4RGNA

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
236
structure length
214
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 58
structure length 214
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgnA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgnA01
1AN8A 3DWAA 1KLUD 4L63B 4RGMA 1BXTA 1MD2D 3BVMA 1ESFA 3OWEB 1YN5A 1SJHD 1I4RA 3BZDB 1KTKA 3EFXD 1LTGD 1EU4A 1UNSA 1EWCA 1EEID 1D5ZC 2TSSA 1B44D 3SEBA 1YN4A 2O2LD 2RDHA 3URYA 1RDPD 1LTSD 4DXGA 1DJRD 2J4XA 1PZID 1FGBD 2IPKD 1YN3A 2ICIA 2XRSD 5ELBA 1G8ZD 1FD7D 2G9HD 4BWGB 1JWUD 3V05A 1LTRD 4RGOS 1PTOF 2XRQD 1TS4A 2IJ0A 3W2DA 3MC0B 1LT3D 2CHBD 1XXGA 1QILA 1JWMD 1TY2A 5I4DA 1LTAD 3DWQA 2SEBD 1M4VA 1LO5D 2AQ1B 4Z9CB 1SXTA 3BYYB 5ELFA 1BCPD 1FNUA 1B1ZA 1LTBD 4UDUC 1FNWA 5ELDA 1PZJD 1PTOC 5FK9C 3KLSX 2AQ2B 1SEBD 1V1OA 2QILA 1I4HA 1PYWD 1CQVA 1ET9A 4ZYSA 1D5XC 1EFID 1I4QA 1PTOH 1STEA 5D3DA 1BCPC 1LTTD 3BYTB 4L6TB 5ELEA 2RDGA 3TSSA 4DXFA 1S5ED 3CHBD 1CT1D 3O13A 3R8BA 4RHSA 2XN9C 2NTSA 2XNAC 1V1PA 4RGNA 2R61A 1I4PA 2QEJC 1SBBB 5D3IB 4C56C 1PRTB 1BCPF 1I4GA 1JWSD 3R2IA 5TSSA 1RF2D 1S5FD 1S5CD 1S5DD 1TY0A 1RCVD 4O1NA 4RHRA 1PRTC 1EU3A 1PZKD 1GOZA 1FNVA 1JQYD 3DWPA 3MFGA 2AQ3B 1AW7A 2WV6D 1TS2A 1TS5A 1SJED 1T5XD 2NTTA 5FKAC 1CK1A 1F77A 1LT6D 1LTID 1LT4D 1KLGD 1PRTF 1I4XA 4RCOA 4RGTA 4TSSA 4RH6A 1SE3A 1EEFD 1PTOD 1JR0D 1L0YB 1PTOB 1ET6A 1ENFA 1V1PB 4NZLB 1CHPD 1UUPA 1JCKB 1HQRD 1L0XB 4OHJA 1SE4A 3BVGA 2Z8LA 3EA6A 5ELCA 1D6EC 1SE2A 1HA5A 1S5BD 3BVZA 3R2TA 1CHQD 4RFBA 1LT5D 1XTCD 1LLRD 1PRTD 1RD9D 1D5MC 1BCPB 1TS3A 3GP7A 4K6LA 1HTLD 1DYQA 1HXYD
chains in the Genus database with same CATH superfamily
5C5LA 4YCUA 5T1IA 2KJ6A 1WJUA 3C2PA 2CS4A 3AE5B 2B8FA 3S2HH 1BXTA 2RKSA 1CTMA 1HZBA 1I4RA 5NUCA 2WX0A 5C4XG 1LTGD 2O5IC 2NVYH 2LY7A 2HTHA 5DPSA 2ZJPA 1CSQA 3HGBA 3PO0A 3L08A 2MJDA 4PS7A 3CCUA 2Y0SB 2F0WA 2JP1A 5HGTA 1C78A 1L4DB 1FGBD 3HOWG 1NENB 4B0MA 3NS1A 3W1GA 1T6BX 4GDKA 5KHOA 1JT8A 4JWUC 1JRPA 1SIJA 1DOLA 4BWGB 3TP5A 1SYBA 2LGIA 4URKA 4XDDA 3VTWA 2UUAL 5DPWA 4ZOHC 1F9SA 3TEHB 3J80c 1JICA 1UH6A 3GTPH 3MXGA 1D1KA 1C4CA 2BF8B 3DWQA 1HNZQ 4BZAA 5LMNQ 2F0GA 3SR1A 3GV3A 4K5XA 5ELFA 1FYCA 3NY5A 4FN2A 5HKHA 3PZ7A 3MC8A 3NPPA 5C4XH 1HNXL 3I57A 3S1QB 1O7YA 2HTME 3MEFA 3EECA 1SB3C 4MNOA 3CC4A 3HK0A 5LL6S 3N6RA 2DY7A 4S3SA 2VQEQ 5D6JB 4B3MQ 2X69A 4K7UA 1YJJA 1V80A 2A69C 4X3TA 3ML9A 4MN3A 3DHIC 1SSNA 2F0PA 5H8YE 3QIAA 4KVGB 4A3KG 1YQ3B 3VYTA 4HDQA 2LI5A 3EROA 4TQUS 4ZRKA 3VH3B 5M5YB 2L11A 3RZOH 1D8LA 2VS1A 2LHEA 2M2LA 4DKAC 4DV7Q 3H6NA 2WAQE 1MG4A 1JQYD 2AUJD 4UP7A 1JJCB 3U4ZA 1GD7A 4GDKB 3FILA 1UE1A 1EFWA 2WKCA 4LFBQ 2BE5D 5FKAC 5JHAA 2JE6I 1N33Q 2IO0B 3ZJTA 4A3JG 2DNFA 2WXHA 2KTRA 3J80L 1KJTA 2KYWA 4BY1B 1Y8OB 1YI2A 3I4NH 1KD1C 5IAAC 3V6CB 1IBMQ 2UWQA 1WGHA 3ZYYX 3PPAA 3T1YL 1V1PB 2ES2A 4U68A 3I4MB 3ZNID 4P16A 4JI7Q 3BK1A 2BB6A 2YTXA 2R7ZG 3CCJA 2WDQB 3N30A 3MA2B 4FVMA 5L83A 3A54A 1NAPA 4R4OA 5HY6A 4A3EG 3BINA 2L00B 3E9SA 1UBIA 3S2HB 4RFBA 1CZWA 1K53A 4IOIE 2JJQA 5C23A 5C44B 3D4WA 3VXWA 2NCNA 2B2WA 2B2UA 2WB1E 4TQ0A 4KKJA 3M4QA 3P42A 4GOCA 3T1YQ 2MBQA 1J6QA 1MFWA 3AM9A 3HKZG 5LXIB 1OXUA 2K0PA 2OQ0A 1G6ZA 3JSVB 5KYIA 2OEDA 2KDMA 3J80E 1IBXA 1SJHD 5ELNA 2LRUA 3EFXD 2ZXPA 1VMPA 1SR3A 2CW0D 1RKNA 3ULJA 3K0XA 2Z0SA 1TBEA 4J6HA 2XEWA 4B08A 2FMMA 4DXGA 4KY7A 3M7GA 4ZDVA 4X3SA 4IWPA 4DQOC 3DVNU 5IT9L 4DV7L 5I6YA 2A6HC 1RWSA 1G8ZD 3ONSA 1BT0A 5BMIA 3A9JB 1KM7A 2A6EC 3V05A 1QOGA 2QDBA 3TDQA 4ICUA 1VMCA 2A6HD 3DPDA 4BBRH 3STBD 3P7JA 1WGRA 4JOIC 1WE7A 1MBYA 3U2SC 2HHHQ 4N59A 2V3NA 4L8JA 4EFOA 4B3ML 2VQEL 3GTJH 5ELDA 2UYZB 4NAWB 1BBWA 1EUVB 1IHZA 2B2TC 2W54A 2A8VA 3VUWA 1D5XC 1E2VA 4EQNA 5I2XA 1IXRA 5M5YH 2L32A 4N8FA 1YNXA 3F2BA 1FXAA 4DXFA 5C2TB 3CU7A 1ASYA 3H7PA 1CT1D 1CKOA 3FVQA 4V0BA 4FBJB 2K32A 1VRAB 4NNJB 3CWIA 2BTEA 4TKNA 4RGNA 1N32Q 4A3IG 2UUAQ 5D3IB 2KAJA 1V1QA 1Y1VG 3Q3NC 3K8AA 1D7QA 1WMHB 5AJ3Q 1G51A 4WJ4A 4DFAA 3M85A 4NXML 1U5KA 1E8XA 5C0XI 1YD8U 2X6GA 1IW7D 1ILQA 2A74C 1PZKD 1RJTA 5EPJA 4BY1H 1N63A 1PGBA 1QOFA 4WWMA 1IKLA 5IT9c 3GTLB 3P4QB 1ICFB 2N78A 2ZVNA 3S1NB 1CI3M 5T1GA 5IWAL 1KOTA 1VF7A 1SIFA 2ZJDA 4LJPB 4BS9A 4JI6L 1LT6D 2EMSA 2KDIA 5M5WH 3RUZA 5IYCH 3VDYA 2V9HA 3A9KB 3J7A5 2MO1A 4WQMA 3LB8C 1LM0A 5HGQA 4FNFA 1EYCA 5J39A 3Q8CA 2LUMA 5D7GA 2Z9HA 1VQEA 3NJTA 1UWXA 4MJSA 2IHFA 1XNQL 2XWJB 1YJWA 3KVFB 1STHA 5C44H 5JXVA 2LKVA 2G5DA 3L9AX 1HHVA 1LV9A 3JC66 4QQBX 1P7EA 4A6QA 2MP1A 2W82A 1QT9A 1XWEA 2CH4A 1XPRA 4YSXB 1SFOH 4MM3B 3RYTA 2HIVA 2KLGA 4IUTA 3T3OA 4F87A 4BVUC 4JI6Q 2PCFB 5KIXA 4DK6C 3NQIA 4DAYB 1BKBA 1N8RC 2ACZB 5C3EG 5D2MB 5I2YA 1ZEQX 4X66Q 2QKIC 3A1QB 1HH2P 4B6WA 1Z5SB 2LXKA 2ONQA 3CQZH 1IBXB 5E1FA 3RFZB 3G6JB 1CMXB 4OEMB 4P6VF 4AYBB 1LTLA 1Q90A 1NEKB 4WH4A 3KUZA 1HFNA 4UP9A 3HOUB 3ZW3A 4W9KA 1XPOA 1TIFA 5CORA 2R6GA 3HFZB 5IKCM 4L5TA 1TU2B 3K5OA 1V43A 3H3VH 1YN4A 4JI5L 2AWTA 4LDTB 2Z6KC 3GV6A 4FXKC 2KDFB 1K3RA 4XDCA 4BBSB 2F0HA 2GOWA 3BWUD 3SFDB 3GB1A 3PO3B 3SK5A 2G9HD 4GN5A 1K73C 1BF4A 5BMHA 4HCNB 1C4QA 2VB3X 4IM0A 2IX0A 2K22A 4HRSA 4MGZE 1IL8A 3BDOA 1I5FA 3WOEA 4DU9A 5CMDA 3Q22A 3KWLA 4NQLB 2WB1G 2CHBD 1RLFA 2K5QA 4BKTA 4DV0L 4CDFC 2LJIA 2HHHL 4NP5A 2K5WA 3NHHA 4A76A 4EKUA 2UUCQ 1TZ1A 4GN4B 4IWOA 3QWNA 4C3IB 4BBNF 2X6LA 2HD3A 1C9FA 1H9RA 2AQ1B 2JQRB 4HTHA 2JVCA 4JX1C 4HMJA 1FNWA 1VQ8A 3JW0X 3DEOA 5C0XG 1FJGL 2JZPA 3SD5A 1EIHA 1EYGA 2AMCB 1ZP0B 2MX2A 3PIO3 5IP4D 2JA6G 1ZYRD 3FDTA 1V49A 2R93G 2A5UA 4II3B 2L0TA 3D4DA 4CDCC 3ZTDA 3VR3A 4ZHOA 1A3VA 4WWNA 3G48A 1CZPA 4BA2I 2NVTB 2DJFC 1XT9B 3MXNB 3I4MG 2N88A 3VUXA 1NUCA 1STYA 2PZTA 1M90C 3BG3A 3DCGA 1ESRA 2DAFA 1VQGA 5JVH3 2BWFA 4GKJL 3GTLH 3IFTA 4KKUA 1KDBA 2NTSA 4A3JH 2JRIB 3VVWB 3PUZA 3S1NH 4DR6Q 3CCLA 3ECIA 2F1MA 1WTOA 1BCPF 4O2DA 2EYPA 5IGGA 4GB9A 3L17A 3QIJA 1S5FD 1C8CA 2WU5B 3IFDA 1PRTC 3H7SA 5M3MG 2LGXA 4JQWC 1YMHE 1F1HA 1ZGUB 3MHBA 4A20A 3X3NA 5BMGA 2K50A 4I6NB 1E0BA 1HTPA 2F0LA 2B63H 1A2TA 3DUZA 4LF4L 1KABA 1OXVA 1HZ6A 4XYQA 1NTGA 2OT2A 4GSWA 1DXMA 3E5SA 2QSDA 1SFOB 1MJDA 4UHVA 1BNZA 2QGQA 3ZJVA 2JEBI 2M17A 3RT3B 2EIFA 1NDDA 1B2TA 4HWIB 1E8WA 2K6QA 2RR9A 4I6PA 4IW0A 5HI1A 5BYQA 1B50A 4ZKBB 3SDZA 1Z6HA 3BY4B 1C79A 1D3ZA 1WJ4A 3ZJYC 4P73A 4NXNQ 5CV7A 1D6EC 2L8JA 3M9BA 4KTAA 1A70A 4IDIA 5COYA 1K8AC 2LSSA 1KXLA 1N33L 1WYGA 1EY0A 5C44G 3IT4B 3U4EG 1B4OA 3Q8AA 4NAMA 4LFBL 1ZXIA 3EN2A 2KHSA 3DHGC 1UBQA 4PNYA 2PI2E 3L54A 2EYHA 4A90A 3CW2C 1YNJC 4K6LA 5D94A 3TCAA 4O0AA 1V5TA 1DOYA 5F2DA 2E2JB 5BN5A 1EY6A 4PZ8A 1V2YA 2L1AA 3SR6A 1NYRA 1XX8A 5C0XH 3RN2A 1QQRA 4DF7A 1HUNA 2LJ5A 1GM5A 2Y5BB 1EEID 2K5NA 4J8QA 3NRZA 4ZUIA 3OLMD 3HM3A 3U4VA 4W9EA 4IALA 1B53A 2W3RA 3J81i 2ZTCA 2JA5H 3AH7A 4OVVA 1YIWA 4A3BH 3LYYA 4JI3L 2FNJB 1N61A 2DZIA 4DR7Q 3IAM1 4C3IH 3H0GG 4LMQD 3KBXA 4C2MH 3S17H 2VRRB 1WFYA 3U7DA 2BCOA 1D2BA 3AV8A 1WGKA 2C7MB 2KMMA 2K5VA 1HNXQ 1BMLC 1VQBA 3C3LA 3T3NA 1AZQA 1II3A 4DR1Q 4R9WA 1Q1EA 1QILA 2RF4A 3MTSA 5CV8A 2KBNA 5D65A 3H15A 1OEYJ 1TYGB 3KWVA 5JJKA 3B08A 4ZYNA 3PO2H 2X38A 2J0MA 2KACA 3IHPC 2KHIA 3PGEA 3RLFA 2EYMA 5C4JB 2J42A 4A3FB 2VUMB 2WXLA 3L4PA 4ME5A 3HP3A 1YJ9A 1SNQA 1SSOA 1U4PA 1TWCB 5KYLA 2WHIA 3CKIB 4P1BC 3LWUA 3OPOA 1T0SC 1F2ZA 3CCSA 2EKIA 4P2CB 3ER0A 1S3SG 2CJOA 4OO1G 4ZRQA 4LF8L 4UY8C 4IFDH 4DAVA 4DWFA 3E6ZX 4EZLA 2MJ8A 2OHFA 2LZ6A 5LMUL 2KQ4X 4ZCKA 3I4OA 3M63B 5E6NA 4A3GH 3RPFC 1IW7C 4K3CA 1J0GA 4ME3A 1TWGH 3H94A 4KHPQ 2BS3B 2ZZPB 1FFVA 4HJ5A 3S1MB 1ZYRC 2H1EA 2PO4A 2LGYA 3OWFA 3I63C 1TJEA 2IGHA 4X64L 2CWPA 2I46A 2MWSB 3OJ4B 2F0NA 5KNDA 2KFKB 4GLAC 5M3FB 4B3SQ 1N36L 1E1OA 1TVXA 1SJED 1QLBB 4DV4Q 4WAAA 4PYZA 2WDRB 1CA5A 1EQRA 1O7IA 2EXDA 3Q6BA 3M4YA 1BOSA 1Q12A 4DR4L 1QOBA 2NN6G 2MLBA 2O6VB 5AUKA 4E71A 1SYGA 5IGEA 2M0XA 2AEHA 5EKLA 1K52A 5C3WA 3TP6A 4LF7Q 4AP4C 2F0MA 1Q0WB 2R92G 2UU9L 4LUZA 3W5UB 2ICEC 3UI3A 5J3BA 5K36H 3E9HA 4DBGA 1F9RA 1C76A 2GMIC 3AE7B 3LJ3A 2Q8RE 1HQRD 4NJCA 1B9RA 1I94Q 2AX5A 1XLNA 3KUPA 1L2FA 2NN6I 5LMNW 1LUZA 2E2JH 3I55A 3R2TA 1CHQD 1GPXA 3T53B 4K6DA 3MTNB 3RN9C 3IRBA 5EKKA 1WR6E 3N1ZC 2I5LX 5G3LF 2KXJA 2QCPX 1HQMC 3AU4A 2L05A 1Y56A 3Q3MC 2D9UA 4H7BA 1FL0A 3HOUG 3Q8FA 1ZKHA 1VQCA 1DYQA 4HJ7A 2UUBQ 2JA5B 4B9WA 4JYAL 2SDFA 1AYFA 3GTQB 4XWTA 4GXBA 3HIZA 1YN5A 1E7VA 3C0RB 4WORA 3EHVA 4WWPA 1E7PB 3SEBA 2KA7A 4BBSG 1F52A 2G3QB 2VZKB 3SVMA 4R8IA 4QIWB 4L5SA 2LHDA 3I8ZA 3PO3G 4JV5Q 1F2LA 1WGDA 3DBSA 1K3BC 4C3JH 4K2KA 4WJPA 1Q10A 2N49A 1TWHB 5HG2A 2WLBA 4W9JA 3KQ4A 5LNK1 4KHVA 1N9WA 3D6CA 4X3KA 2F4VL 2CU3A 3UIOB 1QF6A 4A3FH 5IP7H 1OTCA 2VUMH 2IY1B 2AWNA 2F0DA 3QK0A 4F8CB 1Y8NB 3PRPB 1RIPA 2K5DA 5FO8B 4IFDG 2DENB 4HIDA 3ULPA 4KGSA 4RF0A 4A75A 1O80A 1OXTA 4ZRJA 4ACFA 5AZFA 1YZ6A 4HJAA 1PH3A 4DR3Q 4GNXB 4WRDA 2WWZA 3B1LX 2D0OA 2LWPA 4PK1A 3TEZA 1FNUA 1PMRA 1LTBD 2I38A 2JA6B 2W55A 1PTOC 2R93B 3ETRA 2RSOA 2K7VA 1U4MA 2DHZA 3HM6X 3KLSX 3TBLD 5KHQA 3EIVA 4K14A 2JPHA 5BN4A 3N1YC 2VZAA 3H09A 4NPSA 3TMEA 3NTKA 1KL9A 5FLMG 1L2NA 3BYTB 4L6TB 1YITA 4BY7B 4ILWA 1CKNB 3CCEA 1PFBA 3TP7A 3RZDH 1ZOYB 3A1QA 1VQPA 3U50C 1MPEA 2ON8A 2D0PA 1PFMA 1CJEA 1VQIA 1TKEA 2EYLA 2JQOA 4KIKB 3A8IE 1E7ZA 4A3LG 1ZW7A 5M3FH 1E8ZA 4DV5Q 4OW0A 2QEJC 2YEPB 4M01A 3TREA 3CRKC 2MFIA 3PO3H 2KFKA 1JJGA 1JW9D 2D3GA 4POFA 1JWSD 3VQIA 1WX8A 4AQ7A 1PH4A 3KUDB 4DXAB 4LCDE 4M0WB 2K1BA 5CR3A 2PVOD 4QMGA 3W1SC 2EYOA 3P4RB 2HE7A 1QOAA 2XK5A 1W6KA 1MKHA 1GUNA 3A4RA 2REXA 2DN8A 1WVLA 3N3KB 4LF5Q 4OVUA 2GBRA 3QC8B 2HDLA 4W9LA 2WX1A 2MCNB 3BZKA 3ABVB 3TMPB 4JGHB 2C60A 1A3UA 1EIGA 1Q8IA 3KF6A 4OIJA 4RCOA 4TSSA 4YHHL 4RG1A 1VR9A 3CCRA 1XQQA 1IKMA 2DAJA 3AB5A 3AE6B 5H92C 2F52A 4A3DG 4GNXA 4GDLA 3HKSA 4L5QA 3MAQA 3ICEA 4K0KL 2NVTH 1NY4A 2NS5A 3OOCA 3ERSX 3NP8A 4RMAA 3QOLA 2Z8LA 3H0GB 1FVIA 3H9DA 1HTQA 4MIUA 2L15A 1HTOA 4LJOB 1VF5C 3W1BA 2X8XX 5HFYA 1WRDB 2M19A 3H6MA 3GTQH 2Z6BA 2LVPA 1MGSA 2K01A 1KH0A 3W9CB 1IYVA 2L5TA 2NYZD 3K5NA 2F0VA 4RNAA 4FXCA 1Q46A 1V86A 1QUQB 1FR3A 2KVZA 1QKZA 3ZUNA 4K0KQ 4OWXB 1V9PA 2UXDL 1X6OA 4DK5A 5IGCA 1H9SA 4EQ5A 1S72A 5BO4B 1B3QA 2EY5A 2INDC 4ZRIA 2AUKA 1TWFB 1TZOA 2DYMA 4C00A 4K7SA 5L95C 4DNIA 3KLRA 2NUCA 5HURA 1MG8A 3FAHA 3U7ZA 3CAMA 1DOMA 3A55A 3NBIA 4LF5L 3KFUA 3PSEB 3C8YA 2CQAA 2JXTA 5M5XB 1NBFC 4FADA 3NUHB 2K6DB 3PRMB 4LF9Q 2D5GA 1YVCA 4JW0A 3FEWX 1K0SA 2IGGA 4AUQC 1JWUD 3A8KE 4DUZL 4NMZA 4IUMB 4X57B 4DR5Q 2Q5WD 3TIXA 4C3IG 4X65Q 1HR0Q 4GDLB 1WF9A 1CQFA 4M8AA 1S4ZA 5BN3A 4C3HB 3GTGB 4XQNA 4S17A 3JAMi 2K8CA 3VH4B 2ZTDA 2HCCA 2NB0A 2SEBD 1EIFA 4O42A 4IUUA 3S2DH 2VH2A 1LO5D 3Q3FA 2CKZB 2F03A 2MH7A 1KRSA 3VRAB 1L6UA 1BCPD 4TMAB 4RKLA 1YX6B 4GZYC 1R9TH 2QF7A 5AEKB 1IYFA 3N9YC 5E4WC 2KDBA 1AH9A 1N62A 1CQVA 1ET9A 5G5HA 2KOLA 4NJ7A 1Q82C 3PZ8A 3RUIB 1RAXA 1I4QA 3OTOQ 4NKLA 1BCPC 2JT4B 3M62B 4NW2A 3A74A 2VQFQ 1YQ4B 3TSSA 2IX1A 1EY7A 1TR5A 1KDAA 2WXGA 1L7YA 2JN4A 5EPKA 4RHSA 3KJOA 1C77A 2MP2A 1OXXK 3P20A 1QJOA 1V1PA 3Q8EA 5IYCG 4H0LC 4G0NB 2G1EA 4Q2JA 3S17B 1E9MA 4QF4A 2JA7G 1XMOL 3QO2A 1HFGA 1NI3A 2F4VQ 4CJ0B 2HT1A 3NS8A 5LLIA 1FRRA 4RHRA 1K83H 5M3FG 4OWWB 2GA4B 5CV4A 4K2LA 1UE7A 4JV5L 3ZNZB 3ITPA 2LXAA 2F0UA 2K14A 2WV6D 1WZ0A 1SNPA 2B29A 3OSOA 1H8CA 5CC4A 2NTTA 4HEA1 2G4SA 1CK1A 4X62Q 1LTID 4KI0A 2FUG1 5AZHA 1LT4D 1RRBA 1TWCH 2RDFA 4PV1C 3U9OA 4J1MA 2MHJA 2VB2X 3HEJA 3OW2A 4RH6A 1ZUD2 2B8GA 5C4ZA 1F0ZA 3EFCA 2BOSA 1JMCA 1YJ1A 2KC2A 2ENBA 3IG3A 1SF0A 1FFUA 3AYHB 4OHJA 1E3PA 1EOVA 2KEDA 1HEZE 3B0AA 1UE6A 2KK8A 1ENAA 4I6LB 5C0XJ 1S5BD 2Y3AA 2INPE 3NUCA 4X62L 4MH0E 5AZGA 3ZNHB 4C4VB 1QCBD 5JVG3 1KLVA 1LLRD 4DV1L 1QVCA 4DHJB 3B2GA 1SN8A 2LVOA 4EQPA 1NMFA 2RMMA 4JI0L 2B2VC 2K04A 4A3KH 1FM0D 4IWQA 4G11A 1FCCC 2Z6KA 1SYEA 2VL6A 5IN7A 3M95A 1OXSC 2IWHA 1AEXA 3KYDD 3R3MA 4LF7L 1SYFA 2CVRA 3D0FA 1R4NB 1FMAD 2IO3B 2WU2B 3GOEA 2OQKA 3SHLA 3VA5A 2N7JA 1D5ZC 3PUYA 2ZTEA 1GUOA 4DV4L 1YX5B 2O2LD 5C5MA 4BY7G 2R3ZA 1EZ8A 2K8BA 5J1ZA 2VQFL 2K25A 3PF4A 2N4FA 5BYSA 1PZID 4JLCA 3G6EA 3DBHI 1E22A 2IBIB 1YJNA 1E24A 1FD7D 1SMXA 2MA9B 4CDEC 1KIXA 3L0WB 4BBNC 4HVBA 5EPLA 4KHPL 2ZNVC 1AFPA 2WXNA 4IFDJ 1ENCA 3MC0B 3K7UC 3HRZC 5EBCA 4MGIE 4DK3C 5IO9A 1W2BA 2Y0SE 1BBXC 4A3FG 2VUMG 4OGQC 1GC6A 2KHWB 2PZUA 2EVBA 5LMUQ 1I6HB 4GIVA 2R7DA 2KN4A 3V96A 1N5XA 1HR0L 4PT5A 3V61A 3DVGY 3VUYA 4MTKA 1VQ7A 2XIWA 4LF8Q 2R2QA 4DUZQ 1EQTA 2AQ2B 1SEBD 4V190 1A15A 1PYWD 2N7EA 2NVQH 3TBIB 4USAA 3NELA 5HHDG 3NBHB 3B2FA 2BQQA 2ZEQA 2MGSA 3MHZA 4XT3B 2IX3A 3CMEA 1J5EQ 4R3DA 4NY0A 3AN1A 1K83B 3PTFC 1GUTA 1L1OC 3NTHA 3U30A 3QJZA 2DLBA 2PE6B 1XO3A 2XNAC 3HOVG 4C56C 5GROA 4XYOA 5CBAE 1XNRQ 4EQOA 4CQNA 2RDBC 3VHTC 2PI2A 3RNEC 3I2ZA 4YWKA 2PE9A 1VQ6A 1XMQL 5G55A 2NVXB 4DR7L 3NWSA 3D32A 3Q6SA 1CKMA 2B2YC 2L9HA 3K5LA 1TGZB 1WXAA 2WXJA 1XEEA 3QAQA 4KK7A 2LFNA 3C19A 2PZWA 3QCAA 1CUKA 3GTKB 3SDLC 3TEYA 2KQ3A 1FRDA 1K8MA 1IYUA 3HOWB 1PRTF 2PVGC 2R92B 2RPVA 1PXUA 4RA8A 4N6EB 3APCA 1GB1A 3ONAB 2KTFA 2D07B 1HJPA 2O5JC 2GVBA 4N9TA 5LL6X 1ENFA 3MZ5A 4FDBA 4HKZE 1VQ4A 5IA7A 1JCKB 2ZXRA 5GQOA 2H5XA 3PCOB 4ANXA 4WJOA 1TKWB 3CP0A 1FPYA 2WKDA 3ZKJC 2WXRA 3WAPA 1VD2A 3APDA 3J81E 1LT5D 1F2RI 4US9A 1CZGA 1EYDA 4C1NI 2NVYB 2WXFA 1K8GA 2AHOB 3K58A 1K51A 5JZEB 3A8JE 4IFDI 2M00A 3QJYA 2K03A 4ALPA 2BS4B 4FF4A 2BGFA 1V97A 4OZCA 4D2KA 2N3SA 2JX5A 4FLHA 4OZAA 4CHTB 1GAQB 3T1HL 2V4DA 5IP9H 5JEAH 4QGUA 2IY5B 1HZ5A 1SROA 2F0JA 1WJNA 1D1IA 2IHEA 3AEDB 4KIKA 1NSNS 3SK4A 3I7FA 4X3UA 1IGCA 2NBVB 4LF4Q 4W9FA 4PYUA 2KECA 3U9SA 3CMAA 3QR8A 4DR2L 2PPBC 1SYCA 1XPUA 1JOQA 2J7ZA 3I90A 5KGUA 1QZGA 1ILPA 3ALBA 3GS2A 4W9GA 1YQBA 1PFDA 1F9QA 2WXKA 1KAAA 3RMKC 2NPTA 4A3CG 4G3XB 3N20C 1WFQA 4DAYA 4XX5A 4AQYL 4I7ZC 2LEKA 5IOIA 1Q5WB 5DPRA 2AKWB 2V4IB 1TT2A 4A3MH 2JA7B 3GD7A 5IYBH 4HEDA 1W3SA 3HS0C 2ATWA 1L5PA 2KVMA 4OX9L 1KRHA 1EQVA 1MI0A 3QQ8B 4EUTA 5DPTA 4RAUC 4DR3L 3GE8C 4XQQA 3PF5A 2WXQA 3MVVA 5BYRA 5IYDH 2N1WA 1JE5A 4I7AA 3A0JA 2ZVOA 2EJMA 3QOJA 4XIGS 3RNBC 4UP8A 2O2VB 2XVSA 4UDUC 4DHZB 2PYKA 1PA6A 2PQAA 1MHXA 3A33B 2XBBC 5CV5A 3KLSA 1YNND 1EM7A 3HHMA 2CCZA 4ODGA 4Q5VA 1XLQA 1FJGQ 4IPHA 4ZYSA 5CHFA 2FAZA 1NVID 2H89B 1SLJA 3S15H 2LS01 2EPBA 2A73B 2Q2TA 4MSQB 1S5ED 2UUCL 5J18A 3R8BA 3K80C 1UD7A 2I1KA 3MHSD 1WWTA 3RNGC 3I91A 1JE4A 4RCNA 1W6JA 3PS6A 1UWVA 3OMCA 3M3YH 2GI9A 2M4NA 3VR5A 3GTKH 2GBKA 3HOYG 3S14B 1ICWA 4FXDA 3H8HA 1P16A 5J2RA 2B63G 1X32A 4LK1C 3KK7A 4IURA 1RF2D 2FMCA 3HKZB 3NE5B 3DVNV 1RCVD 2WACA 2UUBL 4OONA 1DGSA 1A8VA 4O1NA 1WZ3A 4XWWA 4OZBA 1VQNA 4JI1Q 3OIQA 4FJVB 2JA8B 3I4MH 4JI5Q 4JE3B 2SAKA 3PQIA 4LW1A 4MTNA 3J7AF 1LFDA 4IJHA 4ITKA 4G57A 1V5OA 4JVZA 2BA1A 1R9TB 2DY8A 1ZE3D 3MFYA 3MEHA 1I4XA 1L0WA 1DONA 1SE3A 2TMPA 1PTOD 1ET6A 2F4IA 4GGQA 2UU9Q 4OO1I 1CHPD 2G9DA 3FKIG 3RULA 4WJWA 1A3TA 2NPTB 4QCLA 1UAPA 4EOYA 2YLMA 1S40A 3W3AA 5C4HA 5I9OA 1R4QB 3ZLZA 2MW5A 4IKGA 1AZPA 1WMHA 2WINB 4NPNA 3RR5A 4DHJD 1PH9A 1MHHE 4FF1A 2L76A 1NJIC 2QJLA 2W9NA 2BB5A 3AE4B 1KNEA 3EFUA 3QG1A 3VYRA 1PH2A 3AU7A 2OOBB 4EVOA 5I9PA 3UDGA 2Q2IA 4K8IA 5GADC 4CJ2C 4B3TQ 4WWOA 3IAS1 3RZWC 4BKSD 1L1OA 1AN8A 4H44C 3E0EA 3IKJA 2V3PA 2INNE 3BVMA 1XCTL 4MACA 2BYEA 4Y52H 4XXEA 2I2YA 4KZ0A 4YY3Q 1C4PA 5IWAQ 3KDFA 2F0EA 1TTNA 1GHKA 1JWBD 2N0SB 1XLOA 3J81L 2VXWA 4CBVA 4HROA 3TN2A 1X1MA 4JI8L 4WJNA 3GDEA 3F2DA 1Y69U 4A55A 3PHWB 4NXMQ 1KDCA 3VR8B 4HXDA 5AJ3L 5A2QE 4HJ9A 4MELA 3V3XA 3T9LA 1WYDA 4KDIC 3VFKA 4FJZA 3VR4A 5H1SE 3PSIA 1N32L 1OQQA 3W2DA 1EQQA 2WP9B 3UINB 5C1ZA 5AUIA 1IBLQ 2G4DB 4MGYE 2BVCA 2BE5C 1SRUA 4DUYL 3HVDA 2N55A 1A2UA 5IIFA 5C3EH 1N5WA 1S3OA 3BYYB 4DR1L 2N7DA 3NENA 3WDNA 5EAYA 1X54A 2DZKA 4JBKA 5IYDG 3PVLA 2MNAA 3M3YB 4QAYA 4CHKA 2IL8A 1EY5A 3VA7A 4A3GG 1EFID 3HOXG 4A3LH 4HN7A 1RM6C 3ZQ4A 1QNKA 2PMZE 1WJJA 1B8AA 4KJOA 2D11A 2D2QA 3SE0A 3KUCB 2KEEA 3I3CA 4PMWA 1WI5A 2LGSA 2ID0A 2DZJA 3MJ5A 4GU2A 4JL9A 2XN9C 2NZHA 2RSNA 2JA8H 2JZ3B 5JHBA 2H88B 2MQJA 4DDGD 2RPQA 4DNTB 2L3ZA 4AYBG 2A4ZA 5M5WB 2PLPA 4GKKQ 4P7IA 2B76B 1EUJA 3BDLA 1A6XA 2PMZB 3RNCC 2YYZA 4HJ8A 3J7AV 3HOVH 3FKIH 4LFAL 1BO0A 2FINB 3DWPA 2KQ7A 1GUAB 4NB3A 5EE3A 5JJIA 3QB3A 4NDXA 1I6HH 3GTMB 4I65A 3KBGA 4ZRZA 1F77A 2I0QA 1KFYB 5C6AA 2K8HA 3J9CA 4TVAB 1VQDA 4A3IH 3TZDA 1J7BA 1DOKA 2NVUI 3V6EB 3RNUA 4MEMA 4FF3A 5JPMC 2I5MX 3Q3OC 3AFPA 1OGWA 2N9PC 5LHY1 1V8CA 4PZ7A 1L0YB 2DX5B 3NWTA 5CTRC 2ZW0A 1EYAA 3VDZA 2AWOA 3GQBA 3G71A 3EA6A 4B95A 1VDVA 1MIUA 1EF1A 4APVA 3CD6A 2XGTA 1OO9B 4KGTA 3CF6E 1M8AA 3LNNA 3D4RA 2MPMA 3ZXRA 1VQJA 4A93G 4BBRB 1LACA 1Q1BA 2F0QA 4G7ZC 2KCNA 3CSFA 2MSED 3PIOA 1P3QU 2WAQB 2GBMA 3EVQA 3UF8A 4JI7L 4ZUJA 1OQRA 4OIKA 2Z4HA 3F8TA 4DHZE 3BJUA 5JJZA 4DV6L 4AJWA 4LK0M 2UXBQ 4TV3A 1DOXA 2Q2UA 3Q8DA 4TRDA 5E7NA 2BDOA 4YTNB 4IQZA 1MD2D 3OWEB 3NEMA 3VR2A 2F3IA 1A5RA 1SMYC 3D31A 4DR6L 5CX3A 4GLSC 1DGJA 4AH6A 4GKJQ 3WANA 2L52A 2J0JA 4KN4C 5IGFA 3TEWA 3PRZA 4CO7A 2E75C 3ND8A 1RDPD 3HKZE 2EY1A 5DM73 3P2BA 5TR5A 1X3FA 4XC2A 2RHSB 3VYUA 2QW7A 4KGRA 4K81A 1A63A 3H3VC 1ZDXA 2ICIA 2MP2B 4FO2A 5KNCA 5M3MB 2PKOA 2BKFA 2AL3A 3H7PB 2NBWB 4BKGA 3HOYB 1PQSA 3KYCD 1KRTA 4LUOA 1SNOA 5CHVC 2K05A 2EZVA 4EE2A 5ELOA 4U673 2JF5A 3WOFA 3AEVA 2KJRA 1LTAD 5DCNA 2LXCA 3AEGB 2OTJA 3I73A 3ND9A 2KCCA 2IYDB 4YWLA 4DV0Q 4KDLB 3VR9B 4Z9CB 3PIPA 4F88A 2BPSA 2C9OA 4FHKA 3Q69A 4LNIA 4M8NA 2KT7A 3I3TB 1JB3A 1S1QB 2RA4A 3UDXA 1JALA 1VS0A 1I50B 3GZNB 3IT6B 2FIFA 1JQ4A 2BT6A 1K50A 1I42A 2CFMA 1KNAA 2QDLA 1STEA 4B0EA 4DNRB 1E5WA 1ZXHA 4JK1C 2CWAA 2JUOA 2KVRA 1XF5L 4IC7B 3AEFB 3HOVB 5LMNL 4NJ6A 3FKIB 1HNZL 3A9JA 4DUYQ 1PDQA 4FYDA 1F2YA 4IPCA 5C4XB 1P0RA 2RQXA 4HCEA 2EY2A 2YTVA 1VQ9A 2B63B 1B3AA 3GTMH 3NXWA 2EJGC 4G4KA 2LRWA 4ZRPA 3ZDTA 3ZVVA 4YCWA 2UXCL 3CQZB 3ZRCA 4P72A 4JI8Q 4JBMA 4R4CA 1FNVA 4N58A 3PGZA 2BYVE 5FOBB 3I72A 2JXMB 1WM3A 1IZ6A 1TS2A 5FO9B 2N1VA 3I5JC 3CCVA 4HSVA 4YY3L 2INCC 1KF6B 4B9XA 4KJNA 4KSKC 2JRHA 4A3PA 3C46A 5EJWA 2CH4W 3I70A 1IL2A 2C9WB 2O6VD 4YL8A 3T51B 3Q23A 3OIPA 2J7QB 1PFNA 2L0CA 3CCMA 2J52A 3FKYA 4WURA 1EEFD 4JG2A 2F0KA 3T16A 1WX7A 1EY8A 2L12A 1E6EB 1PYSB 1IBKQ 1XNQQ 4KZCA 3V60A 1ISNA 3JAML 2DYOA 1D4BA 1GHJA 1L4ZB 2IZVB 4W9DA 4K5WA 1WIAA 2WS3B 1WJ6A 2BW2A 2PW9A 2WGSA 3PLVA 2XSCA 4ZAIA 1JORA 3P1HA 4L2YA 4PMBA 3DWMA 2E6XA 1U4AA 4ANVA 1B7YB 3VR6A 2ASBA 2E76C 3G4SA 5EE0A 2FCSA 5IODA 5G2NA 4M00A 1TKYA 2KUMA 1JOKA 4LFCQ 1B9NA 2KC1A 4JOIA 4HDOA 2EE1A 3DVGX 3GZNI 2B39A 3FILB 4KKTA 1EF5A 1HXYD 2M8SA 3DQVA 2UXCQ 3DOWA 3NG0A 1E0ZA 2I1JA 2DYBA 4L63B 1YOVB 1U4LA 4AJYB 2BS2B 2LASA 3P4SB 3TL5A 5IE8A 4L5RC 5M3MH 3RI7C 1ONLA 1GXDC 4LUVA 1UNSA 4PMCA 4GOPA 3RCZA 3IFWB 2TSSA 4PS3A 2BA0A 5J17A 2PW5A 3A7LA 3P63A 1Y1VH 3MXPA 1LTSD 3KF8A 1L6VA 4Y7NB 4KKSA 3Q0AA 1GG3A 2ALYB 4M0WA 4JI1L 3PHXB 1HRJA 2LD9A 3L3OC 4A3JB 1H95A 3M3JA 4A3OA 1G2SA 4TKOB 4FXGC 5FO7B 3PO2B 4GN3B 1SNCA 4CKBA 4DAPA 2CJNA 1E7UA 1BQQT 3M7NA 1Q7YC 1LQBA 1SE9A 2J0KA 4KV2A 3L13A 5JH5C 4RGOS 1I50H 1QE6A 1A0IA 2R7ZB 1Z7TA 3ML8A 1LT3D 1STBA 2FFKB 3I4LA 1XXGA 1TY2A 4QIWE 2KO3A 5BR8Q 1PGAA 3K57A 2Q8TA 1PH8A 4IUNA 1A62A 1HA6A 1YNTE 3KYHC 1J8CA 4N9F4 2XWBB 1GC7A 4H2AA 2V0GA 2HQLA 5CV9A 3RLOA 1WD1A 4HK2A 3FRPB 5EGTA 2FIDA 3TRZA 4A3GB 4HAEA 3HOXB 4M02A 1OTRB 3AE8B 4ANWA 2D2CC 3IL8A 4XZ4A 1T0QC 1WRIA 5FJ8H 4ICVA 2RSUA 2K1FA 3GTJB 1JROA 3A7AB 3AE9B 4LNFA 1K28A 3GO5A 2KWVB 1KQSA 1Z9FA 1I4PA 5G5GA 4BAXA 4F1SA 1PRTB 1GO3E 2DNEA 2CHZA 2D5DA 2JA5G 1Q1OA 1DCZA 2UXBL 2IO2B 4DV6Q 2JK8A 1TY0A 4BBRG 4HMIA 5FR3A 2JA8G 5EDSA 2BYTA 1EU3A 2BBCA 2WAQG 1EWIA 3KDFB 4DDID 1IYJB 2K5HA 3N32A 4ZK9B 1X3QA 3E56A 4DN4M 2KHJA 4DR2Q 3DBRB 3H1UA 2JYOA 3MP9A 5FLXL 1T5XD 2K3UA 3DWGC 4A9AA 2OF1A 1WE6A 1BVSA 3M4PA 2GRIA 2EXZA 1PLFA 3A4SC 3UDIA 1WH3A 3G7LA 2A68D 3EQLC 2KWCA 4RMFA 2HUGA 5GAHC 4LNOA 1ASZA 1WTPA 2KN5A 1JR0D 4A3BB 1QB5D 4CGYB 4DK1A 3DHQA 1IBML 2ZJRA 1UWMA 1L0XB 4IPGA 2AYOB 2PNRC 1GUGA 4LAAA 1Q81C 2JEAI 4N9PA 3DMUA 1ZPSA 2C7HA 3ULLA 3PT2B 1C7YA 4FA6A 3V2TA 1F2MA 2ZPNA 4LFAQ 1HZCA 3TS2A 1P8LA 1Y1VB 4KKIA 4AIMA 2KQSA 5DLQE 4GKKL 4OL7A 1VQFA 4C3JB 1EOTA 1PDXA 1T0YA 4DK0A 1K8RB 2MRPA 3NZSA 3ZNGC 3Q8BA 1WTVA 4G50A 2V4LA 3UE1A 2P5ZX 1DOIA 2JWUA 5J22A 1X56A 2KCTA 1E2ZA 5IGBA 2ZW1A 2R7ZH 3JYUA 1L0VB 3OJ3A 3CPWA 1CA6A 2LMCA 2A6ED 3HOUH 3KLWA 2IY0B 3LWEA 4B9KA 1VZ8A 4P1CC 5K5PA 1JB7A 4IG7B 2BWES 2HCIA 1MHWC 1EL0A 2C7NB 3IBEA 3ZDMC 4BXXH 4KD3A 3T8MA 1LM8B 4IUPA 1R4MI 4II2B 4KD4A 2XRQD 3HOXH 1VQOA 3PV0A 4Q0FA 4FJYA 4JIOU 4BOSC 3J80i 5CV6A 4MSMB 5I4DA 2UU7A 1IBLL 2JXXA 3ZO5B 4BY7H 4F7XA 1M4VA 3SXHA 1UGMA 2D3CA 4YTMB 4WQOB 1FD6A 1Y14B 2WYQA 3RNAC 2FCMA 2LFIA 1HNWQ 2RCFA 4A3DB 4YIJA 2E2HB 1TT5B 5A2QL 3DXJC 2DWQA 1TXYA 1KC8C 3K0YA 3BZCA 1XCQL 2KJXA 4LLGM 4X6AH 1PTOH 3R93A 2WDTB 1VCIA 2IT1A 1X9NA 3CMMB 1UEAB 3VYSA 3C1EA 4LNQA 2B2TA 1C4AA 2WXMA 1O7ZA 4GLXA 2KLCA 1M1KC 2KOXA 1NYQA 3O13A 1CM9A 1VQLA 1TQOA 1OQYA 2WXIA 3JSVA 5JJLA 5MPOA 3R7RA 2GBNA 3MXUA 2OTLA 1MJCA 4C2MB 4HPLB 5C3JB 2PQEA 4EEWA 1MI2A 4A3EH 4HJGE 3EJIA 4US8A 3HOYH 2HD5B 4LJZC 4QUFA 1PH5A 1S5DD 4B3TL 1QUQA 1EY9A 4HIKA 1JRUA 3CXCA 3AULA 4J3OD 1WXQA 5DNFA 2HJ1A 2EMTA 3S1RH 1J9OA 4DV2L 1RHPA 5IP7G 2JSVX 2G45B 1SE8A 5C4JH 3H0GH 3NVYA 1KLGD 2RHQB 5LXHA 4WJQA 4RGTA 3T13A 1XLPA 1OFFA 1F2RC 3EUB2 5EBDA 2KMAA 4TQ1A 3SU8X 3AEBB 2D62A 1PH1A 1WGGA 2JWZA 3U58A 5CYUA 2VNUD 4DV3Q 4JI0Q 4M1UB 2R2OA 2V3SA 1H9MA 2CKHB 1LYLA 4C3HG 1BUVT 4A93B 4DV1Q 3IAYA 4KSLC 1Q8KA 2ZM6L 1GNUA 1HA5A 2ZCBA 1U9RA 3DDCB 4LF6L 1XTCD 3PV1A 1TWGB 1WCMG 2DBYA 1HR0W 1E1TA 1J7AA 1UGJA 5IT9E 4G7OC 2FE8A 2VZKD 3NBHA 3LXFA 3VTUA 1R4MB 2L4NA 2I07B 4GMVA 4YCVA 5E4XA 5M9OA 2A19A 3NVVA 1FXIA 2QIEB 4RGMA 4ZKCB 2Q2HA 2D3BA 2ZT9C 2E2DC 1NI2A 2NBUA 3BZDB 1KTKA 3DM3A 1K0RA 4RKBA 4XDXA 4RF1A 2MEKA 3UQBA 3R7QA 1Z2MA 3W5VB 1G6JA 4NAWA 2YEPF 4YWGG 2KCMA 4PZ6A 3U52E 3K6OA 1G91A 2B2VA 3OW7A 1PH6A 2F0SA 2XRSD 3QX1A 1VQAA 5GAEC 4POGA 2IGDA 1NE3A 1UEBA 2BDNA 2BKRB 3OAWA 4HCPB 1YIJA 1WI0A 1R4NI 2GB1A 3CIRB 2V1YA 4E3CA 2QC8A 1U4RA 4CJ1B 3GTOH 1SGHA 3NHEB 1TIID 1WTWA 3HOZG 2H4OA 1M94A 2DZMA 5FLXc 1RYJA 1MJEA 4OX9Q 1DM0B 4ANUA 1B1ZA 5L37A 3GE3C 1VDZA 3T56B 2KX0A 4KHZA 2WXPA 1N34L 4H02A 2NR2A 1XTDA 3BIID 4AQYQ 3WA0A 2E3TA 2IDYA 5IOCA 1N60A 5D3DA 2EYFA 4K8JA 5IYBG 2N9KA 2I5HA 2RDGA 3R3OA 4IUQA 1Q3LA 1EIYB 3C1FA 3L7ZC 5JAVA 4Y7NH 4B3RQ 2Z59B 1WCMH 3JAME 4JI4Q 2OJRA 1SYDA 4X65L 1CSPA 1GKHA 2R61A 1YHAA 1TWHH 3S1RB 1QZHA 3TQYA 4DR5L 1VQHA 4FHJA 1V9JA 1SMYD 3ZRFA 4XQJA 1FIQA 1WSPA 3T1HQ 1GUWA 2EYJA 3R2IA 4KLKA 4ULLA 3BK2A 2QMTA 2NZ1D 1I3QB 4DAMA 4GOPB 1AARA 4C7ZA 4HSPA 5K36G 1DZ1A 2JYEA 3W1SA 4GLVB 3MFGA 3A9KA 2C35B 4AYBE 1AW7A 2M9VA 2OJWA 2GLSA 2MUYA 2Z1CA 1HE8A 3DBLB 3VTVA 1TWFH 1AWDA 4YTPB 4OXPA 2FHTA 1F9JA 1STNA 3EBEA 3Q2AC 3CC2A 2C5LC 2NMQA 3QHTA 4ASWC 3S1MH 2R93H 3I4NG 1CKNA 4K7WA 2HDMA 2LXJA 4A3BG 1PYBA 3TUOA 1YHQA 1NNXA 2PEAA 3WWVA 2K28A 2J53A 2RD0A 3I9V1 1X3GA 2UXDQ 1AE2A 3NOBA 1Y1WG 4HLEA 4QJFA 3CF5A 3HUIA 2E5LL 2KWDA 4AWJA 3ZGZA 4EGVA 2RBMA 2VH1A 5ELCA 1O7LA 1PUTA 3TP8A 4HIOA 4XTCS 1FCLA 2K6AA 3CC7A 3LDZE 5KNBA 1E2WA 1ZKOA 3DBLI 4UPAA 3NVZA 2OWOA 5E3FA 1WTQA 1YJIA 3CSTA 4IN3A 4ABNA 3M4OB 2B3AA 4HKQA 3PREA 1U0LA 2RCNA 5KEEA 3TZUA 3HRDD 2DUDA 2F0IA 5T8IA 1XMQQ 2SOBA 3RMHA 4WAFA 5FLMH 4HCSA 1QNUA 2K9XA 2KWUB 5DEHA 1QOHA 4LTUA 2JZZA 2Y5PA 1ESFA 4M8MA 1XNRL 1P1AA 1H4RA 3KH0A 2OEOA 2CQOA 1EZ6A 3GTOB 3PO2G 3URYA 5IGDA 1FEHA 1J5EL 3N52A 2JSOA 3PUXA 2LGDA 3A56A 4CDDC 4GOPC 2L83A 3AU5A 4MDKE 3D6WA 2D3AA 4NQKE 4A3MG 4UAIA 1PHJA 2KZRA 3DBHB 2KENA 2F0FA 1X65A 2E2IB 5A35A 4IO9A 3DM1A 2F3VA 3DHHC 1EY4A 1TS4A 4DV5L 1JMLA 2Z4IA 3X3MA 1WM2A 2M1MA 4JI4L 3AE3B 1J7CA 3NVWA 4IOAA 5EQ0A 3R66C 4XGAB 2QCZA 1QVFA 3JAMc 4MH8A 1ACCA 2K75A 2BH8A 2L0FA 4KN7C 4JC0A 4GNXC 1WTRA 1G2TA 2KJHB 2K39A 4AOFA 1O78A 4KY5A 1C1YB 2AL6A 2PIAA 4EX5A 1VJKA 4BKSA 2N9XA 4ARCA 1GJZA 5FK9C 1UE5A 5D14A 2O6VA 1I7HA 2Y5CA 4REZA 4HIMA 3BDCA 4HPPA 1V1OA 1N34Q 3HOZH 1LGRA 3FC4A 4CKEA 4W9HA 4MT5A 1STGA 1HCZA 1T5EA 3RLNA 1K8OA 1UZXB 2QHOA 4E6IA 2CR5A 4L23A 2CHWA 1JWAD 5ELEA 3L16A 2GVAA 1I3QH 3RZFA 1TWAB 2VY3A 2JA6H 2LUEA 3AE1B 2BYFA 5E6PA 3W1YA 3X23A 1IP9A 2KMCA 4BOZB 3HZXA 4J6IA 4JI2L 3WAOA 1VQMA 2Z0DB 3AFQA 1JOOA 3RD4A 4E74A 3SFEB 3WALA 5TSSA 1VZ6A 4S0RA 4J15A 3AMUA 3S9WA 1HZ9A 4A3KB 1P9DU 3K7AB 3RZDB 5ISRA 1KAWA 1GOZA 3PUVA 2OCEA 4DA2A 1FO4A 4GS3A 4LNNA 2AQ3B 4C3HH 3GTGH 2N9LA 4LWCA 1R7SA 1XD3B 3WIMA 1PV4A 2K33A 3VAWA 3S2DB 4BA1I 3AEEB 3EGRA 4LDTD 4A3DH 3Q24A 1LXDA 1XJVA 2E2HH 1WTXA 1C9OA 1J8IA 4R4QA 4XE0A 4YT0B 1C3TA 1HUMA 1WGYA 2EDGA 1WR1A 3AE2B 4IPDA 4CYEA 1SNDA 1ROEA 1PTOB 2HQEA 3KF8B 3M4OH 3QA8A 1C0AA 2WP8J 1JJ2A 2FCQA 4HPMB 1DD2A 1MVKA 1SE4A 3BVGA 3NTIA 4IOCA 5JEAJ 3PLUA 4HJKA 4TUUA 4A8XC 3QWZB 3K59A 4LF6Q 1IGDA 1RL2A 4L1BA 1XYIA 2EELA 1X3PA 4KY6A 3L2PA 2ZM6Q 4ZHPA 3T4AC 1PH7A 2MHVA 4QUCA 5IY0A 3GTPB 1RFAA 1SDFA 4P74A 4A3EB 1I94L 3UIPB 4FULA 1WY8A 4YXDB 5C3XA 4C3JG 4EZKA 2YU9H 2XK5B 1HTLD 1NR4A 1QVGA 2WDVB 2MO0A 1XMOQ 3H3VI 2GN5A 1BBUA 1KLUD 2A68C 4XT1B 1UF0A 2GBJA 2HDEA 2FUHB 3FP9A 1G291 4JI2Q 2C5CA 4FF2A 2JA9A 4DR4Q 4PS8A 4JPSA 2OXPA 1EWCA 1MSHA 3STBC 1WXMA 4ID6A 1NMGA 4WJ3M 2L7RA 3J81c 4DV2Q 1LABA 2LVQA 2RDHA 1N36Q 3CPFA 2EKEC 4XYCA 2Q8IB 1NR2A 3L0OA 2J4XA 1WTHA 3FHWA 2WQYB 3NK9A 2V1CC 3OTOL 1YN3A 1KHIA 4ZQ3A 2KD0A 2Y0SG 3WAMA 1T9HA 5ELBA 5KRUA 1T0RC 1B70B 1GJXA 2JY6A 3JVZX 5FR6A 3RN5A 3FPPA 1YBYA 3I56A 1PGXA 4A93H 4KX6B 1H9KA 1UELA 1RTOA 3UGBB 3VRBB 2FXQA 2JYTA 1LTRD 2J0TD 3DEPA 5FJ8G 2IJ0A 3HOZB 5AFWA 3MC9A 2ZJQA 1C48A 3P75A 1V6EA 5M5XH 2E74C 2ZNVB 4WIPA 1VQ5A 3APFA 4OWTB 1H9SB 5G3LD 1WD0A 1TWAH 3FPUB 2B3GA 2IO1B 4YWMA 4KMUC 2PPHA 3AQQA 3A5UA 3DLLA 2RVLA 5JOBA 3S16H 3E3XA 1F9PA 3I4NB 1I4HA 4LF9L 1G6PA 2MJ3A 2ZXOA 2EQSA 2NN6H 2NBFA 4A4IA 2Z0EB 2FBWB 3PUWA 3D8GA 3SGIA 1HNWL 2F0OA 3L10B 3NZUA 1LTTD 4K3BA 4IM2A 1WYWB 4C80A 2EJFC 1VCBA 1NCVA 3CHBD 1WOCA 3UE0A 4K5VA 2ZCCA 3E9IA 3K9OB 2KANA 3ENEA 3B6YA 1B9MA 1QG7A 2PNHA 2HJ8A 1Z47A 1EWHA 4IM3A 3F2CA 1NBWA 2K5PA 1I4GA 1TKGA 2QDFA 1Y8RC 5I6WA 1S5CD 3NSWA 1ZDVA 2M56B 1V8QA 1P7FA 4IZ8A 3DBRI 1YEZA 5FLXE 2CHXA 1BR9A 1BUIC 2B2YA 1PFSA 1RTNA 4JI3Q 3OG5A 3RD2A 3KW5B 3UDFA 3K9PB 5EKIA 4IUVA 2PJHA 1J19A 4HR7B 4OO1H 4JBJA 1I35A 2L55A 2WFWA 1QZEA 2HIXA 3PMFA 1Y1WB 3RNFC 2NVQB 2E5LQ 3AXCA 2MBOA 1X55A 2F0TA 3IVFA 4NZLB 4ARIA 1E10A 2D10A 4KV6A 2MJEA 4IJLA 4YHHQ 2YU9B 2K4KA 2L1BA 4R4TA 4A3MB 2JA7H 1WCMB 4JWSC 1HZAA 3Q14C 3D3RA 3BVZA 2A5HA 3J7ZC 4W9IA 1ML0D 4EZJA 1VZ7A 4R1JA 3N1XC 4JCVE 5CHWA 2NWGA 4NXNL 1RD9D 4G7HC 2YV5A 5CBEE 1WXVA 1P98A 3ZJUA 1TS3A 3GP7A 2SNSA 2YTYA 1JC7A 2E8GA 3MXNA 4FP5D 2N9EB 1H9JA 3KJPA 2QA4A 3MWYW 1R4PB 3FMCA 3DWAA 2PMVA 4BXXG 4WFN3 1YHBA 4QB4A 1Q86C 1N6ZA 3E0JA 2MBHA 1HPCA 1PVOA 2O2VA 1EU4A 1Y8PB 4BY1G 3HOWH 4B3RL 2R92H 5GMVA 1B44D 4DPGA 2IW3A 4F8MA 2FJ2A 3ZIMA 4W9CA 3S2AA 1DJRD 4JBWA 1WX9A 2B2WC 3BU2A 2IPKD 2ASQA 2KKCA 2CW0C 5CGKA 2M0AA 5JPNC 3UQAA 4RM9A 3S24A 2A1AA 3EC8A 3KF6B 4QY7A 4PG3A 1FGUA 4N8X1 1SNMA 2MBBB 4RM8A 3LX0A 3TS0A 1BDOA 3F2UA 1PTOF 1RODA 3S16B 1EWYC 2DGYA 2R7FA 3PIP3 1CFMA 1RFKA 2PQAB 4K1RB 1JWMD 2A69D 1AE3A 1VLBA 3ERQA 2WB1B 4PQXA 2RGFA 4P71A 1SXTA 4MM3A 3H91A 5E6OA 5GAGC 1PZJD 1MSGA 1FXTB 3QARA 2N8NA 2QEXA 2K52A 2QILA 3K5MA 2KX3A 4GN1A 2DJGC 1T3QA 4P75A 4QL5A 3Q3JA 1GB4A 4OELB 2NZOA 3UI2A 5BR8L 1V81A 3OHXC 4H13C 2CU1A 2MQHA 3S1QH 2WXOA 1SBBB 3CCQA 3SK6A 2ZPYA 3PZDA 4BFRA 1EO6A 1AP0A 1YNJD 1X3EA 4JPBW 1QWYA 3W5OA 4ZLTF 4A3IB 3U8ZA 4C4VA 3CRLC 3OYYA 2E2IH 4JYAQ 2SNMA 3AI5A 1VQKA 2YVCA 1ZXTA 5EE9A 2F3WA 2EY6A 2KFJA 3LGJA 3HVZA 2MBEA 1SAPA 3K81C 4R8NA 1Y1WH 2KDEB 3AEAB 4C1NK 4LNKA 4YSYB 4MZ9A 1TS5A 3X0WA 2FCNA 1K9MC 4MJSB 4R4IA 3SK8A 5GXGB 4F7ZA 4A3CH 4DGZA 3RZOB 3KOJA 1STAA 4RWSC 2W3SA 3IXSA 3BS1A 1OEYA 3OMGA 5EE1A 1IPGA 4YSZB 2BH2A 2NVXH 2VW9A 2JU6X 4DV3L 5DAUA 3J7YW 3NQTA 1YNNC 4BBSH 3TJPA 4MHEA 3ZXVA 3TEXA 4MGKE 1UUPA 3S15B 4OVZA 3A5ZB 2KTRB 3V62A 2WIIB 4LFCL 4X66L 1E90A 2O4XA 2EOTA 5IP9G 5JEAG 3P4PB 3P1MA 1SE2A 2KNBA 2LMCB 2PTLA 5DM63 1I6VC 3F1ZA 3J81j 3HG9A 3AB9A 1E8YA 3O65B 2WNMA 1GUSA 4CKCA 4C7YA 1WXSA 1L1OB 3S14H 1PRTD 2B2UC 3AECB 3MJWA 3AMZA 4B3SL 3ZTCA 2XTIA 3B9JA 1D5MC 5C3EB 3WCQA 1GVPA 2DNCA 1BCPB 3K7AH 1IBKL 1IUEA 4X64Q 3NZ3A 3SHQA 2PW7A 5E6JA 4AS1A
chains in the Genus database with same CATH topology
5C5LA 5T1IA 3C2PA 3AE5B 2B8FA 1BXTA 2RKSA 1CTMA 1I4RA 5NUCA 1LTGD 2O5IC 2LY7A 3HGBA 3PO0A 2MJDA 2Y0SB 2F0WA 2JP1A 5HGTA 1C78A 1L4DB 1FGBD 1NENB 4B0MA 3NS1A 1T6BX 4JWUC 1JRPA 1SIJA 1DOLA 4BWGB 3TP5A 1SYBA 2LGIA 4XDDA 4ZOHC 1F9SA 1JICA 3MXGA 1D1KA 1C4CA 3DWQA 2F0GA 3SR1A 3GV3A 4K5XA 5ELFA 1FYCA 3PZ7A 3NPPA 3I57A 3S1QB 1O7YA 2HTME 1SB3C 5LL6S 3N6RA 2DY7A 4S3SA 2X69A 1YJJA 2A69C 4X3TA 5H8YE 4MN3A 1SSNA 2F0PA 3QIAA 1YQ3B 3VYTA 3EROA 4TQUS 5M5YB 2L11A 2LHEA 2M2LA 1JQYD 2AUJD 4GDKB 3FILA 2WKCA 2BE5D 5FKAC 2JE6I 3ZJTA 2WXHA 3J80L 4BY1B 1Y8OB 3ZYYX 1V1PB 4U68A 3I4MB 4P16A 3BK1A 2BB6A 2WDQB 3MA2B 4FVMA 3A54A 1NAPA 3E9SA 3S2HB 4RFBA 1CZWA 1K53A 4IOIE 5C44B 3D4WA 2B2WA 2B2UA 4TQ0A 4KKJA 3P42A 3AM9A 1OXUA 2K0PA 1G6ZA 5KYIA 2OEDA 2KDMA 3J80E 1IBXA 1SJHD 3EFXD 2ZXPA 1VMPA 2CW0D 1RKNA 4J6HA 4B08A 2FMMA 4DXGA 4KY7A 3M7GA 4X3SA 4DQOC 5IT9L 5I6YA 2A6HC 1RWSA 1G8ZD 5BMIA 2A6EC 3V05A 1QOGA 2QDBA 3TDQA 1VMCA 2A6HD 3P7JA 1MBYA 3U2SC 4N59A 2V3NA 4L8JA 5ELDA 4NAWB 1IHZA 2B2TC 2W54A 1D5XC 1E2VA 4EQNA 5I2XA 2L32A 1FXAA 4DXFA 5C2TB 3CU7A 1CT1D 3FVQA 4V0BA 2K32A 1VRAB 3CWIA 2BTEA 4RGNA 5D3IB 2KAJA 4DFAA 3M85A 5C0XI 2X6GA 1IW7D 1ILQA 2A74C 1PZKD 1RJTA 5EPJA 1N63A 1QOFA 1PGBA 4WWMA 1IKLA 3GTLB 3P4QB 3S1NB 1CI3M 5T1GA 1VF7A 4BS9A 1LT6D 3RUZA 4WQMA 3LB8C 4FNFA 1EYCA 5J39A 3Q8CA 2LUMA 5D7GA 1UWXA 2XWJB 1STHA 5JXVA 2LKVA 3L9AX 1HHVA 1LV9A 1P7EA 4A6QA 2MP1A 2W82A 1QT9A 1XWEA 4YSXB 4MM3B 4IUTA 3T3OA 4F87A 2PCFB 5KIXA 3NQIA 2ACZB 5I2YA 1ZEQX 2QKIC 2ONQA 1IBXB 5E1FA 3RFZB 3G6JB 4P6VF 4AYBB 4WH4A 1Q90A 1NEKB 1HFNA 3HOUB 5CORA 2R6GA 1TU2B 3K5OA 1V43A 1YN4A 3GV6A 4FXKC 4XDCA 4BBSB 2F0HA 3BWUD 3SFDB 3GB1A 3PO3B 3SK5A 2G9HD 1BF4A 5BMHA 1C4QA 2VB3X 2IX0A 2K22A 4HRSA 1IL8A 3BDOA 4DU9A 3WOEA 5CMDA 3KWLA 3Q22A 2CHBD 2K5QA 2LJIA 4NP5A 2K5WA 3NHHA 3QWNA 4C3IB 2X6LA 1C9FA 1H9RA 2AQ1B 2JQRB 4HTHA 4JX1C 4HMJA 1FNWA 3DEOA 5C0XG 2JZPA 1EIHA 1ZP0B 3PIO3 1ZYRD 3FDTA 3D4DA 3VR3A 4ZHOA 1A3VA 1CZPA 4BA2I 2NVTB 2N88A 1STYA 1NUCA 2PZTA 3BG3A 1ESRA 5JVH3 3IFTA 4KKUA 1KDBA 2NTSA 3PUZA 1WTOA 2F1MA 1BCPF 5IGGA 2EYPA 1S5FD 1C8CA 2WU5B 3IFDA 1PRTC 1YMHE 3MHBA 3X3NA 5BMGA 1E0BA 1HTPA 2F0LA 1A2TA 3DUZA 1KABA 1OXVA 1HZ6A 4XYQA 2OT2A 1DXMA 3E5SA 2QSDA 1SFOB 1BNZA 3ZJVA 2JEBI 1B2TA 5HI1A 5BYQA 1B50A 4ZKBB 3SDZA 1Z6HA 1C79A 5CV7A 1D6EC 4KTAA 1A70A 4IDIA 5COYA 1WYGA 1EY0A 3IT4B 3U4EG 1B4OA 3Q8AA 4NAMA 1ZXIA 2KHSA 4PNYA 2EYHA 4A90A 1YNJC 4K6LA 1DOYA 5F2DA 2E2JB 5BN5A 1EY6A 2L1AA 3SR6A 1NYRA 1XX8A 5C0XH 1QQRA 4DF7A 1HUNA 3NRZA 1EEID 4J8QA 4ZUIA 4IALA 1B53A 2W3RA 3AH7A 3LYYA 1N61A 3IAM1 4LMQD 3KBXA 2BCOA 1D2BA 3AV8A 1WGKA 2KMMA 1BMLC 3C3LA 3T3NA 1AZQA 1II3A 4R9WA 1Q1EA 1QILA 3MTSA 5CV8A 5D65A 1TYGB 3KWVA 2X38A 2KACA 3RLFA 2EYMA 5C4JB 2J42A 4A3FB 2VUMB 2WXLA 3L4PA 4ME5A 3HP3A 5KYLA 1SNQA 1SSOA 1U4PA 1TWCB 3CKIB 3LWUA 3OPOA 1F2ZA 2EKIA 4P2CB 2CJOA 4OO1G 4ZRQA 4IFDH 4DAVA 3E6ZX 2MJ8A 2OHFA 2KQ4X 3RPFC 1IW7C 3H94A 2BS3B 1FFVA 3S1MB 1ZYRC 2H1EA 2PO4A 3OWFA 1TJEA 2IGHA 2I46A 2F0NA 5KNDA 5M3FB 1TVXA 1SJED 1QLBB 2WDRB 1CA5A 5AUKA 3M4YA 1BOSA 1Q12A 1QOBA 2NN6G 1SYGA 5IGEA 5EKLA 1K52A 5C3WA 3TP6A 2F0MA 3W5UB 2ICEC 3UI3A 5K36H 1F9RA 1C76A 3AE7B 2Q8RE 1HQRD 4NJCA 1B9RA 2AX5A 1XLNA 3KUPA 2NN6I 3R2TA 1CHQD 1GPXA 3T53B 4K6DA 5EKKA 5G3LF 2QCPX 1HQMC 1Y56A 2D9UA 4H7BA 3Q8FA 1DYQA 2JA5B 4B9WA 1AYFA 2SDFA 3GTQB 4XWTA 1YN5A 4WORA 1E7PB 3SEBA 2KA7A 2VZKB 3SVMA 4R8IA 4QIWB 2LHDA 3I8ZA 1F2LA 4K2KA 1Q10A 1TWHB 5HG2A 2WLBA 3KQ4A 5LNK1 4KHVA 4X3KA 3D6CA 2CU3A 1QF6A 2AWNA 2F0DA 1Y8NB 2K5DA 5FO8B 4IFDG 4KGSA 4RF0A 1O80A 1OXTA 4WRDA 3TEZA 1FNUA 1PMRA 1LTBD 2I38A 2JA6B 2W55A 1PTOC 2R93B 3ETRA 2RSOA 2K7VA 1U4MA 3KLSX 4K14A 5BN4A 3H09A 3TMEA 3NTKA 3BYTB 4L6TB 4BY7B 4ILWA 1PFBA 3TP7A 1ZOYB 1MPEA 2ON8A 1PFMA 1CJEA 1TKEA 2EYLA 3A8IE 4OW0A 2QEJC 2YEPB 3CRKC 1JW9D 3VQIA 1JWSD 4AQ7A 2K1BA 5CR3A 2PVOD 4QMGA 2EYOA 3P4RB 1QOAA 1W6KA 1GUNA 2DN8A 1WVLA 2HDLA 3ABVB 1EIGA 1A3UA 1Q8IA 4OIJA 4RCOA 4TSSA 1VR9A 3AE6B 3AB5A 5H92C 4YXDB 1IKMA 3MAQA 3OOCA 3NP8A 3QOLA 2Z8LA 3H0GB 4MIUA 1VF5C 5HFYA 2M19A 3H6MA 1MGSA 2K01A 1KH0A 3W9CB 1IYVA 2L5TA 2NYZD 3K5NA 2F0VA 4RNAA 4FXCA 1FR3A 1QKZA 5IGCA 1H9SA 2EY5A 2AUKA 1TWFB 1TZOA 2DYMA 3KLRA 2NUCA 5HURA 3FAHA 3U7ZA 1DOMA 3A55A 3NBIA 3C8YA 2CQAA 2JXTA 5M5XB 3NUHB 2D5GA 3FEWX 2IGGA 1JWUD 3A8KE 4NMZA 2Q5WD 4C3IG 4GDLB 1CQFA 4M8AA 1S4ZA 5BN3A 4C3HB 3GTGB 4XQNA 2HCCA 2NB0A 2SEBD 4O42A 4IUUA 1LO5D 2F03A 2MH7A 3VRAB 1L6UA 1BCPD 4TMAB 4RKLA 4GZYC 2QF7A 3N9YC 5E4WC 1N62A 1CQVA 1ET9A 5G5HA 2KOLA 3PZ8A 1I4QA 4NKLA 1BCPC 4NW2A 1YQ4B 3TSSA 2IX1A 1EY7A 1TR5A 1KDAA 2WXGA 5EPKA 4RHSA 1C77A 1OXXK 3P20A 1QJOA 1V1PA 3Q8EA 4H0LC 2G1EA 4Q2JA 3S17B 1E9MA 4QF4A 3QO2A 1HFGA 1NI3A 4CJ0B 1FRRA 4RHRA 2GA4B 5CV4A 4K2LA 3ITPA 2F0UA 2WV6D 1SNPA 3OSOA 5CC4A 2NTTA 4HEA1 1CK1A 1LTID 4KI0A 2FUG1 1LT4D 2RDFA 4PV1C 3U9OA 4J1MA 2VB2X 3HEJA 4RH6A 1ZUD2 2B8GA 5C4ZA 1F0ZA 2BOSA 2ENBA 1SF0A 1FFUA 4OHJA 2KEDA 1HEZE 1ENAA 5C0XJ 1S5BD 2Y3AA 2INPE 3NUCA 1QCBD 5JVG3 1LLRD 3B2GA 4EQPA 2RMMA 2B2VC 2K04A 1FM0D 1FCCC 1SYEA 1OXSC 2IWHA 1AEXA 1SYFA 2CVRA 1FMAD 2WU2B 3SHLA 3VA5A 2N7JA 1D5ZC 3PUYA 1GUOA 2O2LD 5C5MA 2R3ZA 1EZ8A 5J1ZA 5BYSA 1PZID 1FD7D 5EPLA 1AFPA 2WXNA 4IFDJ 1ENCA 5EBCA 3MC0B 3HRZC 1BBXC 4OGQC 2PZUA 2EVBA 1I6HB 2KN4A 3V96A 1N5XA 4PT5A 2XIWA 1EQTA 2AQ2B 1SEBD 4V190 1A15A 1PYWD 3TBIB 4USAA 5HHDG 3B2FA 2MGSA 3MHZA 4XT3B 2IX3A 4R3DA 3AN1A 1K83B 1GUTA 3NTHA 2DLBA 1XO3A 2XNAC 4C56C 4XYOA 5CBAE 4EQOA 4CQNA 2NVXB 3NWSA 3Q6SA 2L9HA 2B2YC 3K5LA 2WXJA 1XEEA 4KK7A 2LFNA 2PZWA 3GTKB 3TEYA 2KQ3A 1FRDA 1K8MA 1IYUA 3HOWB 1PRTF 2PVGC 2R92B 2RPVA 1PXUA 4RA8A 4N6EB 1GB1A 3ONAB 2O5JC 4N9TA 5LL6X 1ENFA 3MZ5A 4HKZE 1JCKB 2ZXRA 1TKWB 2WKDA 2WXRA 3J81E 1LT5D 1F2RI 4US9A 1CZGA 1EYDA 4C1NI 2NVYB 2WXFA 1K51A 3K58A 3A8JE 4IFDI 2M00A 3QJYA 2K03A 2BS4B 4FF4A 4OZCA 1V97A 4D2KA 2JX5A 4OZAA 4CHTB 1GAQB 2V4DA 5JEAH 1HZ5A 2F0JA 1D1IA 3AEDB 1NSNS 3SK4A 4X3UA 1IGCA 2KECA 3U9SA 2PPBC 1JOQA 1SYCA 2J7ZA 3I90A 5KGUA 1ILPA 3GS2A 1PFDA 1F9QA 2WXKA 1KAAA 4DAYA 2LEKA 4I7ZC 2V4IB 1TT2A 2JA7B 3GD7A 4HEDA 3HS0C 1L5PA 2KVMA 1KRHA 1MI0A 1EQVA 4RAUC 4XQQA 2WXQA 3MVVA 5BYRA 2EJMA 3QOJA 4XIGS 2XVSA 4UDUC 2PYKA 1MHXA 5CV5A 3KLSA 1YNND 1EM7A 4ODGA 4Q5VA 1XLQA 4ZYSA 1NVID 2H89B 2LS01 2EPBA 2A73B 1S5ED 3R8BA 1WWTA 3I91A 1JE4A 4RCNA 1W6JA 3OMCA 2GI9A 3VR5A 4FXDA 3S14B 1ICWA 3H8HA 1X32A 4LK1C 3KK7A 4IURA 1RF2D 2FMCA 3HKZB 3NE5B 1RCVD 2WACA 4O1NA 4XWWA 4OZBA 3OIQA 2JA8B 4JE3B 2SAKA 3J7AF 4ITKA 4G57A 2BA1A 1R9TB 2DY8A 1ZE3D 3MFYA 3MEHA 1I4XA 1DONA 1SE3A 2TMPA 1PTOD 1ET6A 2F4IA 4OO1I 1CHPD 2G9DA 4WJWA 1A3TA 4QCLA 1UAPA 3W3AA 5C4HA 5I9OA 1R4QB 4IKGA 1AZPA 2WINB 1MHHE 2QJLA 4FF1A 2BB5A 3AE4B 1KNEA 3QG1A 3VYRA 3AU7A 4EVOA 5I9PA 4K8IA 4CJ2C 3IAS1 1AN8A 4H44C 3IKJA 2V3PA 2INNE 3BVMA 1XCTL 4MACA 4XXEA 2I2YA 1C4PA 2F0EA 1GHKA 1JWBD 2N0SB 1XLOA 3J81L 2VXWA 4CBVA 4HROA 3TN2A 1Y69U 4A55A 1KDCA 3VR8B 5A2QE 3V3XA 3VR4A 1OQQA 2WP9B 3W2DA 5AUIA 2BE5C 3HVDA 2N55A 1A2UA 5IIFA 1N5WA 3BYYB 3WDNA 3M3YB 2IL8A 1EY5A 3VA7A 1EFID 4HN7A 1RM6C 3ZQ4A 1QNKA 4KJOA 3SE0A 2KEEA 3I3CA 4PMWA 2ID0A 3MJ5A 2XN9C 2RSNA 2H88B 4DNTB 5M5WB 2PLPA 2B76B 1A6XA 3BDLA 2PMZB 2YYZA 3J7AV 1BO0A 2FINB 3DWPA 5EE3A 3QB3A 4NDXA 3GTMB 4I65A 3KBGA 4ZRZA 1F77A 1KFYB 5C6AA 3J9CA 3TZDA 1J7BA 1DOKA 4FF3A 5JPMC 5LHY1 1V8CA 1L0YB 3NWTA 2ZW0A 1EYAA 2AWOA 3GQBA 3EA6A 1VDVA 1OO9B 4KGTA 1M8AA 3LNNA 3D4RA 2MPMA 4BBRB 1LACA 1Q1BA 2F0QA 4G7ZC 2KCNA 2WAQB 3EVQA 4ZUJA 1OQRA 4OIKA 2Z4HA 5JJZA 4LK0M 1DOXA 4TRDA 2BDOA 4YTNB 4IQZA 1MD2D 3OWEB 3VR2A 1SMYC 3D31A 4GLSC 1DGJA 2L52A 4KN4C 5IGFA 3TEWA 2E75C 3ND8A 1RDPD 5DM73 2EY1A 3VYUA 4KGRA 3H3VC 1ZDXA 2ICIA 4FO2A 5KNCA 5M3MB 2PKOA 3HOYB 1SNOA 2K05A 2EZVA 4EE2A 4U673 3WOFA 1LTAD 3AEGB 3I73A 3ND9A 2KCCA 3VR9B 4Z9CB 4F88A 2C9OA 3Q69A 1JB3A 2RA4A 1JALA 1I50B 3IT6B 1JQ4A 2BT6A 1K50A 1KNAA 1STEA 4B0EA 4DNRB 1ZXHA 4JK1C 1XF5L 3AEFB 3HOVB 3FKIB 1PDQA 4FYDA 1F2YA 5C4XB 2RQXA 4HCEA 2EY2A 2B63B 1B3AA 3NXWA 2EJGC 4G4KA 4ZRPA 3CQZB 1FNVA 4N58A 5FOBB 3I72A 2JXMB 5FO9B 1TS2A 4HSVA 1KF6B 4B9XA 4KJNA 3C46A 5EJWA 3I70A 3T51B 3Q23A 3OIPA 1PFNA 2L0CA 2J52A 4WURA 1EEFD 3T16A 2F0KA 1EY8A 2L12A 1E6EB 3JAML 2DYOA 1D4BA 1GHJA 1L4ZB 4K5WA 2WS3B 2BW2A 2PW9A 2XSCA 4ZAIA 1JORA 3P1HA 4L2YA 4PMBA 3DWMA 2E6XA 3VR6A 2E76C 5EE0A 5IODA 1TKYA 2KUMA 1JOKA 1B9NA 2EE1A 2B39A 3FILB 4KKTA 1HXYD 1E0ZA 4L63B 1U4LA 2BS2B 3P4SB 1ONLA 1GXDC 1UNSA 4PMCA 2TSSA 2BA0A 2PW5A 3A7LA 3P63A 3MXPA 1LTSD 3KF8A 1L6VA 4Y7NB 4KKSA 3Q0AA 4M0WA 1HRJA 3L3OC 4A3JB 1G2SA 4TKOB 4FXGC 5FO7B 3PO2B 1SNCA 4CKBA 4DAPA 2CJNA 1BQQT 3M7NA 4RGOS 1QE6A 2R7ZB 1Z7TA 1LT3D 1STBA 2FFKB 3I4LA 1XXGA 1TY2A 1PGAA 3K57A 2Q8TA 4IUNA 1HA6A 1YNTE 2XWBB 4H2AA 2V0GA 5CV9A 1WD1A 3FRPB 5EGTA 4A3GB 4HAEA 3HOXB 3AE8B 2D2CC 3IL8A 1WRIA 3GTJB 1JROA 3A7AB 3AE9B 3GO5A 5G5GA 1I4PA 1PRTB 2DNEA 2D5DA 1DCZA 1TY0A 4HMIA 5FR3A 2BYTA 1EU3A 2BBCA 4ZK9B 1X3QA 3E56A 4DN4M 2JYOA 3MP9A 5FLXL 1T5XD 2K3UA 3DWGC 4A9AA 2OF1A 2GRIA 2EXZA 1PLFA 3G7LA 2A68D 3EQLC 2HUGA 1WTPA 1JR0D 4A3BB 1QB5D 4CGYB 4DK1A 3DHQA 1UWMA 1L0XB 2PNRC 1GUGA 4LAAA 2JEAI 4N9PA 3DMUA 1ZPSA 3V2TA 1F2MA 1Y1VB 4KKIA 4OL7A 4C3JB 1EOTA 1PDXA 4DK0A 3Q8BA 1WTVA 1DOIA 2JWUA 5J22A 1E2ZA 5IGBA 2ZW1A 1L0VB 1CA6A 2LMCA 2A6ED 3LWEA 1VZ8A 5K5PA 2HCIA 1EL0A 4KD3A 4IUPA 2XRQD 4KD4A 3PV0A 4Q0FA 5CV6A 5I4DA 4F7XA 1M4VA 3SXHA 4YTMB 1FD6A 2LFIA 4A3DB 4YIJA 2E2HB 5A2QL 3DXJC 2DWQA 3K0YA 1XCQL 2KJXA 4LLGM 1PTOH 3R93A 1VCIA 2IT1A 1UEAB 3VYSA 3C1EA 2B2TA 1C4AA 2WXMA 1O7ZA 1NYQA 3O13A 1CM9A 1TQOA 2WXIA 5MPOA 3MXUA 4C2MB 5C3JB 2PQEA 1MI2A 4HJGE 3EJIA 4US8A 4LJZC 4QUFA 1S5DD 1EY9A 4J3OD 1WXQA 5DNFA 1J9OA 1RHPA 2JSVX 3NVYA 1KLGD 4RGTA 3T13A 1XLPA 1OFFA 1F2RC 3EUB2 5EBDA 4TQ1A 3AEBB 2D62A 5CYUA 2VNUD 4M1UB 1H9MA 4C3HG 1BUVT 4A93B 3IAYA 1HA5A 1U9RA 1XTCD 1TWGB 2DBYA 1J7AA 1UGJA 2FE8A 5IT9E 4G7OC 2VZKD 3LXFA 3NBHA 2L4NA 2I07B 5E4XA 5M9OA 3NVVA 1FXIA 2QIEB 4RGMA 4ZKCB 2ZT9C 2E2DC 3BZDB 1KTKA 4RKBA 4XDXA 4RF1A 2MEKA 3W5VB 2YEPF 4YWGG 3U52E 3K6OA 1G91A 2B2VA 3OW7A 2F0SA 2XRSD 2IGDA 2BDNA 2GB1A 3CIRB 1U4RA 4CJ1B 1TIID 1WTWA 2H4OA 1RYJA 1DM0B 1B1ZA 1VDZA 3T56B 4KHZA 2WXPA 3BIID 2E3TA 2IDYA 5IOCA 1N60A 5D3DA 2EYFA 4K8JA 2N9KA 2RDGA 3R3OA 4IUQA 1Q3LA 3C1FA 3L7ZC 5JAVA 3JAME 1SYDA 3S1RB 2R61A 1SMYD 4XQJA 1FIQA 1WSPA 1GUWA 2EYJA 3R2IA 4ULLA 3BK2A 2QMTA 2NZ1D 1I3QB 4C7ZA 4HSPA 5K36G 1DZ1A 2JYEA 3W1SA 3MFGA 1AW7A 2M9VA 2MUYA 2Z1CA 1AWDA 4YTPB 2FHTA 1STNA 2NMQA 3TUOA 2HDMA 2K28A 2J53A 3I9V1 3HUIA 2KWDA 3ZGZA 4EGVA 2RBMA 5ELCA 1O7LA 1PUTA 3TP8A 4XTCS 1FCLA 2K6AA 5KNBA 1E2WA 1ZKOA 3NVZA 5E3FA 1WTQA 1YJIA 4IN3A 4ABNA 3M4OB 4HKQA 5KEEA 3TZUA 3HRDD 2F0IA 5T8IA 2SOBA 3RMHA 4WAFA 4HCSA 1QNUA 2K9XA 5DEHA 1QOHA 4LTUA 2Y5PA 1ESFA 2OEOA 1EZ6A 3GTOB 3URYA 5IGDA 1FEHA 3N52A 2JSOA 3PUXA 3A56A 2L83A 3D6WA 4UAIA 2F0FA 2E2IB 5A35A 3DM1A 2F3VA 1EY4A 1TS4A 1JMLA 2Z4IA 3X3MA 3AE3B 1J7CA 3NVWA 5EQ0A 4MH8A 1ACCA 4KN7C 1WTRA 1G2TA 1O78A 4KY5A 2PIAA 1VJKA 4ARCA 5FK9C 5D14A 4REZA 2Y5CA 1I7HA 3BDCA 1V1OA 3FC4A 4CKEA 4MT5A 1STGA 1HCZA 1T5EA 1K8OA 4E6IA 4L23A 1JWAD 5ELEA 1TWAB 3AE1B 3HZXA 3RD4A 1JOOA 3SFEB 5TSSA 1VZ6A 3AMUA 3S9WA 4A3KB 3K7AB 3RZDB 5ISRA 1GOZA 3PUVA 4DA2A 1FO4A 2AQ3B 2N9LA 1R7SA 2K33A 3S2DB 4BA1I 3AEEB 3EGRA 3Q24A 1WTXA 1J8IA 4XE0A 4YT0B 1HUMA 2EDGA 3AE2B 1SNDA 1ROEA 1PTOB 2HQEA 2WP8J 1DD2A 1MVKA 1SE4A 3BVGA 3NTIA 5JEAJ 4A8XC 3K59A 1IGDA 4L1BA 1XYIA 2EELA 1X3PA 4KY6A 4ZHPA 3T4AC 2MHVA 4QUCA 3GTPB 1SDFA 4A3EB 5C3XA 4C3JG 1HTLD 1NR4A 2WDVB 1KLUD 2A68C 4XT1B 2HDEA 1G291 4FF2A 2C5CA 4JPSA 2OXPA 1EWCA 1MSHA 4ID6A 1LABA 2RDHA 2Q8IB 1NR2A 2J4XA 2WQYB 3NK9A 1YN3A 4ZQ3A 5ELBA 5KRUA 1GJXA 3FPPA 1PGXA 4KX6B 1H9KA 3VRBB 1RTOA 2JYTA 1LTRD 2J0TD 3DEPA 2IJ0A 3HOZB 5AFWA 1C48A 3P75A 2E74C 4WIPA 1H9SB 5G3LD 1WD0A 3FPUB 4KMUC 2RVLA 5JOBA 1F9PA 3I4NB 1I4HA 2MJ3A 2ZXOA 2NN6H 2NBFA 2FBWB 3PUWA 3D8GA 2F0OA 1LTTD 4C80A 2EJFC 1NCVA 3CHBD 4K5VA 1B9MA 1QG7A 1Z47A 1EWHA 2K5PA 1I4GA 1TKGA 5I6WA 1S5CD 3NSWA 1ZDVA 2M56B 1V8QA 1P7FA 4IZ8A 5FLXE 1BR9A 1BUIC 2B2YA 1RTNA 5EKIA 4IUVA 4HR7B 4OO1H 2L55A 3PMFA 1Y1WB 2NVQB 2F0TA 4NZLB 4ARIA 1E10A 4KV6A 2MJEA 2YU9B 2L1BA 4JWSC 4A3MB 1WCMB 3D3RA 3BVZA 2A5HA 1ML0D 1VZ7A 2NWGA 1RD9D 4G7HC 5CBEE 3ZJUA 1TS3A 2SNSA 3GP7A 1JC7A 3MXNA 4FP5D 1H9JA 3MWYW 1R4PB 3FMCA 3DWAA 2PMVA 4WFN3 4QB4A 3E0JA 1HPCA 1EU4A 1Y8PB 1B44D 4F8MA 2IW3A 2FJ2A 1DJRD 4JBWA 2B2WC 2IPKD 2CW0C 5CGKA 2M0AA 5JPNC 1SNMA 3LX0A 1BDOA 3F2UA 1PTOF 1RODA 3S16B 1EWYC 3PIP3 1CFMA 1RFKA 1JWMD 2A69D 1VLBA 3ERQA 2WB1B 4PQXA 1SXTA 3H91A 1PZJD 1MSGA 2QILA 3K5MA 1T3QA 1GB4A 3UI2A 3OHXC 4H13C 2WXOA 1SBBB 3SK6A 1AP0A