4RGNA

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
236
structure length
214
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 58
structure length 214
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgnA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgnA01
1CQVA 1HXYD 1KTKA 3DWAA 5FK9C 1JWSD 3DWQA 4OHJA 3CHBD 1PTOH 1S5ED 1TY0A 2RDGA 1V1PA 1FNWA 2XN9C 2CHBD 1S5BD 4DXGA 1YN5A 1PTOD 2IPKD 2QILA 3TSSA 3BZDB 4RGOS 1PZID 1PYWD 1GOZA 2SEBD 5ELBA 1LTID 4C56C 1XTCD 3R2TA 1ENFA 3W2DA 5TSSA 3DWPA 2TSSA 3SEBA 1LT3D 1SBBB 1I4QA 3EA6A 1EU4A 1YN3A 3BVGA 1UNSA 1YN4A 1D5XC 1ESFA 1PRTF 1EEFD 4RGNA 1SEBD 2QEJC 1I4GA 1XXGA 4RFBA 1SE3A 2XRQD 1AW7A 2RDHA 1ET6A 1STEA 4RHRA 1LTAD 4ZYSA 3URYA 5ELDA 3O13A 3BYYB 2O2LD 3GP7A 1T5XD 1RF2D 1ET9A 5ELCA 1TS4A 1HA5A 1BCPB 1V1PB 2AQ2B 1CHQD 1LTTD 1PRTD 2AQ1B 1EU3A 1BCPD 1JR0D 1L0YB 1F77A 1PRTC 1RD9D 5D3DA 1L0XB 3MC0B 2J4XA 1D5MC 1B1ZA 1D6EC 2XRSD 3BYTB 1BXTA 1SJHD 1JQYD 1LTSD 1BCPF 1AN8A 1PTOF 4O1NA 1SJED 1I4HA 1RCVD 1CK1A 4RHSA 3KLSX 1DJRD 3R2IA 1D5ZC 3V05A 1I4RA 1DYQA 1LT5D 1PRTB 4K6LA 4Z9CB 4RGTA 3EFXD 1S5DD 1QILA 5FKAC 1HQRD 1LO5D 1FGBD 1SE2A 1SXTA 1LLRD 1S5FD 4BWGB 1RDPD 1I4PA 5D3IB 4NZLB 1TS2A 5ELEA 1FNUA 1FNVA 1PZJD 1JWMD 2XNAC 1MD2D 1PTOB 4L63B 4RH6A 1TY2A 4RGMA 1EEID 1PZKD 3BVZA 1V1OA 1BCPC 1LTRD 1EWCA 1JWUD 1PTOC 3OWEB 4RCOA 1S5CD 4TSSA 2NTSA 1CHPD 4UDUC 1EFID 1SE4A 2ICIA 1I4XA 3R8BA 1HTLD 2WV6D 1B44D 2Z8LA 3MFGA 2G9HD 5ELFA 1KLUD 1G8ZD 1LT6D 4DXFA 2NTTA 1CT1D 1LT4D 3BVMA 2IJ0A 2R61A 1KLGD 1TS5A 1M4VA 1TS3A 1FD7D 1UUPA 2AQ3B 4L6TB 1LTBD 5I4DA 1LTGD 1JCKB
chains in the Genus database with same CATH superfamily
1OXTA 3N6RA 2B2VA 5IP7G 5IYCH 5M5XH 1IBLL 1P1AA 1S5ED 1A5RA 2PMVA 3S15B 2EY2A 1YIWA 2M17A 5HGQA 4ZHOA 5CBEE 3ND8A 2WU5B 3DUZA 1W2BA 2K8CA 4UAIA 2WXIA 1TWHB 3MFYA 3M4OB 3A4SC 1STGA 2Z6BA 1J7AA 3A9KA 5CHWA 1V1QA 5AJ3L 3C8YA 2LRUA 4I6NB 4MTKA 1WY8A 1LFDA 1YD8U 4DK6C 4HJ9A 5L95C 3Q3MC 3F8TA 2KMCA 3T1HQ 1TWAB 4XTCS 2INCC 3EN2A 3HS0C 1VQ8A 2MA9B 1UAPA 1STYA 1CFMA 1EWIA 1A3TA 2EY6A 3TEYA 2MFIA 3OIQA 1SYFA 5AZHA 2OOBB 2N88A 1TKGA 2A6ED 3JAME 3HOVH 1DD2A 3ZGZA 1SEBD 1Y8NB 3CP0A 4KZ0A 1WXVA 4WRDA 1AW7A 4JI8Q 2QA4A 3T8MA 2JXMB 1VZ8A 3M7GA 4ZYSA 5LMUQ 2Q2TA 2JX5A 2DN8A 3LGJA 3S1MB 1EY0A 3DBLB 1T5XD 3HOZG 3D32A 4A3LG 2MJDA 1SNMA 1QZHA 4A3PA 1WXQA 1T3QA 2KLGA 4X65Q 4B3SQ 2NPTB 4NJCA 2R6GA 4FADA 3A55A 3VH3B 1UZXB 4A3JB 1C4AA 4KDIC 4FF1A 1GJZA 4F87A 1FPYA 3Q14C 1WTXA 1JALA 5D3DA 1NJIC 5EBCA 4IPDA 3SXHA 1STHA 2CFMA 1I6HH 1TIID 1B1ZA 3P7JA 3QJYA 3BINA 3SDZA 1SE9A 4MGIE 1AWDA 2J52A 4YCUA 1A63A 4P72A 2KWDA 2ASBA 4TQ1A 5CV7A 4IG7B 3V61A 1MSGA 4ZKCB 4CDDC 1WIAA 4YY3Q 4MDKE 1VQPA 4Z9CB 1HNWQ 1WZ3A 2R2OA 1UGJA 1ICWA 3KF8B 5M9OA 3C2PA 2IO1B 5M3FG 3QA8A 2W9NA 1KJTA 1TWGH 2K1BA 4M0WB 4ANVA 2M2LA 1KM7A 1N9WA 2CU3A 2D3BA 3RN5A 2F0DA 2MPMA 2FE8A 5C1ZA 1TVXA 2IO3B 3RMHA 3CWIA 1HTOA 4KHPQ 3D6CA 2KACA 3AI5A 4KTAA 1QB5D 5BMIA 5DCNA 3EQLC 4JPBW 4A3BB 1KNEA 3H3VI 4NQKE 3PF5A 4F7XA 4HAEA 4A3CH 4NPNA 2L55A 4UP8A 3CF6E 3EVQA 1C76A 1NBFC 2R2QA 3LYYA 2UWQA 2V4IB 3TMPB 1TU2B 2WDRB 5IP7H 5IYCG 4C1NI 1WX7A 1I4XA 1YX5B 1DOYA 3P20A 2KVRA 3MFGA 5ELFA 1DXMA 1FD6A 3CMEA 1UH6A 1WZ0A 3LDZE 3RMKC 1K3RA 2KQSA 1E8WA 3EHVA 4DN4M 1LUZA 2WP9B 4ULLA 1KL9A 4MGZE 5M5YB 3Q0AA 1DGJA 2NB0A 4S17A 5C4HA 5LMNL 1SSOA 3CHBD 2VQEQ 3PTFC 2HCCA 2KDEB 1RLFA 4C2MH 4JVZA 4R8NA 5I6YA 3A74A 4DXGA 1L0WA 4K2KA 5EPLA 1E8XA 1GXDC 4DXAB 2BTEA 3FILA 1JT8A 4O2DA 2K28A 4ZUJA 1K8RB 3P63A 3ERSX 2AYOB 5ELBA 2O2VA 5M5WB 4A3FG 2PI2E 1XYIA 3ZXRA 2B63H 2KDBA 3ZJTA 4DQOC 2BE5C 2A68C 1LT3D 3QOLA 1CZGA 5IN7A 2BS2B 3CMAA 3W3AA 2Z0SA 3QR8A 1RIPA 3K6OA 1RODA 2WDQB 3K7UC 3TP8A 4B3RL 3P4QB 3NHHA 2Q2HA 2DGYA 2KCNA 4L8JA 5ELDA 2KOXA 4JQWC 1I42A 2AWNA 4JOIA 1N61A 2HJ1A 3VYUA 3EECA 2PNHA 1H8CA 4GLXA 3WAMA 2RF4A 2KK8A 1GM5A 4AQ7A 1RYJA 3TREA 1QVCA 2RVLA 1QVFA 3AMZA 1L4DB 4IWQA 2IY5B 3SD5A 2V4DA 3TJPA 4QGUA 4MSMB 2MSED 5FJ8G 3E3XA 4WORA 2BT6A 3AH7A 1J9OA 3KUZA 2PLPA 3T53B 2NWGA 1QF6A 3GTGB 3VVWB 2BWFA 2BH8A 1X9NA 3CC2A 3MXNA 3GTPH 3GTQH 2X69A 4ZRQA 2I2YA 1ILPA 3S14H 3DHGC 3NENA 3J81j 3L7ZC 1LXDA 4H0LC 2XSCA 4Y52H 3OJ3A 4A3JG 2OTLA 2MGSA 1PTOF 4MELA 4GN1A 5DPWA 2UXDQ 1KF6B 2D5GA 2WAQE 3R2IA 1DONA 1UE1A 4JI6L 5C3JB 4BA1I 3X3MA 3J80E 1NI3A 3P2BA 4BKSD 1DYQA 3QJZA 1B7YB 4ZQ3A 4DKAC 3J7AV 3PPAA 1K3BC 3UIOB 1I3QB 3G4SA 1HQRD 4K6DA 4YIJA 3U30A 4C00A 1NE3A 2I5LX 4HJAA 3RPFC 5LHY1 1NEKB 4ZK9B 3T1YQ 2BB6A 3TDQA 2SAKA 4IWPA 2I5MX 2WWZA 3B0AA 3NVZA 2VB2X 3M4YA 3GE3C 3W1YA 4XYCA 1TWCB 4KLKA 2FCQA 1EM7A 1HTPA 5C44G 4J15A 2MLBA 3I73A 1NDDA 3AE6B 2KD0A 4JI8L 2BA1A 1V2YA 3I55A 2HE7A 2PNRC 5JXVA 3WALA 2C7NB 2E2JB 4C3JH 1EEID 1KRSA 5G3LD 3BVZA 4DR2L 3RNAC 3I4MH 3FP9A 1TZ1A 5C4ZA 1WM3A 4YCWA 1W6KA 4B3TQ 4RM8A 4GSWA 3J9CA 3AQQA 4XQNA 4DV7Q 4HJ7A 2DZIA 2E5LL 2DY7A 5JEAH 1N8RC 1BKBA 1XQQA 4A90A 3E9IA 3K5NA 1LT6D 1FEHA 2NTTA 4B3RQ 3A1QA 2KQ7A 5C3EH 2L15A 5GAGC 3NRZA 4L2YA 1K8GA 2A68D 1H9SB 3AU7A 2JA8H 2X6GA 1JQ4A 2MJEA 3CCSA 5DPRA 3CAMA 1L1OA 4HMJA 3ECIA 2XN9C 1TJEA 4IQZA 1O7LA 2OCEA 2LVOA 3MXUA 3PO2H 2KVMA 5M3MB 4A3FB 2G4DB 4HWIB 3HKZB 1SNPA 2SEBD 2R93B 4ANXA 2RCFA 3DVGX 4KY7A 2F3IA 2KBNA 1YHQA 2JJQA 2M1MA 1T0SC 2PPHA 3PUWA 5JHAA 2IGGA 2AL3A 3KF8A 5I2YA 1BO0A 3W2DA 1R7SA 3BK1A 2YEPB 1TKWB 5LMNQ 3D6WA 4WJWA 5KNBA 1W6JA 2LXAA 2L1BA 3LWEA 4C3IH 1IBMQ 1NNXA 2EIFA 1HHVA 3LXFA 3VR9B 2CKZB 3ND9A 3H9DA 3DVNV 4S0RA 2UXBL 1Q1EA 4EZJA 2KX0A 5EKKA 2KA7A 3BK2A 1YNXA 1WX8A 1F2MA 2GI9A 3O65B 3P75A 1SIFA 3A9KB 1QOBA 4K7SA 3BZKA 4X6AH 3IKJA 4CKCA 1VZ6A 4EUTA 3PIO3 2FXQA 2WXPA 1FFUA 4AWJA 3NZ3A 3PF4A 1P16A 3OOCA 5J39A 1L1OB 4OL7A 3VRBB 1LTTD 4X62Q 3MAQA 1TWFH 5CBAE 2UYZB 4KHPL 3P4PB 2BYVE 4M8NA 1DM0B 3MJWA 3H0GG 3RLOA 3CC7A 4RG1A 4A3BG 4GDKA 5EE9A 2NS5A 4K5XA 4ICUA 4K7WA 5BYQA 1WI5A 2K5HA 1YNJC 1D3ZA 3ULPA 4WJ4A 5JZEB 1OFFA 1TWAH 1NMFA 2XIWA 3S15H 1BCPF 5IT9L 4JX1C 2IX1A 3U8ZA 5M3FB 3IAYA 1L5PA 4LCDE 4GN5A 1NCVA 4XWWA 3M7NA 2OHFA 2D62A 5EDSA 4A3GB 3AE9B 2B2TA 2CJNA 1C77A 4AS1A 2DNCA 1CSQA 2W54A 4REZA 1BQQT 4A3DH 1E10A 1OXSC 1E24A 3NBIA 3NE5B 1WD1A 2GBJA 4DV5Q 2N7DA 4ITKA 1H9JA 1JROA 2JXXA 3H7PA 4XC2A 4PK1A 1VJKA 2JA6H 4IUMB 5GMVA 4AQYL 1E1OA 2SDFA 1JMLA 1L0VB 3DXJC 5COYA 1EYAA 1VQBA 1K8OA 3APCA 2IX3A 4RH6A 4FA6A 1JJCB 1TY2A 2GMIC 4BZAA 1PYSB 1Y8OB 4XE0A 2WXHA 3ML8A 1FM0D 3EFCA 3H6NA 2MP2B 4DAYA 4WAAA 1F9QA 2RA4A 3D31A 1PH9A 2JF5A 4RM9A 4NJ6A 1FVIA 1STBA 2C60A 3GDEA 2UUAQ 2L0FA 2WU2B 4ZAIA 1GUGA 5BR8Q 1HPCA 5C23A 1X3EA 4DV4L 2IJ0A 1R9TB 1M94A 5I6WA 1TS5A 1TS3A 1FRDA 2INNE 4KIKA 3I70A 2V1CC 2D11A 3AV8A 1LTGD 5A2QE 3AU5A 4ZKBB 5CTRC 1E9MA 3PIPA 3DWAA 4KKSA 4HDOA 4MEMA 2MW5A 3NEMA 5C0XJ 4IUQA 1N34L 2B2UA 1B2TA 1NENB 4OZCA 5D2MB 2B8GA 3IAS1 5CR3A 2B76B 4DNIA 2OTJA 2EY5A 1K73C 3I4NG 2G3QB 1TWGB 4BBSG 1YI2A 4DF7A 1IW7C 3QAQA 2F0NA 3ER0A 4KJOA 1PZID 1VQ5A 2IO2B 2ZM6Q 1QOHA 3OTOL 2QJLA 2WXOA 2B2YC 3M62B 2HD3A 4JI1Q 1YX6B 3T3OA 4YXDB 4HDQA 3S1RH 5IIFA 4K3CA 1X54A 3FEWX 3C0RB 4JG2A 1EY7A 1BOSA 4NB3A 1VQNA 3A9JA 2KZRA 1VQKA 4XDXA 2SOBA 3ZNZB 1D5XC 2G9DA 1GD7A 2KHIA 3H91A 4YT0B 2G4SA 2PVOD 2IZVB 2LGDA 2OEOA 2E2DC 1YEZA 3K57A 4RHRA 3K5LA 3HK0A 4A3BH 4E74A 4NQLB 1KQSA 2F3WA 1SIJA 2F3VA 4AQYQ 1JMCA 2UUCL 1BUVT 3KF6A 2UU9Q 4NMZA 1QKZA 4MGYE 1WTVA 3AXCA 2M8SA 2L0TA 3G7LA 2JA9A 1SRUA 1FYCA 1YNJD 4K8JA 4GN4B 1ZPSA 3QWNA 2CQAA 1HZCA 2WP8J 3S1NH 4HK2A 1EU3A 4BBRG 3K7AH 4NAWA 2MH7A 5KHOA 3P42A 2Y5PA 2J4XA 1A70A 1WTQA 5IGCA 4HMIA 4MN3A 1D6EC 1BBXC 1B50A 4DV2L 2BOSA 3KYCD 3V6CB 1WGHA 1F2ZA 2B63B 1WYDA 3AYHB 4IM0A 2F0WA 2DJGC 2KJHB 2PJHA 5D7GA 4BY7B 4DAYB 1A8VA 5D6JB 4DBGA 1EF1A 4GLVB 3MZ5A 1C9FA 4HJ8A 4UY8C 3FC4A 1RKNA 2VS1A 5J3BA 2XK5B 4X62L 4RGTA 5ISRA 2KFJA 3ZRCA 2DZMA 1WYGA 3A8IE 1FGBD 1AZPA 1CKNA 4LF8Q 1DZ1A 2A5UA 3DBRI 3DOWA 5HHDG 5LXHA 3PO2G 3V96A 2JRIB 1P0RA 3EC8A 3VR3A 4JI5Q 5D3IB 2Y0SG 2DZKA 3H7PB 1JJGA 3RR5A 5LXIB 1ASZA 2G45B 4KMUC 4ICVA 3X23A 1B9RA 2L12A 3VR4A 2AWOA 2VQFQ 1WTWA 2XNAC 3S14B 1ZXIA 3NUHB 1C48A 2A8VA 2ZW0A 4AJYB 1ZYRD 3CKIB 2Q5WD 3NHEB 2GVBA 1EL0A 4P16A 3KWLA 4NDXA 4KGTA 4B3TL 2JA7G 1IKMA 2N9EB 2EOTA 1EFID 1JOQA 4X3UA 1HNXL 4FHKA 3NVYA 2FNJB 1A3UA 5IKCM 2Z8LA 2INPE 2FINB 1PH7A 1HR0Q 2RD0A 1VZ7A 3HVZA 2JPHA 4WWMA 1YHBA 1FJGQ 3ABVB 3GZNB 1H9MA 3AEDB 5I2XA 1MG4A 2PKOA 1UUPA 4HEDA 3NBHA 2WXGA 4TVAB 4XWTA 5D94A 1F9PA 3MEHA 3UQBA 2J0MA 2D3GA 5CGKA 3ERQA 1PVOA 2C9WB 3VAWA 3GZNI 1B3AA 1HXYD 1G91A 1G6PA 2WX0A 4R4IA 1XPUA 1A6XA 3VA7A 1FNWA 1HZ6A 1K0RA 4KY5A 3N20C 4JL9A 5IGEA 3PO0A 1EY4A 3KF6B 4OIKA 3OTOQ 3TEWA 1KLVA 2KDMA 1TYGB 2NBFA 4RGOS 4KHVA 5BN5A 3NG0A 1WE6A 3B2GA 3N52A 4YSYB 2L9HA 1CKNB 4BXXG 1WXSA 1XF5L 3I72A 4HIKA 2O6VD 1CZWA 1XPOA 4GU2A 3Q8EA 3PO3H 1V8QA 3T51B 3TP7A 1YQBA 1FIQA 3PIOA 3I4LA 2K33A 5GROA 1UWXA 1WJNA 3PV1A 3ICEA 3DWGC 2N9LA 2QEJC 3PUVA 3IBEA 1Q12A 4CGYB 1K83H 4LF7Q 4FULA 4AJWA 4L1BA 3Q2AC 3BDLA 2QKIC 3CCJA 5IYBH 3L13A 1SLJA 2VZAA 3NS8A 5C0XH 1HJPA 1XLOA 1U4RA 2WIIB 1A2TA 3KDFB 1PV4A 3T1YL 1MHHE 1J19A 1YNND 2X6LA 4WH4A 2JWZA 1TS4A 3WAOA 2V3PA 3VYSA 1YZ6A 2J42A 4HROA 4WQMA 3ONSA 5AZFA 3QOJA 1CHQD 1V97A 1EYDA 2N9XA 1I50B 2I46A 3MTSA 1FXTB 2A69C 4F88A 1G2SA 1JRPA 4A4IA 2NVTB 4DR3L 1BCPD 1JR0D 2KFKB 3RNBC 3APDA 4POFA 3MC0B 4A3LH 1P3QU 3A1QB 3AE4B 4EQOA 2E74C 1Y8RC 1YOVB 3QQ8B 1VQGA 2BCOA 4PT5A 4EEWA 1X56A 2MQHA 2JSOA 1ROEA 4RNAA 4HVBA 4II2B 4J6IA 5G5GA 1JQYD 1Y1WB 2R92G 4DV3L 2K5WA 3AMUA 4XQQA 2LGIA 3IHPC 2LUMA 2PMZE 3NS1A 1C3TA 1B3QA 5EE3A 1SE8A 4R4OA 5IGBA 4URKA 1VLBA 1ZGUB 1E2ZA 3NPPA 1CM9A 4W9DA 2R93H 2LJIA 1EWHA 2MBOA 1AFPA 4A3CG 1Y1WG 2R92B 1K50A 3KUPA 3QCAA 3FKIB 1IP9A 4A3KH 1PFBA 2QC8A 3AECB 2RR9A 4ZUIA 1EIYB 3CPWA 2MO1A 3VYTA 1TBEA 4LF6L 3HRZC 3MJ5A 4W9KA 4L23A 3NUCA 3S1RB 1MBYA 5CC4A 4MACA 5M3FH 3LNNA 4N8FA 2ALYB 3NWSA 1IW7D 5FLXE 3A54A 4A3MB 1S5CD 3QARA 3KUCB 1YIJA 1T6BX 2PIAA 1XLPA 3DQVA 4M00A 3F2CA 3IT4B 4OVZA 4ZRZA 3HUIA 1FO4A 4QUCA 4LF4L 1HRJA 1R4NI 3PZ8A 3A8KE 1Y56A 3GTLB 1IBKL 3TBIB 3S2HH 2WXLA 3BWUD 1K8AC 1CTMA 4A3IB 1R4NB 4GDLA 4B6WA 4PZ6A 2J53A 3DWQA 1WVLA 1VQFA 3VR2A 4A3GH 2KWUB 4N59A 1ZKOA 1F2LA 5LL6X 2KCMA 3AE2B 4LF5Q 4EOYA 5G5HA 1I5FA 1N36L 2N0SB 2WLBA 4GB9A 4HPLB 3S1NB 2DHZA 3Q8CA 2JA5G 1SNDA 3BZDB 3K7AB 4JYAL 1JB7A 1UWMA 1JJ2A 2W3RA 5EE0A 4CJ1B 1MVKA 4KN7C 4WAFA 2RDBC 3L10B 2MCNB 1GC7A 2KDIA 2OQ0A 2ATWA 2AUKA 4KY6A 2R7ZB 5TSSA 2YU9B 2M56B 2B8FA 2XWJB 4UPAA 1C9OA 4KK7A 2L76A 1UNSA 2HUGA 2JA6B 1ESRA 3JAMc 1S1QB 1TXYA 2LEKA 4YWGG 2QMTA 4ZDVA 1LACA 1BF4A 2JYTA 2XRQD 1GNUA 4RAUC 4QUFA 2Z0DB 1ZP0B 2Z4HA 1LTAD 2E5LQ 1XPRA 1SR3A 3Q8BA 4C80A 3PO3G 2RPQA 1K9MC 4JI0Q 2L52A 1IBML 2WINB 1W3SA 3RULA 1RF2D 4P74A 4CDCC 1ZXHA 4J6HA 3BG3A 2F0JA 5A2QL 1I6HB 3C19A 3QC8B 1GUWA 2EXDA 4LUOA 2DENB 3ZDTA 4EZKA 5BO4B 3Q3FA 2WAQG 3L3OC 2V3NA 2NBUA 1PFSA 5GAEC 2Y5BB 4GDLB 2N1WA 2NVXH 2PE9A 2E2IH 4OIJA 5C5MA 1QOAA 1WMHB 2OJWA 3PS6A 2D2QA 3PUYA 1PRTC 2PQAB 2RKSA 1L0XB 4J8QA 4GKJQ 3I91A 1JRUA 4K7UA 2PQEA 2LD9A 1QNUA 4FF2A 1ASYA 3NTKA 4ANWA 2N7EA 1WM2A 1L2NA 1M90C 1F2RI 1BXTA 5CHFA 3HOVG 1XJVA 3JSVB 3L54A 4OZBA 1O7YA 1A2UA 2KYWA 5AJ3Q 4FF3A 1I4HA 1Y1VH 1TGZB 3S1QB 1VCIA 1SFOB 3AE3B 1CI3M 1EWYC 1S5DD 4DUYL 3MC8A 1Q8KA 1KRHA 2JEBI 4RWSC 3HM3A 1XO3A 2BYFA 4BAXA 4FJZA 4WJPA 5GXGB 1RDPD 1K28A 1E5WA 1PFDA 1BBWA 2LXKA 2BPSA 3I63C 1VD2A 2ES2A 1PGXA 2LASA 4M0WA 1C4PA 1TS2A 4NW2A 3HRDD 3KJOA 3L17A 5LLIA 4F7ZA 5LMUL 3OMCA 5AFWA 1U4LA 1WJ4A 2K22A 3PLVA 3Q22A 4N8X1 5JPMC 1K53A 4FXCA 2RHSB 4KSLC 1F9RA 5IGFA 1E2WA 4RCOA 1CZPA 1D4BA 4PS3A 5H1SE 3GV3A 1CHPD 3MWYW 1KD1C 2X8XX 3RNUA 2LMCB 2KXJA 2H5XA 4A3EG 2KAJA 2Y5CA 1JOOA 2O4XA 1WGDA 5EKLA 3P1HA 4IPCA 1BVSA 3ZTCA 1SNQA 5C4JH 4EVOA 2K39A 4NXMQ 3ULLA 4A8XC 5BYSA 2KOLA 1KDBA 1NBWA 4I7AA 5I4DA 5KRUA 2PE6B 4M01A 2CCZA 4ZRJA 3TIXA 1EIHA 2CKHB 3FDTA 1Q46A 3NVVA 1O7ZA 2KQ3A 2L05A 1HH2P 2EELA 3KQ4A 3SR1A 4RF0A 2HIXA 3IL8A 4LTUA 4P1CC 4Q5VA 3OSOA 3F2UA 4DR5L 3DBRB 4DFAA 3A5ZB 1T9HA 3U7DA 4B0MA 1Q81C 4P1BC 1MIUA 3SK5A 1XMOL 4V190 2ENBA 1E7VA 5AZGA 1HFNA 4DR4Q 1WXMA 3VH4B 3HOWB 1QT9A 1ZEQX 1ICFB 1C7YA 3DM1A 3B08A 4CO7A 4K2LA 1HEZE 2XTIA 3JAML 5HFYA 4HKQA 2ON8A 4PG3A 2KNBA 2LHDA 3T13A 3A9JB 1PH6A 2NMQA 1H9RA 1QQRA 1VQAA 4XYOA 2L1AA 4F1SA 1QWYA 1X3QA 3JSVA 4DR1L 3W1SC 2JEAI 3RN9C 1F9SA 2N8NA 4GOPB 2BWES 4MIUA 5FO9B 2R92H 1ML0D 4AYBB 2HDEA 2BA0A 2EJGC 5IYDH 2PQAA 2PZUA 1XT9B 2O2LD 1VDVA 5IWAL 3PHXB 5ELNA 1GHJA 3SE0A 3UDGA 4LJOB 4MGKE 3OMGA 3ZNHB 2EYPA 1PH4A 3OW7A 4IFDJ 1SF0A 1J8IA 5MPOA 1RWSA 3K0YA 3R3OA 3A7LA 1P9DU 3STBD 4K1RB 3NXWA 2YTVA 4CJ0B 3SFEB 1VS0A 2B39A 2VL6A 1SYGA 1PRTD 3FHWA 3I56A 1HNZL 3RUZA 4NXNQ 2RBMA 2WXFA 3MTNB 4DNTB 3G6EA 2O6VB 1YMHE 2BKFA 1EOTA 4DK0A 2BS4B 4KV2A 3AE1B 4GNXC 2OF1A 2J7ZA 3BS1A 4DV1L 2RMMA 4BKGA 1KOTA 2K25A 1JE5A 2NZ1D 5JJLA 2D3AA 3AFPA 1Z7TA 1JICA 4F8MA 3WWVA 1FXAA 1LTSD 1ZOYB 2W82A 5T1IA 3U58A 1MPEA 2F0UA 3A4RA 4US8A 2ZVNA 1WWTA 1B70B 1WTOA 1RFKA 1XLQA 1LT5D 2LVPA 3SFDB 2E8GA 3NJTA 4PZ7A 4GNXA 3QB3A 3TCAA 5J2RA 1VMPA 2NVTH 2FHTA 1VCBA 4PS7A 3PO3B 3WOEA 5GAHC 2IWHA 4JBKA 2DX5B 5KGUA 3HOXH 1KC8C 3PSIA 4OWXB 2MP1A 5HGTA 3GQBA 1G2TA 2WXMA 4LNKA 1G51A 5ELEA 3M3YB 4PMWA 1WTPA 2KTFA 2FAZA 1YITA 1F52A 2KTRB 1Q7YC 5C3WA 2UUBL 1E2VA 2EDGA 4ILWA 4K5WA 2GBNA 3H0GB 4PV1C 5FR3A 3R3MA 2WB1B 3GTJH 2F4VQ 4PZ8A 4LJPB 3MA2B 2C5CA 2YTYA 3GTKB 3W1SA 1NR4A 1C79A 1UEBA 4MZ9A 1MHWC 4DHJB 1K52A 4BBRH 4P75A 3G6JB 1HNWL 4OELB 1E1TA 1RJTA 4E3CA 1M4VA 3X3NA 2AQ3B 2M0AA 1XLNA 3Q3JA 2NUCA 1RM6C 4OX9Q 4HCPB 5E3FA 1C1YB 2XEWA 2RSUA 2YV5A 3TP6A 1AYFA 4ALPA 1RAXA 5IE8A 2ZTDA 4A3IG 4R3DA 4TMAB 4ASWC 3S2DH 3ZKJC 2F52A 1E90A 4DDID 2ZNVB 1J5EQ 1PH5A 4A3KG 3K80C 4MT5A 3AEVA 5CYUA 3HOUG 3PREA 4C3IB 2MX2A 1P7FA 2Z6KA 2WDVB 3WOFA 4G57A 1N5WA 1GOZA 2VH1A 2R93G 3L4PA 4DV4Q 1IYFA 1XTCD 4M1UB 4KN4C 5M3MG 4A3MG 2KHWB 4W9FA 1VQMA 3GTLH 1AP0A 4HRSA 1XCTL 1SBBB 3S2HB 3ZNGC 4N9PA 2XWBB 4DV1Q 4PNYA 2L32A 2ZPYA 3FMCA 1R4QB 3J80c 3M4OH 1T0QC 3I9V1 3FKYA 4HPPA 2B3GA 4A9AA 2HHHL 1H9KA 2IGDA 1HA6A 1PQSA 2LXJA 2K6DB 1E0ZA 2K32A 3FKIG 4UHVA 1WRDB 2KECA 1HFGA 3GD7A 3CU7A 4CJ2C 4GZYC 2JT4B 4JE3B 1XCQL 4II3B 3S17B 4G7OC 4IKGA 5T8IA 3R7QA 1GB1A 1IL2A 5IWAQ 4MM3B 4ANUA 4XIGS 5M5WH 4A3IH 3PGZA 4ODGA 2E2HB 2PYKA 3OYYA 1KXLA 4N9TA 4X57B 2AQ2B 3AFQA 3VTUA 2NPTA 2KN5A 1TQOA 4DAPA 3M95A 3N3KB 4I65A 2FMMA 4QJFA 1PFNA 4DHJD 5C44B 4O42A 3J7YW 3KDFA 5NUCA 3SHLA 1GKHA 4LK1C 4C4VA 3ZIMA 3MP9A 1Z9FA 2K8HA 4WIPA 3Q24A 2B2YA 2IL8A 4MSQB 2R7ZH 1U5KA 3HZXA 4O1NA 4JWSC 1Q1BA 2FFKB 3RFZB 2BW2A 3UINB 3MEFA 5BN3A 3J81L 4HJKA 4R1JA 4EE2A 3N32A 1IGCA 2WXJA 4NXNL 4FLHA 1N63A 3EFXD 4OWWB 4IALA 1EUVB 5DLQE 1HR0L 4HLEA 1YJ1A 4QY7A 2WKCA 2WXKA 1JORA 3CRKC 4JCVE 1V43A 2L0CA 2FCMA 4A3DG 4NXML 2HQLA 3PV0A 4IPGA 4WQOB 3DWMA 2V0GA 4GS3A 2JVCA 5E7NA 4BFRA 1YVCA 1STAA 2KC1A 1N33Q 1PTOB 4X66Q 4L63B 2C35B 3PCOB 2YVCA 3HFZB 3ZVVA 4BOSC 2VUMH 1EY8A 3I4NH 4FDBA 4XQJA 2FCNA 1ISNA 1HZ5A 3W5OA 1LTRD 2A73B 3LX0A 4USAA 5EGTA 4KJNA 2M4NA 2ZJDA 2L4NA 1YJIA 4IZ8A 3WAPA 4KV6A 4DR4L 1LT4D 2KEEA 4JGHB 2B2TC 2H88B 1WX9A 3ZJUA 1F1HA 2K01A 2RQXA 4DAMA 1LTLA 2DUDA 1V5OA 2QCZA 5E6PA 1Y1VB 3RD4A 3B9JA 1JWSD 2NVUI 4Y7NH 5CORA 2JYOA 1UWVA 1N32L 3PZDA 2JQRB 3KBGA 5IYDG 4P71A 1WGRA 3M4PA 4DDGD 2V9HA 2VZKD 1FCLA 5EE1A 1I6VC 5IOCA 3GTMH 3NELA 1M8AA 5M5YH 1PYWD 3V62A 3CF5A 4JV5L 1WGKA 3VHTC 1OQRA 1V8CA 1LTID 4C56C 5FLMH 2LXCA 2BE5D 2QGQA 2PW5A 2PPBC 2IHEA 2PZWA 4BBNC 2MBBB 4CYEA 3DWPA 1DOMA 1GUSA 5C6AA 2XK5A 1TR5A 1EIGA 1I4QA 3Q3NC 4LNOA 4K5VA 4B3MQ 1EZ6A 3BVGA 1SROA 3RNFC 1YN4A 3AU4A 1J8CA 2WB1E 1N6ZA 1EEFD 1S3SG 2BQQA 1SE3A 2A5HA 2ZW1A 1QZEA 4QCLA 3GB1A 2Y0SB 4C3HG 4Q0FA 3MHSD 4EX5A 2HHHQ 1D1IA 5CV4A 5FJ8H 4JI3Q 1A3VA 1PH3A 1OQYA 3GP7A 4A3FH 1Q10A 1VQCA 1U9RA 1E0BA 4NNJB 2EJFC 3J7AF 5ELCA 1K0SA 4QIWE 2KJXA 5CHVC 1O78A 1HA5A 3HOUH 2WXQA 1ZW7A 4WWOA 3H0GH 1CSPA 4BY7G 2IY0B 4M8AA 2WXRA 2GN5A 5C3EB 2AQ1B 1EY6A 4CBVA 4DV0Q 1AEXA 2B3AA 4WWPA 1J5EL 2BKRB 3IVFA 4DV5L 2O5IC 2JYEA 1R4PB 1D5MC 2EE1A 4BBRB 1FXIA 2VNUD 2BGFA 2CW0C 2FJ2A 3ZW3A 2KN4A 4JBMA 2F03A 1E8ZA 1MJEA 1SJED 3H8HA 1KH0A 4MHEA 2ICEC 2MNAA 1P7EA 2KLCA 2E75C 3BZCA 4PS8A 5JHBA 5CV6A 3RZDH 1L1OC 2N7JA 3S2DB 3I8ZA 3ZRFA 4ZHPA 2DAFA 5BR8L 2KTRA 3PQIA 3HOWH 4FBJB 1YNTE 4IM3A 5EQ0A 1SDFA 2B29A 4BBSH 2V1YA 3MHBA 2NVYB 1XNRQ 3VFKA 1IBXB 4RMFA 2IX0A 1IBKQ 2PO4A 4JI0L 1VQOA 4HXDA 1XTDA 1FNVA 3OPOA 1HNZQ 3HOXG 3A33B 1VQLA 2INDC 1Q1OA 4KGSA 1S4ZA 5FLXL 5IP4D 2B2WA 2K5PA 2MHJA 5JJIA 1V86A 3HOYB 1CMXB 3CCUA 1F9JA 1YQ3B 1PTOC 4B95A 3ETRA 2AL6A 4K3BA 2I07B 2M00A 1MI2A 3R8BA 3HOZB 4EGVA 2ACZB 2JZPA 2JK8A 1OTRB 2EYMA 4DXFA 3C3LA 1PH8A 2R61A 2K52A 4A93B 1FD7D 3CCMA 1TWHH 4IFDH 2A6HC 4B9WA 3PZ7A 4UP7A 2ZXPA 2NVQH 1WI0A 3U4VA 1PA6A 2QIEB 3NSWA 1XMQQ 4WJ3M 1BR9A 4HR7B 1N36Q 1EF5A 1K51A 1V6EA 2HTHA 3RZFA 1FR3A 2QDBA 2RDGA 2MWSB 1QCBD 1DOXA 4HPMB 2CHBD 3GTOH 4W9GA 3BDOA 2D07B 3JVZX 3F2DA 3HGBA 3GTKH 1WGGA 3WANA 5C0XI 5C44H 2LGXA 1EYGA 3U7ZA 1ONLA 3DHQA 2A6HD 1IXRA 3F2BA 1DOIA 4LF4Q 4IJLA 3DBLI 4RF1A 2BH2A 3QHTA 3C46A 5J22A 2DLBA 3HOYG 4LFBL 3TS0A 3I7FA 3H6MA 4YWMA 3J81E 3P1MA 3SR6A 4PMBA 3E56A 1Z6HA 5AUIA 4S3SA 5M3MH 1LM8B 2WGSA 1SMXA 4P2CB 4LFCL 3HOXB 4LF9Q 1SB3C 3P4RB 3PT2B 3T9LA 4A6QA 4WFN3 2HT1A 1ZDXA 1PMRA 1KDAA 3WCQA 3AB5A 1STEA 2F0SA 4OVVA 2ZJQA 2O2VB 2Z1CA 4DV7L 2GBRA 3Q6SA 4NAWB 4I6PA 1IYVA 4ZRIA 1K8MA 1SNCA 2O6VA 3DVNU 2UXCL 4JI7Q 4RKBA 3RLNA 2NZHA 1ENCA 3HIZA 1II3A 4IOAA 2WS3B 4YTMB 4JBWA 1PFMA 1E3PA 2F0LA 4A75A 2CS4A 3VDYA 4M8MA 4MH0E 2JN4A 1R9TH 4MM3A 3ZNID 4OVUA 1NR2A 4R4CA 5M5XB 1BMLC 2C5LC 3TBLD 3T4AC 1QZGA 3Q8DA 4IM2A 1UELA 5IGDA 3U4ZA 4RCNA 3T1HL 2XRSD 4LNQA 2LGSA 2K50A 3DBHI 1UE6A 5C3EG 1KRTA 1C4QA 4A3OA 3IRBA 2F0IA 4PQXA 1I94L 1JC7A 1YHAA 3VA5A 3DBHB 3DPDA 5CV5A 1CK1A 5IGGA 4IUTA 3CXCA 2UXDL 5KYLA 3IFWB 4FP5D 1PRTB 5D65A 2P5ZX 3KYDD 5E1FA 3JAMi 4P7IA 5DPTA 3RI7C 3J80L 1WTHA 3HEJA 2M19A 1IBLQ 5HKHA 1EYCA 1AE3A 1I4PA 2FIDA 2NR2A 3GTMB 1Z47A 1NVID 4C3HB 4PYUA 4IUUA 4DR2Q 1WRIA 3M4QA 1FCCC 3L08A 4FF4A 3M9BA 3A0JA 2JA8G 1PDQA 2JU6X 4OXPA 2VRRB 1NSNS 1WR1A 3PRMB 2N9PC 3CSTA 2UXCQ 3OWEB 3D8GA 5T1GA 3RNEC 2ICIA 1SE4A 1UF0A 2DYBA 3EFUA 2J0KA 3DEPA 2G5DA 5EBDA 2DZJA 5G2NA 1DOLA 1KLUD 2LY7A 3D0FA 4K0KQ 4A3JH 3I2ZA 3D3RA 3SU8X 5IP9H 1WOCA 3A8JE 1LYLA 3BVMA 3U2SC 2LZ6A 5JJZA 2LFIA 2Q8RE 2L7RA 2LMCA 2N78A 4LFCQ 4GDKB 4N58A 4A20A 1I35A 2LI5A 2DJFC 4XDCA 1I94Q 2J7QB 5JH5C 4LFBQ 1PTOH 1LM0A 3L9AX 4FXKC 1WGYA 4F8CB 1J7BA 1IHZA 2BDNA 5AEKB 1YN5A 1EQQA 4G4KA 1NYQA 2KKCA 4JYAQ 5IYBG 1PYBA 3TSSA 3S1MH 4OO1H 1KDCA 2ZXRA 2DY8A 5IY0A 3CQZH 4QL5A 1P8LA 3DMUA 1WFQA 4YL8A 4GOPA 1XD3B 3VQIA 4ZRKA 4BVUC 2F0QA 4GNXB 1CQFA 4B0EA 2Q8IB 3T3NA 2IBIB 1IKLA 2YYZA 4HCNB 3R93A 3H3VC 1E22A 1ZDVA 1YNNC 1HNXQ 2WXNA 2WFWA 4HCSA 2WHIA 3UQAA 4EKUA 4P73A 4X3SA 3DEOA 4RGNA 4BXXH 4HIDA 1BDOA 2W55A 3I3CA 3BU2A 2KUMA 1NYRA 4C1NK 2K0PA 3OLMD 4A93G 3URYA 1WD0A 2EZVA 3O13A 3E9SA 1ZKHA 5K36H 3I90A 2GBMA 3GV6A 1PGAA 3IXSA 2PMZB 1XWEA 4I6LB 4LF8L 1OO9B 1A62A 2EJMA 2F0PA 5J17A 4LMQD 2DNFA 3U9OA 2I1KA 2ZXOA 2K6QA 5LNK1 4M02A 1Q90A 3IAM1 5HG2A 4OWTB 2ZCBA 3NBHB 4NPSA 4XT1B 3KW5B 1K83B 4A3EH 2KQ4X 2B2WC 4JW0A 1I3QH 5EAYA 5K36G 4Y7NB 4FXGC 4DA2A 1Y69U 1GB4A 4JI1L 3NQTA 1AN8A 2B2VC 3WDNA 5HURA 4RHSA 2HTME 4IW0A 2ZT9C 2AUJD 4KI0A 1P98A 4DV3Q 3IT6B 3V05A 3APFA 1I4RA 4ZLTF 4OZAA 4QF4A 4E71A 1AE2A 3PRPB 1LO5D 2E2JH 1SE2A 2F0FA 1TT2A 3ZTDA 4HCEA 2D9UA 3NK9A 1NY4A 3CCRA 1L7YA 1DCZA 2QW7A 3HM6X 1IGDA 4YSXB 2CQOA 4G7HC 4KKIA 1RTNA 3PUXA 1MD2D 1E7PB 2ASQA 4AOFA 3PUZA 2NBWB 4KGRA 2SNMA 3FPPA 1V1OA 1BCPC 1HZBA 5A35A 1EWCA 4HSPA 2EYHA 3RZOH 2C7HA 2GB1A 3SGIA 1Q82C 3TS2A 3RZDB 1H4RA 4ZRPA 2A69D 2OT2A 1V9PA 4A55A 3FVQA 2MJ8A 1GUOA 1G8ZD 2K03A 3HOUB 1CUKA 1JOKA 1EIFA 4A3KB 4KKJA 4IO9A 4O0AA 4X64L 2NN6G 2MRPA 5I9PA 4BY1H 1WMHA 3TN2A 3J81c 4BOZB 1JWAD 4ZCKA 2AEHA 3S2AA 1WH3A 2ZCCA 5IT9E 1E6EB 2LGYA 3N1YC 1O80A 5FK9C 3KYHC 2ONQA 1S40A 4OHJA 1GC6A 1J6QA 1G291 3E5SA 2KCCA 3K8AA 5H92C 1V9JA 4MJSB 5LMNW 2KWCA 4N6EB 2RDFA 4AIMA 4G0NB 3JYUA 3RLFA 1S5BD 1GHKA 2KHJA 3LWUA 2A6EC 3E0JA 1IUEA 3CW2C 1Q5WB 2D10A 2DYOA 2K04A 1T0YA 4V0BA 3KH0A 3HP3A 2QEXA 1GPXA 5ELOA 4X64Q 2E3TA 1JWBD 3I57A 5KEEA 2EYLA 1N32Q 1ENFA 1S3OA 2GBKA 4W9CA 4PYZA 2UUAL 4A93H 1IZ6A 2WB1G 3N9YC 4PMCA 2NVQB 3EA6A 4MNOA 4L5RC 3HOYH 2BYEA 2ZVOA 4WJOA 2KDFB 2NVYH 3KBXA 3SDLC 5GQOA 4AUQC 2V4LA 4JI3L 2F4VL 4NJ7A 1J7CA 4LWCA 1Y1VG 2GLSA 3H7SA 1WTRA 4LUVA 3CSFA 1FRRA 2QCPX 3Q3OC 1ET6A 3GTPB 4I7ZC 3GTQB 3GTOB 3OJ4B 3S9WA 3Q69A 2DAJA 4IC7B 3CCEA 2A19A 3ZQ4A 2KANA 3U50C 5JJKA 3HKZE 3RD2A 1Q86C 4FJVB 3S16H 1G6JA 3FILB 1N60A 1MSHA 4QMGA 3M85A 3UI2A 4TKNA 1WCMH 2NBVB 4DK5A 1NTGA 3VR5A 3ZUNA 2EMTA 2KJ6A 4J3OD 2UXBQ 3TL5A 4JI2Q 3VUYA 2FUHB 4BKTA 1LABA 3I4OA 2PZTA 4JV5Q 4FNFA 3Q23A 4OGQC 1OXUA 2O5JC 1OEYJ 1H9SA 1LQBA 3MVVA 4E6IA 5DEHA 4FYDA 1I7HA 5BMHA 4XDDA 1SNOA 1JW9D 3AEEB 2REXA 3G48A 3ENEA 1WCMG 2KMAA 4ZOHC 1HCZA 3GS2A 1ZYRC 1TIFA 3K9OB 1PGBA 4A3DB 3AE5B 5E6OA 3KK7A 3BYTB 4IUVA 3STBC 2D0OA 5IP9G 1OXXK 2KVZA 4IUPA 1SJHD 3TEZA 1I50H 2VW9A 1HUMA 2CWAA 3CC4A 5CX3A 3I4MB 4DR5Q 1C8CA 5C4XB 1U4AA 1BT0A 3SK4A 1QOGA 1M1KC 2BB5A 3PHWB 2JWUA 4OO1G 2IGHA 2LUEA 3RN2A 4JI4Q 5G55A 4AYBG 4BWGB 1Y1WH 4GOCA 2YU9H 1E8YA 3J7ZC 4NZLB 3AE7B 1SYDA 2YTXA 3CQZB 1EO6A 5JOBA 2XVSA 3K0XA 1EY5A 2VZKB 4WWNA 1PZJD 3JW0X 2CH4W 3M63B 2E76C 3H94A 4JI2L 5BYRA 4TV3A 2NCNA 3NOBA 2VQFL 2NZOA 2PI2A 4DR1Q 1L6UA 4JOIC 2KO3A 4RGMA 4LDTD 1EUJA 3M3JA 4W9LA 3EUB2 1YJ9A 2UU9L 2KMMA 2AHOB 1QUQA 2GOWA 2HIVA 3B2FA 1HTQA 4JI4L 2JXTA 5DM63 3CD6A 2K6AA 3PVLA 2I0QA 4LNNA 3HVDA 2N4FA 1XMOQ 1R4MI 4L6TB 4K81A 4JPSA 2EXZA 5KNCA 1JCKB 1C78A 2YEPF 4JK1C 1CQVA 1Y14B 1L6VA 4XGAB 2WACA 1UGMA 5FR6A 5KIXA 4DUYQ 4CHKA 4QB4A 3DLLA 3H1UA 4XZ4A 1ENAA 1VQDA 2K5NA 1PHJA 1RFAA 1IPGA 1E7ZA 2IPKD 2AX5A 1WJ6A 1EZ8A 4L5TA 2KENA 3VRAB 1HR0W 4CHTB 4A3EB 1SYCA 2C9OA 2PEAA 2CHXA 5E4XA 3R2TA 3D4RA 4C3IG 1WJUA 3NWTA 3U9SA 4FHJA 4POGA 1HZ9A 2EKIA 2RSOA 3TZUA 1TKYA 3VR8B 5C3XA 4GMVA 4TKOB 4CQNA 4IURA 1FFVA 3HHMA 1EQVA 3TMEA 2HQEA 2MJ3A 2BBCA 5C2TB 1FMAD 2H1EA 3UDFA 2QF7A 3E9HA 2CU1A 4NY0A 1X3FA 3L0WB 2K3UA 3CCQA 4GLSC 2NYZD 1LV9A 3OHXC 2RPVA 3SHQA 4B9KA 5LL6S 1T0RC 1V80A 2DWQA 4P6VF 1EY9A 3CCVA 3V2TA 1CJEA 3N1XC 4LDTB 3DDCB 3RT3B 2N55A 2K1FA 4RMAA 1LGRA 3NTHA 2ZZPB 1CA5A 2Z59B 1OEYA 4KDLB 5IOIA 4OO1I 3EIVA 1OQQA 3J7A5 3RZOB 2ZM6L 5L83A 1X55A 1IYJB 4X3TA 5FOBB 3ZJYC 1RD9D 2K05A 4MTNA 3KJPA 2K9XA 3TEXA 2KT7A 2XBBC 4B08A 3ONAB 3OAWA 2JA7H 4N9F4 4DU9A 4OW0A 2A1AA 5C0XG 2X38A 2N1VA 4IOIE 2I38A 3VDZA 1ZE3D 2WX1A 4FN2A 2VUMG 2RSNA 2CHZA 1DJRD 1VF7A 3GO5A 1D5ZC 2KWVB 1QE6A 4NAMA 2QDFA 5E6NA 5DNFA 4LFAL 4GLAC 1B53A 3R66C 2IDYA 2VUMB 5TR5A 3EBEA 4EQNA 1WJJA 4BS9A 1LLRD 3L2PA 4HSVA 1B4OA 3CMMB 5HI1A 3QO2A 3RUIB 2K75A 4KD4A 5IA7A 2BF8B 4IDIA 5JVH3 3UE0A 5FO8B 3EJIA 2F0TA 4R8IA 3R7RA 2HCIA 1SFOH 2JA6G 3DBSA 1EQTA 3A56A 3IFDA 3EGRA 3K5MA 4HEA1 2R3ZA 1V5TA 3W9CB 3UGBB 4OONA 1VDZA 2R7ZG 4IFDG 3SK6A 1JWUD 4ARIA 4TRDA 2FIFA 1KFYB 3UE1A 4WJQA 1TWCH 1JE4A 3DHIC 4YSZB 3WA0A 1B8AA 1Z5SB 4C4VB 4MH8A 1MJDA 4RA8A 2D5DA 1CKOA 2K14A 4C3JB 2L83A 2D3CA 1D8LA 1KHIA 2CHWA 2MHVA 1QLBB 3QK0A 1QUQB 1RRBA 1EQRA 1SAPA 2L8JA 3BDCA 3KFUA 2FBWB 2EY1A 5FO7B 1UBIA 1YQ4B 2R7DA 2LFNA 1Q0WB 2MBQA 2M0XA 4BY7H 3TUOA 3AM9A 4G7ZC 4YWKA 5C4JB 3MHZA 2F1MA 5FLXc 3UIPB 2QILA 3QIAA 3D4WA 2F0KA 2HDMA 3HOWG 1SGHA 5CV9A 3V3XA 4FO2A 3AE8B 1VQEA 4YTNB 1STNA 2F4IA 2BVCA 1MGSA 3MXGA 4XYQA 3VR6A 3B1LX 3UI3A 4BY1B 1UEAB 2TSSA 4DV0L 2D2CC 1PH2A 1VRAB 1YN3A 3BIID 3K9PB 3QWZB 2GVAA 3TQYA 1PRTF 2Z4IA 1AH9A 5H8YE 1I4GA 1XXGA 2G1EA 1VQ4A 4QAYA 1TT5B 2WYQA 4RKLA 1PLFA 3CIRB 2Z6KC 4X65L 4B3SL 4W9IA 3FPUB 1X3PA 5JAVA 5FLMG 1IL8A 2LKVA 3Q6BA 1AZQA 2JP1A 1KAAA 1MFWA 2CWPA 5EPKA 2RGFA 3U4EG 4AH6A 1R4MB 3ZO5B 3MC9A 1VQ6A 2JZZA 3VUWA 1V1PB 3K5OA 3H15A 3OW2A 2PVGC 2Q2IA 4LAAA 1V49A 1WYWB 1GUAB 1GVPA 3W1GA 2JRHA 4BBNF 2F0HA 3S24A 4HIMA 2BDOA 2WQYB 4WJNA 1L0YB 4UP9A 3T56B 2IO0B 3VYRA 3VTWA 2TMPA 3E6ZX 3GE8C 4C7ZA 1NMGA 2LWPA 4TQUS 4ZYNA 3ZXVA 2PTLA 4AP4C 1SSNA 3P4SB 4J1MA 5GADC 3LJ3A 3FKIH 2ZNVC 3PLUA 1TWFB 4IUNA 4W9JA 5KYIA 1RCVD 5JEAJ 2IHFA 4DR3Q 3BJUA 2LHEA 4CKEA 2N3SA 5J18A 2E2HH 1QVGA 4LNIA 5C4XG 2F0OA 3I4MG 1MHXA 1TKEA 5JPNC 1X65A 4US9A 2DYMA 5DPSA 2LJ5A 2RCNA 3ZYYX 4HJ5A 2WNMA 2FCSA 1FL0A 2VH2A 3G71A 4R9WA 1X6OA 1WF9A 2GRIA 3PSEB 1S5FD 3ITPA 4A3MH 3HOVB 3QG1A 3OIPA 5CMDA 2C7MB 4IFDI 1KIXA 1WCMB 2JQOA 3K81C 4CDFC 3PIP3 1FJGL 2ZJRA 2I1JA 3FRPB 3GOEA 2QDLA 3KWVA 4R4QA 1VQ9A 2ZJPA 1YJWA 2PCFB 2WAQB 2FUG1 2IT1A 1DOKA 2L11A 2L00B 5D14A 3L16A 4KSKC 3X0WA 4YCVA 3UDIA 2XGTA 1X32A 3K58A 3NQIA 3S16B 3UF8A 1HE8A 3M3YH 2HD5B 4TUUA 4W9HA 1N33L 5AUKA 2EQSA 3MXNB 5EPJA 4CKBA 2D0PA 4HKZE 3KOJA 4EQ5A 4DK1A 3DVGY 1OXVA 4JI6Q 4LF9L 1LTBD 2ID0A 3NP8A 2Q8TA 2IYDB 4GOPC 3NZSA 1B9MA 2K8BA 2KX3A 3T16A 3DCGA 3BY4B 1TY0A 4G3XB 2H4OA 1BUIC 4JC0A 2J0JA 2MO0A 5KNDA 4GKJL 2VY3A 3AEGB 1L2FA 1VQ7A 1UE5A 1GUTA 4H2AA 2E6XA 3ML9A 1RL2A 3PMFA 1D2BA 1VQIA 1GAQB 5C4XH 1G6ZA 3UDXA 2PW7A 3RNCC 3KUDB 4LF5L 4DV2Q 2CW0D 2JA5B 4OEMB 2JA7B 1QG7A 1XX8A 4B9XA 1GG3A 1KNAA 4JI7L 2VQEL 2BS3B 4DR6L 2OJRA 4TQ0A 1Q8IA 3AB9A 2K4KA 4KVGB 1TZOA 1EU4A 3Q8AA 2WKDA 1ESFA 2LS01 3QX1A 4RFBA 2JE6I 2HJ8A 4G50A 5K5PA 4FVMA 3VXWA 1WFYA 5J1ZA 1QNKA 1BBUA 2K7VA 3JC66 4GN3B 4HN7A 3KVFB 1MKHA 3SVMA 2MBEA 2UUCQ 1EFWA 1HZAA 4JI5L 3CCLA 4A76A 4GXBA 3CRLC 2Z9HA 4IN3A 4DNRB 3WIMA 4NP5A 3J80i 4KZCA 2I5HA 1FGUA 1E7UA 2V3SA 3N30A 4DV6L 2Z0EB 4LF6Q 4YHHQ 2MUYA 4KKUA 2AKWB 3NVWA 3CPFA 1OTCA 3H3VH 3VTVA 3AN1A 4HJGE 1CA6A 3S1QH 3S17H 4IPHA 2JSVX 3N1ZC 2H89B 4APVA 1F77A 3A7AB 2KC2A 4HTHA 4KIKB 4GGQA 4DR7Q 3C1FA 4X3KA 1KABA 2VB3X 4XXEA 1VF5C 2K5DA 3L0OA 1D1KA 1XMQL 4XX5A 3Q8FA 1PDXA 1U4MA 1A0IA 4C3HH 1GJXA 5CV8A 2EVBA 1UBQA 1H95A 5IT9c 4L5SA 1NI2A 4ID6A 4K6LA 3TZDA 4QQBX 2OXPA 5L37A 4ME3A 3PRZA 3NTIA 2OWOA 3ZDMC 4DWFA 3TP5A 3SK8A 4ABNA 2NN6I 2MBHA 4DHZB 2LSSA 4K14A 2F0GA 3NY5A 3EROA 3AEFB 3RNGC 4EZLA 4FXDA 1XNQL 1C0AA 3RZWC 5EJWA 4OX9L 2LRWA 4ARCA 1YJJA 5HY6A 3B6YA 1SYEA 1Z2MA 1FNUA 5BMGA 3RCZA 5DAUA 4JIOU 2EYOA 1C4CA 2Q2UA 4MJSA 4EQPA 1XEEA 4D2KA 1BNZA 2JUOA 1VMCA 2KEDA 4DUZL 3AEBB 4DAVA 4BY1G 3HKSA 4YTPB 4K8IA 5G3LF 5IAAC 2NTSA 4UDUC 1XNRL 1B9NA 4BKSA 2EYFA 4KKTA 5C5LA 2L3ZA 2R7FA 1VR9A 5E4WC 1PUTA 2A74C 2B2UC 1CKMA 4LFAQ 1CT1D 4BBSB 2NVXB 4YY3L 1KLGD 4NKLA 3MXPA 5BN4A 3I4NB 1YBYA 5JEAG 4U673 2DBYA 3OG5A 1QOFA 1KTKA 4KHZA 1ACCA 4WURA 2BYTA 1KAWA 1QJOA 1MI0A 2FMCA 3V6EB 4ME5A 4KX6B 1V1PA 1AARA 3RYTA 2Y0SE 1N34Q 4C3JG 1IYUA 2L5TA 4DK3C 2F0MA 1PTOD 1WSPA 4LK0M 1SN8A 2HDLA 2CVRA 3GTGH 4FJYA 1Q3LA 1F2RC 1WE7A 2W3SA 1SMYC 3AULA 2LVQA 4W9EA 4ACFA 4DR7L 1GO3E 3K59A 3SEBA 3IFTA 2KCTA 2N9KA 2VXWA 4C7YA 4DPGA 3A5UA 1DGSA 3IG3A 4GIVA 4LNFA 2E2IB 4IWOA 3ZLZA 4DUZQ 2JY6A 4DHZE 1TTNA 1U4PA 4GKKQ 4DV6Q 1RTOA 2RDHA 1ILQA 2UUBQ 4LF7L 5EKIA 3C1EA 4Q2JA 3BYYB 1VQHA 3H09A 1S72A 2CR5A 3I3TB 2KFKA 4R4TA 4XT3B 4B3ML 3I5JC 2ZTCA 4KD3A 1ET9A 4LUZA 1PH1A 1XNQQ 4A3GG 3D4DA 1BCPB 1SMYD 4C2MB 3HOZH 5JVG3 3KLWA 3KLSA 2NN6H 2EKEC 1SYBA 2UU7A 2F0EA 4BA2I 4H44C 5DM73 2JA8B 4H7BA 2N49A 4L5QA 1N5XA 2MQJA 2EPBA 2CJOA 3F1ZA 1X3GA 1ZXTA 4DR6Q 3PGEA 1VQJA 4AYBE 3V60A 2PW9A 2J0TD 4LLGM 2YLMA 2CH4A 4CDEC 5IODA 2ZTEA 3PO2B 1GUNA 2QSDA 4EFOA 2ZEQA 2OQKA 1RHPA 1J0GA 3W1BA 1X1MA 2MP2A 4IOCA 2KHSA 2K5VA 3KLSX 4YWLA 3ULJA 5I9OA 1WXAA 2Y3AA 3HG9A 2AWTA 3W5UB 1L4ZB 2JZ3B 1MG8A 1EOVA 1NUCA 4YHHL 1F2YA 1Y8PB 3DM3A 3E0EA 1UD7A 2EMSA 1UE7A 2ZPNA 1QILA 3VUXA 5FKAC 3QIJA 4H13C 3KLRA 1SXTA 3GTJB 1ZUD2 1U0LA 2DNEA 2M9VA 2B63G 1OGWA 5F2DA 2KJRA 4JLCA 3TRZA 2QHOA 1HUNA 1V81A 1IBXA 4LW1A 1T5EA 2OEDA 3TEHB 5KHQA 4IJHA 1JWMD 4X66L 1PXUA 1NAPA 2F0VA 2JA5H 4K0KL 3J81i 1WR6E 3AEAB 4QIWB 2IY1B 3DHHC 2RHQB 2MEKA 1PZKD 3LB8C 4H02A 4JWUC 1HQMC 1D7QA 2AMCB 2EYJA 1MJCA 5IO9A 3ALBA 4TSSA 5E6JA 2GA4B 3HKZG 1HTLD 2WV6D 1B44D 4HIOA 3NZUA 2G9HD 2A4ZA 1A15A 3W5VB 2SNSA 1F0ZA 1O7IA 1N62A 4JBJA 4GKKL 2WDTB 2K5QA 4U68A 1YJNA 2IW3A 4DGZA 3U52E 1JB3A 3OWFA 4G11A 4LJZC 3ZJVA 3FAHA
chains in the Genus database with same CATH topology
1OXTA 3N6RA 2B2VA 1S5ED 2PMVA 3S15B 2EY2A 4ZHOA 5CBEE 3ND8A 2WU5B 3DUZA 2WXIA 4UAIA 1TWHB 3MFYA 3M4OB 1STGA 1J7AA 3C8YA 1TWAB 4XTCS 3HS0C 1UAPA 1STYA 1CFMA 1A3TA 2EY6A 3TEYA 3OIQA 1SYFA 2N88A 1TKGA 2A6ED 3JAME 1DD2A 3ZGZA 1SEBD 1Y8NB 4WRDA 1AW7A 2JXMB 1VZ8A 3M7GA 4ZYSA 2JX5A 2DN8A 3S1MB 1EY0A 1T5XD 2MJDA 1SNMA 1WXQA 1T3QA 4NJCA 2R6GA 3A55A 4A3JB 1C4AA 4FF1A 4F87A 1WTXA 1JALA 5D3DA 5EBCA 3SXHA 1STHA 1TIID 1B1ZA 3P7JA 3QJYA 3SDZA 1AWDA 2J52A 2KWDA 4TQ1A 5CV7A 1MSGA 4ZKCB 4Z9CB 1UGJA 1ICWA 5M9OA 3C2PA 2K1BA 2M2LA 2CU3A 2F0DA 2MPMA 2FE8A 1TVXA 3RMHA 3CWIA 3D6CA 2KACA 4KTAA 1QB5D 5BMIA 3EQLC 4A3BB 1KNEA 4F7XA 4HAEA 2L55A 3EVQA 1C76A 3LYYA 2V4IB 1TU2B 2WDRB 4C1NI 1I4XA 1DOYA 3P20A 3MFGA 5ELFA 1DXMA 1FD6A 4DN4M 2WP9B 4ULLA 5M5YB 3Q0AA 1DGJA 2NB0A 5C4HA 1SSOA 3CHBD 2HCCA 4R8NA 5I6YA 4DXGA 4K2KA 5EPLA 2BTEA 1GXDC 3FILA 2K28A 4ZUJA 3P63A 5ELBA 5M5WB 1XYIA 3ZJTA 4DQOC 2BE5C 2A68C 1LT3D 3QOLA 1CZGA 2BS2B 3W3AA 3K6OA 1RODA 2WDQB 3TP8A 3P4QB 3NHHA 2KCNA 4L8JA 5ELDA 2AWNA 1N61A 3VYUA 4AQ7A 1RYJA 3AMZA 2RVLA 1L4DB 2V4DA 4WORA 2BT6A 3AH7A 1J9OA 2PLPA 3T53B 2NWGA 1QF6A 3GTGB 3MXNA 2X69A 4ZRQA 2I2YA 1ILPA 3L7ZC 4H0LC 2XSCA 2MGSA 1PTOF 1KF6B 2D5GA 3R2IA 1DONA 5C3JB 4BA1I 3X3MA 3J80E 1NI3A 1DYQA 4ZQ3A 3J7AV 1I3QB 1HQRD 4K6DA 4YIJA 3RPFC 5LHY1 1NEKB 4ZK9B 2BB6A 3TDQA 2SAKA 3NVZA 2VB2X 3M4YA 1TWCB 1EM7A 1HTPA 3I73A 3AE6B 2BA1A 2PNRC 5JXVA 2E2JB 1EEID 5G3LD 3BVZA 5C4ZA 1W6KA 3J9CA 4XQNA 2DY7A 5JEAH 4A90A 3K5NA 1LT6D 1FEHA 2NTTA 3NRZA 4L2YA 2A68D 1H9SB 3AU7A 2X6GA 1JQ4A 2MJEA 4HMJA 2XN9C 1TJEA 4IQZA 1O7LA 3MXUA 2KVMA 5M3MB 4A3FB 3HKZB 1SNPA 2SEBD 2R93B 4KY7A 3PUWA 2IGGA 3KF8A 5I2YA 1BO0A 3W2DA 1R7SA 3BK1A 2YEPB 1TKWB 3D6WA 4WJWA 5KNBA 1W6JA 2L1BA 3LWEA 1HHVA 3LXFA 3VR9B 3ND9A 1Q1EA 5EKKA 2KA7A 3BK2A 2GI9A 1F2MA 3P75A 1QOBA 3IKJA 4CKCA 1VZ6A 3PIO3 2WXPA 1FFUA 3NZ3A 3OOCA 5J39A 4OL7A 3VRBB 1LTTD 3MAQA 5CBAE 3P4PB 1DM0B 5EE9A 4K5XA 5BYQA 1YNJC 1OFFA 2XIWA 1BCPF 5IT9L 4JX1C 2IX1A 5M3FB 3IAYA 1L5PA 1NCVA 4XWWA 3M7NA 2OHFA 2D62A 4A3GB 3AE9B 2B2TA 2CJNA 1C77A 4AS1A 2DNCA 2W54A 4REZA 1BQQT 1E10A 1OXSC 3NE5B 3NBIA 1WD1A 4ITKA 1H9JA 1JROA 1VJKA 1JMLA 2SDFA 1L0VB 3DXJC 5COYA 1EYAA 1K8OA 2IX3A 4RH6A 1TY2A 1Y8OB 4XE0A 2WXHA 1FM0D 4DAYA 1F9QA 2RA4A 3D31A 1STBA 3T3OA 2WU2B 4ZAIA 1GUGA 1HPCA 2IJ0A 1R9TB 2INNE 5I6WA 1TS5A 1TS3A 1FRDA 3I70A 3AV8A 1LTGD 5A2QE 4ZKBB 1E9MA 3DWAA 4KKSA 5C0XJ 4IUQA 1B2TA 2B2UA 1NENB 4OZCA 2B8GA 3IAS1 5CR3A 2B76B 2EY5A 1TWGB 4DF7A 1IW7C 2F0NA 4KJOA 1PZID 2WXOA 1QOHA 2QJLA 2B2YC 4YXDB 5IIFA 3FEWX 1EY7A 1BOSA 4XDXA 2SOBA 1D5XC 2G9DA 3H91A 4YT0B 2PVOD 2OEOA 2E2DC 3K57A 4RHRA 3K5LA 2F3WA 1SIJA 2F3VA 1BUVT 4NMZA 1QKZA 1WTVA 3G7LA 1FYCA 1YNJD 4K8JA 1ZPSA 3QWNA 2CQAA 2WP8J 1EU3A 2MH7A 3P42A 2Y5PA 2J4XA 1A70A 1WTQA 5IGCA 4HMIA 4MN3A 1D6EC 1BBXC 1B50A 2BOSA 1F2ZA 2B63B 2F0WA 5D7GA 4BY7B 3MZ5A 1C9FA 3FC4A 1RKNA 4RGTA 5ISRA 1WYGA 3A8IE 1FGBD 1AZPA 1DZ1A 5HHDG 3V96A 3VR3A 5D3IB 4KMUC 1B9RA 1WTWA 2L12A 3VR4A 2AWOA 3S14B 2XNAC 1ZXIA 3NUHB 1C48A 2ZW0A 1ZYRD 3CKIB 2Q5WD 4P16A 1EL0A 3KWLA 4NDXA 4KGTA 1IKMA 2EOTA 1EFID 1JOQA 4X3UA 3NVYA 1A3UA 2Z8LA 2INPE 2FINB 1VZ7A 3HVZA 4WWMA 3ABVB 1H9MA 3AEDB 5I2XA 2PKOA 1UUPA 4HEDA 3NBHA 2WXGA 4XWTA 1F9PA 3MEHA 5CGKA 3ERQA 1B3AA 1HXYD 1G91A 1A6XA 3VA7A 1FNWA 1HZ6A 4KY5A 5IGEA 3PO0A 1EY4A 3TEWA 4OIKA 2KDMA 1TYGB 2NBFA 4RGOS 4KHVA 5BN5A 3B2GA 3N52A 4YSYB 2L9HA 1XF5L 3I72A 1CZWA 3Q8EA 1V8QA 3T51B 3TP7A 1FIQA 3I4LA 2K33A 1UWXA 3DWGC 2N9LA 2QEJC 3PUVA 1Q12A 4CGYB 4L1BA 3BDLA 2QKIC 5C0XH 1XLOA 1U4RA 2WIIB 1A2TA 1MHHE 1YNND 2X6LA 4WH4A 1TS4A 2V3PA 3VYSA 4HROA 2J42A 4WQMA 3QOJA 1CHQD 1V97A 1EYDA 1I50B 2I46A 3MTSA 1JRPA 2A69C 4F88A 1G2SA 2NVTB 1BCPD 1JR0D 3MC0B 3AE4B 4EQOA 2E74C 2BCOA 4PT5A 2JSOA 1ROEA 4RNAA 5G5GA 1JQYD 1Y1WB 3AMUA 2K5WA 2LGIA 4XQQA 2LUMA 3NS1A 5EE3A 5IGBA 1VLBA 1E2ZA 3NPPA 1CM9A 2LJIA 1EWHA 1AFPA 2R92B 1K50A 3KUPA 3FKIB 3AECB 1PFBA 4ZUIA 3VYTA 3HRZC 3MJ5A 4L23A 3NUCA 3S1RB 1MBYA 5CC4A 4MACA 3LNNA 3NWSA 1IW7D 5FLXE 3A54A 4A3MB 1S5CD 1T6BX 2PIAA 1XLPA 3IT4B 4OVZA 4ZRZA 3HUIA 1FO4A 4QUCA 1HRJA 3PZ8A 3A8KE 1Y56A 3GTLB 3TBIB 2WXLA 3BWUD 1CTMA 4A3IB 2J53A 3DWQA 1WVLA 3VR2A 4N59A 1ZKOA 1F2LA 5LL6X 3AE2B 5G5HA 2N0SB 2WLBA 3S1NB 3Q8CA 1SNDA 3BZDB 3K7AB 1UWMA 2W3RA 5EE0A 4CJ1B 1MVKA 4KN7C 4WAFA 2AUKA 4KY6A 2R7ZB 5TSSA 2YU9B 2M56B 2B8FA 2XWJB 4KK7A 1UNSA 2HUGA 2JA6B 1ESRA 4YWGG 2LEKA 2QMTA 1LACA 1BF4A 2JYTA 2XRQD 4RAUC 4QUFA 1ZP0B 2Z4HA 1LTAD 3Q8BA 4C80A 2L52A 2WINB 1RF2D 1ZXHA 4J6HA 3BG3A 2F0JA 5A2QL 1I6HB 1GUWA 3L3OC 2V3NA 4GDLB 4OIJA 5C5MA 1QOAA 3PUYA 1PRTC 2RKSA 4J8QA 1L0XB 3I91A 2PQEA 1QNUA 4FF2A 3NTKA 1F2RI 1BXTA 4OZBA 1O7YA 1A2UA 4FF3A 1I4HA 3S1QB 1VCIA 1SFOB 3AE3B 1CI3M 1EWYC 1S5DD 1KRHA 2JEBI 4RWSC 1XO3A 5GXGB 1RDPD 1PFDA 4M0WA 1PGXA 1C4PA 1TS2A 4NW2A 3HRDD 3OMCA 5AFWA 1U4LA 2K22A 3Q22A 5JPMC 1K53A 4FXCA 1F9RA 5IGFA 1E2WA 4RCOA 1CZPA 1D4BA 3GV3A 1CHPD 3MWYW 2LMCB 2KAJA 2Y5CA 1JOOA 2O4XA 5EKLA 3P1HA 1SNQA 4EVOA 4A8XC 5BYSA 2KOLA 1KDBA 5I4DA 5KRUA 1EIHA 3FDTA 3NVVA 1O7ZA 2KQ3A 2EELA 3KQ4A 3SR1A 4RF0A 3IL8A 4LTUA 4Q5VA 3OSOA 3F2UA 4DFAA 4B0MA 3SK5A 4V190 2ENBA 1HFNA 3HOWB 1QT9A 1ZEQX 3DM1A 4K2LA 1HEZE 3JAML 5HFYA 4HKQA 2ON8A 2LHDA 3T13A 2NMQA 1H9RA 1QQRA 4XYOA 2L1AA 1QWYA 1X3QA 2JEAI 1F9SA 4MIUA 5FO9B 1ML0D 4AYBB 2HDEA 2BA0A 2EJGC 2PZUA 1VDVA 2O2LD 1GHJA 3SE0A 3OMGA 2EYPA 4IFDJ 3OW7A 1SF0A 1J8IA 5MPOA 1RWSA 3K0YA 3R3OA 3A7LA 3NXWA 4CJ0B 3SFEB 2B39A 1SYGA 1PRTD 2WXFA 3RUZA 2RBMA 4DNTB 1YMHE 1EOTA 4DK0A 2BS4B 3AE1B 2OF1A 2J7ZA 3BS1A 2RMMA 2NZ1D 1Z7TA 1JICA 4F8MA 1FXAA 1LTSD 1ZOYB 2W82A 5T1IA 1MPEA 2F0UA 4US8A 1WWTA 1WTOA 1RFKA 1XLQA 1LT5D 3SFDB 3QB3A 1VMPA 2FHTA 3PO3B 3WOEA 2IWHA 5KGUA 5HGTA 2MP1A 2WXMA 3GQBA 1G2TA 5ELEA 3M3YB 4PMWA 1WTPA 5C3WA 1E2VA 2EDGA 4ILWA 4K5WA 3H0GB 4PV1C 5FR3A 2WB1B 3MA2B 2C5CA 3GTKB 3W1SA 1NR4A 1C79A 1K52A 3G6JB 1RJTA 1M4VA 3X3NA 2AQ3B 2M0AA 1XLNA 2NUCA 1RM6C 5E3FA 3TP6A 1AYFA 4TMAB 4R3DA 4MT5A 5CYUA 4C3IB 1P7FA 2WDVB 3WOFA 4G57A 1N5WA 1GOZA 3L4PA 1XTCD 4M1UB 4KN4C 1AP0A 4HRSA 1XCTL 1SBBB 3S2HB 4N9PA 2XWBB 2L32A 4PNYA 3FMCA 1R4QB 3I9V1 4A9AA 1H9KA 2IGDA 1HA6A 1E0ZA 2K32A 2KECA 1HFGA 3GD7A 3CU7A 4CJ2C 4GZYC 4JE3B 1XCQL 4IKGA 3S17B 4G7OC 5T8IA 1GB1A 4MM3B 4XIGS 4ODGA 2E2HB 2PYKA 4N9TA 2AQ2B 1TQOA 4DAPA 4I65A 2FMMA 1PFNA 5C44B 4O42A 3J7YW 5NUCA 3SHLA 4LK1C 3MP9A 4WIPA 3Q24A 2B2YA 2IL8A 3HZXA 4O1NA 4JWSC 1Q1BA 2FFKB 3RFZB 2BW2A 5BN3A 3J81L 4EE2A 1IGCA 2WXJA 1N63A 3EFXD 4IALA 2WKCA 2WXKA 1JORA 3CRKC 1V43A 2L0CA 3PV0A 3DWMA 2V0GA 1STAA 1PTOB 4L63B 1EY8A 4XQJA 1HZ5A 1LTRD 2A73B 3LX0A 4USAA 5EGTA 4KJNA 2L4NA 1YJIA 4IZ8A 4KV6A 1LT4D 2KEEA 2B2TC 2H88B 3ZJUA 2K01A 2RQXA 1Y1VB 3RD4A 3B9JA 1JWSD 5CORA 2JYOA 2JQRB 3KBGA 2VZKD 1FCLA 5EE1A 1I6VC 5IOCA 1M8AA 1PYWD 1WGKA 1OQRA 1V8CA 1LTID 4C56C 2BE5D 2PPBC 2PW5A 2PZWA 3DWPA 1DOMA 1GUSA 5C6AA 1TR5A 1EIGA 1I4QA 4K5VA 1EZ6A 3BVGA 1YN4A 1EEFD 1SE3A 2A5HA 2ZW1A 3GB1A 4QCLA 2Y0SB 4C3HG 4Q0FA 1D1IA 5CV4A 1A3VA 3GP7A 1Q10A 1U9RA 1E0BA 2EJFC 3J7AF 5ELCA 2KJXA 1O78A 1HA5A 4M8AA 2WXRA 5C3EB 2AQ1B 1EY6A 4CBVA 1AEXA 2O5IC 2JYEA 1R4PB 1D5MC 2EE1A 4BBRB 1FXIA 2VNUD 2CW0C 2FJ2A 2KN4A 2F03A 1SJED 3H8HA 1KH0A 4MHEA 2ICEC 1P7EA 2E75C 5CV6A 2N7JA 4ZHPA 3S2DB 3I8ZA 1YNTE 5EQ0A 1SDFA 3MHBA 2NVYB 1IBXB 2IX0A 2PO4A 1FNVA 3OPOA 4KGSA 1S4ZA 5FLXL 2B2WA 2K5PA 3HOYB 1YQ3B 1PTOC 3ETRA 2I07B 2M00A 1MI2A 3R8BA 3HOZB 4EGVA 2ACZB 2JZPA 2EYMA 4DXFA 3C3LA 2R61A 4A93B 1FD7D 4IFDH 3PZ7A 2A6HC 4B9WA 2ZXPA 2QIEB 3NSWA 1K51A 1BR9A 4HR7B 1FR3A 2QDBA 2RDGA 1QCBD 1DOXA 2CHBD 3BDOA 3HGBA 5C0XI 3U7ZA 1ONLA 3DHQA 2A6HD 1DOIA 4RF1A 3C46A 5J22A 2DLBA 3H6MA 3J81E 3P1MA 3SR6A 4PMBA 3E56A 1Z6HA 5AUIA 4S3SA 4P2CB 3HOXB 1SB3C 3P4RB 4A6QA 4WFN3 1ZDXA 1PMRA 1KDAA 3WCQA 3AB5A 1STEA 2F0SA 2Z1CA 3Q6SA 4NAWB 1IYVA 1K8MA 1SNCA 4RKBA 1ENCA 1II3A 2WS3B 4YTMB 4JBWA 1PFMA 2F0LA 1NR2A 1BMLC 5M5XB 3T4AC 5IGDA 4RCNA 2XRSD 1C4QA 2F0IA 4PQXA 1JC7A 3VA5A 5CV5A 1CK1A 5IGGA 4IUTA 5KYLA 4FP5D 1PRTB 5D65A 5E1FA 3J80L 3HEJA 2M19A 1EYCA 1I4PA 3GTMB 1Z47A 1NVID 4C3HB 4IUUA 1WRIA 1FCCC 4FF4A 1PDQA 2JU6X 1NSNS 3OWEB 3D8GA 5T1GA 2ICIA 1SE4A 3DEPA 5EBDA 1DOLA 1KLUD 2LY7A 3D3RA 3BVMA 3A8JE 3U2SC 5JJZA 2LFIA 2Q8RE 2LMCA 4N58A 4GDKB 4XDCA 1PTOH 3L9AX 4FXKC 1J7BA 1IHZA 2BDNA 1YN5A 4G4KA 1NYQA 3TSSA 4OO1H 1KDCA 2ZXRA 2DY8A 3DMUA 3VQIA 3T3NA 2F0QA 1CQFA 4B0EA 2Q8IB 1IKLA 2YYZA 3R93A 3H3VC 1ZDVA 1YNNC 2WXNA 4HCSA 4X3SA 3DEOA 4RGNA 1BDOA 2W55A 3I3CA 2KUMA 1NYRA 4C1NK 2K0PA 3URYA 1WD0A 2EZVA 3O13A 3E9SA 5K36H 3I90A 3GV6A 1PGAA 3IXSA 2PMZB 1XWEA 1OO9B 2EJMA 2F0PA 4LMQD 3U9OA 2ZXOA 5LNK1 5HG2A 1Q90A 3IAM1 4XT1B 1K83B 2KQ4X 2B2WC 5K36G 4Y7NB 4FXGC 4DA2A 1Y69U 1GB4A 3NQTA 1AN8A 2B2VC 3WDNA 5HURA 4RHSA 2HTME 2ZT9C 2AUJD 4KI0A 3IT6B 3V05A 1I4RA 4ZLTF 4OZAA 4QF4A 1LO5D 1SE2A 2F0FA 1TT2A 4HCEA 2D9UA 3NK9A 1DCZA 1IGDA 4YSXB 4G7HC 4KKIA 1RTNA 3PUXA 1MD2D 1E7PB 3PUZA 4KGRA 2SNMA 3FPPA 1V1OA 1BCPC 5A35A 1EWCA 4HSPA 2EYHA 2GB1A 3RZDB 4ZRPA 2A69D 2OT2A 4A55A 3FVQA 2MJ8A 1GUOA 1G8ZD 2K03A 3HOUB 1JOKA 4A3KB 4KKJA 2NN6G 5I9PA 3TN2A 1JWAD 5IT9E 1E6EB 1O80A 5FK9C 2ONQA 4OHJA 1G291 3E5SA 2KCCA 5H92C 4N6EB 2RDFA 3RLFA 1S5BD 1GHKA 3LWUA 2A6EC 3E0JA 1IUEA 2DYOA 2K04A 4V0BA 1GPXA 3HP3A 2E3TA 1JWBD 3I57A 5KEEA 2EYLA 1ENFA 3N9YC 4PMCA 2NVQB 3EA6A 3KBXA 1J7CA 1WTRA 1FRRA 2QCPX 1ET6A 3GTPB 4I7ZC 3GTQB 3GTOB 3Q69A 3S9WA 3ZQ4A 3FILB 1N60A 1MSHA 4QMGA 3M85A 3UI2A 3VR5A 4J3OD 1LABA 2PZTA 4FNFA 3Q23A 4OGQC 1OXUA 2O5JC 1H9SA 3MVVA 4E6IA 5DEHA 4FYDA 1I7HA 5BMHA 4XDDA 1SNOA 1JW9D 3AEEB 4ZOHC 1HCZA 3GS2A 1ZYRC 1PGBA 4A3DB 3AE5B 3KK7A 3BYTB 4IUVA 3TEZA 1OXXK 1SJHD 4IUPA 1HUMA 3I4MB 1C8CA 5C4XB 3SK4A 1QOGA 2BB5A 2JWUA 4OO1G 2IGHA 4BWGB 4NZLB 3AE7B 1SYDA 3CQZB 5JOBA 2XVSA 2VZKB 1EY5A 1PZJD 2E76C 3H94A 5BYRA 1L6UA 4RGMA 3EUB2 2KMMA 3B2FA 2JXTA 5DM63 2K6AA 3HVDA 4JPSA 4L6TB 2EXZA 5KNCA 1JCKB 1C78A 2YEPF 4JK1C 1CQVA 1L6VA 2WACA 5KIXA 4QB4A 1ENAA 2IPKD 2AX5A 1EZ8A 3VRAB 4CHTB 4A3EB 1SYCA 2C9OA 5E4XA 3R2TA 3D4RA 4C3IG 3NWTA 3U9SA 2EKIA 2RSOA 3TZUA 1TKYA 3VR8B 5C3XA 4TKOB 4CQNA 4IURA 1FFVA 1EQVA 3TMEA 2HQEA 2MJ3A 2BBCA 5C2TB 1FMAD 2H1EA 2QF7A 2K3UA 4GLSC 2NYZD 1LV9A 3OHXC 2RPVA 5LL6S 2DWQA 4P6VF 1EY9A 3V2TA 1CJEA 2N55A 3NTHA 1CA5A 4OO1I 1OQQA 3RZOB 4X3TA 5FOBB 1RD9D 2K05A 2K9XA 3TEXA 4B08A 3ONAB 4DU9A 4OW0A 2X38A 5C0XG 4IOIE 2I38A 1ZE3D 2RSNA 1DJRD 1VF7A 3GO5A 1D5ZC 4NAMA 1QE6A 5DNFA 1B53A 2IDYA 2VUMB 4EQNA 4BS9A 1LLRD 4HSVA 1B4OA 5HI1A 3QO2A 4KD4A 4IDIA 5JVH3 5FO8B 3EJIA 2F0TA 4R8IA 2HCIA 1EQTA 3A56A 3IFDA 3EGRA 3K5MA 4HEA1 2R3ZA 3W9CB 1VDZA 4IFDG 3SK6A 1JWUD 4ARIA 4TRDA 1KFYB 1JE4A 4YSZB 4MH8A 4RA8A 2D5DA 4C3JB 2L83A 2MHVA 1QLBB 1SAPA 3BDCA 2FBWB 2EY1A 5FO7B 1YQ4B 2LFNA 3TUOA 3AM9A 4G7ZC 5C4JB 3MHZA 2F1MA 2QILA 3QIAA 3D4WA 2F0KA 2HDMA 5CV9A 3V3XA 4FO2A 3AE8B 4YTNB 1STNA 2F4IA 1MGSA 3MXGA 4XYQA 3VR6A 3UI3A 4BY1B 1UEAB 2TSSA 2D2CC 1VRAB 1YN3A 3BIID 1PRTF 2Z4IA 5H8YE 1I4GA 1XXGA 2G1EA 4RKLA 1PLFA 3CIRB 3FPUB 1X3PA 5JAVA 1IL8A 2LKVA 1AZQA 2JP1A 1KAAA 5EPKA 3U4EG 1V1PB 3K5OA 2PVGC 4LAAA 2F0HA 2WQYB 2BDOA 1L0YB 3T56B 3VYRA 2TMPA 3E6ZX 4C7ZA 4TQUS 2PTLA 1SSNA 3P4SB 4J1MA 1TWFB 4IUNA 5KYIA 1RCVD 5JEAJ 2LHEA 4CKEA 2F0OA 1MHXA 1TKEA 5JPNC 4US9A 2DYMA 2WNMA 3ZYYX 4R9WA 2GRIA 1S5FD 3ITPA 3HOVB 3QG1A 3OIPA 5CMDA 4IFDI 1WCMB 3PIP3 3KWVA 3FRPB 2PCFB 2WAQB 2FUG1 2IT1A 1DOKA 2L11A 5D14A 3S16B 1X32A 3K58A 3NQIA 5AUKA 5EPJA 4CKBA 4HKZE 4DK1A 1OXVA 1LTBD 2ID0A 3NP8A 2Q8TA 1B9MA 3T16A 1TY0A 2H4OA 1BUIC 5KNDA 3AEGB 1GUTA 4H2AA 2E6XA 3PMFA 1D2BA 1GAQB 1G6ZA 2PW7A 2CW0D 2JA5B 2JA7B 1QG7A 1XX8A 4B9XA 2BS3B 1KNAA 2WXQA 4TQ0A 1Q8IA 3AB9A 1TZOA 1EU4A 3Q8AA 2WKDA 1ESFA 2LS01 4RFBA 2JE6I 5K5PA 4FVMA 5J1ZA 1QNKA 2K7VA 4HN7A 3SVMA 3CRLC 4IN3A 4DNRB 4NP5A 2MUYA 4KKUA 3NVWA 3AN1A 4HJGE 1CA6A 2JSVX 2H89B 1F77A 3A7AB 4HTHA 3C1FA 4X3KA 1KABA 2VB3X 4XXEA 1VF5C 2K5DA 1D1KA 3Q8FA 1PDXA 1U4MA 1GJXA 5CV8A 2EVBA 4ID6A 4K6LA 3TZDA 2OXPA 3NTIA 3TP5A 3SK8A 4ABNA 2NN6I 4K14A 2F0GA 3EROA 3AEFB 4FXDA 5EJWA 4ARCA 1YJJA 1SYEA 5BMGA 1FNUA 5DAUA 2EYOA 1C4CA 4D2KA 4EQPA 1XEEA 1BNZA 3AEBB 1VMCA 2KEDA 4DAVA 4YTPB 4K8IA 5G3LF 2NTSA 4UDUC 1B9NA 2EYFA 4KKTA 5C5LA 1VR9A 5E4WC 1PUTA 2A74C 2B2UC 1CT1D 4BBSB 2NVXB 1KLGD 4NKLA 3MXPA 5BN4A 3I4NB 5JEAG 4U673 2DBYA 1QOFA 1KTKA 4KHZA 1ACCA 4WURA 2BYTA 1QJOA 1MI0A 2FMCA 4ME5A 4KX6B 1V1PA 4C3JG 1IYUA 2L5TA 2F0MA 1PTOD 1WSPA 4LK0M 2HDLA 2CVRA 1Q3LA 1F2RC 2W3SA 1SMYC 3K59A 3SEBA 3IFTA 2N9KA 2VXWA 4C7YA 2E2IB 1U4PA 1RTOA 2RDHA 1ILQA 5EKIA 3C1EA 4Q2JA 3BYYB 3H09A 4XT3B 4KD3A 1ET9A 3D4DA 1BCPB 1SMYD 4C2MB 5JVG3 3KLSA 2NN6H 1SYBA 2F0EA 4BA2I 4H44C 5DM73 2JA8B