4RGNA

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
236
structure length
214
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 58
structure length 214
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgnA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgnA01
5FKAC 1D5MC 4TSSA 1T5XD 1PZJD 1LO5D 3O13A 1BCPF 3DWPA 1AN8A 2QEJC 3BZDB 5D3DA 1EU3A 1I4PA 1SJHD 1HA5A 1XXGA 1PTOD 2ICIA 1LLRD 5FK9C 1DYQA 1LTTD 1TY2A 2XNAC 2QILA 3R2TA 4RFBA 4RHSA 5I4DA 1L0YB 1DJRD 3BYTB 1YN4A 3BVMA 1I4XA 5ELBA 1CT1D 1KTKA 3EA6A 1ET6A 2WV6D 3EFXD 1PTOC 1LT6D 1D5ZC 1L0XB 3KLSX 1JCKB 1QILA 1S5DD 2NTTA 4ZYSA 1LTSD 1JR0D 1LT4D 2SEBD 1UNSA 1G8ZD 1V1OA 1STEA 1PRTB 1BCPD 4RH6A 3DWQA 1I4QA 1RF2D 2IJ0A 5TSSA 4K6LA 2O2LD 1BXTA 1CK1A 1FNVA 2IPKD 4NZLB 2XRSD 1RCVD 3CHBD 1M4VA 1LTRD 4RCOA 1PZID 4RHRA 1BCPC 2NTSA 2AQ1B 1EFID 1BCPB 1FD7D 1HQRD 1I4HA 1SE2A 1XTCD 1B1ZA 1PTOB 1HTLD 3OWEB 2RDHA 1S5FD 4L63B 1TS2A 3TSSA 5ELCA 1S5CD 1KLGD 5ELDA 1LTID 4L6TB 1JWMD 1UUPA 1HXYD 3SEBA 1I4RA 1EEID 3W2DA 2AQ2B 2CHBD 1FGBD 2G9HD 1I4GA 1TS3A 1F77A 1EEFD 1PRTF 4UDUC 3DWAA 1RDPD 1V1PA 2R61A 1D6EC 4RGNA 4DXGA 2XN9C 1YN3A 1LT3D 4RGTA 2Z8LA 1JQYD 2RDGA 3MC0B 1FNUA 1MD2D 3URYA 4Z9CB 3BVZA 3BYYB 1TY0A 1D5XC 3GP7A 2J4XA 1EWCA 1AW7A 1GOZA 1KLUD 1LTGD 1PTOH 1TS5A 3V05A 3R8BA 1JWSD 1LT5D 2TSSA 1ET9A 1YN5A 1FNWA 1ESFA 4OHJA 1PTOF 1JWUD 1ENFA 4O1NA 4RGOS 5ELFA 2AQ3B 1SXTA 1B44D 1TS4A 4DXFA 1PRTD 4C56C 1SBBB 1SJED 2XRQD 1CHQD 3BVGA 1PYWD 4RGMA 1SE3A 1SE4A 1EU4A 1CHPD 4BWGB 1RD9D 3MFGA 1S5BD 1CQVA 1LTBD 1LTAD 3R2IA 5D3IB 1PRTC 1PZKD 1S5ED 5ELEA 1SEBD 1V1PB
chains in the Genus database with same CATH superfamily
2B2VC 1T5XD 1D1IA 1LYLA 1H9MA 1JRUA 2WS3B 1BCPF 2LXKA 3I70A 2MHJA 3AYHB 1FR3A 2L05A 4CHKA 1EU3A 3VR4A 1HA5A 4HTHA 1W6JA 5E4XA 2QEXA 1EQVA 3CCEA 3K7UC 2BYFA 5AZFA 1RJTA 1FCLA 1Y8RC 2IT1A 4C2MH 2QKIC 3UI2A 2MJ3A 2W3RA 2PQAB 1ESRA 4NJ7A 1EQTA 2KACA 1O7IA 1WTVA 2B63B 2EELA 1L4ZB 4IOAA 3ZNID 2B2TA 4DXAB 1OO9B 1FD6A 1JR0D 2JX5A 3A74A 4LF5L 1ZDVA 1WRIA 2WXQA 4X57B 1PRTB 1RAXA 3VVWB 1VS0A 2LHEA 1BBXC 3PO2G 4X3KA 2FIFA 2K5WA 1DXMA 1QOAA 3QX1A 4A3JB 2ZTDA 4R4QA 1QQRA 1JB7A 1FNVA 5J3BA 3AE2B 2IL8A 4MGKE 4W9HA 3M4OH 4EQOA 1NMFA 3IT6B 1NYRA 3QHTA 1PZID 2F0JA 2CW0D 1WJNA 1OXSC 2ZZPB 3UIPB 3VQIA 3RZWC 1BCPB 1BQQT 4DUZQ 4YWGG 3S24A 4JI3L 3ERSX 4GU2A 3KVFB 1IZ6A 1N8RC 1Q7YC 5C3EH 2F0KA 1PDQA 4BKSD 4A3FB 2N1WA 2MPMA 1Y1VB 3EC8A 3D3RA 4B6WA 3J7ZC 1VQ6A 4GDLA 2F03A 2GBKA 4BBRH 2GA4B 2G4DB 2KHIA 1KNAA 3HVDA 4BBNF 4L6TB 4JYAL 1E5WA 1EEID 1CTMA 2WXIA 3NZSA 4APVA 4FF2A 2CCZA 4MZ9A 1TS3A 1EEFD 2R6GA 4UY8C 4UDUC 4K3BA 2ZW1A 4Y7NB 1V1PA 5COYA 1TTNA 1M94A 3AU7A 1GVPA 2W82A 4KDIC 5M5XH 2W54A 3VTVA 4DV0Q 1PA6A 1E9MA 4K81A 1GXDC 3P42A 1KM7A 3W1YA 1UEAB 2Z6KA 5G3LD 4B3TL 3P63A 4NXNQ 5CBAE 1HTOA 3HP3A 4R8IA 1SR3A 2MP1A 4CDDC 1PH8A 1C4PA 1KLUD 2Q5WD 4EUTA 2WXOA 2LKVA 1FYCA 4ZRZA 3RN2A 2F3WA 4JGHB 4IUTA 1YNXA 1ET9A 1R4MI 3DDCB 3U7ZA 4JV5L 1T0RC 2UYZB 3O65B 4OHJA 2KZRA 1K83H 4PS3A 2JA5B 2KXJA 3B6YA 4XWTA 4URKA 1NJIC 1EZ6A 2J0KA 4JI1L 1EYDA 1YNTE 1E1TA 4A3MH 4L5RC 4NKLA 4KN4C 4GDKB 3KDFB 1A2TA 2PI2E 3ZUNA 3ZQ4A 3UDFA 3BK1A 1RD9D 4K2KA 2PEAA 4BVUC 1DOXA 3DLLA 2KDFB 1HA6A 3I4NB 1XQQA 1WXQA 4C3HH 2LUEA 1XMOQ 2N8NA 1D5MC 3K5OA 4DNTB 5I2YA 1Q82C 2OQ0A 3S14B 2H88B 1IBMQ 4BY1B 3CMEA 1STHA 2BGFA 2Y3AA 2EY5A 4NAWB 2JYTA 5DPTA 3CSTA 2O6VB 2JYEA 2XNAC 3WAOA 1BUVT 3C1FA 4ACFA 4BZAA 2KCMA 3ZW3A 4P73A 3N9YC 4LUVA 2E2JH 3L08A 4IWOA 1RFKA 4EKUA 4NJCA 1BBWA 3S2DB 4O2DA 1JOKA 3PUZA 1ZDXA 3EUB2 1LTSD 1XPUA 1VDVA 1EWYC 4WJ4A 1Z9FA 2KANA 1Z2MA 2XK5B 1JE4A 3I9V1 4DHJD 1UNSA 1B9RA 1QG7A 2QW7A 3IFDA 5EKKA 1MHHE 2HCCA 5C44H 4K0KL 2OEDA 1VR9A 4ANVA 4MEMA 2IJ0A 3L3OC 3ETRA 3SFDB 2F0QA 2E75C 3DM3A 1IBKQ 2N9PC 4DF7A 4AQ7A 1QOGA 1SN8A 2EXZA 3I7FA 2K8HA 3OJ3A 4IPDA 1HR0L 1A62A 2L1BA 3Q8CA 4LDTD 4DV6L 4MGZE 2AQ1B 5E7NA 4A93G 2PPHA 4RG1A 3TEWA 1GHJA 1SGHA 4R3DA 1I5FA 2WFWA 1EWHA 2M4NA 3VR8B 3ZXVA 2DJFC 3UE1A 1EY6A 2KQSA 3OYYA 2KQ7A 4ZRQA 3P7JA 1SE9A 1WGRA 2ZVNA 5BR8Q 3CC2A 5IT9c 1F0ZA 3M3YB 1NAPA 3EBEA 2EYFA 4YWKA 4A3CG 1TS2A 4K8JA 2V4LA 4LNOA 2A5HA 3U58A 2H89B 4WQMA 2RMMA 1HR0W 1U4PA 3ULLA 5CV8A 2JWZA 3IFTA 3PO2H 3H09A 4DR1Q 1XX8A 1WE7A 3I63C 4YHHL 2KYWA 2WHIA 2PIAA 4LNKA 2CS4A 4MGYE 2KEEA 4IO9A 2NVQB 4IC7B 4GNXA 1WTXA 1WYDA 2A6EC 4LUZA 2BCOA 4C1NK 3AMUA 4X66L 2PJHA 4E71A 1T6BX 1FRDA 1HPCA 4OO1G 4JL9A 4ASWC 4QJFA 3K0XA 3PZ7A 2G3QB 2D07B 1R7SA 3ZLZA 1D5XC 1F2LA 3K58A 5BMIA 4X65Q 1I3QH 3HG9A 2V3PA 4J6IA 1UZXB 4TKOB 1V49A 4HR7B 5IIFA 3OHXC 3G6JB 4G7HC 3QCAA 2RSOA 1ENFA 3FC4A 5C0XJ 3ULJA 2QDFA 2JQOA 3KWLA 2KC2A 4TMAB 1WCMB 1KRHA 2J42A 5BMHA 3TS2A 3LYYA 4JE3B 2M2LA 3PGZA 4PNYA 3VR5A 3VRAB 4XYQA 3VYRA 3S1RB 3S1QB 2JWUA 4FO2A 5HGQA 2L76A 4AH6A 4BY7H 2DZJA 3Q3NC 1UBQA 5D3IB 3M7NA 1IHZA 2KLGA 4NMZA 1SEBD 4RAUC 4R4TA 1K9MC 3RZOB 3AI5A 2OXPA 1XNQQ 2M00A 1U4RA 3IG3A 4XC2A 4TQUS 1B9MA 3W1BA 2LHDA 3FAHA 1E3PA 2ZTEA 1DGSA 2A8VA 1PTOD 4GN5A 4DNRB 1KAAA 1DJRD 1B50A 1WGGA 2A74C 2K5PA 2KA7A 4TV3A 3PLUA 1GUSA 1YBYA 3EA6A 1RWSA 4HEA1 1GHKA 4IOIE 1SDFA 1HRJA 3JVZX 4A3EB 1V80A 2LUMA 4ZUJA 3NS8A 2NTTA 4KJNA 2K5DA 5JVH3 1ZXHA 2BS2B 2UWQA 2X8XX 2OTJA 4XDCA 1PH2A 3S16B 1HNWL 2V9HA 3IL8A 2B2UC 4W9KA 4C4VB 1CMXB 3AU5A 3DWQA 4DV2L 3FKIB 2FUHB 2I5MX 4FF4A 4WAFA 1Y56A 2HIXA 4FYDA 5EE9A 3RD2A 3GTQB 2RKSA 4IALA 1Y8PB 4FADA 3DBHI 2AL3A 1JJ2A 3BWUD 1BCPC 4BBSG 4RKLA 3U2SC 2K03A 4KN7C 2L0FA 3JSVB 4ZQ3A 2CH4W 4X62L 1SFOH 3EQLC 1KH0A 2D3BA 3VAWA 1TIFA 3E9IA 4KD4A 3K5LA 4KSLC 5EBDA 1B1ZA 3GTGB 1E8XA 2KWUB 4HKZE 1ENAA 1MJEA 2O6VA 3OMGA 4G4KA 3WA0A 4K14A 1YNNC 1WI0A 2O5IC 1GD7A 2WXHA 4P16A 2MA9B 2Z4HA 2B3AA 3NVVA 2N1VA 2UU9L 4BFRA 1LTLA 4HDQA 4HSPA 1I6HH 2UXBQ 4WJNA 3BDCA 2N9XA 2KWDA 3A8KE 3OSOA 2R92G 2QGQA 2WQYB 2HHHQ 4A3GG 4LLGM 1EOTA 4WRDA 3I73A 3VR9B 2QCZA 1R9TB 1E22A 2RPQA 2AMCB 3E0JA 1N36L 2DAJA 1VMPA 5GADC 1CSQA 3OIQA 2R61A 4KHZA 2AWTA 3RZFA 1D1KA 2KBNA 2RHSB 3GTJB 2LSSA 2RDGA 5H92C 3M3JA 4JI7L 2JZZA 2O2VA 4G11A 3CW2C 1XNRQ 4ZHPA 3H6NA 4AYBB 2JRHA 2L32A 5GAEC 2RDFA 3JYUA 3R8BA 4KMUC 1RTOA 1TWCB 4A3CH 4YT0B 5LHY1 4V190 3R3OA 5JPNC 2AEHA 1QOHA 2F0DA 1JWUD 4ULLA 3CQZB 2C60A 3A33B 1B44D 2N3SA 4JI5Q 2NVXB 1WFYA 4HIKA 1GO3E 3BG3A 3NQTA 3RNEC 4BBNC 4DV4L 2A4ZA 2IGDA 2MBEA 1HZAA 1G291 3L2PA 2BYEA 5KYLA 2NPTA 1MG8A 2Q8TA 1EM7A 4LF8L 1K51A 3A54A 2LZ6A 3Q3MC 4ANWA 2VQEQ 4LNQA 2WGSA 3PIPA 4G3XB 1E10A 3T1HQ 2J53A 5ELEA 4DR5L 4GOPC 1MFWA 4JI8Q 1K8AC 5FK9C 4LWCA 2MH7A 3AEBB 1Y1WB 2R93G 3FILB 2BH2A 3S1MB 3DBLI 5C4JH 4E6IA 2YTXA 2E74C 2BE5D 1TXYA 4NDXA 3M85A 4US8A 2EYOA 1AZQA 1IKMA 1UD7A 2MBBB 4CYEA 2WU2B 2KAJA 4IUPA 2LEKA 1ZYRC 1L0YB 2JN4A 4JPBW 3H3VH 3I4MB 2IO2B 3U8ZA 1ICFB 2KJRA 5I2XA 3GV6A 1N5XA 3J7YW 3D6CA 1PLFA 2KVMA 1UE6A 4DV7Q 4A3IB 3EFXD 1IBLQ 1C3TA 3HOXG 5D14A 2F0VA 2K7VA 1YJWA 2VH1A 3CPWA 3PZ8A 1UE7A 1SSOA 2L0TA 2B2YA 3H7PA 2NR2A 1HHVA 3HK0A 1O80A 5IP4D 2MHVA 1TT5B 3ZNZB 2ZW0A 1I4QA 5H1SE 4OIJA 2DN8A 4GN3B 1KLVA 2WXJA 2WWZA 1WFQA 3FDTA 3NG0A 2UUAL 2YU9H 3C46A 4CO7A 2TMPA 3R7RA 3DVGX 2LI5A 1K0SA 5H8YE 1G6JA 3AFQA 3SHQA 1EFID 3AEAB 1HQRD 4AQYQ 1HTPA 1XLPA 1TWAH 1SMYC 1LACA 1GJZA 4B3RL 3A8IE 2JA7G 5GMVA 3DBLB 3IRBA 3TN2A 2PCFB 2FBWB 1QVFA 3DPDA 4R4IA 2XGTA 5C5LA 4DV3Q 1AE2A 2CHXA 2K25A 1XEEA 3MZ5A 4GMVA 3QARA 4C7YA 2DNFA 2L1AA 3SXHA 4A3BG 1Z5SB 4DV1Q 5CV9A 4MACA 1WI5A 4C3JH 3DHHC 2HDMA 4RCNA 4CKCA 2A69C 2SDFA 5M3MG 3MXNB 2CVRA 3A1QB 2QDBA 3U4EG 3L17A 4FF1A 1JT8A 5FLXc 3CWIA 4YCVA 2Z8LA 1PVOA 2HQLA 2KEDA 1FM0D 4H02A 1C77A 1YJIA 3BVZA 2UXDL 2P5ZX 2Z4IA 1J5EL 1ISNA 2YEPB 3V60A 2EYHA 4C3IG 3R66C 1IXRA 3SGIA 4JBMA 3X3NA 1P0RA 4IUNA 3V05A 3JSVA 2D2CC 1YJ1A 3BZCA 1LQBA 1JJGA 4M01A 3I8ZA 1G91A 2ZT9C 3KJOA 1EYCA 4XGAB 4RA8A 1VQAA 4DXFA 1WM2A 3TP7A 1PRTD 3FPPA 5E3FA 2R92H 2ENBA 4JVZA 3GDEA 3IT4B 3C0RB 3E5SA 5IODA 2JPHA 1XPRA 3Q3FA 2N9KA 3AECB 1OQRA 2KLCA 3R3MA 1Q3LA 1YHBA 1AFPA 2L11A 3KUCB 1C79A 1C8CA 3QJZA 1IGCA 1PMRA 2DAFA 5IWAL 4KKJA 2WKDA 3TCAA 4QY7A 4GB9A 1PH3A 1PZJD 1XTDA 4O0AA 5C4XB 1MJDA 1RYJA 5ELNA 1V6EA 1ZKOA 3NHEB 3FVQA 1I6VC 1SF0A 2JVCA 1YI2A 4W9GA 5G55A 1VQIA 1TY2A 4DR7L 3D4RA 3GO5A 3VFKA 2IX3A 4RM8A 2VUMG 4CJ0B 1NMGA 1SE8A 3BVMA 3B1LX 4A76A 2INCC 1G6ZA 2N7DA 3ZTDA 4DR3Q 3PLVA 4KX6B 2ZXOA 4H13C 4MGIE 2FMMA 1JORA 1OEYA 5DLQE 1VD2A 3OPOA 3RLFA 3UI3A 4LJZC 3H0GG 3C3LA 3PO3G 1HUNA 4ZRKA 3NVWA 4ZLTF 5C3XA 1H95A 1N34L 4YY3L 3N3KB 4K5XA 1OTCA 5EKLA 1VQ7A 1L6UA 1QE6A 4JG2A 1C76A 3MHSD 5AUKA 4FBJB 2R93H 1NBWA 3OTOL 1Z7TA 4HWIB 1YQ4B 2CKHB 1A63A 4YSZB 4HJ7A 3CHBD 4MTKA 4JI3Q 1LTRD 5HURA 1KRSA 4DV5Q 2M8SA 2JE6I 2QMTA 2Y5PA 5FLXE 3M63B 1HCZA 1N5WA 4HCSA 1AP0A 2KK8A 3FILA 3J80E 2GB1A 3Q0AA 1XCQL 1PH9A 2D5DA 2IHEA 3CPFA 5C3EG 3HOXH 2INPE 2L83A 3QG1A 3H94A 1WD0A 4JYAQ 2M0XA 2RDHA 3JAMi 2BWES 3B0AA 4UPAA 4KKUA 4BBRG 4NPSA 3NVYA 1NR4A 4IFDH 3Q22A 4TUUA 3VYSA 3RZDB 1QZEA 4G50A 3W5OA 2WAQE 2ACZB 1M1KC 3VTUA 3QIAA 4UP7A 1FJGL 2Y0SE 1N33L 2K39A 3H1UA 3ML9A 2CQAA 1X65A 5ELOA 5IGEA 1UWMA 3TMEA 4DAPA 4B3MQ 2M56B 2MSED 5M3FG 1D4BA 3TEHB 3L4PA 3WANA 2HIVA 4V0BA 3WOEA 2VS1A 4H0LC 2O6VD 4EQPA 4JOIC 2B2VA 2XN9C 4BXXG 1E7ZA 2XIWA 2CKZB 4MTNA 1MSGA 3RLNA 1NYQA 2C5LC 2KD0A 2N49A 5D7GA 4HCPB 1VQCA 2MQHA 5GROA 4LMQD 3E9SA 1JB3A 1YMHE 3AMZA 1VQ4A 3HEJA 1JOOA 1LTGD 1TS5A 2WAQG 3WOFA 2KVRA 4JI1Q 1XCTL 5JHAA 4YWLA 2PKOA 3EJIA 2AHOB 3PQIA 3CCJA 1WM3A 2Y0SG 2M9VA 3G4SA 4LW1A 5AFWA 5CV5A 1L1OC 1TS4A 1PXUA 1S3SG 2E8GA 1NCVA 1L7YA 2RCFA 4W9IA 2BS3B 5IGCA 5HGTA 4GKJL 5M3MH 2D9UA 2N78A 3K9PB 5EPLA 3NVZA 2KO3A 4EVOA 3A7LA 4UAIA 5FLXL 3ZDMC 4OX9L 4ODGA 1CKOA 1QUQB 2X6LA 3D6WA 5C0XI 1XPOA 2BF8B 2CH4A 5LMNW 4M00A 1FXAA 3V62A 5TR5A 3J80L 4MELA 1J0GA 1VRAB 4WJQA 3N6RA 2UUCL 1E8ZA 1LO5D 2Q2IA 4C3IH 4D2KA 4DAVA 1SYBA 3MXNA 4A3KB 1A3UA 3VDZA 5JEAH 4C80A 3L0WB 1XYIA 1TWHH 5BN5A 1TGZB 3GE8C 3E3XA 1UWVA 1BNZA 3HOUG 5CMDA 2ATWA 1YN4A 2JXXA 4KHPQ 2PZUA 2REXA 3I91A 5KNCA 1WXAA 1BF4A 4US9A 1A6XA 4QUCA 4IG7B 4EZLA 4JI6L 4BOZB 2BWFA 5CX3A 2Z0SA 4K6DA 4S3SA 4WJWA 3HOYB 3Q8BA 3NRZA 3QR8A 3VUWA 4QIWB 4N6EB 5G2NA 1CKNB 2KX3A 4A3LG 3OAWA 1VDZA 4AJYB 2QCPX 2CHZA 1JJCB 2KFKB 5CV6A 1RF2D 1HR0Q 3S1NH 3VUXA 5C1ZA 2KTRB 1C9OA 4USAA 2EY2A 1CQFA 3TZUA 5IE8A 3AFPA 1ZP0B 1EFWA 1Q12A 4ZUIA 2X38A 1WGDA 1D8LA 1VZ8A 4JLCA 2SNSA 2WB1B 5JPMC 2VUMH 4KKIA 3ZRFA 2ZPYA 2LFIA 3AE8B 1YQBA 4LJOB 3KLWA 3A7AB 5EE1A 1FPYA 1B9NA 5C6AA 3RR5A 3FKYA 1XTCD 1IUEA 4CDEC 1Q10A 3D4DA 3CCRA 1WR1A 1DOYA 1NNXA 4JI2L 4KI0A 1IL8A 3H0GH 1KDBA 3PO3H 1MSHA 3H3VC 4WFN3 4G57A 1X3PA 1MPEA 3OIPA 1KLGD 1MBYA 5ELDA 1WTPA 4ZHOA 3PUYA 4CGYB 4EGVA 1HXYD 2INNE 3A8JE 5C3WA 3QIJA 3WAPA 3EGRA 1WYGA 1YITA 3BK2A 1WX9A 4X66Q 3N1XC 3PRMB 3RFZB 2SAKA 5BYRA 3HS0C 2KHJA 4JI0Q 3DEPA 3S2HH 2JSVX 2RGFA 1RDPD 4OWWB 4GXBA 4K2LA 1VQKA 2JEAI 4B9WA 1KL9A 3HOWG 2A73B 5IGFA 1AZPA 4X6AH 1NDDA 4XIGS 1KC8C 4LF4Q 5M5YH 2LMCB 3GP7A 3MTSA 3Q24A 5KNDA 4PS7A 1P1AA 4LFBQ 3HM3A 2ASQA 2N7EA 1LT5D 3GTMH 4C2MB 3HRDD 2E2DC 3S2AA 1IW7D 1GC7A 1HNZQ 1HZBA 1UELA 1E8YA 4IW0A 4F8MA 1HJPA 4DR6L 2KTFA 4M1UB 2PMZB 3KFUA 2KCCA 1MJCA 2GBRA 4EOYA 1CHQD 3ND8A 1PYWD 2N0SB 2ZVOA 3T8MA 5J2RA 3PIOA 3UQAA 5DM63 1J9OA 2CU3A 5M3FH 4LNIA 2F0MA 3ZNGC 1JC7A 1I35A 4BY7G 3GB1A 4DK6C 4HPLB 3SE0A 4K7UA 1N61A 4XYCA 4BXXH 4EQNA 2MJEA 5D94A 5IGBA 5L83A 1VQHA 3KUPA 2EY6A 1WMHA 5EDSA 3SDZA 1N32L 1XMQQ 1SIFA 3HIZA 1R4QB 1Q1OA 2WXNA 2Z0DB 3M4OB 3PO0A 3KUZA 3NE5B 3JAMc 4B9KA 5GAHC 1DYQA 4PS8A 2W55A 3S14H 2LY7A 3JW0X 2K4KA 3BYTB 1I4XA 2B76B 2NBVB 2VZKD 1CT1D 3KF6A 1SNDA 2B3GA 5CYUA 1PDXA 5LLIA 2A68D 1IPGA 3TL5A 3T51B 4PMCA 1GG3A 2R2QA 1ML0D 4IUUA 2MP2A 1N9WA 1O7ZA 5J1ZA 1VQEA 1YIJA 2WXRA 1I50H 1WX8A 1ZXTA 4DV2Q 2MUYA 1KQSA 3AE9B 2BW2A 1K8OA 4FVMA 2CWPA 2MJ8A 1ZOYB 4RF1A 5HG2A 4OW0A 3F1ZA 4GOPB 2VB2X 3TUOA 3N1YC 3K5MA 2EMTA 1WY8A 4X62Q 4I65A 1ZKHA 2G4SA 3ZIMA 4HCEA 4BS9A 3PT2B 4REZA 2KUMA 3CF6E 5M5XB 4LF7Q 1NI3A 3MJ5A 2PE6B 2FHTA 4RHRA 3HOUH 1E1OA 2NTSA 2VY3A 1HZ6A 4HIDA 4AP4C 1J19A 3Q69A 3KLRA 2IO1B 4LNNA 4X64Q 3MAQA 1VQBA 3CRLC 3MEHA 4M8NA 4ANUA 2VXWA 2XEWA 4HLEA 3DQVA 1L2NA 2WIIB 2UU9Q 1UH6A 1IP9A 1R4PB 4IWPA 1M90C 4A3LH 1K83B 4KKTA 2K9XA 1TWFH 1KDCA 1Q86C 3I56A 4GKKL 1WWTA 3NPPA 2XTIA 4JBJA 3I3TB 4KHVA 1I4RA 1TWGH 3K59A 4FJZA 1FGBD 2HQEA 1I4GA 4Q0FA 2F4VL 3Q3JA 5LMUL 2JA6B 3HUIA 1CKNA 1FGUA 2KKCA 3D31A 1EIFA 2A6HD 4C3HB 1II3A 2KFKA 1MHXA 4LTUA 3PS6A 3HOVG 1P9DU 1AE3A 4IFDJ 2XWJB 1YJJA 3TJPA 2DYMA 2KTRA 4K7SA 2PZTA 3NOBA 3ONSA 1MD2D 4CBVA 3JAME 4Z9CB 1BMLC 4J6HA 4IZ8A 2F0IA 1A5RA 3AN1A 4HKQA 4LFCL 3CCVA 1JROA 2LGYA 3A55A 1VQOA 3I4LA 4DNIA 2E2HH 3CMMB 3NENA 1D7QA 3HOZG 2E2JB 2PQAA 1D2BA 1WTOA 2ICEC 1K3BC 3W9CB 4YTNB 4S0RA 5BYSA 3IVFA 5HHDG 1BBUA 5A2QE 1QLBB 2UUBL 5G5GA 3BVGA 2XRQD 5KEEA 1UAPA 2MBQA 3MFGA 2YLMA 2WDVB 5AZHA 1QJOA 2B2UA 4DUYQ 1AH9A 3HOWH 1VQJA 3Q6BA 4X3UA 1P7EA 1TKEA 1EY4A 1IBXB 3KWVA 1G2SA 2I1KA 4HPMB 1S40A 1S3OA 2IX1A 5FKAC 4XQQA 2QSDA 4TKNA 3T3NA 5LNK1 1RKNA 4BOSC 1VQFA 5EGTA 2RBMA 1E8WA 1FXIA 4BKTA 2L52A 5D3DA 3MHBA 3GZNB 1GUAB 1C48A 2BTEA 2EJGC 3F8TA 1A8VA 1RLFA 2LGIA 2QJLA 4M8AA 3PF5A 4JI4L 3SDLC 2FFKB 2AWNA 3T56B 1WRDB 3GTPB 3KJPA 3J81i 4LNFA 1L2FA 1WYWB 4MM3B 4RF0A 1CFMA 3G7LA 5BO4B 2CR5A 4XQJA 1O7YA 2DY7A 1QCBD 1X3GA 4BA1I 5C5MA 3NP8A 5JEAJ 1SYGA 1G51A 2VW9A 4DUZL 5FOBB 1ASYA 2MQJA 3HKZE 2L7RA 1XWEA 2W3SA 4LF9Q 3QJYA 3K5NA 1ZW7A 2NB0A 1ILQA 3PO2B 1OTRB 2WX1A 1SNOA 1S4ZA 4UHVA 1W2BA 2UUAQ 3CCLA 4GZYC 2JZ3B 2J0TD 3IAS1 3JAML 5E6PA 3MJWA 2V4IB 5ISRA 1S1QB 2KJHB 3APDA 5DAUA 4FXGC 2KDMA 1U4AA 3FHWA 2VQFQ 1NEKB 1AEXA 2AUJD 4NZLB 2UXCQ 3UDXA 3G71A 3FKIH 2NBWB 4G7OC 1EYAA 2QDLA 4POFA 2HJ1A 4PYZA 4HRSA 4M02A 2FCMA 3TMPB 4YTMB 2Q2UA 1Q1BA 5IT9E 5A2QL 4W9CA 3HKZG 1I3QB 1KHIA 2JF5A 2NMQA 3MWYW 3BDLA 3DXJC 1FO4A 3NXWA 5AJ3Q 5EJWA 3CP0A 1R4NI 5G3LF 4CHTB 3J7AV 5HFYA 5K5PA 2K04A 4XYOA 4L63B 2B39A 3STBC 1WTHA 5L37A 1TR5A 4GDKA 1GNUA 2BPSA 3CF5A 3KDFA 3I55A 3ZJYC 1HQMC 4OVUA 4NXNL 5FR3A 1JWMD 2D62A 1QOFA 2GMIC 1WR6E 3B2FA 4C3JG 2KHSA 1SNPA 3AE1B 1LM0A 3H6MA 2CHBD 3D8GA 4WURA 2G9HD 3ICEA 4N9F4 1DOMA 3P4QB 4AIMA 4FN2A 3UINB 2PNHA 1E90A 3GTOH 4GOPA 4LFAQ 4XWWA 3VR3A 1WJJA 1OGWA 3WAMA 2MW5A 1RM6C 1HTQA 1R9TH 4K8IA 1WTRA 3MC0B 4NAWA 4GNXC 3OMCA 3SK5A 3K8AA 4F1SA 4QMGA 4HMIA 1G2TA 1STGA 1TY0A 1RHPA 2NN6I 3RD4A 2LJIA 2N9LA 2I2YA 1XT9B 1EWCA 2DGYA 4DAYB 3VXWA 3X23A 3TP5A 3E9HA 1VZ6A 4HJ5A 1KRTA 1K3RA 2TSSA 3W1SC 1B2TA 1XMOL 4KSKC 1TIID 4JW0A 1E6EB 1TKYA 4KIKB 2AQ3B 1Q90A 1TWCH 3NTKA 1JICA 1F2RC 3W5UB 4YCUA 2N7JA 1VQLA 2XK5A 1R4NB 3L10B 3CQZH 4K3CA 4PYUA 1PV4A 2LRWA 2KFJA 1K28A 3OW2A 3C1EA 3M4PA 1CHPD 1FVIA 2NWGA 2XBBC 3T3OA 1Q0WB 2OJWA 1PH4A 3HOVH 1TKGA 3NWSA 1HNXL 4S17A 5IT9L 4BAXA 4DR7Q 3KW5B 3LB8C 4QL5A 2OEOA 2AWOA 5JVG3 3H91A 2RR9A 4CKBA 1AN8A 1X56A 4ALPA 1X6OA 3HOZH 1Y1WH 1SFOB 2AL6A 2JU6X 3Q3OC 5D2MB 3EVQA 4RHSA 5DCNA 3P20A 1YNJC 3VA5A 5M5WH 4A3OA 3K57A 3I90A 3ABVB 3TBLD 1L1OB 2Z1CA 1QZGA 3DHQA 4U673 3ONAB 1U9RA 1IBKL 3GTKB 3EHVA 3I5JC 4II2B 3I4MH 3P2BA 1EO6A 3H15A 4YY3Q 4FP5D 1X3EA 4B0EA 4A3IH 2CU1A 2I5LX 2SEBD 2IDYA 4FXCA 1I6HB 3BJUA 4OO1I 1WZ3A 1BDOA 1SYCA 4R8NA 2BA0A 2L15A 4P75A 4NY0A 3RCZA 2PVGC 1BT0A 2E5LQ 4IJLA 3CCMA 5DNFA 2CWAA 1UGJA 2H4OA 2K1BA 2EY1A 1B4OA 2L5TA 2IPKD 5I9OA 3K9OB 3T13A 4A93B 3T4AC 1K73C 1H9SB 5D6JB 5CORA 3U4ZA 4ZK9B 2BOSA 3H3VI 5J18A 4J15A 3QAQA 1IBXA 3X3MA 1PFNA 3I2ZA 4DR1L 1LFDA 2F1MA 2K50A 1SRUA 3PV0A 1SSNA 2LASA 5C2TB 3U52E 1KOTA 3P75A 3GD7A 3S15H 1SNQA 1GUNA 1BO0A 1ZE3D 2C7NB 1STBA 2FUG1 3P1MA 4IDIA 3K7AH 2GBNA 3UF8A 4A55A 4ID6A 3M4QA 4A3DG 2F0OA 2NZHA 2VH2A 1GPXA 4IFDG 2KC1A 1V86A 1C4QA 1S5CD 1SYFA 1N33Q 2IY1B 3DWGC 4FXKC 2LS01 1A3VA 3N1ZC 3QK0A 3KUDB 4IPGA 1E24A 1WTQA 1L6VA 1WIAA 2OWOA 2A6ED 4KGSA 4XDDA 5IN7A 5E1FA 4K5VA 1BOSA 1SB3C 2LXCA 4BA2I 2G9DA 3RLOA 4GSWA 3ZVVA 5EAYA 2I1JA 3Q8EA 2BDNA 3DEOA 3PCOB 4FNFA 2KENA 1DOIA 2K5VA 2LGDA 1P16A 4JQWC 4RGNA 4QGUA 4NXMQ 4DHZB 3J81c 2NCNA 3TP6A 3T1YQ 2RSNA 1VZ7A 1CUKA 5LMNQ 4OVZA 4DU9A 5C4JB 3URYA 4LK0M 1OXUA 1V8CA 5CBEE 1QT9A 5JJZA 2JXTA 1KD1C 4OZAA 5FLMG 1OXXK 1GOZA 2NUCA 2FCNA 2WLBA 4FHJA 1PTOH 1PH1A 1C78A 1B70B 1SNMA 4LF6Q 4JX1C 2UU7A 2JA8G 1RTNA 2HD3A 2FJ2A 1HZCA 3DM1A 1XNQL 1PTOF 1JW9D 4N8X1 4CKEA 1PGBA 1JQ4A 5JJKA 3MA2B 3RNUA 2EE1A 4B3SL 1F52A 4C56C 4MIUA 1OXTA 4MN3A 2Q8IB 2R7ZG 2GLSA 5DPSA 2PQEA 3DHGC 3S9WA 4DK5A 3J9CA 3R7QA 2K32A 1ZEQX 2PO4A 2UUCQ 4N8FA 3SD5A 4C4VA 4ANXA 1CQVA 1EF5A 4GLXA 3S17H 5A35A 2PE9A 3KBGA 3A4SC 4KV2A 3ZXRA 4A9AA 4AS1A 1GUTA 4RWSC 5JZEB 1OFFA 4QCLA 2K1FA 4NP5A 2M19A 1I94L 3HM6X 3B2GA 2NS5A 5JEAG 1I7HA 3GQBA 4HSVA 1ZPSA 3Q14C 3RULA 4WJ3M 3T9LA 1DCZA 3C8YA 1RODA 3TREA 5FO8B 5C4XH 1TWAB 2QILA 4P74A 4OONA 3Q23A 3T53B 4JI6Q 2QF7A 3H9DA 4FHKA 5ELBA 1PH5A 3ALBA 5F2DA 4AOFA 2V1CC 4XE0A 3GTLH 1F9JA 3PRPB 1STNA 3MFYA 3AE4B 5HY6A 2PLPA 2KNBA 2K52A 2E2IB 2ZM6L 3NUHB 1JCKB 1QILA 5J17A 1A0IA 2GVAA 5K36G 3BINA 2B63G 4KIKA 2F0PA 1Q46A 5LL6X 3APCA 1QVGA 3SVMA 1TJEA 2K8BA 2WXGA 1BCPD 3UGBB 4R1JA 2NVTH 3MC8A 4JK1C 2B2YC 5TSSA 4KY6A 2L9HA 3CAMA 2O2LD 2GI9A 1GKHA 2KHWB 4B0MA 4BBSB 2XRSD 3RN9C 3MHZA 4A3JG 1EIYB 3FP9A 1M8AA 4JOIA 2J52A 4IKGA 1TQOA 3K0YA 5EPJA 2ZJQA 2WXPA 2WXMA 4XQNA 1JMLA 1YNND 3KF8B 4JI2Q 5M9OA 2KVZA 2QHOA 2KQ4X 3EECA 4DDGD 1X55A 2F0EA 4ZKCB 4DA2A 2HHHL 4LF5Q 2Z59B 4WWMA 3TEYA 3RPFC 1XLNA 1V8QA 2K3UA 2PI2A 1VQPA 1JWAD 2YVCA 2KECA 2ZEQA 5T8IA 2V0GA 2ZXPA 1MG4A 2BB6A 3AB5A 2CW0C 3K6OA 1NUCA 3AQQA 3LGJA 1ZGUB 4N59A 5JOBA 3UQBA 1VMCA 2EYMA 2BB5A 3HZXA 4IURA 3TSSA 1EZ8A 5ELCA 4A3FG 1L1OA 1Y1VG 1EQQA 1PQSA 1X1MA 2WX0A 2JJQA 4FJYA 5EE0A 4AWJA 1XNRL 2R92B 4P1BC 1WD1A 4A3GB 3DVNU 2VB3X 1VQMA 1K50A 3W2DA 3U30A 1CZGA 2WXLA 3OJ4B 5CR3A 2G1EA 1FFVA 4ZRPA 4CDFC 3ECIA 4OZBA 1V97A 1DOKA 2YTVA 1T5EA 2GBJA 1MHWC 3CCSA 2CJNA 4NAMA 2DUDA 4RGTA 3IKJA 2NVYB 2EDGA 2Z0EB 3SU8X 1FNUA 4MT5A 2AKWB 2L3ZA 2RSUA 2EYJA 4H7BA 4HMJA 2VQEL 2ZPNA 1F9QA 3NTIA 5D65A 4DR6Q 4DK0A 3J7A5 4A3DH 3IXSA 2HD5B 1YN5A 4JI8L 1ZUD2 1FNWA 3DWMA 3PIP3 1OQQA 3VTWA 1CJEA 3KK7A 1VF5C 5GQOA 3VH4B 1VQ5A 4YXDB 4HXDA 1MVKA 2BYTA 2EJFC 1EIHA 1V5OA 4GS3A 5L95C 3RNGC 2JA5G 4IM0A 2DNEA 4B3TQ 1EU4A 2AUKA 4IWQA 4BWGB 2QA4A 5IGGA 1QVCA 1S72A 3AEDB 1H9RA 1LTBD 5JAVA 3R2IA 3AU4A 4OGQC 4DV7L 2R93B 3P4PB 1S5ED 1IBLL 4C1NI 1VQ9A 2FE8A 1OEYJ 1ZYRD 1V1PB 4JV5Q 1NY4A 1K0RA 2ZTCA 1YEZA 3I4NG 1F9PA 4DR4L 5FLMH 2WACA 3G6EA 2G45B 3BZDB 2EZVA 1SJHD 1UWXA 1XXGA 1H8CA 2BT6A 2JA8H 4BY1G 4IM3A 5CV7A 2F0HA 2KJXA 2NBFA 4A3KH 1SNCA 4AUQC 2IO0B 3HOXB 5CHVC 3M9BA 3QOJA 1WSPA 3A9JB 2PMVA 1Y69U 2R7ZH 1ET6A 1E0ZA 1PGAA 3MXGA 1A70A 1LT6D 4J8QA 3LJ3A 3N20C 2L0CA 1LV9A 1S5DD 1QNUA 1PFBA 1HFNA 1E7VA 2JSOA 1JMCA 2Q8RE 4ME3A 4HJAA 4W9FA 2F0LA 1STAA 1C0AA 2BS4B 2WXFA 4WH4A 4YTPB 2A19A 2HJ8A 1F2MA 1TKWB 3HFZB 1P98A 1V5TA 4W9DA 3L0OA 3QWNA 3HOYH 3DBRB 4R4OA 2KX0A 1WOCA 4QB4A 4DN4M 4K7WA 4EE2A 3GS2A 1A3TA 1YHAA 3A1QA 1SMYD 3KYHC 1RCVD 3AE3B 1JRPA 1HZ9A 3VUYA 3PPAA 5KGUA 1NSNS 1YX6B 4KVGB 5T1IA 4HIMA 4GLAC 4DV1L 2JA7B 1XO3A 2DZIA 1FD7D 3TDQA 1I4HA 1FFUA 3KLSA 1WE6A 2OCEA 4OXPA 3K81C 3NEMA 4NNJB 1WVLA 3N52A 3A0JA 2Z6BA 4K0KQ 1WJUA 5IP7G 1SMXA 2VNUD 3AEEB 4GKKQ 1V2YA 2RVLA 1HZ5A 5K36H 1T0SC 3LX0A 4TRDA 2B63H 3M95A 4A3BB 3RNCC 2DYBA 2ON8A 2FMCA 2WYQA 4PMBA 4XDXA 2A69D 1B7YB 1KF6B 1VJKA 1IGDA 2NYZD 2F4VQ 2WP9B 5KHOA 4IOCA 2BQQA 4PK1A 4I7AA 1PH6A 1TYGB 2FXQA 4DV6Q 3AEVA 2C9WB 1BR9A 3TIXA 4Y52H 1YZ6A 5M3MB 2L12A 1EY7A 2INDC 2XVSA 1C4CA 2E3TA 4WJOA 3ZJVA 2SNMA 4ZAIA 1MGSA 2K5HA 1PRTF 4A3JH 3U7DA 4NB3A 3VHTC 1CKMA 4MJSB 3AEFB 2FCSA 1D6EC 1T3QA 3MXUA 4DXGA 2LD9A 2MRPA 2JYOA 3FEWX 3BU2A 2MNAA 4C3IB 3LNNA 5IYBG 4HIOA 1VCBA 1WXMA 4HK2A 1TVXA 2F0WA 2M17A 4L2YA 1F2RI 2KMCA 4KGRA 3BYYB 1TWHB 4OZCA 4K1RB 1EIGA 4MJSA 2WNMA 3KF8A 4L23A 2K6AA 4YHHQ 1YJ9A 2LXJA 4A3FH 2UUBQ 4HCNB 1Y1VH 4A20A 5IY0A 3SK8A 4KY5A 2V1YA 2IBIB 4WAAA 2HE7A 3H8HA 5ELFA 2LVOA 4OVVA 3EFCA 2BH8A 3D32A 3ZJTA 1SBBB 3GOEA 2EJMA 4OWTB 2ZNVC 5FO9B 3W5VB 3SK4A 3QOLA 1U4LA 4NJ6A 1WCMG 4KV6A 2V4DA 2VL6A 5IYDH 3OG5A 5IGDA 3AEGB 2IHFA 2JZPA 3IAYA 2GRIA 1J7AA 1O7LA 4DR3L 1H9JA 4L8JA 3S1NB 4A4IA 4Y7NH 5CHFA 5AZGA 4EX5A 4YIJA 1BVSA 4OWXB 4GNXB 4TSSA 4RKBA 1SIJA 4HROA 2KWCA 4P7IA 4WWOA 1W3SA 4JI4Q 3DWPA 1X54A 2OTLA 3I57A 1I4PA 5BN3A 2VUMB 2N9EB 4RM9A 2N4FA 5DPWA 4NW2A 3PUXA 2A5UA 3KOJA 1QWYA 3OOCA 1ZXIA 4KZCA 4P72A 1KTKA 4LAAA 2R2OA 1B3QA 3ZTCA 3ZNHB 4YSXB 4RNAA 3H0GB 3TZDA 2JA5H 4DV5L 1F9SA 1PTOC 3PO3B 3NJTA 4EZJA 2IX0A 4OELB 5IP9G 1L0WA 2EVBA 3VH3B 1E7UA 1CSPA 4A3EG 4KY7A 2DENB 5KYIA 1ENCA 3I4OA 3F2DA 2IY0B 3AXCA 2B2WC 1QZHA 4RH6A 2D3GA 4ARIA 3I4NH 4PV1C 1PYSB 3APFA 2K6DB 1SAPA 4K6LA 4DDID 3S2HB 1CK1A 4DR2L 4MSMB 4PZ8A 3P4RB 3PRZA 3FKIG 4F8CB 1M4VA 5GXGB 2WP8J 1EY5A 4BY1H 2HTHA 4IM2A 3J7AF 1IL2A 2C7HA 2MWSB 4FA6A 2M1MA 3T16A 4FLHA 3PV1A 2PZWA 1PUTA 1NI2A 1Q5WB 3SK6A 5C3EB 3CU7A 5M5YB 3QA8A 2BVCA 3W1GA 2IYDB 3DVNV 1N62A 4DFAA 4F7ZA 2GN5A 4B3ML 1HNWQ 2HT1A 4BBRB 1WTWA 1QNKA 1N60A 5BYQA 1E0BA 2F4IA 3GTMB 2M0AA 1OXVA 1KJTA 3S2DH 3PMFA 3QWZB 3HHMA 2PPBC 3RT3B 2Q2TA 2IGHA 3RI7C 2B2TC 4C7ZA 1JE5A 3A9JA 2LWPA 1C7YA 1NTGA 4DK3C 1H4RA 1Y8NB 2DBYA 4W9EA 5CHWA 1C9FA 4AYBE 1EY0A 1Q8KA 2X6GA 4DK1A 5M3FB 2ZCCA 1AARA 3TRZA 1QUQA 4KTAA 2KT7A 3ML8A 3L16A 2EXDA 5CGKA 4F88A 4P1CC 1WH3A 2KCNA 3PREA 3NBHB 1WXVA 4R4CA 1RRBA 2JA6H 3N32A 4II3B 4WQOB 4ARCA 3E6ZX 2BDOA 2KWVB 3KH0A 2EPBA 2WAQB 3SR1A 3A4RA 5IP7H 4RMAA 2HDLA 4ABNA 2I38A 4I6NB 3B08A 4CDCC 3L54A 3ERQA 5E6NA 1RIPA 3NQIA 1Z6HA 2Y0SB 3G48A 4K5WA 2BBCA 2LVQA 3HVZA 4AYBG 4HEDA 4A3MB 3M3YH 3NY5A 5IA7A 3Q8FA 4I7ZC 3N30A 1IYFA 4RMFA 3CMAA 1LABA 4NQLB 1N36Q 1SXTA 1KNEA 3PUWA 4JC0A 2DZKA 2C35B 1KXLA 1EY9A 1I50B 4WORA 5CV4A 4JBKA 2CQOA 4P71A 3F2UA 1HNXQ 3VYTA 3GZNI 4EFOA 1VQNA 4JI7Q 2LGSA 3MC9A 1S5BD 2NN6G 4KHPL 1X3QA 5EPKA 1PFDA 2V3SA 1R4MB 1CZPA 2MBOA 2NVQH 5IYBH 2EYPA 3IHPC 2I0QA 4QAYA 1E7PB 5KHQA 1J6QA 3RYTA 1TBEA 1JWBD 2O5JC 1U5KA 4BKGA 1P8LA 2Z6KC 4B95A 1GB4A 5KIXA 3HOUB 1U4MA 3I72A 1Y1WG 2O2VB 3JC66 1LTTD 4DV4Q 2VZAA 3ITPA 3MVVA 1Q8IA 2J7QB 3NZ3A 4NQKE 3LXFA 2E76C 4ZCKA 4LF8Q 2C9OA 1YIWA 2E6XA 5IAAC 4DKAC 2BE5C 3I4MG 5E6OA 2KCTA 4DR5Q 3GTPH 3QC8B 5AUIA 1UBIA 4A3IG 1WCMH 5C44B 2SOBA 1TWFB 2N55A 1FIQA 4GGQA 2WKCA 4DQOC 4J3OD 2HUGA 2LVPA 1QF6A 2QC8A 1G8ZD 4GN1A 3S1RH 1TWGB 3S1QH 2NPTB 5FO7B 1ASZA 5JJLA 5C4ZA 1ROEA 2JUOA 1NENB 4H44C 4HN7A 4KK7A 4XTCS 4AJWA 5GAGC 5LXIB 3RZOH 3TP8A 1XD3B 1SROA 5FJ8G 2D2QA 5LXHA 3LWEA 4DPGA 3D0FA 5EKIA 4EEWA 2KN5A 1KAWA 3M7GA 1J7BA 2D3AA 2LMCA 5KRUA 2WU5B 2Z9HA 2QIEB 3IBEA 3TBIB 5J39A 2RPVA 3MP9A 4JI0L 4ICVA 2E2HB 1K8GA 4A90A 1CA5A 3NSWA 3W1SA 3UIOB 5IP9H 3RMHA 1AWDA 2DYOA 3R93A 4TQ0A 4A3EH 3NK9A 3V61A 1GM5A 1VQGA 2F0TA 3QO2A 4IQZA 4LF4L 1QB5D 2F3IA 2IWHA 1EL0A 4ITKA 3V96A 3S16H 3SEBA 1QKZA 3H7PB 4LFBL 5HKHA 4KDLB 4B3RQ 5NUCA 3MEFA 1HNZL 3HOWB 4PZ6A 3EIVA 5E4WC 1LUZA 2K22A 3GTQH 3V6CB 2J7ZA 3AE7B 2KN4A 3Q8AA 4FF3A 5MPOA 1IYJB 3UDIA 4GOCA 2JXMB 3CKIB 2MGSA 3U9OA 3LWUA 4HJ8A 2DX5B 2I5HA 1DONA 2KDEB 4POGA 2DJGC 1TZOA 4KZ0A 3M4YA 3PIO3 4ME5A 4F87A 5I6YA 4DV0L 2AX5A 4MH8A 3GTGH 1KIXA 4B3SQ 1P3QU 1DOLA 3CCUA 1EYGA 1VLBA 3ZJUA 4PT5A 1XMQL 1PHJA 3MTNB 1W6KA 1ICWA 4O1NA 1XLOA 4KGTA 4M0WB 4DHZE 1LXDA 1SYEA 4JIOU 2R7DA 1WGHA 4IJHA 2EKEC 2PTLA 1SJED 4IUVA 4RGMA 4BY7B 1NE3A 1SE4A 2JT4B 1GB1A 2UXDQ 3J80i 1J5EQ 1I94Q 1FL0A 3B9JA 3QQ8B 1V9JA 1LTAD 3CIRB 4A3PA 5IKCM 1PRTC 1VCIA 1L4DB 1YOVB 4XZ4A 2YTYA 3DUZA 3Q6SA 1ILPA 3GTJH 1Z47A 2OHFA 3VR2A 1YJNA 3RN5A 3AULA 3WDNA 1X3FA 2ICIA 3NBHA 5C4XG 2MBHA 2OJRA 3BDOA 4RFBA 1EUVB 3NUCA 2OQKA 1IBML 2ZM6Q 2K33A 2F0GA 2F0FA 2ZXRA 1EY8A 4FDBA 2WDQB 2GOWA 3ENEA 1J7CA 3WCQA 1B8AA 1PYBA 3VA7A 2IZVB 5IOIA 4WIPA 4ZDVA 4EQ5A 4LF7L 1GUOA 5IWAQ 1L0XB 3KLSX 3EROA 3NTHA 1RFAA 2NVXH 4ILWA 3GTKH 2MX2A 2NN6H 3E0EA 4X64L 3ZGZA 2VZKB 1STEA 3NHHA 2W9NA 1X32A 1SYDA 4FJVB 2NVUI 1YX5B 1V81A 1EOVA 5E6JA 2DLBA 5LL6S 2LJ5A 2N88A 4MDKE 2J0JA 5FR6A 3A9KB 3V6EB 3GTOB 1Y14B 4RCOA 3S1MH 1YVCA 2K0PA 1Q1EA 4E3CA 3VYUA 2OOBB 4KLKA 4QUFA 2D10A 2VRRB 2K28A 2PVOD 4A93H 4DBGA 1GUWA 4I6LB 1V9PA 3V3XA 4ZRJA 3L13A 1N34Q 2FIDA 4N9PA 2CHWA 3VRBB 3X0WA 2HCIA 2H1EA 4IUMB 2PYKA 5DPRA 5C23A 2ES2A 3EFUA 3OTOQ 3DBHB 1S5FD 3MXPA 2KOXA 2CJOA 2O4XA 3L9AX 2PW5A 3Q8DA 3OWFA 2BKRB 2IY5B 4IPCA 5BR8L 2JK8A 2B29A 2MO1A 2Y5BB 2A1AA 2RHQB 3AH7A 3A5ZB 4R9WA 2WDTB 4ZKBB 2MEKA 1F77A 3CSFA 4DHJB 2BKFA 5FJ8H 3HOVB 2IW3A 2MCNB 3ZRCA 5JHBA 1F1HA 4F7XA 4HJ9A 1UE1A 2L00B 1YN3A 2K01A 2WXKA 4WWPA 4L5SA 3SFEB 5JH5C 4CQNA 2K75A 3SHLA 3NBIA 4NPNA 4OO1H 1X9NA 3AB9A 3ZO5B 3NS1A 3HOZB 3M62B 4LDTB 4DUYL 2H5XA 5M5WB 5JXVA 2Q2HA 1FJGQ 1L0VB 4MM3A 1JOQA 2LRUA 2D3CA 3W3AA 4X65L 1XF5L 1WJ6A 1T0YA 1SLJA 2BYVE 1WF9A 3WALA 1VF7A 1SE3A 3OW7A 2HDEA 3RMKC 3RUIB 4W9LA 1O78A 3TQYA 3P1HA 4CJ1B 4HPPA 2RF4A 1TU2B 1WX7A 4DR4Q 4A6QA 2XWBB 1F9RA 3Q2AC 2GVBA 3CXCA 2KOLA 1A2UA 1EUJA 4U68A 1EQRA 2ZCBA 4G0NB 3VDYA 4YSYB 1UE5A 4LF9L 3IFWB 4QIWE 2PW9A 3PGEA 2I07B 1E2ZA 3BZKA 4A3KG 3R2TA 5I4DA 4GKJQ 2YEPF 2LFNA 4OIKA 1JALA 3ZKJC 2F52A 2B8FA 4IUQA 5EBCA 1WXSA 2K5NA 4OX9Q 2MLBA 3S15B 2VQFL 3AV8A 1C1YB 5CC4A 1NVID 4PZ7A 3CC7A 2UXCL 3K7AB 1DM0B 2NZ1D 3KYDD 3DOWA 2WV6D 4ZOHC 4IPHA 1UF0A 2NBUA 2ZNVB 2JY6A 3PTFC 2D0PA 2LGXA 2YV5A 1PFMA 3ND9A 2CFMA 5T1GA 4ZYSA 5IYCG 2WB1E 3CC4A 2FNJB 2PW7A 1LT4D 2ZJRA 4H2AA 4M0WA 4X3TA 2E2IH 1B53A 3HOYG 1N6ZA 4BKSA 3H7SA 2MFIA 1VQ8A 1P7FA 2JEBI 1EF1A 3AE5B 2YU9B 1WJ4A 1HFGA 1V1QA 2D0OA 5AJ3L 5HI1A 4KD3A 4TVAB 4JBWA 4XT3B 1PH7A 1BXTA 2FINB 4LK1C 1UGMA 2K8CA 4DAMA 3DHIC 1BUIC 1WGKA 3BIID 5EQ0A 3HRZC 4G7ZC 4IN3A 2F3VA 2ID0A 1NR2A 2B8GA 4GLSC 4BBSH 3HKZB 5EE3A 3P4SB 3PF4A 5C0XG 3STBD 3K80C 2WB1G 4DAYA 2ZJPA 3ZYYX 1K8MA 1KFYB 2JRIB 2D5GA 2DZMA 2GBMA 1PTOB 2BA1A 3RNAC 3FMCA 3OWEB 2RQXA 3J80c 1Y8OB 4LFAL 2RD0A 4QQBX 2EKIA 3WIMA 3QB3A 3A56A 3TEXA 4E74A 2KDIA 4C3JB 1N63A 5CTRC 1U0LA 3DMUA 4J1MA 2OF1A 2J0MA 3DBSA 1RL2A 3KYCD 1KDAA 3PHWB 1V43A 5IO9A 1F2YA 2ONQA 4OEMB 3TS0A 4JPSA 1A15A 4A3GH 5C3JB 3J81E 1ONLA 2KDBA 2EYLA 3DWAA 3S17B 2UXBL 2JP1A 1MIUA 1IYVA 1STYA 1G6PA 1F2ZA 1HE8A 5AEKB 2L55A 1IKLA 2JA9A 3IAM1 2ZJDA 1LT3D 1IYUA 2F0UA 2PMZE 5BMGA 4XT1B 3A9KA 1L5PA 2F0NA 3PVLA 4DWFA 4PQXA 1T9HA 1AW7A 2NVYH 1UEBA 2JQRB 2DHZA 3U4VA 4X3SA 4WJPA 3RUZA 4LCDE 1ESFA 2IO3B 3DCGA 2RCNA 1FXTB 3GTLB 2NZOA 1E2WA 3OLMD 1MKHA 4MH0E 3RZDH 1B3AA 4P2CB 2G5DA 4UP9A 1IW7C 3L7ZC 1FMAD 2WINB 2WDRB 3KBXA 4HDOA 5IYDG 4JI5L 4ZYNA 4GIVA 3GV3A 1CZWA 3TEZA 2C5CA 2NVTB 1PGXA 1H9KA 1YNJD 4JWSC 3ULPA 2KMMA 2MJDA 4L5TA 1H9SA 2K05A 2R3ZA 3O13A 4UP8A 4XXEA 1HH2P 2QEJC 3T1HL 4IFDI 1KABA 1MI2A 1LLRD 1EWIA 1K53A 2Y5CA 2E5LL 4A75A 3AE6B 3KQ4A 2HTME 4GDLB 3DBRI 5J22A 4EZKA 4QF4A 3BY4B 5C4HA 2DNCA 2KQ3A 2EQSA 3NELA 4HJKA 3CRKC 2RDBC 3A5UA 1C4AA 4XX5A 1D5ZC 1N32Q 1QOBA 4P6VF 4YWMA 3J81L 1VQDA 3LDZE 1BKBA 1J8CA 1FEHA 1TZ1A 4L1BA 5I6WA 2L8JA 3HGBA 3UDGA 3ZDTA 4C00A 3PSIA 4DR2Q 1V1OA 2A68C 1DD2A 3PUVA 1GJXA 1CI3M 3D4WA 4Q2JA 3HKSA 1FRRA 2OT2A 4JWUC 2PNRC 1HUMA 4YL8A 1WMHB 1YQ3B 3F2CA 2FAZA 3BS1A 3F2BA 3C19A 3VR6A 3EN2A 4HVBA 1ACCA 4DGZA 3PZDA 5JJIA 2D11A 4LJPB 5KNBA 1DGJA 2K6QA 1D3ZA 3U50C 4MHEA 3E56A 1SE2A 2X69A 4Q5VA 4ZRIA 4I6PA 2JA7H 1PFSA 1CA6A 4HJGE 1HTLD 2K14A 5I9PA 4N9TA 2YYZA 4A3DB 4B9XA 1YHQA 3KF6B 1XLQA 5IYCH 4AQYL 4PMWA 4NXML 1LGRA 3ER0A 2I46A 1K52A 3T1YL 2MO0A 4M8MA 3I3CA 5LMNL 3C2PA 2MP2B 4A8XC 4GN4B 2EIFA 4O42A 1DZ1A 1HEZE 2EMSA 4B08A 1LTID 3V2TA 3CCQA 1YD8U 1UUPA 4A3BH 1E2VA 4DV3L 2AQ2B 3CD6A 4A3MG 2R7FA 4LF6L 1GUGA 4YCWA 2ASBA 3NWTA 2DWQA 1Q81C 4KKSA 4CJ2C 2F0SA 1CM9A 3FRPB 2JA6G 3PSEB 2XSCA 3NZUA 4GLVB 2AYOB 5C0XH 1NBFC 1K8RB 4JCVE 1JQYD 4C3HG 3DVGY 4FULA 4WWNA 1T0QC 2L4NA 5BN4A 2IGGA 4FXDA 2DY8A 1XJVA 3RNBC 4PG3A 5DEHA 5G5HA 2JA8B 2J4XA 4OL7A 2C7MB 1OQYA 4LUOA 4MSQB 2A6HC 1GC6A 1JWSD 1MI0A 3SR6A 1LM8B 4HAEA 3U9SA 5LMUQ 1WZ0A 4MNOA 4TQ1A 3PHXB 5IOCA 2R7ZB 4N58A 1J8IA 4KJOA 4RGOS 1GAQB 2KJ6A 4L5QA 3GE3C 3WWVA 4ICUA 2RA4A 2V3NA 2K5QA 2KMAA 3UE0A 1FCCC 2EOTA 1I42A 3J81j 1AYFA 5DM73 3FPUB 4LFCQ 1TT2A 2B2WA 2ALYB 2FCQA 1PZKD 2LXAA 3AM9A 1WGYA 4W9JA 3RNFC 5C44G
chains in the Genus database with same CATH topology
2B2VC 1T5XD 1D1IA 1H9MA 2WS3B 1BCPF 3I70A 1FR3A 1EU3A 3VR4A 1HA5A 4HTHA 1W6JA 5E4XA 1EQVA 1RJTA 1FCLA 2IT1A 2QKIC 3UI2A 2MJ3A 2W3RA 1ESRA 1EQTA 2KACA 1WTVA 2B63B 2EELA 1L4ZB 2B2TA 1OO9B 1JR0D 2JX5A 1ZDVA 1WRIA 2WXQA 1PRTB 2LHEA 1BBXC 4X3KA 2K5WA 1DXMA 1QOAA 4A3JB 1QQRA 1FNVA 3AE2B 2IL8A 4EQOA 3IT6B 1NYRA 1PZID 2F0JA 2CW0D 1OXSC 3VQIA 1BCPB 1BQQT 4YWGG 2F0KA 1PDQA 4A3FB 2MPMA 1Y1VB 3D3RA 2F03A 2GA4B 1KNAA 3HVDA 4L6TB 1EEID 1CTMA 2WXIA 4FF2A 1TS3A 1EEFD 2R6GA 4UDUC 2ZW1A 4Y7NB 1V1PA 5COYA 3AU7A 2W82A 2W54A 1E9MA 1GXDC 3P42A 1UEAB 5G3LD 3P63A 5CBAE 3HP3A 4R8IA 2MP1A 1C4PA 2Q5WD 1KLUD 2WXOA 2LKVA 1FYCA 4ZRZA 2F3WA 4IUTA 1ET9A 3U7ZA 4OHJA 2JA5B 4XWTA 1EZ6A 4GDKB 1YNTE 1EYDA 4NKLA 4KN4C 1A2TA 3ZQ4A 3BK1A 1RD9D 4K2KA 1DOXA 1HA6A 3I4NB 1WXQA 3K5OA 1D5MC 4DNTB 5I2YA 2H88B 3S14B 4BY1B 1STHA 2Y3AA 2EY5A 4NAWB 2JYTA 2JYEA 2XNAC 1BUVT 3C1FA 3N9YC 1RFKA 4NJCA 3S2DB 1JOKA 3PUZA 1ZDXA 3EUB2 1LTSD 1VDVA 1EWYC 1B9RA 1JE4A 3I9V1 1UNSA 1QG7A 3IFDA 5EKKA 1MHHE 2HCCA 2OEDA 1VR9A 2IJ0A 3L3OC 3ETRA 3SFDB 2F0QA 2E75C 4DF7A 4AQ7A 1QOGA 2EXZA 3Q8CA 2L1BA 2AQ1B 3TEWA 1GHJA 4R3DA 1EWHA 3VR8B 1EY6A 4ZRQA 3P7JA 3M3YB 1NAPA 2EYFA 1TS2A 4K8JA 2A5HA 2H89B 4WQMA 2RMMA 1U4PA 5CV8A 3IFTA 3H09A 1XX8A 2PIAA 2KEEA 2NVQB 1WTXA 2A6EC 4C1NK 2BCOA 3AMUA 1T6BX 1FRDA 1HPCA 4OO1G 3PZ7A 1R7SA 1D5XC 1F2LA 3K58A 5BMIA 3HG9A 2V3PA 4TKOB 4HR7B 5IIFA 3OHXC 3G6JB 4G7HC 2RSOA 1ENFA 3FC4A 5C0XJ 3KWLA 4TMAB 1WCMB 1KRHA 2J42A 5BMHA 3LYYA 4JE3B 2M2LA 4PNYA 3VR5A 3VRAB 4XYQA 3VYRA 3S1RB 3S1QB 2JWUA 4FO2A 5D3IB 3M7NA 1IHZA 4NMZA 1SEBD 4RAUC 3RZOB 2OXPA 2M00A 1U4RA 4TQUS 1B9MA 2LHDA 3FAHA 1PTOD 4DNRB 1KAAA 1DJRD 1B50A 2A74C 2K5PA 2KA7A 1GUSA 3EA6A 1RWSA 4HEA1 1GHKA 4IOIE 1SDFA 1HRJA 4A3EB 2LUMA 4ZUJA 2NTTA 4KJNA 2K5DA 5JVH3 1ZXHA 2BS2B 4XDCA 3S16B 3IL8A 2B2UC 3DWQA 3FKIB 4FF4A 4WAFA 1Y56A 4FYDA 5EE9A 3GTQB 2RKSA 4IALA 1Y8PB 3BWUD 1BCPC 4RKLA 3U2SC 2K03A 4KN7C 4ZQ3A 1KH0A 3EQLC 4KD4A 3K5LA 5EBDA 1B1ZA 3GTGB 4HKZE 1ENAA 3OMGA 4G4KA 4K14A 1YNNC 2O5IC 2WXHA 4P16A 2Z4HA 3NVVA 4HSPA 3BDCA 2KWDA 3A8KE 3OSOA 4LLGM 2WQYB 1EOTA 4WRDA 3I73A 3VR9B 1R9TB 3E0JA 1VMPA 2R61A 3OIQA 4KHZA 1D1KA 3GTJB 2RDGA 5H92C 4ZHPA 4AYBB 2L32A 2RDFA 3R8BA 4KMUC 1RTOA 1TWCB 4YT0B 5LHY1 4V190 3R3OA 5JPNC 1QOHA 2F0DA 1JWUD 4ULLA 3CQZB 1B44D 2NVXB 3BG3A 3NQTA 2IGDA 1G291 5KYLA 2Q8TA 1EM7A 1K51A 3A54A 1E10A 2J53A 5ELEA 5FK9C 2MH7A 3AEBB 1Y1WB 3FILB 3S1MB 4E6IA 2E74C 2BE5D 4NDXA 3M85A 4US8A 2EYOA 1AZQA 1IKMA 2WU2B 2KAJA 4IUPA 2LEKA 1ZYRC 1L0YB 3I4MB 5I2XA 3GV6A 1N5XA 3J7YW 3D6CA 1PLFA 2KVMA 4A3IB 3EFXD 5D14A 2F0VA 2K7VA 3PZ8A 1SSOA 2B2YA 1HHVA 1O80A 2MHVA 2ZW0A 1I4QA 4OIJA 2DN8A 2WXJA 3FDTA 3C46A 2TMPA 5H8YE 1EFID 3AEAB 1HQRD 1HTPA 1XLPA 1SMYC 1LACA 3A8IE 3TN2A 2PCFB 2FBWB 5C5LA 1XEEA 3MZ5A 4C7YA 2L1AA 3SXHA 5CV9A 4MACA 2HDMA 4RCNA 4CKCA 2A69C 2SDFA 2CVRA 2QDBA 3U4EG 4FF1A 3CWIA 2Z8LA 2KEDA 1FM0D 1C77A 1YJIA 3BVZA 2YEPB 2Z4IA 2EYHA 4C3IG 3X3NA 4IUNA 3V05A 2D2CC 3I8ZA 1G91A 2ZT9C 1EYCA 4RA8A 4DXFA 3TP7A 1PRTD 3FPPA 5E3FA 2ENBA 3IT4B 3E5SA 5IODA 2N9KA 3AECB 1OQRA 1Q3LA 1AFPA 2L11A 1C79A 1C8CA 1IGCA 1PMRA 4KKJA 2WKDA 1PZJD 1RYJA 5C4XB 1ZKOA 3FVQA 1I6VC 1SF0A 1TY2A 3D4RA 3GO5A 2IX3A 4CJ0B 3BVMA 1G6ZA 4KX6B 2ZXOA 4H13C 2FMMA 1JORA 3OPOA 3RLFA 3UI3A 4LJZC 3C3LA 1HUNA 3NVWA 4ZLTF 5C3XA 4K5XA 5EKLA 1L6UA 1QE6A 1C76A 5AUKA 1Z7TA 1YQ4B 4YSZB 3CHBD 1LTRD 5HURA 2JE6I 2QMTA 2Y5PA 5FLXE 1HCZA 1N5WA 4HCSA 1AP0A 3FILA 3J80E 2GB1A 3Q0AA 1XCQL 2D5DA 2INPE 2L83A 3QG1A 3H94A 1WD0A 2RDHA 4KKUA 3NVYA 1NR4A 4IFDH 3Q22A 3VYSA 3RZDB 2ACZB 3QIAA 2CQAA 5IGEA 1UWMA 3TMEA 4DAPA 2M56B 1D4BA 3L4PA 3WOEA 4V0BA 4H0LC 4EQPA 2B2VA 2XN9C 2XIWA 1MSGA 1NYQA 5D7GA 3E9SA 4LMQD 1JB3A 1YMHE 3AMZA 3HEJA 1JOOA 1LTGD 1TS5A 3WOFA 1XCTL 2PKOA 3EJIA 2M9VA 5AFWA 5CV5A 1TS4A 1PXUA 1NCVA 2BS3B 5IGCA 5HGTA 2D9UA 5EPLA 3NVZA 4EVOA 3A7LA 4UAIA 5FLXL 4ODGA 2X6LA 3D6WA 5C0XI 1FXAA 3J80L 1VRAB 3N6RA 1LO5D 4D2KA 4DAVA 1SYBA 3MXNA 4A3KB 1A3UA 5JEAH 4C80A 1XYIA 5BN5A 1BNZA 5CMDA 1YN4A 2PZUA 3I91A 5KNCA 1BF4A 4US9A 1A6XA 4QUCA 4S3SA 4K6DA 4WJWA 3HOYB 3Q8BA 3NRZA 4QIWB 4N6EB 1VDZA 2QCPX 5CV6A 1RF2D 4USAA 2EY2A 1CQFA 3TZUA 1ZP0B 2X38A 1Q12A 4ZUIA 1VZ8A 2SNSA 2WB1B 5JPMC 4KKIA 2LFIA 3AE8B 5EE1A 3A7AB 1B9NA 5C6AA 1XTCD 1IUEA 1Q10A 3D4DA 1DOYA 4KI0A 1IL8A 1KDBA 1MSHA 3H3VC 4WFN3 1X3PA 4G57A 1MPEA 3OIPA 1KLGD 1MBYA 5ELDA 1WTPA 4ZHOA 3PUYA 4CGYB 4EGVA 1HXYD 2INNE 3A8JE 5C3WA 3EGRA 1WYGA 3BK2A 3RFZB 2SAKA 5BYRA 3HS0C 2JSVX 3DEPA 1RDPD 4K2LA 2JEAI 4B9WA 2A73B 5IGFA 1AZPA 4XIGS 2LMCB 3GP7A 3MTSA 3Q24A 5KNDA 3HRDD 1LT5D 4C2MB 2E2DC 1IW7D 4F8MA 4M1UB 2PMZB 2KCCA 1CHQD 3ND8A 1PYWD 2N0SB 5DM63 1J9OA 2CU3A 2F0MA 1JC7A 3GB1A 3SE0A 1N61A 4EQNA 2MJEA 5IGBA 3KUPA 2EY6A 3SDZA 1R4QB 2WXNA 3M4OB 3PO0A 3NE5B 1DYQA 2W55A 2LY7A 3BYTB 1I4XA 2B76B 2VZKD 1CT1D 1SNDA 1PDXA 5CYUA 2A68D 3T51B 4PMCA 1ML0D 4IUUA 5J1ZA 1O7ZA 2WXRA 1ZXTA 2MUYA 3AE9B 2BW2A 1K8OA 4FVMA 2MJ8A 1ZOYB 4RF1A 5HG2A 4OW0A 2VB2X 3TUOA 3K5MA 4I65A 4HCEA 4BS9A 4REZA 2KUMA 5M5XB 1NI3A 3MJ5A 2FHTA 4RHRA 1HZ6A 2NTSA 3Q69A 3KLRA 3MAQA 3CRLC 3MEHA 2VXWA 2WIIB 1R4PB 1K83B 4KKTA 2K9XA 1KDCA 1WWTA 3NPPA 4KHVA 1I4RA 3K59A 1FGBD 2HQEA 1I4GA 4Q0FA 2JA6B 3HUIA 3D31A 2A6HD 4C3HB 1II3A 1MHXA 4LTUA 1YJJA 4IFDJ 2XWJB 2DYMA 2PZTA 1MD2D 4CBVA 3JAME 4Z9CB 1BMLC 4J6HA 4IZ8A 2F0IA 3AN1A 4HKQA 1JROA 3A55A 3I4LA 2E2JB 1D2BA 1WTOA 2ICEC 3W9CB 4YTNB 5BYSA 5HHDG 5A2QE 1QLBB 5G5GA 3BVGA 2XRQD 5KEEA 1UAPA 3MFGA 2WDVB 1QJOA 2B2UA 4X3UA 1P7EA 1TKEA 1EY4A 1IBXB 3KWVA 1G2SA 2IX1A 2QSDA 3T3NA 5FKAC 4XQQA 5LNK1 1RKNA 5EGTA 2RBMA 1FXIA 2L52A 5D3DA 3MHBA 1C48A 2BTEA 2EJGC 2QJLA 2LGIA 4M8AA 2FFKB 2AWNA 3T56B 3GTPB 4MM3B 1CFMA 3G7LA 4XQJA 1O7YA 2DY7A 1QCBD 4BA1I 5C5MA 3NP8A 5JEAJ 1SYGA 2W3SA 5FOBB 1XWEA 3QJYA 3K5NA 2NB0A 1ILQA 3PO2B 1SNOA 1S4ZA 4GZYC 3IAS1 2J0TD 3JAML 2V4IB 5ISRA 5DAUA 4FXGC 2KDMA 1NEKB 1AEXA 2AUJD 4NZLB 4G7OC 1EYAA 4HRSA 4YTMB 1Q1BA 5IT9E 5A2QL 1I3QB 2NMQA 3MWYW 3BDLA 3DXJC 1FO4A 3NXWA 5EJWA 5G3LF 4CHTB 3J7AV 5HFYA 5K5PA 2K04A 4XYOA 4L63B 2B39A 1TR5A 5FR3A 1HQMC 1JWMD 2D62A 1QOFA 3B2FA 4C3JG 2KHSA 1SNPA 3AE1B 2CHBD 3D8GA 3H6MA 4WURA 2G9HD 1DOMA 3P4QB 4XWWA 3VR3A 1RM6C 4K8IA 1WTRA 3MC0B 3OMCA 3SK5A 4QMGA 4HMIA 1G2TA 1STGA 1TY0A 1RHPA 2NN6I 3RD4A 2LJIA 2N9LA 2I2YA 1EWCA 3TP5A 1VZ6A 2TSSA 1B2TA 1TIID 1TKYA 1E6EB 2AQ3B 1Q90A 3NTKA 1F2RC 1JICA 3W5UB 2N7JA 1FD6A 3C1EA 1CHPD 2NWGA 3T3OA 1TKGA 3NWSA 5IT9L 3LB8C 2OEOA 2AWOA 5JVG3 3H91A 4CKBA 1AN8A 1SFOB 2JU6X 3EVQA 4RHSA 3P20A 1YNJC 3VA5A 3K57A 3I90A 3ABVB 2Z1CA 3DHQA 4U673 3ONAB 1U9RA 3GTKB 4FP5D 4B0EA 2SEBD 2IDYA 4FXCA 1I6HB 4OO1I 1BDOA 1SYCA 4R8NA 2BA0A 2PVGC 5DNFA 1UGJA 2H4OA 2K1BA 2EY1A 1B4OA 2L5TA 2IPKD 5I9OA 3T13A 4A93B 3T4AC 1H9SB 5CORA 4ZK9B 2BOSA 1IBXA 3X3MA 1PFNA 2F1MA 3PV0A 1SSNA 3U52E 5C2TB 3P75A 3GD7A 1SNQA 1GUNA 1BO0A 1ZE3D 3P1MA 1STBA 2FUG1 4IDIA 4A55A 4ID6A 2F0OA 1GPXA 4IFDG 1C4QA 1S5CD 1SYFA 3DWGC 4FXKC 2LS01 1A3VA 1WTQA 1L6VA 2A6ED 4KGSA 4XDDA 5E1FA 4K5VA 1BOSA 1SB3C 4BA2I 2G9DA 3Q8EA 2BDNA 3DEOA 4FNFA 1DOIA 4RGNA 3TP6A 2RSNA 1VZ7A 4OVZA 4DU9A 5C4JB 3URYA 4LK0M 1OXUA 1V8CA 5CBEE 1QT9A 5JJZA 2JXTA 4OZAA 1OXXK 1GOZA 2NUCA 2WLBA 1PTOH 1C78A 1SNMA 4JX1C 1RTNA 2FJ2A 3DM1A 1PTOF 1JW9D 1JQ4A 4CKEA 1PGBA 3MA2B 2EE1A 4C56C 4MIUA 1OXTA 4MN3A 2Q8IB 2PQEA 3S9WA 3J9CA 2K32A 1ZEQX 2PO4A 1CQVA 5A35A 3KBGA 4A9AA 4AS1A 1GUTA 4RWSC 1OFFA 4QCLA 2M19A 4NP5A 3B2GA 5JEAG 1I7HA 3GQBA 4HSVA 1ZPSA 1DCZA 3C8YA 1RODA 5FO8B 1TWAB 2QILA 3Q23A 3T53B 2QF7A 5ELBA 5F2DA 4XE0A 1STNA 3MFYA 3AE4B 2PLPA 2E2IB 3NUHB 1JCKB 1QILA 5K36G 2F0PA 5LL6X 3SVMA 1TJEA 2WXGA 1BCPD 4JK1C 2B2YC 5TSSA 4KY6A 2L9HA 2O2LD 2GI9A 4B0MA 4BBSB 2XRSD 3MHZA 1M8AA 4IKGA 2J52A 1TQOA 3K0YA 5EPJA 2WXPA 2WXMA 4XQNA 1JMLA 1YNND 5M9OA 2KQ4X 2F0EA 4ZKCB 4DA2A 4WWMA 3TEYA 3RPFC 1XLNA 1V8QA 2K3UA 2V0GA 1JWAD 2KECA 5T8IA 2ZXPA 2BB6A 3AB5A 2CW0C 3K6OA 1NUCA 4N59A 5JOBA 1VMCA 2EYMA 2BB5A 3HZXA 3TSSA 4IURA 1EZ8A 5ELCA 5EE0A 1F0ZA 2R92B 1WD1A 4A3GB 2VB3X 1K50A 3W2DA 1CZGA 2WXLA 5CR3A 2G1EA 1FFVA 4ZRPA 4OZBA 1V97A 1DOKA 1T5EA 2CJNA 4NAMA 4RGTA 3IKJA 2NVYB 2EDGA 1FNUA 4MT5A 2EYJA 4H7BA 4HMJA 1F9QA 3NTIA 5D65A 4DK0A 3IXSA 1YN5A 3DWMA 1ZUD2 1FNWA 3PIP3 1OQQA 1CJEA 3KK7A 1VF5C 4YXDB 1MVKA 2BYTA 2EJFC 1EIHA 2DNEA 1EU4A 2AUKA 4BWGB 5IGGA 3AEDB 1H9RA 1LTBD 5JAVA 3R2IA 4OGQC 2R93B 3P4PB 1S5ED 2FE8A 4C1NI 1ZYRD 1V1PB 1F9PA 2WACA 3BZDB 2EZVA 1SJHD 1UWXA 1XXGA 2BT6A 5CV7A 2F0HA 2KJXA 2NBFA 1SNCA 3HOXB 3QOJA 1WSPA 2PMVA 1Y69U 1ET6A 1E0ZA 1PGAA 3MXGA 1A70A 1LT6D 4J8QA 2L0CA 1LV9A 1S5DD 1QNUA 1PFBA 1HFNA 2JSOA 2Q8RE 2F0LA 1STAA 2BS4B 2WXFA 4WH4A 4YTPB 1F2MA 1TKWB 3QWNA 4EE2A 4QB4A 4DN4M 3GS2A 1A3TA 1SMYD 1RCVD 3AE3B 1JRPA 5KGUA 1NSNS 5T1IA 2JA7B 1XO3A 1FD7D 3TDQA 1I4HA 1FFUA 3KLSA 1WVLA 3N52A 2VNUD 3AEEB 2RVLA 1HZ5A 5K36H 3LX0A 4TRDA 4A3BB 2ON8A 2FMCA 4PMBA 4XDXA 2A69D 1KF6B 1VJKA 1IGDA 2NYZD 2WP9B 1TYGB 1BR9A 5M3MB 2L12A 1EY7A 3ZJVA 2XVSA 1C4CA 2E3TA 2SNMA 4ZAIA 1MGSA 1PRTF 3AEFB 1D6EC 1T3QA 3MXUA 4DXGA 2JYOA 3FEWX 4C3IB 3LNNA 1TVXA 2F0WA 4L2YA 1F2RI 4KGRA 3BYYB 1TWHB 4OZCA 1EIGA 2WNMA 3KF8A 4L23A 2K6AA 3SK8A 4KY5A 3H8HA 5ELFA 3ZJTA 1SBBB 2EJMA 3W5VB 5FO9B 3SK4A 3QOLA 1U4LA 4KV6A 2V4DA 5IGDA 3AEGB 2JZPA 3IAYA 2GRIA 1J7AA 1O7LA 4RF0A 1H9JA 4L8JA 3S1NB 4YIJA 4TSSA 4RKBA 1SIJA 4HROA 3DWPA 3I57A 1I4PA 5BN3A 2VUMB 4NW2A 3PUXA 3OOCA 1QWYA 1ZXIA 1KTKA 4LAAA 4YSXB 4RNAA 3H0GB 3TZDA 3PO3B 1F9SA 1PTOC 2IX0A 2EVBA 4KY7A 5KYIA 1ENCA 2B2WC 4RH6A 4ARIA 4PV1C 1SAPA 4K6LA 3S2HB 1CK1A 3P4RB 1M4VA 5GXGB 2WP8J 1EY5A 3J7AF 3T16A 2PZWA 1PUTA 3SK6A 5C3EB 3CU7A 5M5YB 1N62A 4DFAA 4BBRB 1WTWA 1QNKA 1N60A 5BYQA 1E0BA 2F4IA 3GTMB 2M0AA 1OXVA 3PMFA 2PPBC 2IGHA 2B2TC 4C7ZA 1Y8NB 2DBYA 1C9FA 1EY0A 2X6GA 4DK1A 5M3FB 4KTAA 5CGKA 4F88A 2KCNA 4ARCA 3E6ZX 2BDOA 2EPBA 2WAQB 3SR1A 4ABNA 2HDLA 2I38A 3ERQA 3NQIA 4K5WA 1Z6HA 2Y0SB 2BBCA 3HVZA 4HEDA 4A3MB 3Q8FA 4I7ZC 1LABA 1SXTA 1KNEA 3PUWA 1EY9A 1I50B 4WORA 5CV4A 3F2UA 3VYTA 1S5BD 2NN6G 1X3QA 5EPKA 1PFDA 1CZPA 2EYPA 1E7PB 1JWBD 2O5JC 1GB4A 5KIXA 3HOUB 1U4MA 3I72A 1LTTD 3ITPA 3MVVA 1Q8IA 3NZ3A 3LXFA 2E76C 2C9OA 2E6XA 2BE5C 5AUIA 1FIQA 5C44B 2SOBA 1TWFB 2N55A 2WKCA 4DQOC 4J3OD 2HUGA 1QF6A 1G8ZD 1TWGB 5FO7B 5C4ZA 1ROEA 1NENB 4H44C 4HN7A 4KK7A 4XTCS 3TP8A 3LWEA 5EKIA 3M7GA 1J7BA 2WU5B 2LMCA 5KRUA 2QIEB 3TBIB 5J39A 2RPVA 3MP9A 2E2HB 4A90A 1CA5A 3NSWA 3W1SA 3RMHA 1AWDA 2DYOA 3R93A 4TQ0A 3NK9A 2F0TA 3QO2A 4IQZA 1QB5D 2IWHA 1EL0A 4ITKA 3V96A 3SEBA 1QKZA 5NUCA 3HOWB 5E4WC 2K22A 2J7ZA 3AE7B 2KN4A 3Q8AA 4FF3A 5MPOA 2JXMB 3CKIB 2MGSA 3U9OA 3LWUA 1DONA 1TZOA 3M4YA 3PIO3 4ME5A 4F87A 5I6YA 4MH8A 2AX5A 1VLBA 1DOLA 3ZJUA 4PT5A 1W6KA 1ICWA 4O1NA 1XLOA 4KGTA 1SYEA 2PTLA 1SJED 4IUVA 4RGMA 4BY7B 1SE4A 1GB1A 3B9JA 1LTAD 3CIRB 1PRTC 1VCIA 1L4DB 3DUZA 3Q6SA 1ILPA 1Z47A 2OHFA 3VR2A 3WDNA 2ICIA 3NBHA 3BDOA 4RFBA 3NUCA 2K33A 2F0GA 2F0FA 2ZXRA 1EY8A 2WDQB 3WCQA 1J7CA 3VA7A 4WIPA 1GUOA 1L0XB 3KLSX 3EROA 3NTHA 4ILWA 2NN6H 3ZGZA 2VZKB 1STEA 3NHHA 1X32A 1SYDA 5E6JA 2DLBA 5LL6S 2N88A 3GTOB 4RCOA 2K0PA 1Q1EA 3VYUA 4QUFA 2K28A 2PVOD 1GUWA 3V3XA 3VRBB 4N9PA 2HCIA 2H1EA 2PYKA 1S5FD 3MXPA 2CJOA 2O4XA 3L9AX 2PW5A 3OWFA 3AH7A 4R9WA 4ZKBB 2MEKA 1F77A 3HOVB 2IW3A 4F7XA 1YN3A 2K01A 2WXKA 3SFEB 4CQNA 3SHLA 3NBIA 4OO1H 3AB9A 3NS1A 3HOZB 5M5WB 5JXVA 1L0VB 1JOQA 3W3AA 1XF5L 1VF7A 1SE3A 3OW7A 2HDEA 1O78A 3P1HA 4CJ1B 1TU2B 4A6QA 2XWBB 1F9RA 2KOLA 1A2UA 4U68A 4YSYB 2PW9A 2I07B 1E2ZA 3R2TA 5I4DA 2YEPF 2LFNA 4OIKA 1JALA 2B8FA 4IUQA 5EBCA 3S15B 3AV8A 5CC4A 1NVID 3K7AB 1DM0B 2NZ1D 2WV6D 4ZOHC 3ND9A 1PFMA 4ZYSA 5T1GA 2PW7A 1LT4D 4H2AA 4M0WA 4X3TA 1B53A 1P7FA 2JEBI 3AE5B 2YU9B 1HFGA 5HI1A 4KD3A 4XT3B 4JBWA 1BXTA 2FINB 4LK1C 1BUIC 1WGKA 3BIID 5EQ0A 3HRZC 4G7ZC 4IN3A 2F3VA 2ID0A 1NR2A 2B8GA 4GLSC 5EE3A 3HKZB 3P4SB 5C0XG 4DAYA 3ZYYX 1K8MA 1KFYB 2D5GA 1PTOB 2BA1A 3FMCA 3OWEB 2RQXA 1Y8OB 2EKIA 3QB3A 3A56A 3TEXA 4C3JB 1N63A 3DMUA 4J1MA 2OF1A 1KDAA 1V43A 1F2YA 2ONQA 4JPSA 1A15A 5C3JB 3J81E 1ONLA 2EYLA 3DWAA 3S17B 2JP1A 1IYVA 1STYA 1F2ZA 2L55A 1IKLA 3IAM1 1LT3D 1IYUA 2F0UA 5BMGA 4XT1B 1L5PA 2F0NA 4PQXA 1AW7A 2JQRB 4X3SA 3RUZA 1ESFA 3GTLB 1E2WA 1B3AA 4P2CB 1IW7C 3L7ZC 1FMAD 2WINB 2WDRB 3KBXA 3GV3A 1CZWA 3TEZA 2C5CA 2NVTB 1PGXA 1H9KA 1YNJD 4JWSC 2KMMA 2MJDA 1H9SA 2K05A 2R3ZA 3O13A 4XXEA 2QEJC 4IFDI 1KABA 1MI2A 1LLRD 1K53A 2Y5CA 3AE6B 3KQ4A 2HTME 4GDLB 5J22A 4QF4A 5C4HA 2DNCA 2KQ3A 3CRKC 1C4AA 1D5ZC 1QOBA 4P6VF 3J81L 1FEHA 4L1BA 5I6WA 3HGBA 1V1OA 2A68C 1DD2A 3PUVA 1GJXA 1CI3M 3D4WA 4Q2JA 1FRRA 2OT2A 4JWUC 2PNRC 1HUMA 1YQ3B 3BS1A 3VR6A 1ACCA 4DGZA 5KNBA 1DGJA 4MHEA 3E56A 1SE2A 2X69A 4Q5VA 1CA6A