4RGNA

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
236
structure length
214
Chain Sequence
b'SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 58
structure length 214
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgnA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgnA01
1S5FD 1PRTC 1LTGD 4L6TB 1D5XC 1SBBB 3OWEB 2XNAC 1FNWA 2XRQD 2R61A 1YN3A 1DJRD 1CHQD 4BWGB 1TY2A 1JWMD 2RDHA 1TS4A 1YN5A 2QILA 4RGOS 1UNSA 1LTSD 1STEA 1BXTA 3CHBD 4NZLB 2TSSA 3BVGA 1PTOD 1B1ZA 4RHSA 1ENFA 1RCVD 1TS3A 1V1PA 4C56C 5FKAC 1MD2D 1EEID 2ICIA 1ET6A 1I4HA 1PZJD 3BVZA 1ESFA 1ET9A 3BYYB 1TS5A 1FNVA 4RCOA 1LTID 5ELFA 2AQ3B 5TSSA 1QILA 1EU4A 2O2LD 3DWAA 1S5BD 4RHRA 4ZYSA 3DWPA 1B44D 2RDGA 5D3DA 2J4XA 3BYTB 1HA5A 1JWSD 1JWUD 3EFXD 1CHPD 1F77A 5D3IB 4L63B 1CT1D 1YN4A 1HQRD 2CHBD 4DXGA 1EFID 1SE2A 1PZKD 1LT6D 1PTOC 4OHJA 1L0YB 1JR0D 1V1PB 1HXYD 4O1NA 1PTOB 1I4RA 1FNUA 1PZID 2QEJC 1EU3A 1SE3A 2XRSD 1KLGD 2Z8LA 4RH6A 3GP7A 4RGMA 3BVMA 3V05A 1KLUD 1BCPD 1V1OA 1LO5D 3TSSA 3MFGA 1PTOF 1CQVA 1PTOH 3O13A 1SE4A 1XXGA 2G9HD 2XN9C 3EA6A 3URYA 5FK9C 1I4QA 1SJED 3R2IA 1LTRD 1UUPA 1PRTD 3SEBA 1D6EC 1I4GA 5ELCA 1BCPB 3R2TA 4Z9CB 2AQ2B 1PYWD 4RFBA 1JQYD 3W2DA 1T5XD 1AW7A 2IJ0A 1M4VA 1RDPD 1BCPF 1L0XB 1PRTB 2IPKD 4UDUC 1EEFD 5ELEA 1LTTD 1LTBD 1TY0A 1S5ED 4TSSA 1S5DD 1D5MC 1FD7D 1JCKB 1SXTA 1D5ZC 1PRTF 4RGTA 1XTCD 4RGNA 1DYQA 1G8ZD 2AQ1B 2SEBD 4DXFA 1RF2D 1I4PA 1KTKA 3DWQA 5I4DA 1EWCA 1S5CD 1SJHD 1BCPC 1GOZA 5ELBA 1I4XA 1FGBD 1HTLD 1AN8A 1LT3D 3MC0B 3R8BA 1LLRD 2WV6D 1LTAD 1SEBD 2NTTA 1CK1A 2NTSA 1LT4D 4K6LA 1TS2A 1RD9D 3KLSX 1LT5D 3BZDB 5ELDA
chains in the Genus database with same CATH superfamily
1S5FD 1VQ9A 1GC6A 5KYIA 3CCRA 1X9NA 1T3QA 3U4EG 3AQQA 5JVG3 5MPOA 3AB9A 1YN3A 1WJ4A 2CHXA 3DOWA 1N9WA 2JA6H 4PNYA 4XIGS 2F1MA 2K8HA 3EROA 2KN5A 1SYFA 3AU5A 4DK6C 3BZKA 1NEKB 1BXTA 2ZM6Q 3HVZA 1QVFA 1XQQA 4W9KA 3Q3JA 1E7PB 2KX3A 1RCVD 2F0PA 3F2BA 1SNDA 5M3FG 1EQQA 3T1HL 3A9JB 2PZUA 1ZXHA 4KLKA 3CCVA 2K6AA 4QUFA 1IBXB 2ZW1A 1H9JA 3DM1A 2LXJA 1GM5A 1X55A 3A7AB 5CV9A 1XPRA 4XX5A 2GBMA 1V5TA 3RMKC 1AFPA 2MBQA 3RNGC 1Z47A 5DPRA 3W3AA 4ZYSA 1B44D 2WHIA 3BG3A 1KXLA 5C23A 5C0XJ 2I5LX 1U4LA 2MBOA 3AEVA 1C0AA 5LXHA 2KWVB 1UWVA 2XWJB 4LF9L 5IT9E 2LJ5A 1LM0A 3AE5B 2L0CA 1CT1D 1NSNS 2Z6KC 4GDKA 4IJLA 4DBGA 3HRZC 1ILQA 5C3JB 2RMMA 3AM9A 1BBXC 4HJGE 2RBMA 2JJQA 3KFUA 1W6JA 3T1HQ 1STGA 3V96A 2HTHA 5IYCH 5BMGA 1YNNC 1E5WA 1LT6D 1WXAA 2JE6I 3RULA 1IW7C 4XGAB 2OQ0A 2K4KA 2Q2UA 2ZNVB 1KQSA 2ZTCA 2K5HA 3CAMA 2YTXA 2AX5A 3UF8A 2OOBB 3NELA 4M1UB 2K22A 2K8BA 2N0SB 3QQ8B 4FNFA 4A3GB 1TBEA 3SGIA 3S2DH 4OO1I 2AYOB 1FRRA 4MNOA 3IG3A 3LYYA 4BS9A 2DY7A 3CRKC 1QJOA 4KD3A 3JAML 4K6DA 4FXDA 4BBSG 3ZKJC 3J80c 1SJED 2JYEA 1EIFA 4LF9Q 2OXPA 2ZEQA 2DYOA 3BZCA 2NVTB 3W1BA 1WR6E 1Q5WB 2PVGC 1BCPB 3UDFA 3SVMA 3AEGB 4LW1A 2WFWA 1GJXA 3AFPA 3R66C 1U9RA 2A4ZA 4KZ0A 5CGKA 2ASBA 4B95A 1DGSA 3APCA 3DHQA 4GDKB 5DM63 1ISNA 1JE4A 4I7ZC 3EHVA 4NAMA 2BVCA 3UINB 1KABA 1S5ED 2WKDA 2JVCA 1E7ZA 1SMYD 2F0TA 2Q5WD 2D62A 1WI5A 2PW5A 1GUOA 3PV0A 2AQ1B 1ICFB 2B2WA 4WH4A 1HZ5A 3T8MA 3Q14C 1PFDA 2LMCA 2WXHA 5C4XB 2LFIA 5DPTA 2QCPX 2GOWA 1NCVA 2MJ3A 3NTKA 2OWOA 2CWPA 3L9AX 2AEHA 3IFWB 2I1JA 1Q90A 4X3TA 1YVCA 2L0TA 2FJ2A 2VL6A 4BA1I 3A74A 3OWEB 1A63A 3L7ZC 5IA7A 4N58A 4DF7A 2QW7A 1V49A 2F4VL 3OHXC 1VF5C 2WAQE 1PH5A 1E8ZA 4KHPL 3DPDA 1FL0A 2MUYA 2Z0SA 2QA4A 1G91A 2QIEB 4IW0A 5AEKB 1K83H 2EYOA 4FXGC 3T3NA 1K73C 4A3DB 3ZYYX 2WWZA 3ULLA 3ICEA 1VQAA 1K8OA 3G48A 5DCNA 3VUYA 1V1PA 3AU7A 2L05A 2VW9A 3L0OA 4ZHPA 2MBBB 2VUMH 1V97A 3BVZA 2NN6G 2V3SA 2F0DA 3J81L 5G3LF 2N55A 2LMCB 4JVZA 5IYDG 1YIJA 3NZSA 1DGJA 4X3UA 3I9V1 3WA0A 3DWPA 2PKOA 1JW9D 2YU9B 4QQBX 5I2YA 3UDXA 2KDFB 3BYTB 1DOIA 4WJQA 2F4VQ 1WCMH 3PHXB 1JWUD 4KHPQ 3CIRB 3AV8A 3GS2A 2BWES 3K9OB 1TWFB 4L5SA 5FO7B 1HUNA 2KZRA 2WDTB 4DNIA 3A4SC 2AWOA 1HQRD 3RPFC 1AZPA 3VVWB 4UAIA 2OJWA 4IC7B 1JC7A 3M7NA 4OWXB 2JA8G 1D2BA 4P72A 3HIZA 5JHBA 1V1PB 2DNEA 3HK0A 1HJPA 3OAWA 3QC8B 1V2YA 4TKNA 2WAQB 2BYEA 3AE3B 3NWTA 1BCPD 2KFJA 5L37A 3M3JA 3S1MB 2XVSA 4IPHA 5FJ8H 3KF6A 4K0KL 2EYLA 3UIPB 2G9HD 2B2VC 1TKEA 1TZOA 4ASWC 1U5KA 1YI2A 2JA7H 4EQOA 1Z2MA 1QOAA 1V43A 3SEBA 1LACA 1L2FA 1YNXA 3E0EA 3WWVA 5AZFA 5H92C 4L5RC 1NAPA 2AQ2B 2B39A 2N78A 1LUZA 3CCSA 3S14B 1RLFA 1AW7A 2IJ0A 2WXRA 2LGIA 1UF0A 5EE3A 2NVXH 4N59A 5A2QE 1YIWA 2EY6A 1FM0D 3GTGH 1KF6B 3DEPA 3ITPA 4PYUA 2KEEA 2BDNA 5ELNA 4NPNA 1I6HB 1Y1VH 2PVOD 2H4OA 1OXTA 1Y1WH 1KIXA 1JICA 2MCNB 3M9BA 2JK8A 4GNXA 4RGTA 1PRTF 1KRTA 3L0WB 4V0BA 1DYQA 4DU9A 1YJIA 2N9EB 4MT5A 2INCC 1NYRA 1A0IA 2KBNA 4K0KQ 2R92G 4HKQA 1EYCA 3T51B 3C46A 4MGYE 1QOBA 4BY1G 1TJEA 3I7FA 1MG4A 1V5OA 3KF6B 4JWSC 4BKTA 3KW5B 2LASA 1BUVT 3A33B 4AJYB 1A62A 3P20A 2R93G 2K14A 1T5EA 2IO1B 2F0KA 4L6TB 1BT0A 2LZ6A 4AYBE 1SYCA 4KZCA 5IOIA 2K5NA 5M3FH 4IURA 1FEHA 1LGRA 2HIXA 3VDYA 2GB1A 1DJRD 1IBKL 4F8CB 3GO5A 1GNUA 2JWZA 3HM6X 2B2UA 1FJGL 1FVIA 5FLXc 2WXLA 2RSNA 3RZDB 5KNDA 3S17B 3U52E 2EJGC 3MFYA 4RHSA 1NVID 1SE9A 5KEEA 3C0RB 4P71A 4RWSC 3HOYH 4ITKA 2K5WA 2LVPA 3DBRI 4GNXB 5BR8L 4DV2L 2A6EC 3UGBB 4ZRPA 4IUVA 1FIQA 1TS5A 2EOTA 1LTID 5JOBA 3IT6B 2V1YA 1XLPA 5BMIA 2MQJA 4D2KA 3ZQ4A 3TP8A 1TWAH 1V86A 1RTOA 4PZ6A 1SR3A 4HTHA 3NVYA 2J4XA 1PMRA 1K0RA 1XF5L 1CZWA 1IBKQ 2L83A 1PH6A 3NQIA 4CQNA 1FJGQ 1TWGB 4EZLA 4BOZB 2NB0A 2G4DB 3RD2A 5I9PA 2AL6A 3I73A 1X65A 2EKIA 5E6PA 3DQVA 3NBIA 3S1NB 1I35A 1W2BA 1EZ6A 5I6YA 2JSVX 2IZVB 1ENCA 5CV7A 4DXGA 2ZCCA 3MC9A 3M4QA 1UZXB 3P4SB 1ROEA 5BR8Q 4L5TA 4DV2Q 4W9CA 1EY6A 3H0GB 4BBSH 4GOPC 2JRIB 4WQMA 3PO0A 3ZIMA 4N6EB 4AYBB 2DYMA 2A69D 2JP1A 5IT9c 2BKRB 3TN2A 4RA8A 1K3BC 1JWAD 1J9OA 1TKWB 4QMGA 4DR1L 4A3FG 4WJNA 1BVSA 3SFDB 5HI1A 1LO5D 5C0XI 3RLOA 4HR7B 2CFMA 4GXBA 3S24A 4FULA 1D4BA 2P5ZX 2F0GA 2QDBA 4YTMB 2LUMA 3WOEA 1I4QA 5E4WC 3HOUB 3KUCB 3V60A 1RJTA 2NR2A 1E8WA 1QT9A 2KTFA 2DZMA 4DHJB 1H4RA 1CI3M 2W54A 1V81A 3TRZA 1N6ZA 2A8VA 2FE8A 2PE9A 3KBGA 2YEPB 4REZA 3M4OB 4IZ8A 3AN1A 3TP6A 2MO0A 1T5XD 4AJWA 3KQ4A 4CDFC 2J0JA 3KWVA 2E75C 2EYPA 2PLPA 2MO1A 3U8ZA 2UYZB 4AH6A 1HEZE 4ZCKA 2A68C 1ZOYB 1LTTD 3K59A 5HGTA 4BY7G 5HFYA 4HJAA 3EIVA 4DR1Q 4KD4A 1UE6A 1ONLA 4P2CB 4XYOA 4R4QA 3I4LA 4QIWE 1JQ4A 1WTPA 5C44B 1S72A 4B9XA 2K1BA 1KDCA 2I46A 1F9SA 4X6AH 2ZJRA 2Y3AA 4QCLA 3TUOA 2A6HC 4MTKA 5KIXA 1RFKA 4ZRQA 4JI3L 4R8IA 1P7EA 3I72A 3U2SC 1JOOA 4K6LA 1RD9D 2JA6B 4U68A 2JRHA 2WXGA 1YZ6A 1VJKA 1MI0A 4JI5L 5I6WA 4M02A 5DAUA 1R7SA 3SDZA 5E3FA 4LJZC 3EGRA 4OW0A 1EYGA 4L8JA 2RDHA 2NPTA 2FMCA 1R9TH 3KUPA 2NN6H 2I0QA 4PZ8A 2TSSA 3AB5A 1S3OA 1CSQA 1H9KA 5IYDH 2PEAA 3BK2A 2HTME 1VRAB 1RIPA 1PH4A 2AWNA 1G51A 1GUAB 5M5XH 1CTMA 1RTNA 1MJDA 4B6WA 4ZOHC 4JI3Q 4AOFA 1N63A 3N1YC 3C1EA 3HEJA 3RR5A 5C4ZA 2B63G 2BF8B 4FF3A 1D1KA 1PGAA 3VH3B 4JI5Q 3S1QH 4HEA1 2Q2TA 2IO3B 3BIID 4MH0E 1VMPA 2C9OA 4HLEA 2ATWA 1JWSD 3FKIG 2JA8H 2SNSA 4H2AA 1WH3A 4QIWB 1N5XA 3CMEA 3D6WA 2JYTA 3VR2A 4UP7A 4P74A 2KLGA 4DV0L 1G2SA 4OO1G 4NDXA 4IQZA 4FHKA 1SNPA 5HHDG 2B2YA 5CV8A 1E24A 2CHBD 1HA6A 1A2UA 5AJ3L 4QJFA 3MP9A 2GVBA 1EFID 3I70A 2HDEA 2ZVNA 4PS8A 4WJPA 2W82A 4HJ8A 3S2DB 1PTOC 4QY7A 1TU2B 2L76A 2QGQA 4DAMA 2CJNA 4GN4B 4N9PA 1OXXK 5KNBA 1DCZA 3PUXA 4KKSA 4RH6A 4XDXA 3I55A 2B2TC 4RGMA 2SAKA 3J7AV 4DK0A 3MHZA 4DHJD 1I5FA 2VXWA 1EUJA 1FPYA 4JC0A 4GU2A 2FUHB 1BOSA 3H09A 2B8GA 1PGXA 3LGJA 2NBUA 4QGUA 3BJUA 4JBMA 1HZCA 5LL6X 4ZAIA 2R7DA 1ZDVA 2EYHA 4DNTB 4IM0A 1PUTA 2M2LA 3AE7B 1Z9FA 4ZHOA 1GPXA 3Q2AC 5F2DA 4DV0Q 1C77A 3D4WA 3E9SA 1C1YB 4BOSC 3PZDA 2HQEA 4EE2A 4HJ5A 1LABA 1WM2A 3E0JA 5AJ3Q 1NUCA 2BWFA 1Q8IA 4IUQA 4R4OA 4A76A 1Y69U 2R92H 2OQKA 3D0FA 1L0XB 3SD5A 4BY1H 1A70A 3FKYA 4EZKA 4Q2JA 2Q8TA 2X69A 4I7AA 2B29A 2UXDL 2ZZPB 5CV6A 3QOJA 1YJNA 4DV4L 2X8XX 4L2YA 3U4ZA 3VA7A 4WORA 1PXUA 2K6DB 3I3CA 2R93H 1QLBB 1FO4A 3NE5B 4IALA 5HURA 2IYDB 2Y5CA 3ETRA 1TTNA 2N1WA 4DUZL 1YQ3B 2K8CA 2CW0D 2K04A 3EJIA 3MVVA 5D14A 1HNZL 2PYKA 2KD0A 3KUDB 3RUZA 3IAS1 1BBWA 4KK7A 1ENAA 1QCBD 4J15A 2F0HA 1KNEA 2PQAA 1XCQL 3D6CA 4LDTB 2A74C 3C1FA 5FLXL 1K83B 2BOSA 4ALPA 2D2QA 5BN3A 3TDQA 2M00A 4HMIA 1ZW7A 1VDVA 3ND8A 4BWGB 1F9QA 3DMUA 4MJSA 2NZHA 3SHQA 3J81j 4A3LG 2KHIA 5DLQE 2UXDQ 2KAJA 3D4DA 3VR3A 3PRMB 1K0SA 2L1AA 2RKSA 2VUMB 2EYMA 1VQ5A 4XYCA 3VR8B 3I63C 3IAM1 4JBWA 1RKNA 3HOVG 2CR5A 4DUZQ 4OONA 3APFA 1SYDA 3W1YA 1EEID 2K5VA 1WXSA 1QZHA 1ET6A 1HE8A 1I4HA 4AQYL 3L17A 2XK5A 4HPLB 3WAMA 3I4MG 1ESFA 1OXSC 3ZNHB 1FNVA 2DLBA 3WAOA 1WCMB 4RCOA 2L11A 4RKBA 1YHQA 3C2PA 2K9XA 1SDFA 2ENBA 4LNQA 1SNMA 1I6VC 5FR3A 4FADA 3X3NA 2PQAB 4CBVA 1V8CA 4FF1A 1VQGA 3DXJC 2WU5B 3HUIA 1STNA 1IPGA 2L4NA 3TEHB 4PS3A 1GUTA 3TMEA 2C7MB 1CHPD 1IBLL 1QB5D 2PMZE 3W5OA 2UUCL 2KMMA 3PO2H 3U58A 1WGDA 1PYBA 4A3FH 4MJSB 3Q8DA 1XEEA 4B9KA 3WDNA 2YTYA 1J7AA 3SR6A 1CJEA 2AUJD 4FXKC 3NS8A 3PIO3 3H3VI 1XLQA 3ZRFA 3DLLA 1CZPA 4A6QA 1SF0A 3OIQA 3VA5A 4ICUA 4WIPA 4B3ML 3DWMA 1KLGD 1OFFA 2JA7B 1AEXA 2IHEA 3Q8EA 4C4VA 1LTLA 4BFRA 2XK5B 4XQQA 4DR2L 2MP2A 4G11A 1N62A 3MFGA 4DR4L 3QIAA 1Y8NB 4KY5A 2VH1A 3ONSA 3LNNA 3J81c 1UUPA 3VTWA 1DXMA 2W3RA 1N33L 4A3CG 1IBLQ 1F2RI 4X3KA 3RI7C 4A9AA 1LXDA 2UUCQ 4BY7H 2NVXB 2KQ7A 4PQXA 2MLBA 3GTGB 3PVLA 5C4HA 2LUEA 5JPNC 2LXKA 4MN3A 1Y1VB 4LJPB 1Q81C 5IKCM 3GTPH 4JYAL 4JIOU 2IX3A 1Y1WB 1TKYA 1Z6HA 5FO8B 2R7ZG 1V6EA 3U7DA 4TMAB 1L1OA 4GN5A 3GZNB 4NXNL 5IP4D 2QJLA 3MAQA 4B3MQ 2N4FA 3UE0A 3SHLA 1LTBD 1HR0L 1EOTA 1EY0A 4TSSA 3S15H 3AXCA 2FINB 3AMZA 3I5JC 1Y56A 5EKIA 4DK3C 4DR2Q 5E6OA 3A9KA 2E6XA 4LDTD 4DR4Q 2PMZB 4DXFA 4RM9A 1VQ6A 3ERSX 1FXTB 4C4VB 1QOGA 3R7QA 1FD6A 2NWGA 3AEAB 4LCDE 4II3B 1MGSA 3DWGC 4IOCA 2MP2B 3TS2A 3CPWA 1L6VA 1VCBA 5M3FB 1N33Q 4I65A 3S1RH 1LLRD 2GN5A 2EDGA 4B0EA 4ZRJA 2MPMA 4A3IG 1LT4D 2ASQA 3VAWA 4RMFA 1WIAA 5ELDA 1K8RB 2KWDA 1UE5A 4ZKBB 1PRTC 5JAVA 4JYAQ 2PE6B 4J6HA 1WX9A 4IPDA 1YBYA 2A19A 2M17A 2XRQD 3L3OC 4WRDA 2MBEA 2VZKB 2CH4A 2JZ3B 4NMZA 2LY7A 2C5LC 4NXNQ 1JE5A 1RHPA 3HOYB 2IGGA 4FXCA 1SNCA 2F3WA 1HR0Q 4JCVE 4W9FA 1CUKA 4IFDI 1L1OB 4FJVB 4GGQA 4XZ4A 1F2MA 1GXDC 2M9VA 3VDZA 2PTLA 2B63H 4XDDA 4IUMB 3N3KB 3MHBA 2KCMA 1I94L 2RHSB 1UEAB 3TEWA 4UHVA 1K51A 1IKMA 3GB1A 4DR5L 1OTRB 3A9KB 1TWAB 3FPUB 2B2WC 3FKIH 3E3XA 3ZJYC 1UEBA 1WE7A 2KO3A 2HHHL 4C3JG 2INNE 3DHIC 1MHHE 5DNFA 3VR5A 2EPBA 3VFKA 1E22A 3TQYA 1ZKHA 4IOIE 3CRLC 4OO1H 1JORA 4XDCA 1TT2A 4IWOA 4KX6B 3H3VC 3EVQA 4YXDB 3FDTA 2K52A 3FP9A 2E3TA 3A54A 1JMCA 1N5WA 2WXFA 2MEKA 4ZYNA 4BBSB 3T4AC 3E6ZX 3V6CB 4UP9A 2AUKA 3SU8X 2FHTA 3UQBA 1PV4A 2V1CC 1YN4A 1XCTL 4K7SA 1BF4A 4IG7B 1PQSA 3CXCA 1OXUA 2A73B 2NBWB 4FA6A 4DR5Q 1X56A 3X23A 1Q12A 1F2RC 3Q3MC 4A8XC 3KJOA 1DM0B 1C9FA 1I4RA 1FNUA 2BH8A 1EU3A 3LWEA 2N49A 5JEAG 2E2HH 2XTIA 2KLCA 4HPPA 3CSTA 1JB7A 3A5UA 4HJKA 1L6UA 4IJHA 2LRWA 3P1MA 2GBNA 1PTOF 3TIXA 2A69C 3ZVVA 1K53A 3O13A 4FJZA 4FP5D 2F0WA 2F3VA 4OIKA 3OSOA 3OOCA 1EY8A 4LK1C 1SLJA 4L1BA 3FEWX 1NMGA 5IGCA 2ZTDA 3PLUA 5ELCA 3RNCC 3R2TA 4A20A 1IZ6A 4JI4L 1JOKA 2K3UA 3B2GA 4JPSA 4LF6L 2WGSA 4M8MA 2G9DA 3GDEA 1E6EB 5JJLA 3MXPA 2IPKD 4WJWA 1HR0W 4LF8L 1UE7A 3ZNGC 1SN8A 5EE9A 4CO7A 3J7YW 5K36G 1AARA 3MTSA 5A2QL 1YJ9A 2FBWB 2ZXPA 4EGVA 2AL3A 4JW0A 2KDMA 3HOXG 4X64L 1UWXA 4DAVA 3KH0A 1G8ZD 4CJ1B 3ZJTA 4LF5L 1QKZA 1VZ6A 1EY5A 1I4PA 1WZ3A 5I4DA 3MWYW 1WFYA 1ZGUB 1VR9A 1FCLA 1S5CD 3F2UA 4KDLB 1HUMA 2VZKD 1AN8A 4A3LH 1NYQA 1IL2A 2D0OA 5KGUA 2KUMA 1K52A 2MW5A 2BH2A 1TWCH 1CK1A 1EO6A 3V61A 1TS2A 1QOFA 1R9TB 4JI4Q 3KLSX 4X66L 2Y0SG 1GKHA 3AMUA 1Y8PB 4MZ9A 4LF6Q 3HOVH 3QIJA 4L23A 1SYEA 3PREA 4MGZE 2XNAC 2IX0A 4LF8Q 3L2PA 1JJGA 4WJ3M 1YHBA 3GTOH 1ML0D 3I4MH 1U4MA 4CKBA 5M5XB 3HOWG 2SDFA 4GZYC 2DBYA 3TCAA 3TMPB 1H9RA 4DAYA 1KHIA 3BVGA 3U30A 4X64Q 1B1ZA 1UBQA 3VHTC 2F0QA 3BU2A 4J8QA 4F7XA 4KSLC 4LF5Q 4LWCA 2KCTA 2FFKB 5FKAC 1L0WA 4DFAA 4GNXC 3U4VA 2C35B 1QF6A 3S1QB 1D8LA 1U4AA 3J80i 1XPUA 2BB5A 1PZJD 2K05A 2L8JA 5EPLA 2CHZA 2ZVOA 3AULA 4XE0A 2N88A 4ULLA 3GV3A 5CV5A 2JA8B 5C1ZA 2SOBA 2AQ3B 1OO9B 4ILWA 3Q8AA 4X66Q 4EEWA 1YJJA 1EU4A 1XPOA 3I4OA 1R4NI 1MI2A 3HG9A 2RDGA 2LKVA 5FOBB 4LF4L 4M8AA 2MJEA 2LSSA 2GI9A 2K5PA 3NOBA 4S17A 4WQOB 4IM3A 3FPPA 1R4MB 5AFWA 1E90A 2KCNA 5IP7G 4C3IG 4AUQC 1WTQA 4HEDA 1A5RA 4JOIC 4LNKA 5EBDA 2O6VB 1JB3A 3ML9A 4IWQA 1Z7TA 2F0OA 4RF1A 4DAYB 5GXGB 4YCUA 1WTOA 1WJUA 1GO3E 2L15A 4PS7A 4P73A 2OHFA 1Y14B 3D4RA 1WD0A 1IP9A 3FILA 4A3CH 2QEJC 2Z8LA 2K0PA 3NZ3A 2OTLA 4NQLB 5CHWA 3ABVB 3DVNV 1RAXA 1PDXA 2BYFA 4PT5A 2CJOA 3NJTA 5D7GA 2JPHA 3TSSA 5J22A 4X62L 2UXBL 4LF4Q 2WXJA 3LJ3A 4FHJA 3H15A 4URKA 2R7ZH 4V190 2KNBA 2IO2B 4PV1C 3ZW3A 1RYJA 2CKZB 2R92B 4N8X1 3TREA 2HQLA 4BY1B 1HRJA 3QWZB 5M5YH 5KNCA 5I2XA 2DN8A 4C3HG 1GHKA 4RFBA 1LV9A 4A3BG 1VQ7A 1JALA 3HHMA 4WJOA 3ZJUA 4EUTA 2R93B 2KOLA 2V4DA 1BCPF 1LYLA 5E6JA 1WGKA 1KDAA 1FYCA 3PV1A 3UI3A 2EY5A 4FJYA 4A3IH 1VQJA 3NTHA 3HOZG 3FILB 3H1UA 3TJPA 4X62Q 5LMNL 3VYSA 1OTCA 2UXBQ 2V0GA 2WKCA 4CJ2C 1RRBA 2INPE 4IUNA 2RPQA 3RNFC 4MGIE 4P75A 3W5VB 1EL0A 1P16A 4FVMA 2LGSA 2ONQA 1Q1OA 2OF1A 1LTAD 3ZLZA 5L95C 2M0XA 2F0MA 1LT5D 3R93A 4PK1A 2HE7A 3I57A 4E74A 1SE8A 5AZHA 3K8AA 2WIIB 2J42A 4K81A 3I2ZA 5IE8A 4W9EA 1JWMD 1TXYA 4KSKC 2QILA 3ZTDA 1G2TA 4H0LC 3PIP3 2LRUA 3AE8B 1ESRA 4LUOA 2JZPA 1YEZA 4A4IA 3A5ZB 4GSWA 3UI2A 2AWTA 5LMNQ 3ZXVA 3RNUA 2KC2A 2L1BA 1MD2D 4O2DA 2C9WB 4K7UA 1YNJD 1HTQA 2Q8RE 4IM2A 3KLRA 3KVFB 1VQFA 3RZOH 2UWQA 1TGZB 3QJYA 2H89B 2F0NA 4ARCA 4KKTA 3NUCA 3GTQH 1I3QH 1P7FA 3PO2B 3NTIA 4W9GA 4DWFA 2O6VD 4A3FB 1IL8A 1SFOH 4CKCA 5M3MG 5JH5C 1Q46A 4ZRIA 2WB1G 5IGEA 5FLMG 1J5EL 1SYBA 5JEAH 1FFVA 3IXSA 1HQMC 2WX1A 3DBSA 4PMCA 5DM73 4B0MA 3U50C 1F2YA 2LVOA 3S2AA 3ULJA 1WX7A 1SB3C 1F52A 2CWAA 1EY4A 2YTVA 3Q8CA 5ELOA 2ZXRA 2BDOA 3J7ZC 1EFWA 5EKKA 1BNZA 4NB3A 3PRZA 4BY7B 2WXOA 3DBHB 3H6NA 1AE3A 3E9IA 3STBD 1F1HA 5JJIA 3T13A 4H7BA 4IWPA 3EA6A 1FGUA 2RDBC 1SYGA 4M01A 3TEZA 1WJJA 3M7GA 4LFBL 3GTPB 2FIFA 3U7ZA 5TR5A 1XNRL 4XXEA 1WR1A 2QKIC 3VTVA 1NDDA 4KV6A 1J5EQ 1YJWA 5K36H 2I38A 2RQXA 1FXIA 1X6OA 1TR5A 4BBRG 3HOXH 3S15B 5IGGA 4LF7L 4JLCA 4BXXG 1O7ZA 4KN4C 3B0AA 3NZUA 2BS4B 4XYQA 1M4VA 2B2YC 1YQBA 2E74C 1RDPD 3HGBA 3Q23A 1VZ7A 2CCZA 2KFKA 1IYFA 3A8KE 2CQAA 3PF4A 1O78A 2K03A 4KI0A 4NJCA 4KDIC 2OEOA 3VUWA 4GLSC 5GAGC 1QG7A 5LMNW 3S1RB 2KMAA 4RGNA 2AKWB 3RMHA 2J7QB 3RUIB 2LEKA 1RF2D 3I8ZA 1AH9A 1EIYB 5LNK1 4E3CA 1H9MA 4XC2A 1U4RA 5J39A 1CFMA 4LFBQ 4N9F4 1WY8A 2JUOA 5COYA 5CV4A 1SAPA 3HFZB 1XNRQ 4IFDG 3GZNI 3KJPA 1HPCA 3HOWH 3HM3A 1SRUA 1SEBD 4JWUC 1PH8A 3VXWA 2HDMA 5HGQA 4LF7Q 5CHFA 1CQFA 1NR4A 5EBCA 1UBIA 1WGGA 1G6ZA 4TQ1A 5JXVA 4NP5A 2B2VA 2B63B 1HNXL 4KJNA 1TYGB 3TEYA 1A3VA 1DOMA 3NWSA 1NBFC 4MIUA 3V6EB 5C3XA 1YN5A 1QUQA 3KYDD 2DZKA 3FKIB 1OQRA 1HH2P 2KFKB 3P4RB 3GD7A 2RSUA 1YNND 2RA4A 1WOCA 1W6KA 2RPVA 1IW7D 3V2TA 1ZDXA 1DD2A 4KIKA 1TS3A 3M62B 4OVVA 1GJZA 2Q2HA 4K5WA 4QB4A 2KA7A 3LDZE 3P4PB 4FBJB 2PPBC 1Q1BA 3QO2A 4W9HA 3PT2B 1WX8A 3J7A5 3VYRA 3N1XC 2WDQB 4BKGA 3EFUA 5IP7H 4C3IH 3W1GA 3HRDD 1PFMA 3N30A 4BZAA 1RFAA 1F9RA 4GS3A 2K7VA 1EWIA 1ZUD2 1DOXA 2PQEA 3DWAA 2IY5B 4DXAB 2WNMA 2C7HA 2K39A 1HNXQ 4R4CA 1STHA 3OIPA 4LUZA 4JI7L 1II3A 4TV3A 1GUWA 2CQOA 2EMSA 4LNFA 1F77A 2M4NA 1I50H 3KBXA 1Q1EA 4MELA 1K8GA 4ZRKA 1QUQB 2PO4A 3PIOA 4B08A 1EYDA 4A93G 2E2HB 3DVNU 1C79A 2VQFL 3GTKH 2X6LA 1SE2A 1PZKD 2EIFA 4KIKB 5D2MB 4NPSA 1VLBA 1C3TA 2QDLA 2EYFA 5IIFA 3T53B 4GLXA 1B3AA 5JPMC 4DR3L 2KJ6A 2O2VA 3SFEB 2Y5PA 4LNOA 2LFNA 3BVMA 4TUUA 1KLUD 4XQNA 4C3HH 2NYZD 5E4XA 1NNXA 3HP3A 3PQIA 1WTRA 4A3BH 2IW3A 3VR9B 4ME3A 4P7IA 3CCMA 2PW9A 3URYA 1EWHA 2F52A 2G5DA 4JI7Q 3R2IA 2G3QB 4P1CC 2DAFA 3CW2C 3PMFA 3O65B 4K5VA 1HNWL 2G4SA 2EJFC 3EN2A 4DN4M 3F8TA 3ENEA 3HOZH 2PIAA 4OL7A 4HMJA 2H1EA 3MXGA 2SNMA 2IBIB 4GIVA 4KMUC 3RLNA 5BYQA 1KM7A 2V3NA 4MGKE 5CORA 1VQCA 2VQFQ 2ZTEA 4H44C 3CCEA 2GBJA 4JQWC 2F0LA 4UDUC 2YEPF 4WAAA 3GE3C 4G3XB 1UGMA 2J53A 4M00A 3IVFA 3TEXA 1NI3A 4DR3Q 2MJ8A 4O42A 4WJ4A 1SXTA 2VZAA 1M8AA 1TWCB 1Q7YC 4YL8A 4BKSA 4UP8A 3F1ZA 3TBIB 2O2VB 3GOEA 5T1IA 3LX0A 1H8CA 1I7HA 3HOVB 1EWCA 1SJHD 3L16A 3IHPC 1F0ZA 2VB3X 3MC0B 3GQBA 3LWUA 1KJTA 1HNWQ 1ZP0B 3V3XA 4NJ7A 2JEBI 4DGZA 4JI1L 3H9DA 3IKJA 3GTOB 3I4MB 1WF9A 1Q0WB 1VMCA 2BW2A 1DZ1A 4R4TA 2L0FA 2XEWA 3B2FA 3N6RA 4XQJA 3Q6BA 4HKZE 3VRAB 3WCQA 4A3MG 1VQIA 4EQPA 2R61A 1D1IA 2IY0B 1CHQD 1YJ1A 2J52A 4HRSA 3AH7A 4LTUA 2JX5A 4M0WA 2WINB 1UNSA 3J7AF 3S16H 3OJ4B 4KVGB 3E9HA 4DA2A 4CYEA 2JXXA 4PZ7A 4FDBA 4A55A 3CF5A 3P1HA 2FCNA 2NN6I 1XTDA 3M3YH 3PRPB 3VUXA 1SMYC 5IODA 1CM9A 4LFAL 3H91A 1DONA 1MFWA 2OJRA 1GC7A 4EX5A 4YWGG 4HIOA 5M3MH 1H95A 3J80E 4RCNA 2OT2A 4C1NI 1V9PA 3NBHA 4ME5A 1PH7A 2DUDA 1VQKA 5JJKA 2DZJA 3Q8BA 4HCPB 1N32L 1X3QA 2DWQA 2RGFA 3JSVA 1A6XA 2ACZB 3PHWB 4RG1A 1ZPSA 2MH7A 3DVGY 4RHRA 1B53A 1Q3LA 4YSYB 4GLVB 2KENA 4P1BC 1WMHA 4YCVA 2W55A 1I42A 2VQEL 2IGDA 4DV4Q 2F0JA 2HD5B 4AQ7A 5D3IB 2KECA 2DGYA 3P4QB 2KJXA 2KEDA 4ZDVA 2MRPA 1J6QA 4AS1A 4M0WB 1K28A 1EQTA 1HNZQ 1BBUA 1WRIA 4GN1A 1O7IA 4LFAQ 2NVQH 2JSOA 2MA9B 3A55A 1R4MI 2QHOA 4A3OA 5KRUA 5EQ0A 3WALA 2R7ZB 4HCNB 1N32Q 2D07B 1P8LA 1TT5B 5GROA 2ZJDA 2IL8A 3JAMi 3TZDA 4BBRH 1T0QC 1WWTA 3NBHB 2VB2X 4R4IA 1WVLA 5CC4A 4BXXH 5M5YB 1L4ZB 2L00B 4R9WA 1HZBA 3A1QA 1NE3A 2EY1A 3NQTA 3JSVB 2X38A 5C5MA 2BQQA 3G7LA 2VQEQ 3KDFA 1KAAA 3DHGC 1C9OA 2V3PA 3X3MA 1WMHB 3W1SA 4EFOA 2J0MA 4JBJA 2DY8A 4ICVA 5EKLA 2E5LL 3I4NG 1GG3A 4HJ7A 1YNTE 3P63A 2ZW0A 4P6VF 4A3IB 4GKKL 2ZNVC 3BY4B 1S4ZA 4UPAA 1MG8A 4AQYQ 4B3RL 3A8JE 3IL8A 2ZCBA 3OG5A 1B3QA 2K25A 4G57A 1K9MC 4IFDH 3NUHB 2BB6A 1PFSA 2RHQB 3QAQA 1TY0A 2HIVA 2B3AA 5EPJA 1SNOA 4AIMA 5IYBG 2GBKA 1FD7D 2N1VA 2K50A 2KK8A 4DHZE 3OTOL 3GTJH 1R4QB 2KYWA 4IPCA 2KWCA 4FYDA 2JA5G 3G4SA 4NQKE 1U4PA 2NZ1D 2KQ4X 2KVZA 1BQQT 2LGXA 2LD9A 2GBRA 1O7YA 2CH4W 1BCPC 1GOZA 5G5GA 3W5UB 1FGBD 1HTLD 1UAPA 3VR6A 4A3JG 2CU1A 3DHHC 2D5GA 3A1QB 3EUB2 3WAPA 1WTWA 4BA2I 2Z1CA 3DM3A 1VQHA 2GRIA 2EE1A 2Q8IB 2PZTA 4Q5VA 3CCQA 1EIHA 3KDFB 4KY7A 3CC7A 1VQNA 1LQBA 1QE6A 5CBEE 2E5LQ 1FFUA 5D94A 3RNAC 1L4DB 1PVOA 1D5XC 3B6YA 3G6JB 4US8A 4GKKQ 4Y52H 1C4QA 4EVOA 4B3RQ 2KKCA 4MSMB 1TZ1A 2TMPA 3M85A 2HCCA 5C3WA 3K5NA 1E0BA 1S1QB 4HVBA 1TS4A 5A35A 4R1JA 4RGOS 4OWWB 4G50A 4BKSD 3CMAA 4F8MA 4HROA 4O0AA 4HXDA 5M5WH 3M4YA 3QB3A 2FAZA 4U673 3OTOQ 2JY6A 4GB9A 4DQOC 1ENFA 3RZOB 2FCQA 3U9SA 3B1LX 1OXVA 1VF7A 3RLFA 4FF2A 1PGBA 2KHSA 4EQ5A 3VH4B 3AYHB 3CQZH 3GTQB 3KUZA 1EQRA 1I3QB 1IUEA 3PS6A 5G5HA 1L7YA 5HG2A 3KLWA 3J81i 2DJFC 1O7LA 2K75A 4MSQB 4JI6L 2LXCA 2QSDA 2BTEA 3HS0C 1ICWA 3Q69A 1P9DU 1SFOB 2PZWA 3K5LA 4R8NA 1E2WA 3PSIA 3KWLA 1V8QA 4GOCA 2Y0SE 5J2RA 2PNRC 5JJZA 2Y5BB 3QR8A 3MHSD 4A93H 4BBNC 4I6LB 1U0LA 2MFIA 3ER0A 5J18A 3T3OA 4QAYA 2L32A 2WDVB 3RT3B 4HDOA 4DHZB 2ON8A 1IHZA 4GDLA 1A3TA 1B50A 2Z6BA 1Q82C 1EZ8A 4RAUC 1WSPA 2VH2A 3NXWA 3KYCD 3MXUA 1V1QA 2EXZA 2K32A 2KANA 3AECB 1VD2A 2MQHA 2BKFA 3Q3NC 2A68D 5KYLA 2WXQA 3ZUNA 2D11A 2KOXA 1K3RA 2IO0B 2LHDA 2W9NA 3IFDA 1C4AA 5T8IA 2BYVE 3P42A 2LJIA 1D3ZA 4HWIB 4JI6Q 4KV2A 2XRSD 3H6MA 3PCOB 1NENB 4FF4A 2CVRA 2IX1A 2A1AA 2QCZA 4YY3L 1L5PA 3NSWA 4TVAB 4R3DA 4KN7C 3KK7A 4WAFA 2A6HD 3PZ7A 1PDQA 4USAA 4GN3B 3NVVA 2YV5A 3HOXB 3PO3G 1XXGA 2EELA 1XX8A 2LS01 2C60A 1X3GA 3HKZG 3QK0A 4DK1A 5EE1A 3A8IE 3KOJA 4BAXA 5C0XG 1VQMA 1E7VA 3STBC 2QMTA 4GDLB 1VCIA 4F88A 2C7NB 4PYZA 5D65A 1I94Q 4IUTA 5K5PA 1UELA 1UWMA 1WGHA 1EOVA 3NRZA 3SR1A 3PLVA 3OMCA 3W2DA 1WTHA 3EC8A 1XO3A 1WXQA 3KF8A 5HY6A 1WYWB 2Y0SB 2HHHQ 4POFA 1ZEQX 1TWHH 3MA2B 4A3KG 1MPEA 2PW7A 3U9OA 1ACCA 1KDBA 4PG3A 1G291 2IY1B 4YY3Q 2HJ8A 5HKHA 2L12A 4K7WA 5IP9G 3HOWB 1J8CA 2N3SA 2MBHA 2C5CA 2E2JH 5LXIB 3SE0A 3CC4A 3I91A 4EOYA 1KTKA 3DWQA 5C4JH 1K50A 4A3MH 2DX5B 4JE3B 4NY0A 3K81C 1E10A 4OWTB 5IWAL 4RF0A 2G45B 1LT3D 3CF6E 1STBA 1E7UA 2DENB 3PSEB 2WV6D 3KLSA 3TP7A 1SROA 1B70B 2NTTA 3FRPB 5EGTA 2KACA 2WXKA 1UD7A 1ZKOA 2EXDA 4LNNA 2BS2B 2CHWA 3PGEA 2JQRB 4K14A 1KD1C 1SNQA 1X32A 2IHFA 1WJNA 2F0IA 3HOYG 3NHEB 2BA0A 1MHWC 2R3ZA 3PIPA 2K5QA 2ICEC 1WGRA 4A3EG 3KF8B 4WWPA 1BMLC 4BVUC 2NVYH 3RD4A 3K6OA 3DVGX 1B9RA 1ASZA 4K8JA 1PTOD 4OXPA 4C3IB 5C3EG 3PF5A 4DR6L 4WWMA 4G7ZC 4Q0FA 4C56C 2EKEC 1MSHA 1IYUA 2M19A 3OW7A 4DV7L 5E6NA 2LXAA 5IWAQ 5JEAJ 1JRPA 4LJOB 4DV1L 1KAWA 2KJHB 3H94A 1J19A 1E9MA 3QOLA 5ELFA 5TSSA 2WU2B 5J17A 4K8IA 1YMHE 3M63B 1WTVA 1QILA 3TBLD 5CR3A 5BN4A 3SDLC 1I50B 1S5BD 3ULPA 5J1ZA 1TVXA 3BINA 3R3OA 2M0AA 1KLVA 3EECA 4FN2A 4HN7A 4DAPA 3EFXD 2O6VA 5G2NA 3GE8C 4EKUA 1SIJA 5D6JB 3GTKB 1MJEA 3QCAA 4YSXB 2ZXOA 2QC8A 2HJ1A 3TS0A 3CCJA 2MNAA 1N36L 1JJ2A 1KRHA 1YOVB 2EQSA 4DR6Q 4F1SA 1STYA 1IGCA 1C48A 5CBAE 1YX6B 2O5IC 3N32A 1UH6A 5LLIA 4CGYB 4DV7Q 1ZXTA 4C3HB 4OX9L 4DR7L 1XWEA 4A3BB 1N8RC 1AWDA 3AE4B 3J9CA 4W9IA 1L0YB 3OWFA 4DV1Q 4O1NA 1P0RA 2E8GA 4J1MA 1ZYRD 4MACA 5IAAC 2K1FA 4LUVA 2F0SA 4TRDA 1CMXB 2MX2A 4US9A 1XYIA 3I4NH 2D5DA 1VDZA 1XMOL 3HOZB 3QARA 1TIID 3SK4A 5GQOA 3C8YA 4K2LA 4EZJA 1LTRD 2Z59B 4MDKE 3RZWC 2PNHA 1HTPA 2WB1E 2B2UC 1WFQA 4I6NB 1I4GA 2GVAA 5IYBH 2Z9HA 4J6IA 1N36Q 3H7SA 1PYWD 3RCZA 5G55A 3RN5A 1IKLA 5GADC 1STAA 2JA5H 5FR6A 3AEBB 5GMVA 4OX9Q 3FVQA 4DR7Q 4RM8A 5GAHC 1PRTB 2WXPA 2V4IB 4A3JH 3VRBB 3OLMD 4C2MH 2MHJA 1HZAA 5BYSA 4A3GG 2K01A 4DKAC 5IGBA 2JZZA 3NK9A 2V9HA 1JCKB 4DNRB 3APDA 3FAHA 1CZGA 1CKOA 1GB1A 1XMOQ 4TQ0A 3ZNZB 4JI2L 1KL9A 2N7EA 4DDID 5IGFA 4W9LA 1MHXA 3PPAA 1ASYA 4YTNB 4WFN3 3R8BA 1WRDB 1I4XA 2KDBA 1E2VA 3WIMA 3UE1A 1WM3A 2NCNA 3VQIA 4CDCC 1KRSA 1T0YA 4W9DA 3S16B 2IT1A 2KVMA 1JMLA 1A15A 4YIJA 1EUVB 2B3GA 3FHWA 4LMQD 4N9TA 1QNUA 4WURA 5IO9A 4C80A 3M3YB 1TY2A 1S3SG 2DZIA 5G3LD 2YLMA 5IGDA 2Z6KA 3Q22A 1LTSD 4C7ZA 2RCFA 5CMDA 4NZLB 5M3MB 1AZQA 2R7FA 3IT4B 4XWTA 3PGZA 2WB1B 3CCUA 2DNFA 2B76B 2KT7A 5BN5A 2D3AA 4P16A 4II2B 1QOHA 3IRBA 4JI2Q 1XMQL 5C4XG 3V62A 1PH1A 1HHVA 2WLBA 2REXA 3MTNB 3BYYB 4WWOA 1B7YB 2CW0C 1JWBD 5IOCA 1DOYA 3OJ3A 2RF4A 4S3SA 2AMCB 5EPKA 3T56B 2BE5D 2EYJA 3I56A 1UE1A 1WYDA 3NVWA 3B9JA 4JGHB 2JN4A 3DBLB 1LM8B 4A3PA 3EQLC 4C3JH 2ES2A 4A3DG 3CMMB 2XWBB 3R3MA 1UGJA 4IPGA 4YWKA 1MIUA 3UDGA 2NVQB 3IBEA 4FLHA 1A3UA 4BBNF 3A56A 3S2HH 4DPGA 4MEMA 4JG2A 3SK8A 4L5QA 2ALYB 1SSOA 2M1MA 4K3BA 1XMQQ 3VYUA 4BBRB 3F2DA 3CC2A 3PO3H 2LI5A 3NVZA 1RL2A 1BUIC 1WXMA 2L9HA 1SE3A 3BDCA 3UDIA 5C0XH 2DYBA 3I90A 4XT3B 2BYTA 4OIJA 3CKIB 3GP7A 5DPSA 4ZUJA 1GAQB 5C2TB 1NJIC 1E8XA 1GVPA 1N60A 1GHJA 4OZBA 3JAME 2FMMA 2KC1A 3UIOB 2LGDA 1PTOH 1PH9A 3N1ZC 1SE4A 4CHTB 1N34L 4E71A 4A3KH 5BYRA 3MEHA 1OQQA 4JI8L 3D8GA 3K9PB 1PFNA 1PRTD 3T1YL 4Y7NH 1D6EC 3T9LA 1T9HA 3JW0X 3CPFA 1CA5A 3S9WA 1G6PA 1E8YA 2E2IH 2NS5A 2X6GA 2N7DA 4Z9CB 5IP9H 5M9OA 1VQEA 1JQYD 1NR2A 4DV3L 1TIFA 4H02A 3GTJB 1QZEA 3BK1A 1FCCC 4JI0L 2WAQG 4HSPA 1EEFD 4N8FA 4HPMB 2LHEA 4MH8A 2VS1A 1EF5A 1JT8A 1S5DD 2Z4HA 4JOIA 3GTMH 4ANVA 1D5MC 3ERQA 1KH0A 4RMAA 2F3IA 3G71A 4E6IA 3JYUA 3QG1A 1EQVA 2SEBD 3GTLH 1P98A 2HCIA 2QEXA 3ZRCA 1N34Q 2R2OA 3D3RA 2VY3A 4XWWA 5ELBA 2ZPYA 1VQ8A 4JI8Q 3K58A 3T1YQ 2O5JC 4A3EH 4YSZB 2JU6X 4KKUA 4S0RA 1PA6A 1B9MA 3K7AH 4YWMA 1SIFA 1L2NA 1E0ZA 5C3EH 2DNCA 3H8HA 1Y8RC 1LTGD 4DV3Q 5M5WB 4OZAA 3PTFC 3QHTA 5AUKA 1V9JA 3N52A 2L5TA 3G6EA 3HVDA 2B8FA 2FNJB 1VQPA 1M90C 4HIKA 4JI0Q 2FUG1 1B9NA 3QX1A 3ZGZA 2M56B 3CQZB 5E7NA 4ZLTF 3GV6A 4KKIA 3MZ5A 2WX0A 1STEA 2KVRA 2MWSB 2NMQA 3NY5A 2QF7A 2VRRB 1BKBA 3ZDMC 1QVCA 3NHHA 2CKHB 3QJZA 2Z0EB 4IKGA 3NEMA 2ZJQA 1OGWA 5CX3A 2EZVA 2G1EA 1J7BA 4HDQA 2ZJPA 4OEMB 3X0WA 3MXNA 3Q6SA 5IN7A 3WOFA 4A93B 1WJ6A 4APVA 3J81E 1AE2A 1NI2A 2UUBL 1Y8OB 1ET9A 1F9PA 3CP0A 1JROA 4K2KA 2I5MX 5H8YE 1L0VB 1PH2A 3J80L 1IYJB 5KHQA 1NTGA 2EVBA 1FR3A 3PO2G 3AE1B 2O2LD 2JXMB 2KHWB 1ILPA 2IGHA 1QQRA 3OYYA 1J8IA 4TKOB 1HA5A 2MHVA 2LGYA 1HZ9A 3LB8C 3M4PA 3ALBA 2JF5A 2MJDA 4B3SL 4XTCS 2E2DC 2PPHA 3NP8A 2NUCA 4CJ0B 4JL9A 2WXMA 1FMAD 2GMIC 3JC66 4L63B 4C7YA 4HCSA 2I2YA 2L7RA 4IUPA 3CCLA 2WS3B 5CHVC 1E2ZA 3ML8A 4NKLA 3MC8A 4DV6L 1JR0D 3JVZX 1HXYD 2XSCA 5J3BA 5C6AA 2K28A 2UUBQ 1LFDA 2LWPA 2R6GA 3AU4A 4RNAA 1T6BX 2PI2E 3MXNB 2JA9A 1XT9B 1EY7A 2E76C 3E5SA 3T16A 4IO9A 1FXAA 1SSNA 3Q24A 3TP5A 3PUWA 2FCSA 2ZPNA 1FRDA 3TZUA 1EY9A 2WACA 2D3GA 4ZK9B 1DOLA 2A5HA 4IFDJ 1X1MA 1CSPA 2FCMA 4LNIA 4LAAA 3RNEC 1X54A 5FK9C 2J0KA 4B3SQ 2YVCA 3A0JA 1C4CA 4CHKA 2J0TD 2PI2A 4XT1B 4A3GH 1TWHB 1PH3A 2JXTA 4RKLA 4G4KA 2BS3B 2WDRB 1K8MA 4B3TL 1MSGA 4ABNA 3CD6A 3NPPA 3H0GG 1J7CA 1P1AA 5FO9B 3Q8FA 4AP4C 1VZ8A 4AYBG 3RZFA 2R2QA 2NVTH 4HJ9A 2JYOA 2E2JB 2RCNA 4DV6Q 2Z4IA 2L52A 2F0VA 5ELEA 3PUZA 5C4JB 4A3MB 4ARIA 2K33A 3QWNA 1JRUA 3K57A 1Z5SB 4IDIA 1IYVA 2N9XA 2GA4B 1D5ZC 3MJ5A 3HOUG 3L10B 1R4NB 2L55A 2WP8J 2NBVB 3Q3OC 3ZO5B 3RN9C 2MGSA 4OVUA 1J0GA 3IFTA 2BGFA 1PHJA 2OTJA 3BDLA 4GLAC 1EWYC 1G6JA 2K5DA 2KHJA 2JEAI 3AI5A 1X3FA 3PZ8A 1B8AA 4JK1C 3OPOA 1C7YA 1HFNA 3L54A 2NTSA 2RVLA 4B3TQ 2NVYB 5H1SE 1WYGA 3W1SC 2EY2A 2ID0A 4PMBA 4PMWA 4JBKA 1FNWA 5C4XH 2CS4A 1SGHA 2KXJA 4JX1C 2OCEA 5ISRA 2J7ZA 5EDSA 4OGQC 1T0RC 1YX5B 2JWUA 4K1RB 1E1OA 2Z0DB 4DDGD 1Q86C 1OQYA 4F7ZA 3CSFA 2XIWA 1NMFA 5C44G 1WXVA 4NNJB 2BCOA 2KQ3A 2NPTB 1IBML 1RM6C 4GOPA 2F4IA 3HZXA 4QL5A 4DV5L 4B9WA 2ICIA 4OELB 4WWNA 2F03A 4A3DH 4YWLA 4ODGA 4C1NK 1ZXIA 2JA6G 1HTOA 2UU7A 4ZQ3A 2D10A 1NBWA 1C78A 2WXIA 3I3TB 5LL6S 2WQYB 2L3ZA 4G7HC 3AE2B 1P3QU 4I6PA 3NS1A 3AE6B 4ANUA 2KX0A 1WGYA 3AEFB 2YYZA 3NENA 2BBCA 1GD7A 3MJWA 3E56A 1YHAA 1YD8U 4NXML 2KTRA 3C19A 1KOTA 1L1OC 1F2LA 5C5LA 3OMGA 4K5XA 2XBBC 5IY0A 1QZGA 4KJOA 1R4PB 2NVUI 1X3EA 3VR4A 1CA6A 2F0FA 2YU9H 2JT4B 2ZT9C 5EJWA 4CKEA 3H3VH 2WXNA 4X57B 1IBMQ 3B08A 3LXFA 3DEOA 2KCCA 4LK0M 4DV5Q 4J3OD 3I4NB 1TWFH 3D31A 4OHJA 3ZNID 4DK5A 3F2CA 1IGDA 5NUCA 5FLMH 4GOPB 1H9SA 1PLFA 2KQSA 1OEYA 4JI1Q 2HT1A 4NW2A 1YQ4B 3V05A 3P75A 1V1OA 1W3SA 1BO0A 2D3BA 1ZYRC 1JJCB 2XN9C 5IYCG 2INDC 4LLGM 4NXMQ 3K80C 1JOQA 2JA5B 1T0SC 3L4PA 2RSOA 3W9CB 3RFZB 1VQLA 4KTAA 2BT6A 1GB4A 4G7OC 5L83A 3RYTA 3S1MH 2OEDA 1N61A 2KTRB 4A3JB 4KGTA 4C2MB 2KDIA 3AE9B 1Q8KA 3K5MA 2UXCL 3JAMc 3BS1A 3MEFA 5T1GA 1AP0A 2MSED 5AZGA 2WP9B 2H5XA 3ECIA 3N20C 3NG0A 2M8SA 4YTPB 3CU7A 2HD3A 5JZEB 2D9UA 2KJRA 3S14H 4HSVA 1HFGA 2PMVA 3RN2A 4IN3A 3A4RA 1H9SB 2RDFA 4ZRZA 2W3SA 2XGTA 4KGRA 3P7JA 2AHOB 1RODA 1MVKA 2HDLA 5CYUA 3SK5A 1I6HH 4H13C 4KHVA 1WD1A 4ID6A 3HKZE 3L08A 2JQOA 2EMTA 1MJCA 1WTXA 1D7QA 3WANA 3RNBC 3BZDB 5DEHA 4CDEC 3Q3FA 1GUGA 2UXCQ 4QUCA 3H7PA 2F0EA 1SBBB 3DBRB 4YCWA 2FXQA 1C4PA 1GUSA 4YT0B 3SK6A 1XJVA 3PUVA 4GMVA 2A5UA 5BMHA 1CKMA 5EAYA 5CTRC 3CHBD 1B2TA 4A75A 2A6ED 1VQOA 4JV5L 1Q10A 2I1KA 3OW2A 2MP1A 5IT9L 1ZE3D 4YHHL 4HK2A 5LHY1 4NAWA 4OVZA 3FMCA 4MHEA 1YITA 3DCGA 4DUYL 4EQNA 5LMUL 2CU3A 3R7RA 3ZTCA 3RZDH 1EYAA 4GKJL 2B2TA 2V4LA 3S17H 3Q0AA 2DJGC 1KNAA 1VQDA 4KY6A 4C3JB 2FIDA 3N9YC 4M8NA 4UY8C 2BA1A 1CKNA 1PYSB 2N9PC 3D32A 1XNQL 4POGA 5EE0A 3DUZA 3ZXRA 2QDFA 3KYHC 3K7UC 4HAEA 4TQUS 1E1TA 3BDOA 4QF4A 5D3DA 3S2HB 1QNKA 4NJ6A 3EBEA 1VQ4A 3H7PB 1B4OA 2VUMG 4ZUIA 2BE5C 4ZKCB 4X3SA 1V80A 4IUUA 1K8AC 3PO3B 4MM3A 3FC4A 3QA8A 5I9OA 2EJMA 3K0YA 3DDCB 3HKZB 1EF1A 4JV5Q 3AEEB 4KKJA 4G0NB 1TQOA 2DHZA 4LFCL 4YHHQ 2RD0A 5AUIA 3K0XA 1TWGH 2F0UA 4HCEA 4KHZA 5E1FA 4DUYQ 1TKGA 3DBLI 1F2ZA 1VS0A 1WCMG 5LMUQ 1S40A 5JVH3 5GAEC 2H88B 2O4XA 4GKJQ 4NAWB 2LVQA 5DPWA 1PTOB 4OZCA 1O80A 1PZID 5BO4B 3S1NH 1XLOA 4A3KB 1YNJC 1DOKA 3K5OA 2D2CC 3SXHA 1VQBA 4HIMA 3IAYA 2I07B 1XNQQ 2N9LA 3ONAB 4Y7NB 1WE6A 2DAJA 1A2TA 2UU9L 3H0GH 2N8NA 4IOAA 4A90A 5KHOA 4MTNA 2E2IB 1CQVA 1CKNB 1C8CA 1RWSA 3AEDB 4ANWA 2NBFA 2D0PA 4X65L 4AWJA 2K6QA 1QVGA 2IDYA 3VTUA 2PCFB 1MKHA 3C3LA 2IWHA 2UUAL 1WZ0A 3BWUD 1GUNA 4FO2A 3A7LA 1MBYA 1KC8C 1M94A 1XLNA 4C00A 4KGSA 4LFCQ 2N7JA 4MM3B 3HOUH 3GTMB 4ACFA 2KDEB 5FJ8G 3HKSA 1X3PA 3VYTA 4CDDC 4K3CA 1BR9A 1SMXA 2JA7G 3GTLB 1OEYJ 1QWYA 1C76A 2D3CA 4W9JA 2WYQA 1BDOA 2KMCA 3L13A 1M1KC 3M95A 3M4OH 2KN4A 1WI0A 1PFBA 2VNUD 1KFYB 2RR9A 3ZDTA 2ZM6L 2BPSA 4A3EB 1HZ6A 1XD3B 3A9JA 1XTCD 4ANXA 1IXRA 2UU9Q 1F9JA 1NY4A 3EFCA 3CWIA 1EM7A 3P2BA 3ZJVA 3K7AB 1IBXA 3AFQA 1HCZA 5C3EB 1EIGA 2NZOA 5JHAA 1E3PA 2N9KA 4X65Q 3UQAA 3TL5A 2Q2IA 3PUYA 2UUAQ 3ND9A 4JPBW 2I5HA 5FLXE 1AYFA 2KWUB 1Y1VG 4F87A 4HIDA 2PJHA 2HUGA 1Y1WG 2GLSA 1A8VA 5C44H 3DBHI
chains in the Genus database with same CATH topology
1S5FD 5KYIA 1T3QA 3U4EG 5JVG3 5MPOA 3AB9A 1YN3A 4PNYA 4XIGS 2F1MA 3EROA 1SYFA 1NEKB 1BXTA 3HVZA 1E7PB 1RCVD 2F0PA 1SNDA 2PZUA 1ZXHA 2K6AA 4QUFA 1IBXB 2ZW1A 1H9JA 3DM1A 5CV9A 3A7AB 1AFPA 1Z47A 3W3AA 4ZYSA 1B44D 3BG3A 5C0XJ 1U4LA 2XWJB 5IT9E 3AE5B 2L0CA 1CT1D 1NSNS 3HRZC 1ILQA 5C3JB 2RMMA 3AM9A 1BBXC 4HJGE 2RBMA 1W6JA 1STGA 3V96A 5BMGA 1YNNC 1LT6D 2JE6I 1IW7C 2AX5A 4M1UB 2K22A 2N0SB 4FNFA 4A3GB 4OO1I 1FRRA 3LYYA 4BS9A 2DY7A 3CRKC 1QJOA 4KD3A 3JAML 4K6DA 4FXDA 1SJED 2JYEA 2OXPA 2DYOA 2NVTB 2PVGC 1BCPB 3SVMA 3AEGB 1GJXA 1U9RA 5CGKA 3DHQA 4GDKB 5DM63 1JE4A 4I7ZC 4NAMA 1KABA 1S5ED 2WKDA 1SMYD 2F0TA 2Q5WD 2D62A 2PW5A 1GUOA 3PV0A 2AQ1B 2B2WA 4WH4A 1HZ5A 1PFDA 2LMCA 2WXHA 5C4XB 2LFIA 2QCPX 1NCVA 2MJ3A 3NTKA 3L9AX 1Q90A 4X3TA 2FJ2A 4BA1I 3OWEB 3L7ZC 4N58A 4DF7A 3OHXC 1VF5C 2MUYA 1G91A 2QIEB 2EYOA 4FXGC 3T3NA 4A3DB 3ZYYX 1K8OA 1V1PA 3AU7A 4ZHPA 1V97A 3BVZA 2NN6G 2F0DA 3J81L 5G3LF 2N55A 2LMCB 1DGJA 4X3UA 3I9V1 5BMHA 3DWPA 2PKOA 1JW9D 2YU9B 5I2YA 3BYTB 1DOIA 1JWUD 3CIRB 3AV8A 3GS2A 1TWFB 5FO7B 1HUNA 2AWOA 1HQRD 3RPFC 1AZPA 4UAIA 1JC7A 3M7NA 1D2BA 1V1PB 2DNEA 2WAQB 3AE3B 3NWTA 1BCPD 3S1MB 2XVSA 2EYLA 2G9HD 2B2VC 1TKEA 1TZOA 4EQOA 1QOAA 1V43A 3SEBA 1LACA 5H92C 1NAPA 2AQ2B 2B39A 3S14B 1AW7A 2IJ0A 2WXRA 2LGIA 5EE3A 4N59A 5A2QE 2EY6A 1FM0D 1KF6B 3DEPA 3ITPA 2KEEA 2BDNA 1I6HB 2PVOD 2H4OA 1OXTA 1JICA 4RGTA 1PRTF 4V0BA 1DYQA 4DU9A 1YJIA 4MT5A 1NYRA 4HKQA 1EYCA 3T51B 3C46A 1QOBA 1TJEA 4JWSC 1BUVT 3P20A 1T5EA 2F0KA 4L6TB 1SYCA 4IURA 1FEHA 2GB1A 1DJRD 3GO5A 2B2UA 2WXLA 2RSNA 3RZDB 5KNDA 3S17B 3U52E 2EJGC 3MFYA 4RHSA 1NVID 5KEEA 4RWSC 4ITKA 2K5WA 2A6EC 4ZRPA 4IUVA 1FIQA 1TS5A 2EOTA 1LTID 5JOBA 3IT6B 1XLPA 5BMIA 4D2KA 3ZQ4A 3TP8A 1RTOA 4HTHA 3NVYA 2J4XA 1PMRA 1XF5L 1CZWA 2L83A 4CQNA 3NQIA 1TWGB 2NB0A 5I9PA 3I73A 2EKIA 3NBIA 3S1NB 1EZ6A 5I6YA 2JSVX 1ENCA 5CV7A 4DXGA 3P4SB 1ROEA 1EY6A 3H0GB 4WQMA 3PO0A 4N6EB 4AYBB 2DYMA 2A69D 2JP1A 3TN2A 4RA8A 1JWAD 1J9OA 1TKWB 4QMGA 3SFDB 5HI1A 1LO5D 5C0XI 4HR7B 1D4BA 2QDBA 2F0GA 4YTMB 2LUMA 3WOEA 1I4QA 5E4WC 3HOUB 1RJTA 1QT9A 1CI3M 2W54A 4REZA 2FE8A 2YEPB 3KBGA 3M4OB 4IZ8A 3AN1A 3TP6A 1T5XD 3KQ4A 3KWVA 2E75C 2EYPA 2PLPA 1HEZE 1ZOYB 2A68C 1LTTD 3K59A 5HGTA 5HFYA 4KD4A 1ONLA 4P2CB 4XYOA 3I4LA 1JQ4A 1WTPA 5C44B 4B9XA 2K1BA 1KDCA 2I46A 1F9SA 2Y3AA 4QCLA 3TUOA 2A6HC 5KIXA 1RFKA 4ZRQA 4R8IA 1P7EA 3I72A 3U2SC 1JOOA 4K6LA 1RD9D 2JA6B 4U68A 2WXGA 1VJKA 1MI0A 5I6WA 5DAUA 1R7SA 3SDZA 5E3FA 4LJZC 3EGRA 4OW0A 4L8JA 2RDHA 2FMCA 3KUPA 2NN6H 2TSSA 3AB5A 1H9KA 3BK2A 2HTME 1VRAB 2AWNA 1CTMA 1RTNA 4ZOHC 1N63A 3C1EA 3HEJA 5C4ZA 4FF3A 1D1KA 1PGAA 4HEA1 3BIID 1VMPA 2C9OA 1JWSD 2SNSA 4H2AA 4QIWB 1N5XA 3D6WA 2JYTA 3VR2A 1G2SA 4OO1G 4NDXA 4IQZA 5HHDG 1SNPA 2B2YA 5CV8A 2CHBD 1HA6A 1A2UA 3MP9A 1EFID 3I70A 2HDEA 2W82A 3S2DB 1PTOC 1TU2B 2CJNA 4N9PA 1OXXK 5KNBA 1DCZA 3PUXA 4KKSA 4RH6A 4XDXA 2B2TC 4RGMA 2SAKA 3J7AV 4DK0A 3MHZA 2VXWA 1BOSA 3H09A 2B8GA 5LL6X 4ZAIA 1ZDVA 2EYHA 4DNTB 1PUTA 2M2LA 3AE7B 4ZHOA 1GPXA 5F2DA 3E9SA 1C77A 3D4WA 2HQEA 4EE2A 1LABA 3E0JA 1NUCA 1Q8IA 4IUQA 1Y69U 1L0XB 1A70A 4Q2JA 2Q8TA 2X69A 5CV6A 3QOJA 4L2YA 3VA7A 4WORA 1PXUA 3I3CA 1QLBB 1FO4A 3NE5B 4IALA 5HURA 2Y5CA 3ETRA 1YQ3B 2CW0D 2K04A 3EJIA 3MVVA 5D14A 2PYKA 3RUZA 3IAS1 4KK7A 1ENAA 1QCBD 2F0HA 1KNEA 1XCQL 3D6CA 2A74C 3C1FA 5FLXL 1K83B 2BOSA 5BN3A 3TDQA 2M00A 4HMIA 1VDVA 3ND8A 4BWGB 1F9QA 3DMUA 2KAJA 3D4DA 3VR3A 2L1AA 2RKSA 2VUMB 2EYMA 3VR8B 3IAM1 4JBWA 1RKNA 1SYDA 1EEID 1ET6A 1I4HA 1ESFA 1OXSC 1FNVA 2DLBA 1WCMB 4RCOA 2L11A 4RKBA 3C2PA 2K9XA 1SDFA 2ENBA 1SNMA 1I6VC 5FR3A 3X3NA 4CBVA 1V8CA 4FF1A 2WU5B 3DXJC 3HUIA 1STNA 2L4NA 1GUTA 3TMEA 1CHPD 1QB5D 2KMMA 1XEEA 3WDNA 1J7AA 3SR6A 1CJEA 2AUJD 4FXKC 3PIO3 1XLQA 1CZPA 4A6QA 1SF0A 3OIQA 3VA5A 4WIPA 3DWMA 1KLGD 1OFFA 2JA7B 1AEXA 3Q8EA 4XQQA 1N62A 3MFGA 3QIAA 1Y8NB 4KY5A 3LNNA 1UUPA 1DXMA 2W3RA 1F2RI 4X3KA 4A9AA 2NVXB 4PQXA 3GTGB 5C4HA 5JPNC 4MN3A 1Y1VB 2IX3A 1Y1WB 1TKYA 1Z6HA 5FO8B 4TMAB 2QJLA 3MAQA 3SHLA 1LTBD 1EOTA 1EY0A 4TSSA 3AMZA 2FINB 1Y56A 5EKIA 2E6XA 2PMZB 4DXFA 1FD6A 1QOGA 2NWGA 3AEAB 1MGSA 3DWGC 1L6VA 5M3FB 4I65A 1LLRD 2EDGA 4B0EA 2MPMA 1LT4D 5ELDA 2KWDA 4ZKBB 1PRTC 5JAVA 4J6HA 2XRQD 3L3OC 4WRDA 2VZKB 4NMZA 2LY7A 2IGGA 3HOYB 1RHPA 4FXCA 1SNCA 2F3WA 4IFDI 1F2MA 1GXDC 2M9VA 4XDDA 3MHBA 1UEAB 3TEWA 3GB1A 1K51A 1IKMA 1TWAB 3FPUB 2B2WC 4C3JG 2INNE 1MHHE 5DNFA 3VR5A 2EPBA 4IOIE 3CRLC 4OO1H 1JORA 4XDCA 1TT2A 4KX6B 3H3VC 3EVQA 4YXDB 3FDTA 2E3TA 3A54A 1N5WA 2WXFA 2MEKA 4BBSB 3T4AC 3E6ZX 2AUKA 2FHTA 1YN4A 1XCTL 1BF4A 1OXUA 2A73B 1Q12A 1F2RC 4A8XC 1DM0B 1C9FA 1I4RA 1FNUA 1EU3A 3LWEA 5JEAG 1L6UA 3P1MA 1PTOF 2A69C 1K53A 3O13A 4FP5D 2F0WA 2F3VA 4OIKA 3OSOA 3OOCA 1EY8A 4LK1C 4L1BA 3FEWX 5IGCA 5ELCA 3R2TA 2K3UA 1JOKA 3B2GA 4JPSA 2G9DA 1E6EB 3MXPA 2IPKD 4WJWA 5EE9A 3J7YW 5K36G 3MTSA 5A2QL 2FBWB 2ZXPA 4EGVA 2KDMA 1UWXA 4DAVA 1G8ZD 4CJ1B 3ZJTA 1QKZA 1VZ6A 1EY5A 1I4PA 5I4DA 3MWYW 1VR9A 1FCLA 1S5CD 3F2UA 1HUMA 2VZKD 1AN8A 1NYQA 1K52A 5KGUA 2KUMA 1CK1A 1TS2A 1QOFA 1R9TB 3KLSX 3AMUA 1Y8PB 4L23A 1SYEA 2XNAC 2IX0A 1PGXA 1ML0D 2DBYA 1U4MA 4CKBA 5M5XB 4GZYC 2SDFA 1H9RA 4DAYA 3BVGA 1B1ZA 2F0QA 4F7XA 4J8QA 5FKAC 4DFAA 2FFKB 1QF6A 3S1QB 2BB5A 1PZJD 2K05A 5EPLA 4XE0A 2N88A 4ULLA 3GV3A 5CV5A 2JA8B 2SOBA 2AQ3B 1OO9B 4ILWA 3Q8AA 1YJJA 1EU4A 1MI2A 3HG9A 2RDGA 2LKVA 5FOBB 2MJEA 4M8AA 2GI9A 2K5PA 3FPPA 5AFWA 2KCNA 4C3IG 1WTQA 4HEDA 5EBDA 1JB3A 1Z7TA 2F0OA 4RF1A 5GXGB 1WTOA 2OHFA 3D4RA 1WD0A 3FILA 2QEJC 2Z8LA 2K0PA 3NZ3A 3ABVB 1PDXA 4PT5A 2CJOA 5D7GA 3TSSA 5J22A 2WXJA 4V190 4PV1C 1RYJA 2R92B 1HRJA 4BY1B 5KNCA 5I2XA 2DN8A 4C3HG 1GHKA 4RFBA 1LV9A 1JALA 3ZJUA 2R93B 2KOLA 2V4DA 1BCPF 5E6JA 1WGKA 1KDAA 1FYCA 3UI3A 2EY5A 3NTHA 3FILB 2V0GA 3VYSA 2WKCA 4CJ2C 2INPE 4IUNA 3W5VB 1EL0A 4FVMA 2ONQA 2OF1A 1LTAD 2F0MA 1LT5D 3R93A 3I57A 2WIIB 2J42A 1JWMD 2QILA 1G2TA 4H0LC 3PIP3 3AE8B 1ESRA 2JZPA 3UI2A 2L1BA 1MD2D 1YNJD 2Q8RE 3KLRA 3QJYA 2H89B 2F0NA 4ARCA 4KKTA 3NUCA 1P7FA 3PO2B 3NTIA 4A3FB 1IL8A 4CKCA 5IGEA 3IXSA 1SYBA 5JEAH 1FFVA 1HQMC 4PMCA 5DM73 4B0MA 1F2YA 1SB3C 1EY4A 3Q8CA 2ZXRA 2BDOA 5EKKA 1BNZA 4BY7B 2WXOA 3T13A 4H7BA 3EA6A 1SYGA 3TEZA 3M7GA 3U7ZA 3GTPB 4XXEA 2QKIC 4KV6A 5K36H 2I38A 2RQXA 1FXIA 1TR5A 3S15B 5IGGA 1O7ZA 4KN4C 2BS4B 4XYQA 1M4VA 2B2YC 2E74C 1RDPD 3HGBA 3Q23A 1VZ7A 3A8KE 2CQAA 1O78A 2K03A 4KI0A 4NJCA 2OEOA 4GLSC 1QG7A 3S1RB 4RGNA 3RMHA 2LEKA 1RF2D 3I8ZA 5LNK1 1H9MA 1U4RA 5J39A 1CFMA 5COYA 5CV4A 1SAPA 4IFDG 1HPCA 1SEBD 4JWUC 2HDMA 1CQFA 1NR4A 5EBCA 4TQ1A 1G6ZA 5JXVA 4NP5A 2B2VA 2B63B 4KJNA 1TYGB 3TEYA 1A3VA 1DOMA 3NWSA 4MIUA 5C3XA 1YN5A 3FKIB 1OQRA 3P4RB 3GD7A 1YNND 2RA4A 1W6KA 2RPVA 1IW7D 3V2TA 1ZDXA 1DD2A 1TS3A 4K5WA 4QB4A 2KA7A 3P4PB 2PPBC 1Q1BA 3QO2A 3VYRA 2WDQB 3HRDD 1PFMA 1F9RA 2K7VA 1ZUD2 1DOXA 2PQEA 3DWAA 2WNMA 1STHA 3OIPA 1II3A 1GUWA 1F77A 3KBXA 1Q1EA 2PO4A 4B08A 1EYDA 2E2HB 1C79A 2X6LA 1SE2A 1PZKD 1VLBA 2EYFA 5IIFA 3T53B 1B3AA 5JPMC 3SFEB 2Y5PA 2LFNA 3BVMA 1KLUD 4XQNA 2NYZD 5E4XA 3HP3A 1WTRA 2IW3A 3VR9B 2PW9A 3URYA 1EWHA 3R2IA 3PMFA 4K5VA 2EJFC 4DN4M 2PIAA 4OL7A 4HMJA 2H1EA 3MXGA 2SNMA 4KMUC 5BYQA 2V3NA 5CORA 4H44C 2F0LA 4UDUC 2YEPF 2J53A 3TEXA 1NI3A 2MJ8A 4O42A 1SXTA 1M8AA 1TWCB 3TBIB 5T1IA 3LX0A 1I7HA 3HOVB 1EWCA 1SJHD 1F0ZA 2VB3X 3MC0B 3GQBA 3LWUA 1ZP0B 3V3XA 2JEBI 4DGZA 3IKJA 3GTOB 3I4MB 1VMCA 2BW2A 1DZ1A 3VRAB 3B2FA 3N6RA 4XQJA 4HKZE 3WCQA 4EQPA 2R61A 1D1IA 1CHQD 2J52A 4HRSA 3AH7A 4LTUA 2JX5A 4M0WA 2WINB 1UNSA 3J7AF 4DA2A 4A55A 3P1HA 2NN6I 1SMYC 5IODA 1CM9A 3H91A 1DONA 4YWGG 3J80E 4RCNA 2OT2A 4C1NI 3NBHA 4ME5A 3Q8BA 1X3QA 2DWQA 1A6XA 2ACZB 1ZPSA 2MH7A 4RHRA 1B53A 1Q3LA 4YSYB 2W55A 2IGDA 2F0JA 4AQ7A 5D3IB 2KECA 3P4QB 2KJXA 2KEDA 4AS1A 1EQTA 1WRIA 2JSOA 3A55A 5KRUA 5EQ0A 2R7ZB 2IL8A 1WWTA 3TZDA 3L4PA 1WVLA 2VB2X 1L4ZB 5CC4A 5M5YB 4R9WA 2EY1A 3NQTA 2X38A 5C5MA 3G7LA 1KAAA 2V3PA 3X3MA 3W1SA 2DY8A 5EKLA 1YNTE 3P63A 4P6VF 2ZW0A 4A3IB 1S4ZA 3A8JE 3IL8A 3NUHB 4G57A 4IFDH 2BB6A 1TY0A 5EPJA 1SNOA 1FD7D 1R4QB 4FYDA 1U4PA 2NZ1D 2KQ4X 1BQQT 1O7YA 1BCPC 1GOZA 5G5GA 3W5UB 1FGBD 1HTLD 1UAPA 3VR6A 3EUB2 2D5GA 1WTWA 4BA2I 2Z1CA 2GRIA 2EE1A 2Q8IB 2PZTA 4Q5VA 1EIHA 4KY7A 1QE6A 5CBEE 1FFUA 1L4DB 1D5XC 3G6JB 4US8A 1C4QA 4EVOA 2TMPA 3M85A 2HCCA 5C3WA 3K5NA 1E0BA 1TS4A 5A35A 4RGOS 4F8MA 4HROA 3M4YA 3QB3A 4U673 4DQOC 1ENFA 3RZOB 3U9SA 1OXVA 1VF7A 3RLFA 4FF2A 1PGBA 2KHSA 3GTQB 1I3QB 1IUEA 5G5HA 5HG2A 1O7LA 2BTEA 2QSDA 3HS0C 1ICWA 3Q69A 1SFOB 2PZWA 3K5LA 4R8NA 1E2WA 3KWLA 1V8QA 2PNRC 5JJZA 3T3OA 2L32A 2WDVB 2ON8A 1IHZA 1A3TA 1B50A 1EZ8A 4RAUC 1WSPA 3NXWA 3MXUA 2EXZA 2K32A 3AECB 2A68D 5KYLA 2WXQA 2LHDA 3IFDA 1C4AA 5T8IA 3P42A 2LJIA 2XRSD 3H6MA 1NENB 4FF4A 2CVRA 2IX1A 1L5PA 3NSWA 4R3DA 4KN7C 3KK7A 4WAFA 2A6HD 3PZ7A 1PDQA 4USAA 3NVVA 3HOXB 2EELA 1XXGA 1XX8A 2LS01 4DK1A 5EE1A 3A8IE 5C0XG 2QMTA 4GDLB 1VCIA 4F88A 5D65A 4IUTA 5K5PA 1UWMA 3NRZA 3SR1A 3OMCA 3W2DA 1XO3A 1WXQA 3KF8A 2Y0SB 1MPEA 1ZEQX 3MA2B 2PW7A 3U9OA 1ACCA 1KDBA 1G291 2L12A 3HOWB 2C5CA 3SE0A 3I91A 1KTKA 3DWQA 1K50A 4JE3B 1E10A 4RF0A 1LT3D 1STBA 2WV6D 3KLSA 3TP7A 2WXKA 2NTTA 3FRPB 2KACA 5EGTA 1ZKOA 2BS2B 2JQRB 4K14A 1SNQA 1X32A 2F0IA 2BA0A 2R3ZA 2K5QA 2ICEC 1BMLC 3RD4A 3K6OA 1B9RA 4K8JA 1PTOD 4C3IB 4WWMA 4G7ZC 4Q0FA 4C56C 2M19A 1MSHA 1IYUA 3OW7A 5JEAJ 1JRPA 3H94A 1E9MA 2WU2B 3QOLA 5ELFA 5TSSA 4K8IA 1YMHE 1WTVA 1QILA 5CR3A 5BN4A 1I50B 1S5BD 5J1ZA 1TVXA 3R3OA 2M0AA 4HN7A 4DAPA 3EFXD 1SIJA 3GTKB 4YSXB 2ZXOA 1KRHA 1STYA 1IGCA 1C48A 5CBAE 2O5IC 4CGYB 1ZXTA 4C3HB 1AWDA 3AE4B 1XWEA 4A3BB 3J9CA 1L0YB 3OWFA 4O1NA 4J1MA 1ZYRD 4MACA 2F0SA 4TRDA 4US9A 1XYIA 2D5DA 1VDZA 3HOZB 1TIID 3SK4A 3C8YA 4K2LA 1LTRD 1HTPA 2B2UC 1I4GA 1PYWD 1IKLA 1STAA 3AEBB 3FVQA 1PRTB 2WXPA 2V4IB 3VRBB 5BYSA 2K01A 5IGBA 3NK9A 1JCKB 4DNRB 3FAHA 1CZGA 1GB1A 4TQ0A 5IGFA 1MHXA 4YTNB 4WFN3 3R8BA 1I4XA 1E2VA 3VQIA 3S16B 2IT1A 2KVMA 1JMLA 1A15A 4YIJA 4LMQD 4N9TA 1QNUA 4WURA 4C80A 3M3YB 1TY2A 5G3LD 5IGDA 3Q22A 1LTSD 4C7ZA 5CMDA 4NZLB 5M3MB 1AZQA 3IT4B 4XWTA 2WB1B 2B76B 5BN5A 4P16A 1QOHA 1HHVA 2WLBA 3BYYB 2CW0C 1JWBD 5IOCA 1DOYA 4S3SA 5EPKA 3T56B 2BE5D 2EYJA 3NVWA 3B9JA 3EQLC 2XWBB 1UGJA 2NVQB 1A3UA 3A56A 3SK8A 1SSOA 3VYUA 4BBRB 3NVZA 1BUIC 2L9HA 1SE3A 3BDCA 5C0XH 3I90A 4XT3B 2BYTA 4OIJA 3CKIB 3GP7A 4ZUJA 1GAQB 5C2TB 1N60A 1GHJA 4OZBA 3JAME 2FMMA 1PTOH 1SE4A 4CHTB 5BYRA 3MEHA 1OQQA 3D8GA 1PFNA 1PRTD 1D6EC 1CA5A 3S9WA 2X6GA 4Z9CB 5M9OA 1JQYD 1NR2A 3GTJB 3BK1A 1FCCC 4HSPA 1EEFD 4MH8A 2LHEA 1S5DD 2Z4HA 1D5MC 3ERQA 1KH0A 4E6IA 3QG1A 1EQVA 2SEBD 2HCIA 3D3RA 4XWWA 5ELBA 3K58A 2O5JC 4YSZB 2JU6X 4KKUA 1B9MA 1E0ZA 2DNCA 3H8HA 1LTGD 5M5WB 4OZAA 5AUKA 3N52A 2L5TA 3HVDA 2B8FA 2FUG1 1B9NA 3ZGZA 2M56B 3CQZB 4ZLTF 3GV6A 4KKIA 3MZ5A 1STEA 2NMQA 2QF7A 3NHHA 4IKGA 2EZVA 2G1EA 1J7BA 3MXNA 3Q6SA 3WOFA 4A93B 3J81E 1Y8OB 1ET9A 1F9PA 1JROA 4K2KA 5H8YE 1L0VB 3J80L 2EVBA 1FR3A 3AE1B 2O2LD 2JXMB 1ILPA 2IGHA 1QQRA 1J8IA 4TKOB 1HA5A 2MHVA 3LB8C 2MJDA 4XTCS 2E2DC 3NP8A 2NUCA 4CJ0B 2WXMA 1FMAD 4L63B 4C7YA 4HCSA 2I2YA 4IUPA 2WS3B 1E2ZA 4NKLA 1JR0D 1HXYD 2XSCA 5C6AA 2K28A 2R6GA 4RNAA 1T6BX 1EY7A 2E76C 3E5SA 3T16A 1FXAA 1SSNA 2PTLA 3Q24A 3TP5A 3PUWA 1FRDA 3TZUA 1EY9A 2WACA 4ZK9B 1DOLA 2A5HA 4IFDJ 4LAAA 5FK9C 1C4CA 2J0TD 4XT1B 1TWHB 2JXTA 4RKLA 4G4KA 2BS3B 2WDRB 1K8MA 1MSGA 4ABNA 3NPPA 1J7CA 3Q8FA 5FO9B 1VZ8A 2JYOA 2E2JB 2L52A 2Z4IA 2F0VA 5ELEA 3PUZA 5C4JB 4A3MB 4ARIA 2K33A 3QWNA 3K57A 4IDIA 1IYVA 2GA4B 1D5ZC 3MJ5A 2L55A 2WP8J 2MGSA 3IFTA 3BDLA 1EWYC 2K5DA 2JEAI 3PZ8A 4JK1C 3OPOA 1HFNA 2NTSA 2RVLA 2NVYB 1WYGA 2EY2A 2ID0A 4PMBA 4PMWA 1FNWA 4JX1C 5ISRA 2J7ZA 4OGQC 2JWUA 2XIWA 2BCOA 2KQ3A 1RM6C 2F4IA 3HZXA 4B9WA 2ICIA 2F03A 4ODGA 4C1NK 1ZXIA 4ZQ3A 1C78A 2WXIA 5LL6S 2WQYB 4G7HC 3AE2B 3NS1A 3AE6B 3AEFB 2YYZA 2BBCA 3E56A 1F2LA 5C5LA 3OMGA 4K5XA 4KJOA 1R4PB 3VR4A 1CA6A 2F0FA 2ZT9C 5EJWA 4CKEA 2WXNA 3LXFA 3DEOA 2KCCA 4LK0M 4J3OD 3I4NB 3D31A 4OHJA 1IGDA 5NUCA 1H9SA 1PLFA 4NW2A 1YQ4B 3V05A 3P75A 1V1OA 1BO0A 1ZYRC 2XN9C 4LLGM 1JOQA 2JA5B 3W9CB 2RSOA 3RFZB 4KTAA 2BT6A 1GB4A 4G7OC 2OEDA 1N61A 4A3JB 4KGTA 4C2MB 3AE9B 3K5MA 3BS1A 5T1GA 1AP0A 2WP9B 4YTPB 3CU7A 2D9UA 4HSVA 1HFGA 2PMVA 4IN3A 1H9SB 2RDFA 4ZRZA 2W3SA 4KGRA 3P7JA 1RODA 1MVKA 2HDLA 5CYUA 3SK5A 4H13C 4KHVA 1WD1A 4ID6A 1WTXA 3BZDB 5DEHA 1GUGA 4QUCA 2F0EA 1SBBB 1C4PA 1GUSA 4YT0B 3SK6A 3PUVA 3CHBD 1B2TA 2A6ED 1Q10A 2MP1A 5IT9L 1ZE3D 5LHY1 4OVZA 3FMCA 4MHEA 4EQNA 2CU3A 1EYAA 2B2TA 3Q0AA 4KY6A 1KNAA 3N9YC 4C3JB 2BA1A 5EE0A 3DUZA 4HAEA 4TQUS 3BDOA 4QF4A 5D3DA 3S2HB 1QNKA 1B4OA 4ZUIA 2BE5C 4ZKCB 4X3SA 4IUUA 3PO3B 3FC4A 5I9OA 2EJMA 3K0YA 3HKZB 4KKJA 3AEEB 1TQOA 5AUIA 2F0UA 4HCEA 4KHZA 5E1FA 1TKGA 1F2ZA