9NA 3W8FA 1RM4A 2C5EA 1BTOA 1XSEA 3NUGA 5IDQA 1V9LA 4K28A 1LRKA 1W0CA 4J90A 1YOVA 2YZ7A 1TVEA 4CMGA 3FF4A 3ITDA 3RAJA 3N58A 4ALIA 3RUAA 1T2EA 3AUSA 3BZUA 4ZRNA 2X22A 3C24A 3H9QA 2VT3A 1QORA 4E33A 4MOWA 4F45A 1HE5A 1UUFA 4IMRA 1KVQA 4PZDA 3H65A 3MCVA 3TQHA 5FF9A 4DTIA 1OZAA 1GR0A 4I9HA 5T8KA 2YHUA 2IEDA 2AG5A 1S7CA 3ZNPA 2IZZA 1VI2A 3RJ5A 1PIWA 2ET6A 2EWMA 4IQ0A 4A10A 4AJPA 1EQUA 1PL8A 2PK3A 1WPQA 3MOIA 3PJDA 3GEDA 1VPDA 3F47A 3KVOA 4PG7A 2FR0A 3CIFA 3DL2A 3GUCA 1ZZEA 3Q2KA 4BO6A 2WM3A 3UCFA 4E5PA 1YS4A 2ZIZA 4L76A 4B3IA 4MP3A 1IOLA 1B26A 2OMEA 2D8AA 1CDOA 1KOLA 1GCOA 1L7EA 3PJEA 3VDQA 4AG3A 1N1GA 4YJHA 3T4EA 3VDRA 1I2CA 1PJBA 3SBOA 4CMIA 2OL4A 4Y9DA 5I9NA 4W6ZA 2O23A 2VUUA 2B35A 3CKYA 1MLDA 2X0JA 2X0NA 4LRTB 5IXSA 1P33A 3TWOA 1ADGA 4BKOA 5THQA 5ER9A 2AQHA 4CV0A 4TKMA 4XQCA 1Y9AA 1PJQA 4JIGA 3E9NA 4UUMA 3QHAA 4D79A 1FDWA 1IPEA 5JYEA 4E4YA 2VQ3A 5L7YA 2ZB4A 1HE4A 1QLHA 2O50A 2VT2A 3C3XA 1U2DA 3EVNA 3OSUA 1H9BA 2WD8A 3DBHA 1BXZA 3GRKA 3SLGA 3ZI0A 3TNLA 2ZTUA 5A9SA 4BV8A 2DKNA 1OMOA 4R51A 1WWKA 2H63A 1KEVA 5H81A 1OI7A 3ETGA 4BNWA 1N92A 2NU7A 1X7GA 1VC2A 2PGLA 4GX2A 4H15A 3MJ4A 1VJ0A 1YONA 4TZTA 4Z0HO 3ZWWA 3WIEA 1VLLA 1SEPA 1EDZA 2D59A 2WEKA 3GZNA 3STHA 3ZWPA 3PJGA 4AJ4A 1YL6A 1KEUA 2ILTA 3PFFA 1M75A 1R4NA 5FWNA 1QV6A 1K5HA 5FEUA 1FDVA 5IDYA 2AQ8A 1O89A 3MJTA 4CLXA 4RPKA 3TPCA 4C7JA 2C82A 4WK6A 5H83A 3V2UA 2J8ZA 1J5PA 2HO5A 4R1NA 4J1TA 3UW3A 3WGIA 4O5OA 3I9JA 3W4KA 3GN2A 5IFLA 1ISIA 1E6WA 4BS9A 1QMGA 2HSDA 5T64A 1JQBA 4BMSA 4CPDA 9LDBA 1PZFA 3E5MA 2GRAA 3AM4A 3PHJA 2O48X 4Z0TA 4WECA 3ZGYA 3KETA 2J3HA 4L4SA 2VYVD 1Q7GA 5F1OA 3WIDA 3SEFA 1LI4A 2H9IA 1F8FA 1TB4A 5F3RA 1PZHA 3PHIA 1ONPA 1P3DA 1AE1A 1DC3A 3G1TA 3JD0A 3SXPA 2DPHA 3JTMA 1KY5A 1VJ1A 3ABIA 1GFSA 2PKRA 1IZ9A 1X15A 1E7SA 1B0AA 3KEOA 2AE1A 1YO6A 4CMHA 4LN1A 1RM0A 3EGOA 5T8KC 2Y1FA 3I9LA 1G0OA 1IHXA 2C29D 3KO8A 3NT4A 4D0SA 3OQBA 5HRUA 1PGPA 3AFMA 4LCJA 3MJEA 4RLSA 5I7VA 4MJLA 4YWJA 3QY9A 2YQ5A 4I9UA 1JA9A 1M6HA 2GZ3A 3FR7A 4LGVA 1W73A 4NJMA 4NNJA 5CDUA 3ONDA 1N2SA 3A9WA 3UCEA 2PWZA 3GQVA 3CH6A 5JAQA 5TX7A 3GDOA 2TMDA 3U4HA 3GHYA 2BFAA 1GYQA 1I0ZA 1Y8QA 4E30A 1CQJA 4PLHA 2EGHA 3B20A 1DBVO 1GZ3A 4II3A 3PP8A 4RVDA 3KRTA 4P8RA 2O4UX 4FJ0A 1HLPA 3PK0A 4QQRA 5JYDA 1SOWA 2X5KO 4D46A 4LRSB 1ZMTA 2Q2QA 3AW9A 2W4QA 4Q3NA 2FMUA 3V5NA 3WJAA 3WSWA 1XELA 2BFOA 1ENOA 2PKQP 4MKRA 4YJGB 4A0SA 2W2LD 2Y1CA 3B1KA 5C7IO 4FS3A 3ZV6A 3GNSA 3AOGA 4AJJA 3SX2A 1NFRA 2X5OA 5CFZA 1PGJA 5F5LA 3SVTA 3SC4A 1YKFA 2JD0A 2PD4A 1Z7EA 2PZLA 4CL3A 1VJTA 4XDZA 1HL3A 2QYSA 3Q0EA 2GLXA 4GSKA 3QIVA 4GAEA 1NFQA 3E9QA 1AHHA 2ZB7A 3RC2A 5TQVA 4D41A 4GSLA 4J9VA 1LC3A 4UULA 3MJVA 2Z5LA 3RJ9A 4AVYA 1HSOA 1BHSA 5DOVA 3BA1A 1M76A 3DWFA 3Q1LA 4KTTE 4XIJA 3UFXA 1E3JA 4AJ1A 4PZCA 3OH8A 3WGTA 4BV9A 5KKCA 2B4QA 3ASUA 4EUFA 1SMKA 2IRWA 3BHIA 2JL1A 4FQ8A 1V8BA 1U4OA 2NVWA 3N74A 4J4BA 1CERA 4IMPA 1UP4A 3ORFA 4TRRA 1LJ8A 1PJ3A 3U4IA 4Y67A 2GASA 3K8ZA 1N9GA 1LX6A 3LF2A 2XF8A 3G17A 3H7AA 1GY8A 1BVUA 4W9NA 1C0IA 3OJFA 5I8ZA 2VRCD 2G82A 3K96A 5FFFA 5FI3A 3U49A 5EINA 4IS2A 3RI3A 4R5MA 1YQXA 1NR1A 1ZXBA 4E5NA 3RC9A 2PZKA 4UUPA 4BO1A 5A05A 1HDYA 4IXWA 3GAZA 4B79A 1BGVA 4K6FA 1R0KA 2V7PA 4IDAA 2QW8A 1I30A 2CSUA 2EKPA 2WDZA 2HMUA 2NTVA 4BKRA 3IOYA 5KVQA 1DEHA 2NV6A 4ZGWA 5B12A 5GZ1A 5EQDA 3LT2A 3D1LA 5BNTA 4HY3A 4TQGA 3ZNQA 5CAEA 4Q3AA 4A03A 4J7XA 5GMOA 2FSSA 9LDTA 2R6JA 4J6FA 5L3ZA 3G1UA 2HMTA 2O3JA 2VYNA 2EV9A 1U3UA 1HDOA 4BVAA 2VHYA 3IJPA 1ZCJA 3JQ7B 3PWSA 4J1QA 4URFA 5HS4A 1D1TA 4XDYA 3WX0A 5B1YA 1U4SA 1I3MA 1NVGA 2CF6A 2DLDA 1BXGA 3GHHA 5CPBA 1FJHA 3VC7A 3PTZA 3SJUA 3MTJA 3DOJA 1C1DB 2OGUA 3LVFO 3V2HA 3GG2A 5JSFA 2VUTA 1YDEA 3P2OA 4N5MA 4OL9A 4DXHA 1I36A 3DHNA 2B83A 4XR9A 1HT0A 3ICPA 3U09A 4B7XA 4YRBA 4TWRA 4OOFA 3TF5A 4INAA 2Q99A 1BXGB 4BQPA 1OFGA 2AW5A 3FNHA 1P31A 3KV3O 4OYRA 3KYDB 2QRJA 3Q9UA 4U0JA 4H3VA 3AY7A 3RUEA 3ZZNA 4AJNA 2GN6A 1BXKA 4P38A 4JGBA 2NVBA 3JQAA 3OICA 3E9MA 3DBRB 1RKXA 1NPTO 5J23A 2HAEA 2HRZA 1E3WB 2DUWA 3JYOA 4D7AA 3JQCA 2C2XA 1TA4A 3DBLA 3L4BA 4BMVA 1XGKA 3EUWA 4DYVA 4H7PA 4ZRMA 3CZMA 4WCFC 3DMTA 5DP2A 1SPXA 5KOIA 1E7QA 4WOKA 3HDHA 1EVYA 2JAHA 1P1KA 1HDRA 4RZIA 2BELA 4TROA 3U5TA 2ZTVA 3FN4A 4RF3A 3PXXA 2YDXA 2BRUA 3CUKA 2EF1A 3INRA 5G0UA 3DAGA 1RM5A 3Q3CA 3WQRA 4GKBA 5G4KA 2AE2A 1IY8A 3W8DA 3GMDA 5K6AA 3AFNA 4E5YA 1JWBB 5KKAA 3JYNA 4FSHA 4DUPA 4XCVA 3JQ9C 4F6CA 1HWYA 4MKXA 5CDTA 3U9LA 2CFCA 4ZQFA 3M2PA 2AEFA 3V1UA 4F46A 4WCFA 4R54A 3S2GA 2D4AA 2Q49A 4UVEA 4Z9FA 1T4DA 4YJFA 3WGOA 1IUKA 3ROKA 3ZHXA 2XAAA 4HKTA 3ZWXA 3A28A 4BKUA 5JFOA 1JN0A 5MGBA 1B3RA 1EFKA 3ENKA 3GH3A 1QSGA 3OM9A 4J1SA 1E6UA 3OIDA 4YT4A 1E1KA 1QLJA 1MA0A 1X1TA 1KEPA 3WTCA 2OHXA 2P9GA 1QR6A 1XG5A 2YQ4A 3TJRA 4DC1A 5KVCA 5JO0A 2GERA 3IKVA 3KYBA 3PLNA 4HNHA 4RF4A 5TIIA 3IUPA 1YGYA 1LSJA 2NADA 1IE3A 4GKVA 3GRPA 2FP4A 5EMHA 4OGWA 2X58A 2EHDA 4NIMA 4CM5A 4BOYA 1V35A 2EW8A 2EW2A 2VNSA 2YW9A 2Y1GA 4KUEA 1A9ZA 4GVLA 4ZQGA 3OETA 1I2BA 3GFBA 3LLVA 3NV9A 4WCDA 4CMAA 4ZU3A 4U7WA 1R15A 4KP7A 4DLLA 3BXXA 4ND3A 1JKIA 3HFGA 3WDSA 1DJNA 3H4VA 1NAIA 4NPCA 3VAZA 3NAQA 5TNXA 4M49A 2NVUA 3I23A 4WGGA 5JDCA 2DPGA 1YBAA 5THKA 4WLOA 4DMLA 3PZBA 4ITUA 1O6ZA 4CLRA 5U9CA 2ZJ0A 3V2GA 3QP9A 4QSMA 5JY1A 3WSVA 4XYGA 5L45A 2FRDA 1XLTA 3BHJA 1D4FA 1HF3A 1ZEMA 2JD1A 1EZ4A 4R3NA 1DRWA 2VHWA 3H9GA 3OIFA 5BNIA 5L95A 4M89A 2POQX 1B8VA 3C1TA 3BMOB 4HBGA 3AM3A 4JJIA 1UXHA 3VH2A 1EMDA 4P4LA 4BNYA 2FPPA 3EK2A 3T7EA 4O1MA 3F1KA 2IYPA 1A9YA 2AHRA 3NT2A 3L6DA 1YQDA 2X8LA 4CLEA 3GAFA 2Y1OA 4OAQA 4YRAA 4YRDA 1TT7A 4GX0A 4FD3A 2J5QA 1WAMA 1I32A 3DTYA 4D3DA 3QQPA 4LCEA 4E21A 4J7CA 1Y8RA 3GY0A 1HZJA 2Y1DA 4MP8A 3L4SO 5G2OA 2VZ0A 4D0RA 5DBGA 2G76A 3WMWA 2CNBA 3VZQA 3NJ8A 5JMPA 1GCUA 3NDIA 1H9AA 1P1JA 1ZBQA 3ANNA 4X54A 1KVTA 2NQ8A 2ZJ1A 1QP8A 3A1NA 4RL6A 2Y1EA 2JCXA 2D3TA 3Q6IA 3E18A 3OJOA 4IGFA 1E5QA 3JQ7A 3PWKA 2V6FA 3KM0A 4CMEA 3TDKA 1ZH8A 2VTEA 2IZ1A 4YQYA 5IZCA 3I1JA 4GPD1 3VZRA 3E82A 3L9WA 1HXHA 1GUFA 2DM6A 4MIEA 4OMUA 1K3TA 4YVFA 3WNQA 4JBIA 4DPLA 4NQZA 2YFQA 4TRNA 4MVJF 3WTBA 2ZYDA 2P91A 4J16A 8LDHA 1NQ5A 2VUSA 3HB5X 1X7DA 4LVCA 2JCYA 4ZQHA 3IL2A 4RV9A 4NR0A 1FDUA 4XA8A 3QE3A 3BTUA 1YB4A 3AJRA 2WYVA 4PLTA 4D43A 1QYWA 1WMBA 2XXBA 3ICCA 3GVXA 4KWIA 1TLTA 2X4GA 1B8PA 1EE9A 4I08A 2E37A 3L77A 3HDQA 1HDGO 2FZWA 2F1KA 2Y66A 3KUXA 4R41A 5JCXA 5C37A 1E3WA 3C7DB 3LZ6A 3SJ7A 4YR9A 4RLHA 3TZCA 3W6UA 3UOGA 3E1KA 3JQAB 5G0VA 3RKUA 3TN7A 5F1KA 2C7GA 1LQTA 3AI3A 4QT0A 5LDGA 5ADHA 1MFZA 2HUNA 3DBHB 1WMAA 3SC6A 4CMKA 5G4LA 2AMFA 4L73A 1DC6A 3JQ8B 3R3SA 3PHLA 5L51A 3SLKA 4QFCA 4XWYA 5B4UA 1FDSA 2O3TA 2HMWA 1PJ2A 1MB4A 3PYXA 4XB1A 1EVJA 5KTKA 3UF0A 3GPDG 3LC2O 3DZKA 3IMFA 4YA6A 5JE8A 1T2CA 4HX5A 1LUAA 1U3WA 4MDHA 4A5OA 4NBVA 4W82A 3EY4A 1I24A 3VPHA 5KCZA 3DZJA 5I7SA 1PQUA 1BVRA 2JD2A 2I5PO 4E2WA 2VZ9A 1ADCA 2YUTA 4I5EA 4TKLA 4E2XA 8ADHA 5JW6A 4M86A 4QECA 1GPJA 5JDIC 5IZCC 2BFPA 1FMCA 1XDWA 4D3SA 2ZATA 3JQ9A 5I7FA 2FZEA 2C5AA 3L4BC 1SEVA 5IN4A 3FBGA 2BGMA 2QYTA 1C3VA 1YE3A 4PVCA 1YQGA 5L4SA 3W1VA 4JBHA 1DFHA 3LT0A 4CLRB 1YBVA 2JHFA 5HTOA 4YCAA 3MJSA 3FTNA 1PTJA 5GY7A 3KSZO 2NVUB 4Z9YA 4B4OA 2E6UX 3RUDA 5L7TA 2ZTLA 2GR9A 3H9EO 3RFVA 4RVHA 3GGOA 3H9UA 2OOSA 3G0OA 4TSKA 1ULUA 1TXGA 3NTOA 2EERA 1SO8A 3TOZA 2B36A 3KYCB 1GQ2A 2GF2A 3DOOA 5ILGA 3LT4A 4K26A 1PJLA 1AUPA 1O8CA 1LDGA 2Q46A 4I1IA 2X9GA 2GDZA 4N18A 2UUPA 5ITWA 1RM3A 1QV7A 1ZO8A 5LCXA 2GZ1A 4GQAA 4HUJA 3HNPA 5COQA 2Y0CA 5JY6A 4FB5A 1UAYA 2V6MA 1PZGA 3H6KA 3NKLA 4UEKA 3TSCA 5KJ6A 1YJ8A 4J9UE 4YXFA 2DTDA 3RIHA 4IZIA 4EDFA 2BI7A 1WP4A 2EG9A 5BSGA 2X86A 4NG5A 2P4HX 4Y98A 4ONEA 3BHMA 3FTPA 1V6AA 5EERA 5CDGA 4DMMA 3LYLA 4GH5A 2B69A 3PQFA 4IIVA 4E2YA 4QXMA 3GC6A 4YACA 2O3SA 2I65A 3AK4A 1E7WA 2OP0A 4DPMA 2NSDA 1UZMA 2RIRA 2I76A 2HLPA 3VTZA 3WBBA 3MTGA 2NU9A 2OZPA 3ENNA 1T2FA 4RZHA 3FNEA 3D4OA 1NR7A 5A1TA 4J43A 4DYDA 2B4TO 1Y5MA 4DL9A 2QRLA 3VH4A 1MP0A 5TC4A 4MP6A 3H8VA 4RDHA 4ND4A 3I52A 4L8VA 4DA9A 1R66A 1FXSA 2G5CA 4XRGA 2ZTMA 4AJOA 1DIGA 3MZ0A 4ALJA 4DVJA 3NJ4A 3RCBA 3VPXA 1XHLA 1MG0A 3PDUA 1MXFA 3C7AA 3G3EA 1A5ZA 3HSKA 4DQUA 3F5QA 1ID1A 4NBTA 1YBMA 4YT2A 4ND5A 2EKLA 3GVHA 1F0YA 5G4KB 4FFMA 5KJFA 3L6OO 4J2HA 3JQ6A 2TMGA 4TRJA 3IAHA 1TEHA 3MJCA 2FOIA 4P22A 3W8EA 1ISGA 4NFYA 1C14A 3WFJA 3WQQA 4DREA 4ZHSA 3K9QO 4B4VA 1JKJA 3GA0A 3GR6A 3JD3A 2FWMX 4Q39A 1B2LA 3GVPA 4MVJG 4CMCA 3PFWO 4BMNA 4YAIA 1U8FO 1QKIA 1E5LA 1NP3A 1Q0LA 4LSMA 1ZSVA 3I6QA 4EUHA 4PLZA 3E5RA 1LLDA 1Z82A 3S1LA 2YDYA 2DTEA 1NNUA 3OF2A 4ZICA 3WBFA 4BNGA 3DBRA 1PX0A 1N7HA 3HWRA 4Z3DA 4S3MA 1DSSG 3WGYA 5JLAA 3WLFA 5AYVA 4WNIA 4GBJA 3HHPA 4XKJA 1P74A 5EQFA 2CDCA 5AXBA 3UUWA 5ICMA 5JC8A 3ZWCA 2X7HA
chains in the Genus database with same CATH superfamily
4N0MA 3RTAA 1OLOA 3MF4A 1CUCA 5CNKA 5IUJC 3W5IA 2P9FA 1WSBA 1Q7BA 2QR2A 3F3YA 2OWDA 3KTAB 1TYDE 2NSJA 3IOEA 3HFJA 5DPMA 3W2FA 1XCBA 3WS7A 2B61A 4RK5A 1LI5A 4LF8B 3LV8A 3EDYA 4OQYA 3RIGA 3W4IA 4D9IA 4QHSA 3P96A 2BL4A 1M66A 2VCHA 1SBHA 3WYCA 2CLDX 3V8MA 1YA8A 2CNWA 1XDSA 2WMYA 4BO8A 2KSQA 1ILEA 5GONB 2O3QA 3ADDA 1OZGA 2FEOA 7REQA 4WUTA 2GBLC 2I8CA 3EZXA 3K8YA 3S0JA 1IVNA 3MPOA 3I9MA 3JALA 4IFEA 4PXSA 5BURA 2WM8A 1NJGA 5F2OA 4NICA 2REQB 1IAVA 2KJQA 2C2HA 4FBMA 1QYRA 3WGHA 4K1LA 1JG3A 3K6JA 1N5OX 3RC8A 2P3LA 2WJ4A 3A9CA 2I91A 1GJRA 4RPLA 3JYQA 4M7RA 1L7OA 4EUEA 1VCNA 2N46A 3TJMA 3BRCA 4BCBA 1MV5A 2Z2JA 4PO9A 5GPBA 1OZFA 2W48A 3QKRB 4RCVA 4ZCLA 4FYVA 4JL5A 1YMVA 4LMRA 4W5OA 2AN4A 4BO5A 2AA3A 2GFQA 1DTSA 2JLWA 2ZVDA 1AHNA 3D3NA 4M22A 4XGIA 1VMDA 1IBKB 1FS5A 3EZ9A 3I5YA 3HP4A 4O4HA 1E3MA 4LISA 4BLUA 5LLDA 2C4TA 3OD1A 4TWAA 2IYQA 1CETA 4Q9NA 5ENZA 3EGDB 5CXXA 1K7EB 2EKBA 1N9GB 1QM5A 2HV9A 4MKZA 1OWOA 4DBZA 2X7JA 1G5QA 2JK1A 5M29A 4B7CA 4N7MA 5EJGA 2Z4SA 5HFAA 1PWEA 1PGQA 2OBBA 4GI7A 4M9CA 1P29A 2VWPA 3ZV5A 4WMLA 1FFYA 3AEXA 2JAXA 3D2LA 3K70B 4QO8A 4WX2B 4CVNA 5LIRA 3CZ5A 1K0FA 1SB8A 3I42A 2JGDA 4IS3A 4RO0A 4KHZA 2FW7A 4OHBA 1W52X 4BGEA 2ZAMA 2OCKA 3BK1A 2IA5A 1E6LA 5DNWA 2YYYA 4BEBA 3OEED 5IYZA 4F6RA 5LQCA 2ONCA 3K5WA 2O2EA 3IXQA 1KS2A 2OT3B 2UZ4A 1BDHA 4BQEA 1H2HA 3IURA 3OJXA 4G67A 3GZ4A 3RIXA 1ESNA 5C7OO 4MVJM 5IJ9A 1XKXA 2ZZKA 5EQJB 3PVZA 5KCZA 1ZIYA 3GX1A 3HJNA 4BNKA 2DERA 2JBHA 2P40A 1AS3A 1M1YB 2DC1A 4H35A 3VR5H 7ABPA 4RTRA 2Q8PA 4OH1A 1W36C 2ZR0A 1Y5NA 3TL3A 2UXCB 2H31A 2ZIGA 2G36A 4RULA 2R8RA 2XA1A 1RCFA 3FD8A 4HFNA 2RG7A 2IV3A 2COEA 4PHHA 2LKDA 4WK4B 2PQ2A 3ZTYA 1A9SA 1E77A 3VU3A 1F06A 1E92A 4ZCPA 3IOBA 4WASA 2C8VA 1QB8A 3B7WA 3CZ9A 4UHFA 4MV6A 1XPJA 3ONFA 4D44A 1GRQA 1L8OA 3EVDA 1WSDA 4YJGA 2OTCA 3LQKA 5AVYA 5JH7A 1HR0B 5KAMA 4X8HA 1L4MA 3G85A 4EI9A 3ANYB 4A82A 3E27A 4Q34A 3AP2A 1P81A 1QNLA 1JU4A 2Y99A 4PSAA 1H2BA 3K15A 3CX7A 5EI5A 2Q29A 1O5TA 1A3CA 1IWPB 2Y1XA 3E9DA 4LQLA 1KR2A 1QV9A 1RNLA 4JGGA 1G55A 1YVUA 2CXXA 5DTEA 3JQAD 2G77B 3FNBA 4R8VA 5AM2A 1IZYA 3SBEA 4UPEA 1Y8QB 3UH1A 1CZKA 3B6IA 3DE6X 1YI8A 3A4VA 1QYCA 4MINA 4MHTA 3TJZA 1Y8CA 2HA2A 3FNIA 4XXHA 3WYAA 3I2KA 2M98A 2ECOA 3FUTA 4GOXA 2NGRA 3ROMA 1WZEA 2IW3A 5ELMA 1LVUA 2UDPA 1JA0A 3S2SA 1YOVB 1X92A 4C43A 5C3UA 3JAKB 3TVDA 2JK0A 2DVMA 1MGPA 5EXPA 3FKJA 1DQPA 1XEFA 3OQPA 4OMFG 3ELYA 2CJPA 1ZK1A 3ANSA 4Q3BA 3L4EA 2W6ZA 3KQKA 1M1ZA 1SOVA 4FNGA 5HWSA 3ILHA 4M0PA 4PY2A 4BE9A 3GJ5A 3R6DA 1CB7A 2FUNB 4ZVRA 4UVHA 3HGTA 3EF3A 4M7WA 1JS1X 2DQYA 3FWYA 1TQ2A 4UVGA 1PR3A 1VG0B 5K99A 3VR6H 3Q3EA 4AUMA 5LZ4A 4W4TA 3TTVA 2PTHA 4YJKA 1CS4C 4D3XA 2J48A 3GB9A 4IEIA 2ORWA 4W5HA 4AM8A 1TU4A 1PU2A 3CLRD 3ZDQA 3KTDA 4E5MA 4MHSA 5DNCA 1I2ZA 2QX9A 3SFVA 1LEHA 3DBVO 1JAHA 4A2WA 3ZWKA 1A2OA 3GBSA 2WSYB 5B58C 2CBXA 3Q9LA 2PA3A 4QXRA 4DIEA 4EPTA 2D0DA 1VXOA 3DZHA 5JO9A 3B1WA 1Q20A 4FHZA 4X65B 4IJKA 4YRJA 1ENPA 1R74A 4LQDA 1E1CB 2C3YA 1F8YA 2A0UA 2ECQA 4GUDA 4K6MA 4MUAA 1R88A 3TZHA 1C2TA 1PZNA 1II9A 2BKLA 2GRJA 2NX2A 4FMCF 1R0LA 2QM7A 4N0QA 4ZA2A 4ZYTA 5JMOA 2CNDA 4I1SA 3BULA 4P2GA 4B3SB 4NMHA 2FN3A 5FTKA 1G21B 3I37X 4BBJA 2BUAA 4J0QA 7MDHA 4OJNA 3NDRA 3ZCPA 4RSHA 2XITA 4H77A 2BFEB 3IVAA 4LDJA 3EIEA 3R3XA 4GYWA 3RRJA 4D6XA 2QJFA 2Y0EA 2PKCA 3N0WA 5TXGA 2J0UA 5CBPA 3WXBA 1EGVB 1HYGA 1QYXA 1U4NA 4O3FA 4N8EA 1PQYA 3UXYA 2AQKA 3V4RA 4EEXA 2HH9A 1GLVA 3BMCA 3F4KA 5EL0A 1Z0UA 2JF0A 2Q50A 1TL7C 2O0LA 3H5NA 4DLYA 5A4KA 3MEQA 1TM5E 5E1OA 3SVZA 2J3KA 4OO3A 1TADA 2FWNA 3KDSE 5F3WB 4OBBA 4WKNA 3BXHA 1NW4A 1U0RA 3G8AA 5JU6A 2EFHB 4C1BA 1EEXB 4PQRA 3CMMA 3R6WA 1QF9A 1T5IA 1F4VA 3HGMA 4FT4A 2FKAA 4BNIA 2LDBA 3O4JA 3TOVA 3GAMA 2WZCA 2OHGA 4OXKA 1AGPA 2A4KA 1IBSA 2V7WA 2W0SA 4KQ9A 1PRYA 1SCBA 1Y3AA 2WV7A 2XKAA 4WLFA 1ZAKA 2WF8A 3E7XA 1J0EA 3LCUA 2I0FA 2VUHB 1BQ4A 1DCMA 2IHUA 1SXGA 4YP1A 4F2DA 5CDSA 1XDGA 3FHOA 4K2HA 4RXUA 4X45A 3HE3A 3HZZA 3EH2A 2X1VA 3KDAA 4G0WA 3G8YA 1MIOA 1DOZA 2G08A 1UMBB 3EMKA 3KOMA 4G07A 3LW8A 5JQGA 4ED9A 2O2IA 4B84A 3LBYA 1UFVA 1EKXA 2A9JA 3WQSB 3ZK8A 1RHQA 2QV0A 1E9FA 3ZVLA 4EYEA 5LZ5A 3UVEA 5IEBA 2EZUA 3DM9B 1DO0A 5H3CA 3X2EA 1XTBA 1M7GA 1BRTA 2LDXA 3KLPX 1MD9A 1T9ZA 2P2ZA 2ASVA 1NUQA 1PN3A 1L5LA 3PUWA 2EX1A 3BPSA 1KZHA 4A8JA 3I32A 2F8MA 3K35A 3UGQA 1N4AA 4DCSA 4JAVC 4K86A 1SBCA 1KH2A 4QEKA 1TYEB 1HTTA 2W93A 2NV2B 4HMQA 1REQA 4P7FA 4WKOA 4B32A 1WXHA 4WD3A 5BMVF 3R20A 1C5KA 5ER6A 4Y0VA 5K4GA 2RAVA 3DZ8A 3I5MA 4H1VA 3W34A 5JMWA 3UWPA 1I33A 2R1VB 1EFPB 3M6IA 4BB6A 4O63O 4EKYA 3RK4A 3LHIA 3ZW8A 5I3ZA 2VP9A 2O7NA 4IV5A 1N7IA 3LRXA 1CUDA 5I7EA 2B1JA 4AZ0A 1DAEA 5JPIA 2ZIWB 3WLEA 4Y1RA 1NMYA 3THWB 4PM4A 2O8EB 2I33A 3SYNA 2P9BA 2ZEJA 4TN5A 4ZQBA 1NI4B 4ZVPA 1T1RA 1ZHHA 5E7MA 5JCJD 1CZLA 3MT7A 1QRDA 4GMFA 4XYMA 3RYFA 3V7UA 1J33A 1AA6A 3HB9A 3RD5A 3TQRA 2JDIA 2JZOA 2Q1SA 2OD9A 2DPLA 3FPSA 4AKTA 4C89A 3DQQA 3AYXB 5HFNA 1RRFA 2BC9A 3DZDA 2C7VA 3TLXA 2PMFA 3W5DA 2J30A 4DDUA 1F17A 1Y4DE 5ALWA 3PDCA 3I72A 4KXUA 4Q7LA 1DZIA 2IU4A 4MAAA 2BM1A 2GTPA 3FDFA 4K9PA 1TO6A 3TMKA 3UAWA 3RF7A 1XCPA 4WJZA 3PT9A 3T5CA 3TW4A 3VU1A 1Y82A 2P7HA 1CY0A 3MINA 1V3QE 4Q1CA 4EP1A 6Q21A 3U7HB 4IHJA 2BGNA 4FJ2A 3WLLA 4AN4A 1Y3HA 5AVWA 5AQEA 5EA2A 2VZEA 3VPHA 4UM9B 1ETHA 2IV2X 5CLQA 4LDAA 5B2ZA 2GESA 1YH3A 1AKQA 3I2GA 4M0CA 2HFKA 2E49A 2Q1TA 3PUZA 4RESA 5JPDA 4J4HA 3C16C 2BHTA 2V6GA 3GT0A 2D1FA 3IP1A 3K6RA 3NTQA 2JB9A 1JKMA 4Q12A 4XLLA 1B15A 1DKRA 1K6XA 1N4DA 5CLGA 1DXYA 1BW9A 5FUXA 3ZDFA 2I3BA 1SHKA 5CIYA 4DR6B 4TMYA 3ZS9A 1JZQA 1U9YA 1E7MA 1DFIA 1OT3A 2HNBA 2QG6A 4XCQA 3UG7A 3D3KA 4FPXA 1LC0A 1FNDA 3VKVA 4OLAA 3U3MA 3ISTA 4RK6A 5ECGC 4HJRA 3EFBA 2JLAA 3ET4A 3CHYA 3OEEA 1J21A 1SWWA 1EXDA 3ASVA 1WB9A 3R7AA 3LGXA 1GKUB 4PC1A 4YBRA 3Q8MA 1HLGA 4X9XA 4AJKA 1JJ7A 2R7NA 3KP1A 4ENTA 3SICE 3VR1A 4BATA 1X1QA 2X8BA 2FWRA 3TNDA 5B58T 5I7UA 1RXVA 4R98A 3QVWA 2FTKE 1PS8A 4J0GA 3RTCA 1WUYA 2GPNA 1TQ6A 2FPGB 4GLOA 3FSJX 1CUJA 1Q3HA 3COPA 3IKLA 3ILYA 4ESEA 5JEEA 4G1VA 3SQNA 2PUDA 3GRVA 1IEVA 3WWZA 2LNDA 4HGPA 4N40A 3PF9A 4QYSA 2YVKA 3O3CA 4FFSA 2ZT5A 1J8VA 4X0EA 1QK5A 2RHRA 4C14A 4C4TA 4BBZA 1NVUQ 3MA0A 2E7ZA 3IKTA 4TM7A 3FFTA 4K0RA 4OBEA 3RBAA 2D5AA 4RAOA 4EENA 2VG8A 4KMMA 4LWOA 2OEPA 1COWD 3TOXA 3UK1A 5FX2A 4DJJA 3LY5A 1N8SA 2B20A 4KLRA 5C1BA 1QONA 5CAEB 1NONA 3JQDA 2FEMA 2CXUA 1DKPA 3KQNA 1Z4PX 1SUAA 2W2OA 3CONA 4NHOA 5IXYA 2A5LA 5AM3A 3KKPA 3NHAA 1XA3A 1MVNA 1FQOA 2J6IA 3CC8A 1U5CA 5J4HA 3FI0A 2O8DA 5JFGA 4ALMA 1N77A 4AJ2A 2AGVA 1DRVA 3S2FA 5HFJA 4EA6A 3HCPA 4MH0R 2WILA 1AUXA 1YS6A 2Q6VA 3S40A 1TJYA 4MQUA 3WHLA 4JI2B 1UQTA 1ZN2A 1K2WA 5DLPA 4GI1A 1R6XA 1QHGA 1ZONA 2B34A 4FK8A 4FCVA 1LI7A 2V6IA 2FSHA 2Z1MA 3L7NA 5EGNA 3UEOA 2VIIA 4CL8A 4NYIR 1QGYA 3HV0A 5LJIA 4FHEA 4ARSA 4YJ2A 1TMOA 1TW2A 5LNK6 1CLEA 4I19A 3U44A 1ZOLA 3MJDA 2Z2YA 1W6RA 3HU5A 4XX1A 4JI0B 3C98A 3HBJA 4OHZA 4NAVA 5JXJA 1D1QA 2A9QA 1YC2A 2Y1WA 4RGQA 1ZW1A 1A8HA 2E82A 3EXHA 1EJ2A 3EHEA 1VDMA 3ZV4A 1Y6JA 3FMIA 5EPEA 4EFMA 4LSZA 2PRIA 4B6PA 4E32A 4BRWA 1NI3A 4IQ8A 2DFVA 3M81A 1GCGA 2W2MA 4TMVA 1XCLA 3KKQA 1KVSA 1MTOA 2BEUB 5DHFA 3PNYA 4D4JA 1BSVA 1JT9A 1US8A 3BICA 3UFXB 2HYDA 4EATA 1K3FA 1YBFA 1PNOA 1RAAA 4RGYA 3VDMA 1ISPA 4MCAA 4JLWA 3ZDRA 3A2KA 4MYCA 3AT1A 4FYIA 4EVQA 1ZVVA 2QMQA 3U4DA 3FZYA 1M83A 3BWEA 3PFNA 4DUYB 1LPBB 3Q5EA 5FLKA 3QV1A 3V55A 2BYTA 3N3AC 2QMHA 3VZPA 2FW9A 2TECE 4HAOA 5CYPA 1ZOSA 4GQBA 1J8MF 4QQKA 4EI7A 3RLIA 4XWAA 1Q0HA 2GCNA 2WPNA 1P0CA 3HKDB 2VYVA 1V5IA 2GLUA 3JQBA 3QW2A 3RQIA 1D3AA 4ZALA 1P2VA 4F72A 1PDOA 2PG3A 3REQA 3P0FA 1R3DA 2AWNA 1R6DA 4E51A 5ILOA 4BQSA 1Z06A 3PKZA 3NDPA 4QTUB 3MW8A 2QKYA 2RKOA 4GICA 5KC9A 4O4IA 1J4AA 1G41A 5C2JB 1KIFA 1OWNA 1SQGA 3I3SR 4UUAA 1CZUA 4P3OA 5T6BA 4W7SA 2ZUSA 1JEDA 2Z8XA 3ANLA 5TMEA 4I5GA 1JE0A 2GM5A 5TMPA 1DXHA 4PAMA 1JZTA 3QBVA 1II8A 1F0KA 5KAPA 1NNI1 3EXFB 3KHSA 3BEOA 4S2EA 2A30A 1YR7A 1WTAA 1IK4A 2BVNA 4H6VA 3H5RA 3TZBA 3WYEA 4YT5A 5LA6B 1EVKA 3KL4A 1YL5A 3SZGA 1HM5A 2PYIA 5F9HA 4I55B 4XE5A 5D51S 5DN6A 5KC8A 4AUNA 1OFVA 3GFGA 2O8CA 2WWXA 5KVVA 2ODNA 4WWHA 1ZMRA 1Z8HA 2Y9MB 2CV0A 2EBWA 1FTQA 1QIJA 2C5HA 2HDWA 1ZI6A 2YINC 3OHSX 1U3TA 4PYRA 4B8YA 2GCIA 4NJMB 1FYDA 1MEEA 4DDMA 1XXHB 2CBZA 2J5KA 4LNUA 5KPJA 2PNFA 2X1HA 4CNQA 4D6PA 4UBNA 1E1LA 1ZEJA 4IFIA 1HDIA 1XTQA 3OIWA 3GU3A 4ZK6A 3C1AA 3PEVA 2ZUFA 4RKQA 3CUYA 2FR1A 2RCNA 1U28A 1Y3DE 1UH5A 1NN1A 1K7CA 2PGXA 3A4TA 3QKWA 5DHAA 2P30A 2Q41A 2YX1A 5A3QA 1KIAA 4EZBA 4F2WA 2C7QA 1ZW6A 2JW5A 3QVMA 3HWSA 1VECA 1BA2A 5GAJA 1WV1A 3QVLA 1CUYA 4TLLB 5CT4A 2QTLA 3SDZA 3TKLA 2K6GA 1OC2A 1J97A 2GCOB 5C80A 4TSRA 2PWAA 4W5RA 1GYPA 2ZI9A 3QU5A 4KQJA 3TKYA 4NS1A 2RH4A 3GK3A 1YKSA 5FT9A 4DMGA 5IDWA 2CY0A 2FSUA 4QXQA 2HV8A 2JGRA 5GZ3A 4DEXA 2ZKLA 1H1LB 3G59A 3IO3A 2ZS7A 1R4MA 4KE6A 1JALA 4QUBA 2R8EA 4C2BA 2PS0A 4BNFA 4YQZA 4UM8B 4POOA 3E3OA 3AVXA 3C7KA 4L02A 4O2BF 5FP0A 2AOXA 2XVMA 4ABYA 5AW4A 1ZM3A 2GPWA 3QUBA 4HB3A 2CCKA 3LY7A 1E32A 4E4RA 2ZDHA 1GL6A 5GJVC 1HTBA 1XNQB 5AW8A 3QUAA 2FW0A 4HATA 3H19A 4I4CA 1UOPA 2YXDA 2OCBA 1W4LA 3RYTC 1CRPA 5DYTA 5E9AA 2ROQA 2VAXA 4QU0A 2R7MA 5JS6A 4OKNA 5TT1A 1JEOA 1V8FA 3O94A 4A73A 1EG7A 2G5TA 3AR9A 1AN0A 3I8SA 2CF5A 2EP7A 1GFIA 1Z5PA 1ZJJA 1FSZA 2Q3BA 4B4VA 1RT9A 4KX3A 1I1OA 3CTMA 2X5JO 3DV2A 1DAKA 3ENVA 3W79A 1EP9A 1TM2A 2EFYA 1LLQA 4QGFA 5AW5A 3HJFA 3AVTA 4FWIB 1JHDA 2JI9A 5JCOC 2GETA 2AXQA 3F5SA 2HMYB 3F4LA 5JZVA 1XIVA 2GLTA 5I7OA 2ZRCA 1TI7A 4W7IA 2GO1A 3GFVA 2WJHA 1Q84A 3K0CC 4KSYA 4U2CA 4E31A 1QU3A 2NZWA 3D3WA 3WHKA 5IVPA 1OLUA 2Q2NA 2JJYA 3IEIA 4ZEOA 4YGYA 4BRUA 4F71A 4GLFA 5LA6F 4JT2A 2H07A 1WMEA 2PM8A 4AN0A 3AQ4A 5A3RA 5A3SA 2OGTA 1X3LA 1N2IA 2EC5A 3CF4G 3HMKA 3NBZC 4XIYA 3T7TA 5L7WA 2PSJA 3BERA 4KN9S 1IQ0A 3EXAA 3VA7A 4NMWA 4E11A 1JLKA 4MV1A 2CB9A 3IAS1 5B30A 3DMTC 1M0WA 5DTJA 3RC1A 3OZCA 4R2LA 10MHA 4RD2A 3HM9A 1LNSA 3TQOA 1W59A 4AJIA 1SA0A 2YV2A 4CQLB 4E14A 4HH0A 1DLJA 4N5IX 1W47A 3H4TA 4LBWA 2V7EA 3W6ZA 5HZKA 2M6LA 5T3UA 4IDNA 3FDZB 2Q1UA 2VCYA 1ZWKA 2WE8A 3CZCA 1L5OA 3DEJA 5DMHA 4DQ0A 5JV5A 2HGSA 1JNYA 2M1ZA 3R0IA 1XR3A 4BV3A 4Z4EA 1T36A 5DT2A 4Q6WA 4RNCA 1U8YA 5T6MA 4A23A 1BCRB 1ZHOA 3NWPA 1GPDG 4L4UA 1G291 4K81B 3B5EA 5FO0A 4NV0A 2H1HA 5HF5A 4HRYA 5EJ2A 1P4RA 4MPRA 3RVPA 1M6YA 2G1PA 4FILA 4BY9E 1G98A 3AF1A 2BGJA 3AY6A 3SR3A 2QE7A 1SQFA 1H6DA 1K8YB 1XBTA 4YDRA 4B75A 4UNNA 1W5SA 2VTDA 5M5BA 1WS6A 3VVCA 1QRRA 3IVCA 1YR6A 1P1HA 3UMVA 4HXYA 4KPYA 3OWOA 1QXSA 3MWEA 3NNNA 4JBXA 5EQTA 4AC9A 1ACMA 1MRSA 3HN7A 4BQQA 4IW3B 2F3UA 5B7QA 2XVXA 5UKDA 4UHJA 5KWSA 1GXSA 4UBIA 4QYIA 3CEAA 3AI1A 4ZVKA 3PNKA 3B89A 1DZ3A 4DUGD 3X1DA 5DN9A 3LKDA 3KTOA 2OUIA 1MV8A 5G1NA 3PA6A 1WHSA 1XMIA 2ZP1A 2ZXEA 2MINB 2OZVA 3I9NA 5T4HA 4CUKA 4UJ3A 3FPLA 2UAGA 1EE2A 3AXTA 4B4WA 1TZ2A 3ZZMA 1KSFX 1USWA 4RIIA 1RP7A 3EZ2A 2W2QA 4IJVA 1ISFA 5AKJA 4AS3A 5DW0A 4C9BA 2NSHA 4PQYA 3RU2A 2WJZB 4JJFA 1Q7RA 4KVAA 1WTCA 1TEZA 3IAEA 3C15C 1MQSA 3HP7A 2CLSA 4RELA 5F9MA 4ARZA 1YZLA 2R1TB 4AZSA 4OI4A 2ZBVA 1AGXA 1J39A 2NU6A 3EVTA 1FVXA 4TS1A 4U7JA 1JDPA 2XT9A 4OHFA 3BIOA 3DJYA 4IUDS 5J3JA 1OFUX 1RAGA 5B5SA 1N2HA 2A92A 3JZFA 4PTZA 1CY7A 3UHAA 1C3OA 2ZS9A 1HYBA 1U98A 1CEYA 3IUYA 1VI6A 2XDAA 2WWRA 1CRWG 2F1OA 2WTXA 3GVIA 1KDPA 2ZYGA 3HCEA 4QHTA 2F8TA 2O0JA 2Q3LA 2TMYA 3LT5A 4Q1EA 4UU7A 5HIMA 1ADFA 3AFOA 4K9KA 4XSVA 1ZJWA 2DFNA 4KXVA 2P69A 3WI7A 1OKKD 4MUFA 4TKUA 4MV5A 4G4JA 1KP9A 1P2UA 4QUGA 4V38A 3ZV3A 3JV7A 1OIWA 2AFHA 1MJNA 2P79A 4ZJPA 4RS3A 4EFLA 4NOLA 2BY4A 2HIGA 3EN0A 1M1UA 4BJ1A 3H0CA 4PPNA 2IEGA 4N0DA 4ZJYA 2JHCA 1Z9BA 5B6PA 2GK4A 1S1MA 3CR7A 5JWRA 3V1TC 4WLVA 1C0EA 1I4WA 1G2PA 4CIXA 4DQLA 1NVWQ 5F73A 3WRYC 1TKRA 4CM3A 4CM7A 5K1ZA 3MTDA 5JECA 3HJAA 4G4SO 4QDJA 4U5QA 1FJGB 2DHQA 1ECLA 1ZINA 3EPPA 3VR6D 1TDJA 4DOMA 1DLIA 2BD0A 1FLNA 2GZDA 5HMMA 1P8AA 3M6VA 5CCEA 5FAKA 1XPRA 3PSHA 4Y2YA 3K0CA 2JAUA 3VR3D 1HLFA 3ZQKA 1PQWA 3NV7A 3O47A 2GYWA 1PR2A 2VEOA 2WSIA 2FE4A 1OX6A 4YMIA 4DV4B 2R62A 1XF1A 1MG5A 5FBWB 2OYRA 3UXHA 2NUPA 2XZOA 4P5EA 4I50B 4MPDA 3ZE0B 4B2PA 2FGJA 2OBNA 3RNOA 3SQMA 2EIHA 4MMYB 4MJ3A 3D7KA 4LI3X 4LBZA 2H8KA 1AA9A 1IY2A 1IHYA 4TKVA 2XVYA 1CIVA 3JRNA 4LS3A 4N65A 1RYFA 2IQIA 1XX6A 4XYBA 4DR3B 5EP1A 4YLYA 1NNEA 1KYIA 1RXEA 4TLEA 4I3GA 5AKZA 5J2TA 3TKAA 4CM9A 5F4ZA 2Z30A 4XWOA 1A4UA 2OORA 3QF7A 4M8SA 1OUMA 4ALNA 1VG9B 1QTRA 2V7BA 1N33B 1Y8AA 1W581 3D8SA 3QUSA 5B4VA 3HVUA 4TYNA 2PX5A 2OCGA 2BP7B 3GEIA 3VVLA 2FLVA 2WIDA 3FUXA 3M5CA 4YRKA 2ONJA 2Q3DA 3CLKA 1N0VC 3DXXA 4O08A 2F43B 4MW0A 2D2VA 1UKAA 4B6GA 4XSHA 4ZPJA 2QD2A 3MMSA 3H87A 3P4UA 2IS1A 1OKKA 3R0JA 3PEYA 2JA1A 4NH4A 2DXIA 4WBNB 4CKXA 1AKEA 1YE8A 4H4DA 2CD9A 5KWIA 3G6WA 2PFGA 4GOOD 3M2TA 4J75A 3JVEA 2PZAA 2O8FA 2WUGA 1Z07A 1E2MA 4YMTA 2VL7A 1JSRA 4TV8F 2R1ZA 3KPYA 1Q6YA 1MTZA 1W4BA 2I2BA 2X9VA 3HB0A 3PGLA 3AU9A 1NATA 3LMKA 3KQMA 5IBCA 1G2IA 2JIBA 3L8EA 2HRBA 1G5RA 2P1ZA 3G7SA 1EXNA 1Y4ZA 3H5WA 1E2QA 1AKUA 1EP3B 3Q8LA 4R8RA 3PL5A 4MVJD 4COOA 3HP1A 2WV9A 1NRXA 1ZUD1 1XAJA 3V1NA 1JJAA 3W5AA 2ZI7A 1S9DA 2G17A 4ZTUB 3CSSA 1VSTA 2WVGA 2I6QA 4PZ0A 4DNPA 3ESYA 2D1TA 1EK5A 4FOOA 4XIGS 1WNFA 2JDID 5BW8A 4Y6RA 2DUUA 3RK0A 1QLWA 5LOVA 5LDDC 13PKA 5AM0A 3T9AA 1UL1X 3WLTA 2WBLC 4RVGA 3BXGA 4DW8A 3GW8A 6REQA 4L15A 2Y9PB 1CQIA 2DR0A 5ES3A 1XQ6A 5SV2A 3V8BA 1GILA 1JQJC 3JQFA 2PH1A 3OTOB 4E1VA 3SHOA 1EH5A 4C29A 2SCUA 2IHZA 5C5CA 1YR8A 3IIJA 2XNDA 3VU0A 2WT9A 1O96B 4IXMA 1G21E 2NUTB 3JQ8A 4JGIA 6ADHA 4HFJA 5DHSA 1K08A 4LZZA 4KKXB 3GEEA 2V3WA 3O7MA 1WD5A 4X3OA 1JHVA 1XUOA 2IH2A 4HSEA 5EPUA 4NCJA 4S35A 3D3EA 5HQ3B 2Q4RA 3E7FA 2HBYA 2YHAA 3HVHA 4P3PA 3T0IA 1YQWA 2XW6A 4POAA 3DB2A 2H17A 1WSAA 3INTA 4BLWA 4F7WA 4J4TA 3AVQA 1WKVA 3HLYA 4HWKA 3IRUA 3TLMA 4C06A 3OC6A 3WWEA 4D42A 4TGLA 3ISVA 5L40A 1WUJS 3UQZA 4HQRA 3THRA 3AERA 3ETJA 4YUZA 3R0QA 4BX0A 1VSVA 1JI3A 2XMZA 3JY6A 3QMMA 4A6XA 4PWZA 4GKJB 1VL6A 3O4GA 4ZV9A 3BDVA 2X2FA 3DM5A 5JAZA 1GGKA 5CD1A 1NMQA 3QU4A 4JOQA 3G9QA 1NC1A 5LYJF 1F4LA 4Q3EA 2FUKA 1U6KA 3BQNB 3S55A 4BBAA 2NMVA 1PJ4A 2P27A 2ZYIA 5CXUA 1CQPA 3KAPA 1AD2A 1Z7BA 4DSZA 5D6NA 1ZYUA 4GLJA 4Y6PA 4BNXA 2SBTA 2VOJA 4BMZA 4FDMA 2H9YA 5J63A 1RMQA 1FSSA 3DVSX 1EA5A 1PEDA 1YV9A 4R1UA 4YLGA 1ZGCA 1YFKA 3FDXA 3GGSA 4BZZA 4QM7A 3GCZA 2B1RA 1DIOB 5D3MB 2EKDA 3EYWA 4AKHA 1DO8A 5GJBA 1CY1A 1CDZA 4GXRA 2CXRA 2Z8YM 4PE5B 2QVXX 3B48A 1ISJA 1JT2A 1R12A 4B3GA 2VAWA 1CIJA 3JVDA 3BIFA 3KPUA 5ICSA 1P9WA 1Z15A 4KV7A 3ZE2B 1QFXA 3P9RA 4J2OA 2ZOSA 3RASA 4LIPD 5K8LA 1R4MB 4UEWA 4HN9A 4P1ZA 3QPWA 3TZEA 4FKZA 3QVSA 5EEGA 3TMYA 2YWBA 4Q18A 4QOEA 3PB3A 3SC3A 3WLNA 1UDWA 1XYVA 2C0CA 2P5SA 4WZBE 3HY6A 1JG7A 3WMFA 1QFSA 1M8JA 2P1RA 2YBEA 1EAMA 1WZIA 4MAFA 3LC7O 4WBXC 5C8XA 4RTKA 2BHSA 3H97A 1XJ0A 2VF8A 2DEUA 3UWKA 4FMDB 5JSQA 4G63A 3OQOA 3PJRA 2NVOA 3VSDA 5ARDA 5EAIA 1F3OA 1HQKA 3O83A 5ALTA 1EUZA 3IVRA 1YOBA 2HMSA 4GOJA 4JVLA 4RJIA 4Y9TA 3FYCA 1BJTA 5DCWA 3ZLTA 2QQFA 4CTMA 2ANBA 2P2DA 4JFRA 2FPMA 3AP1A 2C42A 1A1SA 4IV0A 4YP6A 1RCTE 3VPDA 4CQMB 3PDIA 2Z4RA 3HK2A 3A3OA 5A4AA 4JQCA 1E61A 1UIMA 3I2FA 1KRHA 2I6GA 1BN6A 1Q83A 2FCRA 1X7HA 4E13A 1N36B 2PYDA 1UFKA 1Z0DA 2AH5A 2CHGA 2ZFUA 3HKBA 3X44A 2OO5C 4QL3A 2PXCA 2Z8ZA 2ZIAA 1CJUC 4G5GA 1E6CA 4E3ZA 1E2KA 4ND7A 3O82A 1Z13A 1IBCA 2XDWA 2PJDA 2VP6A 4GPBA 5D3KA 2BGWA 4P80A 2WINI 1SCIA 4EJ0A 1NURA 1M7BA 3OLCX 1JIUA 3IERA 1OXKB 4EFKA 3R3YA 3ZVMA 3DHWC 2Y77A 2GNAA 1GD1O 3ACDA 1VL1A 2Q27A 1GPH1 2FP4B 1SK8A 3I1YA 1SU8A 4HQNA 2KHZA 2OV4A 2XI4A 1ZM9A 3LHDA 4UTZA 3R8CA 3DUWA 1BE0A 5C7LO 3CLUC 4R69A 1EJ6A 5FWXA 5I9BA 4F4HA 3ZDDA 4ARIA 2RI0A 3DO5A 5A0VA 3REQB 4L22A 4RDXA 3WB9A 2QW0X 3SSAA 1KWGA 3A6EA 3EDMA 1WMDA 4JKYA 4BX9A 1KI2A 1VIYA 4PCVA 1IDOA 2H7YA 3O2QB 4JU9A 1P4AA 3VYTB 2REXB 4HNRA 4FOLA 4TTAA 4W9RA 1KYXA 2HQOA 3LNTA 5CB6A 4YHHB 4MK4A 5I9TA 1E0AA 2G7ZA 3OE7A 4UVDA 3T0FA 3VO2A 1QDUA 4QNNA 4EG1A 5JSZA 4B4DA 3L0PA 3SIWA 2FWBA 3CF4A 2QJTA 2I29A 3Q98A 4FN4A 1HNXB 4ZHQB 4YJFB 3A9VA 5CJJA 1RYYA 4HLCA 4RL4A 5E8RA 1LBIA 2HU7A 4AJEA 5JQWA 3QVUA 4JP2A 1MX5A 3DQPA 3QEJA 1TFRA 2QUBA 4IKPA 1TGYA 1UT8A 1C0LA 4PIMA 4R2IA 4MWEA 4Q4HA 4S2UA 4II2A 1HX7A 5FWXB 3D7LA 2WB4A 1LDNA 3P94A 1O9BA 3C6QA 1S01A 3LSYA 1UZLA 3IVXA 3WL3A 3I39X 1AGNA 4QLOA 3WY9A 5IWAB 1LJLA 4ZEWA 1IM5A 1JHOA 4HT3B 5DBFA 5C8DA 5IDVA 1QR2A 3HCRA 4TVSA 2H6EA 5D1HA 3IDFA 1F2VA 4YJ2B 3I2YX 1PSDA 1S96A 3NBXX 1YR2A 1WIWA 4KBGA 1YQUA 2A9PA 4G2NA 4TMXA 4BNTA 1QP4A 1J25A 2B37A 1LK0A 3L1HA 3OM1A 2J32A 4UKDA 1K63A 2EQBA 5TT0A 1OREA 2WUVA 3ANMA 4G9GA 2R7AA 1ZK0A 4GWLA 5EN4A 2AEJA 4OI0A 3PCTA 4NG4A 2QQGA 4FBGA 1XZBA 3Q7QA 4YECA 1NULA 4HDOB 1TQ4A 3H2JA 5KOJB 1U9IC 4ZYYA 5I5GA 1XWWA 3C14C 4CR8A 4QDZA 1KAMA 1XTKA 2Q8QA 2VJMA 4KRYA 1KFEB 2Q8NA 1WUHS 4RMIA 5E6RA 1KAOA 3KQQA 1T0BA 4FCTA 2IODA 3KS9A 1ULSA 2ZCJA 4KVZA 4AKEA 4FFWA 3U4QB 1PL7A 4A26A 5M3BA 1DAOA 2PSSA 1ESDA 1QG2A 2D1YA 1V4NA 2ESRA 3UK2A 5DWQA 2JHAA 3VC3A 5DBIA 4CEJA 1DFGA 2JRCA 1FW6A 2IGTA 2O0HA 5JS8A 3O4FA 4XYEA 4PAGA 1ZWLA 3BUSA 2GAJA 1QOQB 3G7UA 5ICFA 3A2LA 5ITZA 5K8IA 3M1AA 3SJBA 1X1EA 2WW8A 2WJAA 1PD0A 4PO8A 3C5VA 1KYZA 5CLJA 1COWA 1KVRA 4ASUA 4FIZA 2PGAA 4DQXA 4RYLA 4NZNA 4EL0A 5B7GA 2R8ZA 1BCSA 2H1SA 3K0KA 1LSSA 1AXGA 4F12A 3T12A 4YAEA 1XZMA 2CHUA 2J9YB 4XJTA 4JC4A 2AMVA 2DKFA 4RKRA 1LSUA 1LSOA 3UENA 2H5JA 4LSWA 4IHQA 1HUQA 2DU8A 4CKCA 2F4VB 4BTEA 3EPHA 5CCBA 3S5JA 3D3QA 3O9MA 3HCAA 1ZMOA 4EJ6A 1G6OA 1JXQA 1JLHA 5EZ6B 4WKGA 2RGUA 3WLJA 4YQFA 2GCPA 1M2VA 4OIMA 1NTOA 4P7JA 2OXRA 5CB0A 5IZ4A 3PC8A 3M4YA 1JXMA 3GEGA 4EO7A 3DWIA 1J0DA 1T1IA 4YP7A 4TS4A 1SELA 3BEDA 1NMSA 5H68A 3UJ3X 2BI4A 4GNKA 1A88A 2CVHA 5ECDA 5JIBA 1RRCA 2C03A 3VZDA 3BMQA 1RYDA 3ICVA 2VQ6A 2I03A 4EUKA 3QTLA 1JKFA 3K1AA 3L7YA 4KXMA 2K7ZA 3AB7A 2Z57A 1LX7A 2P5TB 4BP1A 2IXAA 4JLUA 3IP3A 3L6UA 1D4AA 4CMJA 4EMTA 5F2KA 4C6RA 5AVSA 3IILA 2QIPA 4U8HA 1F6WA 4ODIA 5C1IA 2C5EA 4GP6A 4LJLA 5J40A 1AQLA 4H60A 4ITVA 1ZISA 3G2QA 2YZ7A 1TVEA 3B6JA 4LY3A 1ABEA 5FL3A 4CCAA 3FF4A 1M34A 1E0KA 3NP7A 1J00A 5L3QA 3QE4A 2Q5LA 4G2TA 3SE0A 5D5QA 3RUAA 2GXQA 4KQIA 3NBAA 4UAUA 3RNLA 4DM7A 1RABA 5KNDA 1M0EA 4G5RA 1TCVA 4JYZA 2DUJA 2GBCA 2X22A 4K8RB 3QTTA 3KPJA 2HPZA 2XDQA 4E33A 5I6DA 1OE0A 5FOVA 4F45A 1HE5A 3EDRA 2BFDB 5AO9A 3EEOA 1EDBA 2RHTA 1QQ6A 3VQTA 1Y1TA 4GBED 4JLDA 3AXSA 3MCVA 2WUWE 3TQHA 5BUQA 4WN3A 4AIIA 1GR0A 2YHUA 1X8JA 2AG5A 3ZZTA 4D0GA 1N1MA 2FXVA 3PBKA 3K7EA 1VI2A 2AF4C 2OORC 3R24A 2ECKA 3RJ5A 4Q7QA 5B3LA 2AD5A 5REQB 4FHGA 4IQ0A 4KO2S 5JYCA 2FOLA 2PO7A 3O93A 1WPQA 1ZNXA 2WOOA 3PJDA 3GEDA 1VPDA 4IDQA 4PG7A 4QAJA 2YV4A 5EIBC 5TEVA 4EPVA 4Z8YA 3EWAA 1HNZB 2FGKA 3W3AD 1M2EA 1WO8A 3FFWA 3UBTA 1XAGA 3UCFA 3ZHOA 2W00A 2ZIZA 1IN1A 3M7IA 4ZAFA 1UKCA 1OQAA 4B3IA 1EFPA 5JI2E 1GGFA 1TFUA 1CDOA 3EIUA 1W7AA 2CKDA 3U31A 1Z0IA 1P39A 4WV3A 3TIVA 3VDQA 3QJYA 5HCIA 1J1UA 4YJHA 3EC1A 2XQJA 1QGDA 3GZJA 3D1VA 3SBOA 4R40A 4LTNA 4Y9DA 4WDQA 4WBNF 1QBGA 4W6ZA 2O23A 5H7XA 4GECA 1KAGA 4JR1A 4MROA 4BWVA 4BX2A 3CVYA 1NG9A 5FUQA 2G6BA 3CKYA 3O1LA 2DQZA 4A8JB 1TUBA 3TUIC 5IXSA 3S8YA 1WHTA 4ZWNA 3L0SA 5ER9A 3RO7A 3ZGLA 3N2EA 4BEVA 1JP7A 3JR7A 2L42A 3T7DA 4XQCA 3BK7A 4XFDA 2EFGA 3QSYA 2O54A 1KFJB 4X63A 5FHQA 3EFHA 1P18A 4X6XA 3HSSA 3B9RA 1VMEA 4C7OB 4XD7D 4D79A 3NR2A 2QTVA 3V34A 3ZBUA 1II0A 2XUOA 1TC2A 3CKLA 1FOEB 3IO5A 4GM1A 4L0CA 4YYEA 5D5HA 3WVNA 4UMDA 2ZB4A 5C8VA 3C3XA 1DX6A 1U2DA 3C3CA 1GPKA 4QKQA 3AESB 3AV3A 1JNXX 3OSUA 4GO1A 5HQJA 3LY9A 2QMEA 3SLGA 1YQTA 2J3D