4RGNA

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
236
structure length
214
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 58
structure length 214
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgnA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgnA01
4L6TB 1B44D 3MFGA 4RGNA 1PTOC 1ESFA 1JR0D 1ENFA 5ELFA 1UUPA 4RGOS 3W2DA 1PRTB 5I4DA 3R8BA 1PTOF 2G9HD 4OHJA 2RDGA 1SE3A 1SJHD 1SE2A 1MD2D 1L0XB 1JWSD 3BVMA 1M4VA 3CHBD 1JWMD 2NTSA 4RFBA 1F77A 2AQ2B 1D6EC 3O13A 3TSSA 2Z8LA 1XTCD 1I4QA 1PZJD 1AN8A 3BVZA 1FGBD 1KTKA 1D5ZC 2IJ0A 4RHRA 1PYWD 4Z9CB 1PTOB 2TSSA 1EU3A 1L0YB 3DWQA 2XRSD 1KLUD 1LTTD 1EFID 1S5CD 1RCVD 5TSSA 1EWCA 4C56C 1LT4D 1CT1D 3DWAA 4DXFA 1I4XA 1BCPC 1TS4A 1HQRD 1PZKD 1LTRD 1QILA 1S5FD 1FD7D 1S5BD 4RGMA 1CK1A 1LT5D 4TSSA 1JWUD 1PZID 1HA5A 1JQYD 1B1ZA 1BCPF 1BXTA 1SBBB 2NTTA 3DWPA 1YN5A 1D5XC 2O2LD 1ET9A 1G8ZD 1EEFD 1LTBD 2XN9C 1I4HA 1CHPD 1BCPD 4UDUC 3V05A 2R61A 1LO5D 5D3IB 4RHSA 2AQ3B 4O1NA 1DJRD 1HXYD 1EEID 1STEA 2WV6D 1JCKB 1PTOH 1TY2A 1V1PB 1XXGA 2ICIA 2XRQD 3R2IA 1BCPB 1SXTA 1TS3A 5ELEA 5FK9C 2SEBD 3BVGA 4NZLB 1YN3A 3SEBA 1I4GA 1TS2A 1LTID 1RD9D 1TY0A 3EA6A 1CQVA 1LTSD 1LT3D 1RF2D 1FNWA 1T5XD 1V1PA 1SEBD 1DYQA 4K6LA 2RDHA 3BYTB 3BYYB 1LLRD 1TS5A 3KLSX 5D3DA 4DXGA 1V1OA 5FKAC 1SJED 1S5DD 1LTGD 1ET6A 2J4XA 5ELDA 1UNSA 4ZYSA 1HTLD 2XNAC 2QILA 2QEJC 1FNUA 4L63B 1D5MC 2AQ1B 1RDPD 1I4PA 1PRTC 3EFXD 3GP7A 2CHBD 2IPKD 5ELBA 3MC0B 1KLGD 1SE4A 4BWGB 1PRTF 4RGTA 5ELCA 1PTOD 4RH6A 1LT6D 3URYA 3OWEB 1EU4A 3BZDB 3R2TA 1YN4A 1AW7A 1LTAD 1GOZA 1S5ED 1CHQD 1PRTD 1I4RA 1FNVA 4RCOA
chains in the Genus database with same CATH superfamily
1FCLA 2VUMG 1ESFA 1JR0D 3J7AV 3H7SA 4JI0L 1XF5L 2KBNA 5NUCA 1C77A 1SMYC 2BDNA 3TMEA 2B63H 1E24A 4X65L 1FXIA 2L76A 2UU7A 2EVBA 2L3ZA 3HM3A 1HZ5A 4LDTB 5CORA 5E4WC 2MBHA 1U0LA 1RM6C 3F2BA 3B08A 4HEA1 4JI5L 3BZCA 4X3TA 3BVMA 3KDFA 2KJHB 3U30A 4DV5L 3KF8B 1QNUA 2RSUA 1JWMD 3Q3NC 1IKMA 2NN6H 1EYDA 1N6ZA 3L4PA 4G4KA 1JMLA 1YIWA 5IP4D 2KX3A 4IW0A 2IY5B 4LFCL 3TP5A 1HE8A 3RCZA 4CQNA 3I57A 1L2FA 3I5JC 4Z9CB 4XQJA 4UY8C 2W54A 2KD0A 4W9FA 2WYQA 1NR2A 1IPGA 5HG2A 1EY8A 2ICEC 2XK5A 4BBSH 4C56C 5C0XH 5DM63 4KD4A 3ECIA 2D5GA 1GKHA 1LTLA 2QC8A 1KRSA 4YCWA 2RQXA 4K2LA 4W9DA 4DDID 1UAPA 2BYVE 3I73A 3W1BA 3HIZA 5JXVA 3OSOA 2M8SA 1B3QA 4DR5L 3QARA 3ZKJC 1D5XC 2DHZA 1Y1VH 4HJ5A 2ACZB 2YTXA 4N8X1 4FYDA 1EEFD 2N7JA 5D7GA 3TN2A 3L3OC 1VZ8A 3FILA 4TKOB 2F0IA 2ENBA 4KJNA 2H1EA 2RMMA 4AJWA 3A9JB 2PPHA 2YU9B 1XNRL 4RHSA 1TZ1A 5H8YE 4J3OD 4B3RL 4IDIA 1I42A 4U673 3W3AA 2EYMA 4ANVA 4JOIC 5FLMG 3TZDA 2WXOA 1TVXA 4WWNA 5KHQA 1HTOA 4ZKBB 1G2SA 4Q2JA 1NBFC 5JJIA 1LTID 5E3FA 5C5MA 4CYEA 4EEWA 3I4NB 3A55A 1LT3D 5M3FB 3QJZA 2NZ1D 3S1NH 4JL9A 4BAXA 4LNQA 4DR4Q 2N9LA 5EE3A 2DYOA 1AEXA 4HEDA 4MEMA 1N9WA 1FEHA 2RPQA 1ZGUB 2J0MA 3PIO3 3KUCB 5HGQA 4XE0A 1LM8B 1NENB 1M1KC 4TQ0A 3M62B 5JHBA 3RLFA 5DLQE 3KUDB 2AQ1B 2CW0C 1V80A 3ONSA 4KZCA 3Q23A 4RAUC 2FCNA 3PF4A 1PFNA 3P20A 1D1IA 2M0AA 1E0ZA 3SGIA 4DV7Q 3RNCC 4HPMB 3NP8A 1GPXA 5BR8Q 2ZJPA 2IPKD 4CJ2C 1AYFA 1HEZE 4QIWB 3T9LA 1KRHA 4RGTA 5JVH3 4DAYA 4IUUA 5M5YH 3URYA 2JSVX 4LF5L 2REXA 3BDOA 1KJTA 3H0GG 1RAXA 4QQBX 3DEOA 3GZNI 3BZDB 2BYFA 1LTAD 2GBKA 1TU2B 3QR8A 2ES2A 1PRTD 4MH8A 2VY3A 3RYTA 4ANWA 1EOVA 3I7FA 3T8MA 5FLXc 3A33B 3L16A 2DJFC 4GLVB 2LVOA 4LF7L 3NPPA 3W2DA 1VQPA 4YTPB 2ZM6L 3FVQA 3K5NA 3JAME 3C3LA 1H9SB 5FOBB 1I5FA 3HOVH 2HTME 3HOUG 3N1ZC 2K52A 1KDAA 4G3XB 3TDQA 3EFCA 3T53B 1SYFA 1SR3A 4GOPB 4OX9Q 3A7LA 3IFDA 1EUVB 4JK1C 1N32Q 1FMAD 3K5LA 3A8KE 2KMMA 1HRJA 2MQJA 1YI2A 4H13C 5COYA 2XVSA 1TT5B 2FCSA 1E7UA 3QK0A 3K9PB 2MP2B 1PGXA 2A4ZA 1EU3A 2MSED 1XX8A 1LTTD 3H0GH 4BOSC 4HCSA 3D8GA 3PTFC 2JA6B 3ZTDA 4K8JA 2PZWA 1I4XA 4JE3B 5DNFA 1TS4A 2R92G 3P4SB 4BBNC 1HQRD 3FILB 1Q8KA 3GTKB 5GAGC 1CK1A 1Q90A 3A8JE 4IJHA 3B2FA 5AUKA 1HA5A 5DEHA 2KHSA 1F2ZA 3RN2A 2HDEA 1G51A 1XNQQ 2L0TA 1HNXL 4A3FG 2H89B 2FINB 3SU8X 5C44G 3VR2A 2ONQA 3V6CB 4I6NB 2AUJD 2LSSA 3Q24A 2BCOA 4KKTA 2CS4A 3L17A 3UGBB 3WWVA 2N9XA 4KHZA 2Z9HA 2VZKD 1VS0A 4NJCA 1DXMA 4K1RB 3GTQB 3SFEB 5D3IB 4KY6A 4LF9Q 1STEA 2HDLA 2XRQD 1PTOH 4BY7H 3IT4B 4DR7L 2K6QA 2KOXA 3CD6A 3ERSX 3U52E 5EPJA 3FKIH 1YN3A 3Q6SA 2INDC 1TS2A 1WCMB 4X3UA 1XMQQ 1VQ8A 2JA7B 3H9DA 4C3JG 3HZXA 1V1QA 3J80i 1FNWA 4ICVA 3Q3MC 3PGEA 2F0NA 4MT5A 4LF4Q 3SR1A 5D3DA 4GGQA 1KQSA 1NTGA 3ZXVA 1E7PB 4XC2A 4DNIA 4HIKA 1HTQA 1EY7A 2SNMA 4H44C 4LK1C 2BPSA 2V4IB 4DAYB 4JG2A 4P74A 4DK0A 4ZYSA 1I6HH 2CFMA 5C44H 1FNUA 3VQIA 1YIJA 3CC7A 1ZOYB 3AEVA 1PDQA 3HS0C 4BY1G 2EKIA 4MACA 3F1ZA 2F0WA 4B0MA 1I35A 1E7VA 1Q82C 4NQKE 2BTEA 1VF5C 3SK5A 3APDA 4HMJA 1CJEA 2LXAA 3DBLB 4YL8A 2WU2B 2Y5CA 3V96A 1EQVA 4HVBA 4DV2L 4ACFA 1C48A 4JI7L 2B2VA 1CTMA 2MJ8A 4N9F4 2EPBA 3SD5A 1C9FA 2E2IB 2EYFA 2KQ3A 2KO3A 2KX0A 1FNVA 1SLJA 1TWAB 4BBRH 1K53A 4R1JA 4BS9A 1Q10A 2B8GA 2J7ZA 4DV6Q 1SNQA 4GU2A 2QDBA 1JE4A 1K51A 4M8AA 3Q3OC 4JI6Q 1L1OB 1I50H 2E6XA 1YX6B 2D0PA 1WTRA 4FO2A 2KTFA 2WXKA 4OELB 1P7EA 2KJXA 4DR6L 3WAMA 2JA9A 2WB1B 1BR9A 3Q2AC 3ZIMA 3MAQA 5I9PA 3DM3A 3P63A 1WGHA 3I9V1 3QA8A 4A93H 1F77A 4J1MA 3MC8A 2JWUA 1HUMA 5C2TB 5HFYA 1HR0W 1GXDC 2RDFA 1I4QA 4HSVA 3E5SA 2BBCA 1AN8A 3GV3A 4UHVA 3HUIA 2V3PA 2Y3AA 1PYWD 1E2ZA 5IP7G 3NXWA 5KYIA 1F9PA 3K8AA 2N0SB 5HHDG 2KDEB 2F1MA 3C2PA 2LI5A 2R2OA 3NWSA 4B3TQ 3GTGB 5C4XG 2JA5G 1ZW7A 4DFAA 2CU1A 1OXSC 4DXFA 3DLLA 2L52A 5C3EG 1J19A 4ME3A 1XQQA 3TEZA 5G3LF 1U4AA 1NEKB 5IYBG 3VAWA 4IUNA 3S2HB 2R7FA 4UP7A 1T0RC 1E5WA 5JPNC 2VXWA 4K0KL 4W9HA 3ZNGC 1FFUA 4HJ9A 1KRTA 3VDZA 1HTPA 1V6EA 1IXRA 3I4OA 1YJIA 2HDMA 1W3SA 2HQLA 1UH6A 4R4IA 2Z0SA 3CF6E 3Q8FA 3T51B 3LB8C 1K3RA 4OXPA 3NVWA 1O78A 4O2DA 2WXJA 1SYEA 1YHQA 2A1AA 2N1VA 2KECA 4JW0A 4WQOB 4FN2A 2XWBB 3DPDA 3EA6A 4QGUA 2PTLA 2QMTA 3CSFA 2JA5H 1EF1A 2IGHA 2ALYB 2CVRA 1QF6A 4NNJB 4PNYA 5GAEC 2AMCB 4A3EG 4M8MA 1A70A 4DNRB 2JUOA 1II3A 5IYCG 2Z59B 3MXPA 4IALA 2NVQB 4W9CA 2WKDA 4BKGA 1VQLA 1E1OA 4GKKQ 5EGTA 5G5HA 4A3OA 1DOLA 3OOCA 4P7IA 2NVTH 4C1NI 2DZIA 4D2KA 3KWLA 1KNEA 4QY7A 1MJDA 4AP4C 3TUOA 4RMFA 5C4JB 2FXQA 2F0PA 2BH8A 1E8XA 2NMQA 4WJPA 1PTOD 2GBNA 4QIWE 4IOIE 2JA8B 3UE1A 4RA8A 3PF5A 1ZP0B 3HP3A 4KMUC 4L5QA 5KNBA 2B3AA 4IOCA 2PO4A 4JV5Q 4NPNA 1WX7A 5EPKA 1GB4A 1SE9A 4V190 1I4RA 4X57B 4ASWC 2DZMA 3R8BA 2KMAA 2NWGA 4RGNA 1EWYC 2UUBL 4JI3Q 1GHJA 4GN5A 5C4HA 3GS2A 3KUZA 3L13A 4BXXG 5E6OA 1PDXA 4AWJA 2A74C 2E2DC 3CRKC 3HOXB 4L5TA 2EYPA 1WGGA 2IO2B 3P42A 1NUCA 3RN9C 4YSZB 2O5JC 2R7ZH 5CGKA 2A6ED 3PGZA 3HHMA 2G9HD 1PLFA 2EY1A 2RDGA 4AH6A 3DDCB 4BKTA 4RKLA 1X54A 3MJWA 5LLIA 2A5HA 3C1EA 1CUKA 1M4VA 2F52A 5H1SE 4DV1L 2IX0A 3CHBD 1KD1C 4KGSA 2KDBA 5AZHA 3K80C 4YY3Q 4HMIA 3GTJH 3NRZA 4NAMA 1JT8A 5DPWA 3ZXRA 1E3PA 1KTKA 3ZNHB 4DV3Q 1GD7A 1IW7D 2KC2A 5C6AA 3J80L 1R9TB 1LABA 2D2CC 1Z47A 3OHXC 3EHVA 4WWMA 3JAML 2JXXA 2M19A 3RPFC 4K3CA 4LWCA 1BO0A 1UE1A 3HEJA 2XSCA 3U4VA 3RZDH 4A9AA 1TYGB 3T1HL 1WTVA 3I55A 5HI1A 2F0VA 3FMCA 3H8HA 1S5FD 4YSYB 1PXUA 4LLGM 1QJOA 2N49A 4KKUA 1ASYA 4RCNA 4BXXH 3EGRA 1EIHA 1VQKA 3JW0X 2B2TA 1J6QA 4C3IB 2EZVA 5DM73 1Z7TA 5JEAJ 1B3AA 1G8ZD 2MH7A 2A68D 5AZFA 3OTOQ 1J7BA 4IWOA 4F7XA 4US8A 4JPSA 2CKZB 2E2JB 2MCNB 3VUXA 4RNAA 2E5LQ 1YNND 3PRMB 1MBYA 1EOTA 1KH0A 4HK2A 3J7A5 1XD3B 2KVZA 4OVVA 4G7OC 2IBIB 3KH0A 2YLMA 3VRAB 4ID6A 3N52A 4EGVA 4F88A 4QB4A 1WTXA 1OQYA 4KVGB 1K83B 2AHOB 5BN3A 1TS3A 3S2DB 3H1UA 1EUJA 1U5KA 4IN3A 1JJGA 1NCVA 3GTPB 2A69D 3S1QB 2IO1B 3N32A 2FMCA 1I4GA 1ONLA 3T13A 4HTHA 3V3XA 3TEWA 1CQVA 1WX8A 3PO2G 4FF3A 2Z6KC 1WYGA 3KJOA 3HOZB 1BKBA 1K28A 2UUCQ 2DNCA 1KF6B 1T5XD 2RVLA 2NVXH 3LDZE 2Q8IB 4H7BA 2JK8A 2R93G 1JALA 3J81c 1RWSA 4P16A 1EY4A 3S15H 2PQEA 3I4MB 4KDIC 2YTYA 1V1OA 1S72A 3W1YA 1PH2A 5ELDA 1J0GA 5C5LA 4JYAQ 1UD7A 2C7MB 2QDFA 1Y1WG 2QEJC 1YZ6A 4ZUJA 2JQOA 2DJGC 4AQYQ 1RDPD 5CX3A 3KVFB 1KXLA 2QDLA 2RA4A 2A6HD 4EQPA 4A3MB 1IBLQ 1IYVA 3MJ5A 1MHHE 4LFAL 1N8RC 4JI1Q 3ITPA 2WAQB 3S14H 1RL2A 2B2UC 1FRDA 2K8CA 2HHHQ 5M5XB 2NB0A 2D3CA 1N36L 1Q8IA 2RCFA 1HZ6A 3WOEA 1SIJA 3KYCD 4FXCA 1WM3A 2E8GA 4W9JA 4NAWB 1TZOA 2HTHA 5G5GA 4X62Q 1A62A 1TWFB 1YJ1A 2WDVB 1PTOC 4M01A 2HT1A 2WLBA 4CHTB 2FMMA 4JC0A 1SFOH 1PRTB 2PVOD 3QO2A 1P0RA 1STGA 5E7NA 1P98A 3PO3H 2EXDA 3J7AF 4HRSA 5CYUA 4W9LA 2EELA 2PW7A 3M9BA 2KTRB 1VQHA 4C3HB 1KDBA 5IT9c 2LGDA 3MXUA 1WTQA 1G291 2JX5A 3STBD 1SGHA 2K33A 3ZJYC 2OQ0A 2JWZA 1N34L 3N6RA 3EFUA 3HVZA 3ICEA 2QF7A 1PYSB 1A8VA 4GOCA 3FPUB 4AQ7A 2YV5A 1JC7A 2D3BA 5E6JA 3A8IE 4A3KB 1O7YA 3BG3A 3PZ8A 3QWZB 4WWPA 3RI7C 2PMZB 3P4RB 3U4EG 4LTUA 1GC7A 2M4NA 4FF4A 3OG5A 1N62A 2H5XA 4ILWA 3DVGY 4A3DG 1BCPC 2K32A 3NQIA 3QAQA 4OGQC 4ULLA 3S16H 4DDGD 2Y0SB 3UF8A 4YT0B 4FA6A 2EYOA 4IG7B 2PW5A 2PNHA 1B1ZA 5IODA 3CMMB 2KEDA 4HCEA 1XMOL 4LW1A 4HSPA 1Q1OA 1QQRA 1PH8A 4JI2L 3HOYG 4C1NK 4TRDA 4DHJB 3EECA 5IA7A 2I2YA 1LV9A 1TWGH 4B3MQ 3RZOH 1WJ6A 2KNBA 2HD3A 2B63B 3AU7A 1PFDA 3VH4B 1HCZA 4GDKB 2K50A 2N9KA 3DBHI 1Z9FA 4OWTB 2O2VB 3HG9A 5LMNQ 4YCUA 1DJRD 2OJWA 1WGYA 4FNFA 1CI3M 1TY2A 1K0RA 4KHPL 4JIOU 4GN1A 1XCQL 2FBWB 1O7LA 5DAUA 2MEKA 4US9A 2JXMB 2K5HA 1TWHH 1V8QA 4K14A 1WE6A 3D3RA 4ICUA 1RD9D 3B9JA 2BDOA 1LTSD 4L2YA 5BMGA 2O5IC 1YNXA 3F2CA 1FGUA 2BWFA 3ONAB 3CQZH 1B50A 2CQOA 2M1MA 3CRLC 1HFNA 3AULA 2N55A 2D9UA 1IP9A 1JJCB 2IDYA 2A69C 1TS5A 2KFKA 4BBSB 1V8CA 4IUMB 3B1LX 3NS8A 1LGRA 3K6OA 3PIPA 1STBA 3NVYA 3I56A 3HKZG 4HJ8A 2DAJA 4FHKA 3AU4A 2VQFL 2PE6B 1A15A 2L1AA 2N7EA 2Q2IA 4DUYQ 2EY2A 1Y1VB 2DZKA 2CHBD 3VR6A 1CKMA 1JORA 1VR9A 1NMGA 1SSOA 5IWAQ 2BB5A 3W1SA 4XWWA 5CV4A 3K58A 1I94Q 2H88B 3CAMA 3CPFA 2NR2A 3SK6A 4NP5A 1ISNA 3A9JA 1VRAB 3U50C 2J7QB 3K57A 3BK2A 4FBJB 2A6HC 2CW0D 2JJQA 1ZYRD 2K14A 4BFRA 2ZJQA 3EJIA 4PG3A 3ZVVA 5CHVC 1R4PB 4CHKA 5JEAG 4LNOA 2Q8RE 2R7DA 5C0XI 4DR2L 2FJ2A 2LGYA 3FKYA 3OIPA 3AE8B 1KDCA 5EKIA 1WY8A 5ELFA 3UDFA 2PEAA 3RULA 1YQ3B 1YNJC 1D8LA 2K22A 3KUPA 5M3MH 1JOQA 1X1MA 3BJUA 1JWBD 4P2CB 2SOBA 3LWEA 4OHJA 4UPAA 4QUFA 1BUIC 2LRWA 4AYBB 1RLFA 3S2AA 2KHJA 3CCUA 2VW9A 5JVG3 4LF8Q 3ZUNA 3TSSA 1KM7A 1GUAB 1WFQA 3AEGB 5K5PA 2IO0B 1SN8A 4RF0A 4HPLB 3NG0A 1SROA 3TMPB 2L7RA 1L6UA 4O42A 2SDFA 4A3IH 1EFID 1LYLA 1WTPA 3M95A 3Q14C 5ELNA 3STBC 2KACA 3GTLH 1PQSA 4ZDVA 4WIPA 3B2GA 4A3GH 1Z5SB 4ZRIA 1BUVT 1UGJA 1H9KA 5M5YB 2DNEA 2AL6A 1E9MA 1EIFA 2DAFA 4GMVA 5JEAH 1OXTA 4IFDJ 1FD7D 3E56A 2KDFB 2K1FA 4JQWC 5IOIA 4DQOC 3D4RA 2WGSA 4PZ8A 2Z4IA 2BA1A 3ZO5B 3UINB 3BINA 2B2WC 5KHOA 1LTBD 1H9SA 1GJXA 1K8RB 4MELA 1STAA 2K05A 4P75A 4PV1C 5LHY1 2KWUB 4WJ4A 1ZDVA 1HQMC 3UIOB 3HOVB 1OEYA 1N33Q 4OVUA 3GE8C 4IM3A 2V4DA 1SYDA 4GOPA 2CU3A 2F0TA 1UGMA 2L83A 1EQTA 4O1NA 1AZQA 2B2YA 1F2LA 2WV6D 4MTKA 4C80A 2ICIA 3IL8A 1BBXC 3R2IA 3TZUA 3S1RH 1A3TA 1K8AC 4IOAA 3DHGC 1L4ZB 4HKZE 3IRBA 2KFKB 1IUEA 1A2TA 1E1TA 4MGZE 3BVGA 4R4OA 1NVID 4FXDA 2IT1A 4GNXB 3CCLA 2LASA 3ENEA 2VUMH 4IQZA 2MP2A 5F2DA 1XLNA 1ENAA 4CJ0B 5KEEA 4DR4L 1H95A 1GNUA 2JYOA 2N8NA 3H0GB 3BYTB 3RNUA 3HM6X 5IIFA 1IBXB 2SNSA 4KKJA 3WDNA 4ZQ3A 3HOWG 1X3GA 1OTCA 2J4XA 1G6PA 1DM0B 5E4XA 3HK0A 5CV5A 1MI0A 2ID0A 5JJZA 1FR3A 3OW2A 1F2RI 2MGSA 1PGBA 5FLXE 1IBKQ 1GJZA 3K81C 3V2TA 5AFWA 2MA9B 3B0AA 3WAOA 4Y52H 2O6VD 5D2MB 4LNKA 3NUCA 4DV7L 4EUTA 2OXPA 4ME5A 5BR8L 2RDBC 2A5UA 3IAM1 1PRTF 2WAQE 2MWSB 3GZNB 5KYLA 3P1MA 4W9IA 3T3OA 1DCZA 1OQQA 2Z4HA 4GLXA 1YN4A 3BDCA 1GUNA 3I72A 3Q8AA 4YSXB 5LL6S 2PI2E 3NUHB 1Q1BA 3JC66 2UWQA 4M00A 4DPGA 1CKNB 3EN2A 4BY7B 4M1UB 4RCOA 1FL0A 3D4WA 2KOLA 3VTWA 4K7SA 1PFBA 4XXEA 2KMCA 3PV0A 3VUYA 1L0WA 1PFSA 3FKIB 4ANXA 1MHXA 1I3QH 1ZYRC 2KCMA 4EKUA 1SE3A 4ZRQA 4OONA 1SAPA 1P16A 4YHHQ 3EVQA 1ROEA 1KOTA 2LKVA 2WFWA 1Q81C 2PPBC 4OX9L 1DOMA 2ATWA 2AL3A 3AEEB 3DVGX 4J6IA 4LJOB 4RFBA 1XJVA 2EYHA 1N32L 3PHXB 4CJ1B 5FLMH 1I6HB 4DA2A 2KANA 1AFPA 4HCNB 2OJRA 1HZAA 1HNZQ 3AEBB 2MBEA 3G48A 5A2QE 4J6HA 2LJIA 1MGSA 3L08A 3P4QB 1AZPA 4TVAB 2BS2B 2PMZE 1WGDA 1VQNA 4FP5D 1KNAA 1QOGA 2C7NB 3NZUA 4YWGG 2UU9Q 3A4RA 3VYUA 1WI5A 1FO4A 1TGZB 3ZYYX 4M8NA 4FF2A 3R3OA 2Y0SE 5EJWA 4EVOA 3T1YQ 1YN5A 3DQVA 5G2NA 5JHAA 4BBRB 1XNQL 1MG4A 2ASQA 1ET9A 1VQOA 3U7ZA 1L1OA 1JOOA 2WXIA 2C5CA 1ILPA 2BKRB 5FR6A 1IHZA 3PSIA 1PH5A 1B53A 4Y7NH 3OW7A 4I6LB 1HXYD 4LF9L 2LVQA 3V62A 2DLBA 1BQQT 4TQUS 1HUNA 1FFVA 2KJ6A 1Y8PB 3ML8A 2M00A 3I4NG 2HCCA 4A93B 1VF7A 5M3FG 5GMVA 1WXMA 4A4IA 3TL5A 5AZGA 2WU5B 4HDQA 1LM0A 1S40A 1Y14B 3SDZA 1XMQL 1T3QA 2XGTA 3Q69A 3SE0A 1EYAA 1QZEA 1BBWA 3Q0AA 5JJLA 1XEEA 3HOUH 1TIID 4LUOA 3KLSX 4DXGA 4LF4L 4HIOA 2PVGC 5CHWA 3F2DA 1SJED 3A5ZB 2IZVB 4ZYNA 4IJLA 2L11A 4P71A 3QIAA 2N1WA 3PVLA 2O4XA 1EQQA 1E8ZA 1J5EQ 3C0RB 2C9OA 1YQ4B 4HLEA 1GAQB 2PIAA 3IFWB 4MN3A 3L10B 3DBRI 4LFBL 2QIEB 3PLVA 3GP7A 1PH4A 3KOJA 2MBBB 3AEDB 1SNOA 4CDCC 2MPMA 3APFA 1CQFA 1SE4A 1WVLA 5D94A 4FLHA 1HNWQ 5J22A 2K28A 2GLSA 2HJ1A 2ZNVC 3A0JA 1K73C 4IFDG 2EXZA 2F0LA 4YWKA 2R2QA 1E10A 5DPTA 4AS1A 5IGBA 2QGQA 1RFKA 4JOIA 1CMXB 2OTLA 1DOIA 2OTJA 2R92H 3J80c 1XT9B 3JAMi 1VQCA 3ZNZB 4C2MH 3UQAA 4CDFC 3W5OA 1X9NA 1C4QA 3PREA 1H9RA 4DV6L 4PS8A 2DY7A 2K3UA 5C3XA 4A3FH 2C7HA 3PT2B 3KFUA 4G11A 2W3RA 4LFBQ 2UUAL 4JI6L 3A4SC 3L2PA 1G91A 3VA5A 2JA5B 2YEPB 1PGAA 5C3WA 1SYBA 4PS3A 3UDIA 3KJPA 4A20A 2FCQA 1VCBA 4AYBE 2BVCA 2E74C 2K0PA 1JOKA 3KLWA 1GUOA 1W6JA 4J15A 2I5HA 5DPRA 2GA4B 4X3KA 2KQSA 2JA6G 2RD0A 3SK4A 1LXDA 3PIOA 4WJNA 4XIGS 2NVTB 1H9JA 1ZKOA 4C3JH 2B3GA 5IP9G 2JEAI 3MHSD 4JWUC 3WIMA 2Q2UA 2WIIB 4N58A 5IY0A 4XYQA 3A54A 4B3TL 3TS2A 2MFIA 3DWAA 4BKSA 2UUAQ 4ZHPA 2KUMA 3S24A 1SRUA 1TWCB 1E2WA 1QG7A 2L12A 1R4MI 2XIWA 1VDZA 1JWUD 2FAZA 3EC8A 1TT2A 2X69A 2RPVA 3NWTA 1XPRA 1RJTA 2Q2HA 2L55A 4FADA 1A0IA 4GN4B 3SK8A 1G6JA 4BY1H 3VTUA 3T16A 5I9OA 2LFNA 3NELA 1I4HA 1A6XA 1TKYA 3ND9A 2E2HH 4KKIA 3DBSA 2R7ZB 2R61A 4XX5A 2ZTEA 2OF1A 1EZ8A 3AYHB 5EKKA 1FXAA 2FFKB 2NBFA 3IHPC 1V86A 1WM2A 1EEID 1V9JA 1XXGA 1WTHA 2JA7G 3NZ3A 3IVFA 1F52A 1V5TA 3E6ZX 4X64Q 2X38A 2ZEQA 1WJUA 5EQ0A 4IKGA 3GTJB 3IXSA 1RIPA 2M9VA 4RM8A 5GQOA 2IY0B 1XO3A 2MJDA 5LMNW 4DV0L 1IBMQ 3QOLA 4R4TA 3ZRCA 3GTMH 1M8AA 3U9OA 2PYKA 2UXCQ 5JJKA 2IHEA 3CCSA 2RDHA 4A3CG 3E3XA 1X6OA 2E76C 1KAAA 3RN5A 2D5DA 3FRPB 4ZRZA 5FKAC 3RZDB 1M94A 3W9CB 1P7FA 2KA7A 3K59A 3H7PA 4NXNQ 5CR3A 1C9OA 3NY5A 3SFDB 2H4OA 4FDBA 4R8NA 4GKKL 4S0RA 3EFXD 1ZUD2 3A74A 3PUYA 3T56B 5L37A 3S17H 4MSMB 5IP7H 1WF9A 1KLGD 1VQ5A 2K04A 1TIFA 5MPOA 2XEWA 1Q7YC 3TBLD 4JBKA 4MH0E 2MO1A 4HJKA 4WJOA 3RZWC 5C4XH 4DV0Q 3PZDA 2J0TD 1T6BX 2RGFA 3TS0A 5C3EH 3T4AC 3M4OH 2G9DA 3LWUA 4JV5L 5IYDG 1WRDB 1WR6E 3TIXA 2LJ5A 4P1CC 4GSWA 2CHZA 2MHJA 4OWXB 3NVVA 4GB9A 5IYBH 3RMKC 3O65B 5FLXL 4JI3L 2DNFA 1C0AA 1KHIA 1XPUA 5CTRC 2K8HA 2Q5WD 3CPWA 4USAA 2WB1G 2BYEA 1ZXIA 3PMFA 4L23A 2NVXB 2QKIC 2V3SA 4A6QA 4EQ5A 1VQAA 1WJJA 1NY4A 3S15B 1QT9A 2NPTB 1EF5A 4POGA 2ZVNA 4IM2A 4R4CA 1TXYA 2MO0A 2QA4A 2I5LX 2JQRB 3AB9A 1YD8U 4YY3L 3DVNV 2CH4A 4PZ7A 2OT2A 1DOXA 4CBVA 5FO8B 4XDXA 4GKJL 4DV3L 2NBVB 1VQJA 2NS5A 2KWVB 1ICFB 1L0YB 3GD7A 1TTNA 1WYWB 2OHFA 1R4QB 3E9IA 5J39A 2VH2A 3S14B 1STYA 3DHHC 2LUMA 4DWFA 2PI2A 3DCGA 1CZPA 3PV1A 4A3EH 1NJIC 4NAWA 3L7ZC 2GBMA 2EJMA 2NZHA 5AJ3Q 1LT5D 4B9XA 5BN5A 4ZCKA 5IYCH 4QCLA 2V3NA 3AECB 3DWPA 4OZAA 1IYUA 1AWDA 1AP0A 3CP0A 4GZYC 1G6ZA 3B6YA 3RNBC 3OTOL 1D1KA 1SFOB 5A2QL 1BCPD 4GKJQ 5BMIA 2K7VA 4KTAA 2KCCA 1SNCA 3M4YA 3J81E 4L5SA 2E5LL 3IT6B 3PO3B 1QOFA 3HKSA 2HIVA 4WJ3M 2KTRA 3QX1A 5BYRA 1DONA 3D6CA 1ZEQX 2PQAA 4DV4Q 2G1EA 1GG3A 5ELEA 1N60A 3NHEB 3H3VC 3AE4B 3KK7A 4I6PA 4XT3B 3CMEA 2NVYH 5HY6A 2C9WB 4H2AA 4ARCA 3H7PB 1DGSA 1TY0A 4CGYB 1GHKA 1P3QU 5EE9A 4MJSB 3W5UB 3G6EA 3F8TA 3N3KB 4DK5A 4HJAA 4DUZQ 4II3B 2UUCL 4A3PA 2EY5A 3PHWB 5LXHA 4ZK9B 4IURA 3DEPA 1OTRB 2KWCA 4G7HC 3DOWA 3SR6A 4IPGA 2WXMA 2KFJA 1YX5B 1IZ6A 1QVFA 1HTLD 2XNAC 5IOCA 2DY8A 3S16B 4JYAL 1E8WA 4N6EB 4OVZA 3VVWB 2WXPA 4KN7C 1F2RC 4AQYL 3KBXA 1OFFA 1ZKHA 4JCVE 4MIUA 2L4NA 4UP9A 1IBLL 2JA8G 3LGJA 4JI1L 1I7HA 4HR7B 3RZOB 4GDKA 4RH6A 2I0QA 1PMRA 2LZ6A 2DUDA 3D4DA 1NI2A 2YEPF 4L8JA 2HHHL 1CZGA 1Q86C 2O2VA 2O6VB 2MW5A 5IT9E 3E0JA 1EY0A 4PZ6A 2PZUA 4QF4A 3GO5A 5IGFA 2J53A 4X62L 3UI2A 3PIP3 4OO1I 2Y5PA 5GAHC 3PQIA 3HOXG 3MFGA 4HCPB 2JF5A 3JSVB 3LYYA 1TWHB 4RGOS 4LNIA 2Q2TA 1NYQA 3EQLC 3BS1A 4RM9A 1SDFA 3AB5A 2LMCA 1BT0A 3R7QA 1WOCA 2AWTA 3CQZB 1G2TA 1BBUA 1IGDA 1UWMA 4K3BA 5DPSA 1ILQA 5EBCA 4IUTA 1ZDXA 1R4NI 3ALBA 5LNK1 2ZXPA 1D6EC 1FYCA 2F4VQ 2Z8LA 3SHQA 1YJNA 4JI8Q 5LL6X 4OO1G 1B7YB 5CMDA 2M17A 3C8YA 1YNJD 4A3JG 2DGYA 3TEXA 1D5ZC 2DN8A 2TSSA 4KY7A 4WH4A 5TR5A 2F0MA 2P5ZX 3AE5B 4XQNA 3PO2H 3U8ZA 3EUB2 2BW2A 2HE7A 1CZWA 1W6KA 3H15A 2R93H 1L7YA 2IGDA 3AH7A 3HRDD 2LD9A 2I46A 2RSNA 4GLAC 1DD2A 1E7ZA 4ZUIA 2JVCA 4RGMA 3NBHB 1X55A 2ZTDA 2GBJA 2JYTA 1PZID 4C3IG 2W55A 2WXLA 3GDEA 1ZXHA 3H6NA 1NAPA 1BXTA 4XDDA 1SBBB 1JE5A 1Y1WH 4KV6A 4AUQC 1QE6A 2PQAB 2YVCA 5IE8A 2N9EB 4UP8A 1HJPA 2AWOA 2K5QA 5I6YA 1WFYA 1VLBA 5C3JB 4IUPA 5KNCA 1SYGA 2EJGC 2XTIA 4UDUC 4B3ML 3RT3B 5M3MB 2WXNA 2KKCA 1WXAA 1P9DU 1V5OA 3DBHB 2ZVOA 1GVPA 3MA2B 5FO9B 3IFTA 3GTOB 2V1YA 1VMCA 4K7WA 5IN7A 4B3SQ 2RBMA 5CBAE 5LMNL 1QVCA 4OO1H 3HKZB 2G45B 5FJ8G 2OEOA 4A3JH 5IKCM 3X3MA 4KN4C 3RNAC 2EYLA 1E8YA 1X3FA 4IUVA 1E6EB 5AUIA 4JGHB 3HGBA 1SNMA 2KJRA 2F0QA 2KDIA 4KGRA 1WD1A 1C4AA 2MJEA 2F0UA 3SDLC 3UDGA 4A3BG 2EMSA 1QCBD 1VCIA 5LXIB 5BMHA 3I4MG 5E6PA 1BF4A 3I3TB 1V1PA 4A3IB 3ZJTA 1SYCA 2M2LA 3KLSA 3GTLB 3CCQA 2BE5C 5CV9A 5T8IA 4A3GB 1E22A 3VR3A 3CKIB 2N3SA 4LUZA 2UXBQ 1WGKA 1YHAA 2QJLA 3WANA 1SE8A 2FIFA 5AEKB 4A3MG 5IGEA 2Z0DB 3VFKA 1F1HA 3RR5A 3CW2C 2W9NA 1HZ9A 2WAQG 3JYUA 2MP1A 2N78A 5K36G 1WZ3A 3V6EB 4DNTB 4DUYL 4OWWB 3OYYA 1QB5D 2KZRA 5ELBA 2VZKB 3MC0B 3I8ZA 1VDVA 4NXML 5IWAL 4PT5A 2KLCA 1I94L 4DR3Q 4GOPC 1FIQA 3GTPH 3RLOA 2B2YC 3P7JA 5FJ8H 4NJ7A 4F8MA 3RD2A 4BVUC 3VYTA 1P1AA 1AW7A 4DKAC 1GOZA 3VA7A 3EROA 2LMCB 1H9MA 2F0SA 1C76A 3ZW3A 4A3DH 4ZRPA 3QCAA 4WAAA 1MHWC 2F3IA 3S1RB 2MJ3A 2KCTA 3IAYA 4L6TB 2RCNA 3C19A 4K8IA 1J9OA 2IW3A 4N9PA 4WORA 4M02A 4A3BH 4GNXA 4II2B 1NI3A 1MG8A 2ZJRA 2WXFA 1A3VA 4XT1B 3VR4A 4CKBA 2VUMB 1RHPA 3AXCA 3N9YC 2RKSA 2GBRA 3HOYH 1N61A 1GO3E 1P8LA 4C3HG 2WXQA 1Z6HA 3WA0A 1IBXA 1IL2A 4K5XA 1X56A 4DK1A 4NXMQ 1H4RA 4LF8L 2AX5A 2JEBI 4HIDA 2K9XA 4WJQA 2AQ2B 2MUYA 3PPAA 3OWFA 1VQBA 2EOTA 4LAAA 2EY6A 4A3KG 2WACA 2PLPA 2SAKA 5M5XH 3V61A 4RHRA 4P73A 3DWGC 4NQLB 2YTVA 2B2UA 2KDMA 3GQBA 5GADC 2XWJB 5EAYA 2XRSD 2INNE 1KLUD 1QOAA 3C46A 2B8FA 1WRIA 2Y0SG 4WJWA 2GVAA 4K5VA 4QMGA 3S1NB 3OLMD 2KAJA 5IAAC 4PMWA 4BA2I 1CKNA 4PMCA 4TSSA 1WR1A 1JWAD 2WX1A 1UE5A 1X65A 1K8OA 1QZGA 4HXDA 4BBNF 1K8MA 2IL8A 3U58A 4MTNA 3TQYA 3H09A 2K03A 4JBJA 3GE3C 3FAHA 2B63G 3I90A 1J7AA 3DHIC 3NVZA 3ND8A 3FEWX 4U68A 2XN9C 4DR1Q 5DCNA 2LGSA 3APCA 1F9RA 4HPPA 1F2YA 1I3QB 4KD3A 1WIAA 1DOYA 2PE9A 2VL6A 1XPOA 1PYBA 3VR5A 1N33L 5E6NA 1NMFA 1XTDA 2F0JA 3G4SA 4KSLC 4TMAB 4B95A 1V1PB 2BF8B 2L0CA 4KDLB 4PK1A 4A3KH 4X66Q 1CKOA 3DM1A 3I4LA 5HKHA 3T3NA 1SSNA 2ON8A 4RF1A 1B4OA 3SEBA 2L8JA 3Q8DA 3NBIA 1CM9A 3OJ4B 3QOJA 1YJ9A 5CBEE 4S17A 1OO9B 4O0AA 5EBDA 3RFZB 3M3YH 3CCEA 3HFZB 3OMGA 4BBSG 1YJJA 4YWMA 3J81L 1LLRD 2NZOA 3KWVA 2IY1B 5M5WH 1VQ6A 1ET6A 2BWES 3OMCA 2KN4A 1OEYJ 2K8BA 2ZCCA 4E74A 1BDOA 4C4VA 2QILA 3MVVA 5T1GA 2JRIB 2CJOA 1Y1VG 1PVOA 4XWTA 4RMAA 4C7ZA 1IBKL 3EBEA 3IKJA 4HN7A 3H3VI 3AM9A 3K0YA 3VYRA 2I1KA 3AN1A 1L1OC 1QUQB 3RNFC 2JPHA 3ML9A 3I91A 4FULA 2JE6I 3Q3JA 1AH9A 1C1YB 2Z1CA 2L32A 2MRPA 3UE0A 5L83A 2WP9B 5J18A 2HCIA 4Y7NB 2M56B 2FE8A 1NBWA 1XLQA 1HZBA 1MIUA 3QB3A 1TKWB 2K5NA 2Q8TA 2LXKA 3GV6A 1PH3A 1WWTA 4PS7A 4EFOA 4JI0Q 1WTOA 1HHVA 2BGFA 4X65Q 2I5MX 1RKNA 2EYJA 3E0EA 3UDXA 4AYBG 1B2TA 2LHDA 2KHIA 2CHXA 1GUSA 3H91A 4KY5A 4R4QA 4UAIA 4HJ7A 1N5XA 1UELA 1EWHA 3VHTC 2LRUA 4BZAA 4JI5Q 2KLGA 3C1FA 1L0XB 5FR3A 2D3AA 4DV5Q 3HOUB 3HVDA 4KI0A 5HGTA 4YHHL 1ESRA 4KIKB 3FHWA 2VS1A 5IT9L 1ZPSA 2KQ4X 3TP8A 3AE6B 3X3NA 1YHBA 1TKGA 2KT7A 1B8AA 3ETRA 1Q12A 4IO9A 4LFCQ 1STHA 1O7IA 1IGCA 2WP8J 2JZ3B 2GMIC 3L0WB 1ICWA 2KHWB 3BVZA 1V97A 2FUG1 4PMBA 4E6IA 3MC9A 3S1MH 4F87A 1PTOB 1HNZL 2ZXRA 2ZJDA 3AE7B 1J7CA 2VNUD 1KABA 3FP9A 5TSSA 1EL0A 2WHIA 2ZW0A 2WXGA 1CT1D 3R7RA 1B9RA 5I2YA 1E2VA 3NENA 4K6DA 1VMPA 4MZ9A 1PZKD 1JROA 3K7AH 1ZE3D 2OCEA 2UU9L 3HOWH 5J2RA 4APVA 3SHLA 1UF0A 2V9HA 1Q5WB 5BO4B 3L9AX 3H3VH 2R92B 2UYZB 3RZFA 1H8CA 4DR5Q 4AIMA 2MHVA 3A1QB 4C2MB 3T1YL 4DHZB 1UEAB 3P4PB 4I7ZC 3H6MA 4NPSA 1MJEA 3HOVG 2CH4W 3KF6A 4QUCA 2R6GA 2WKCA 3VR8B 1C7YA 1S4ZA 3TCAA 4A3FB 3MFYA 3V60A 4IPDA 5C44B 1PH9A 1DGJA 1IYFA 3X0WA 1NR4A 4YIJA 5JAVA 3Q22A 2I38A 2WQYB 3K9OB 1LO5D 2D11A 4ZHOA 2LY7A 3GB1A 2GVBA 2I07B 4DAMA 2A19A 1XNRQ 3J9CA 4B3RQ 3JVZX 4IC7B 3BU2A 2ASBA 4F8CB 4G57A 2N7DA 3TRZA 2B2VC 4I7AA 1BCPB 3OJ3A 3RLNA 3HKZE 3M7NA 4WURA 3ZJVA 1YNTE 5IO9A 1LACA 3I3CA 2WDRB 4NB3A 2UXDL 5G55A 2V4LA 4TKNA 2F0EA 3AE9B 2K25A 1A5RA 4C4VB 3S9WA 5GROA 3CXCA 1M90C 2LGIA 1VQFA 2DYBA 2HUGA 2KVMA 2D10A 3CU7A 4C3JB 2LS01 4NMZA 2DX5B 5C4ZA 1WXQA 3WOFA 5IGGA 4K6LA 3MZ5A 3D6WA 4G7ZC 3BYYB 1EYGA 3CCVA 2C5LC 3D0FA 2BH2A 1BNZA 1Y8NB 3KDFB 1Y56A 3J80E 3NJTA 1NE3A 1I50B 3L54A 2Y5BB 5JZEB 1WYDA 2PCFB 2WNMA 4IZ8A 1ASZA 1VZ7A 1YMHE 2B2WA 1J5EL 3DBRB 2JSOA 4V0BA 3MHBA 3NK9A 4R3DA 3KBGA 2LVPA 1HA6A 3MXNA 1QZHA 4EE2A 1MFWA 2UXDQ 4BY1B 1AE3A 4XQQA 2XK5B 4LF5Q 1SIFA 2GOWA 3J7YW 1HNWL 2VB3X 2HIXA 2E2HB 4POFA 2C60A 3TP7A 4LNNA 4BY7G 5LMUL 4FXKC 4P72A 2VRRB 2KCNA 4HIMA 1OGWA 4IFDI 4ZRKA 3PUWA 2K01A 3FKIG 2K5DA 1OXUA 2JY6A 1RODA 4LF7Q 2JN4A 1VQDA 1ACCA 4ZLTF 1QLBB 2ZM6Q 4P1BC 4KV2A 4W9GA 5I4DA 3I63C 3ERQA 1FD6A 1EO6A 3Q8CA 4L5RC 1X3PA 1VZ6A 2WINB 4DHJD 1CSQA 2YU9H 1PH6A 3GTMB 5CC4A 4GLSC 3RNEC 2QCZA 2NCNA 1Y8RC 3AFQA 1T9HA 1FPYA 1VJKA 4MGYE 5GXGB 1Z2MA 4R9WA 1PV4A 3PUXA 2NVUI 2F0DA 1E0BA 5LMUQ 1N63A 3TJPA 1R7SA 4LF6L 1T0YA 1CA5A 2BT6A 2DWQA 3I4NH 4NJ6A 1JW9D 1HH2P 2BKFA 5M3FH 1OXXK 4WWOA 3ZNID 3ZRFA 3I2ZA 3TREA 3F2UA 1MKHA 2OWOA 4HDOA 2M0XA 1C78A 3JAMc 1QOHA 4YTMB 2PNRC 4LCDE 3IBEA 3S17B 4OEMB 1EWCA 2FUHB 1I6VC 2WS3B 3KF6B 1V81A 4EQNA 3RMHA 2JP1A 2F03A 1L5PA 1GUTA 5C4XB 4JVZA 1R4MB 4BBRG 4HWIB 4WAFA 2RF4A 3U9SA 4M0WA 5C3EB 3M4OB 4FF1A 1EM7A 1HNXQ 4X6AH 1EQRA 1NSNS 4HROA 3PRPB 4LF6Q 4LJZC 2KYWA 2AUKA 4TV3A 1B9MA 5CV8A 2L0FA 1UWXA 1EY6A 5KRUA 4ALPA 1NYRA 2EQSA 5CV6A 5CHFA 5ELOA 2G5DA 4TUUA 2W82A 1F9SA 1SNPA 4IFDH 2R3ZA 4A93G 2NPTA 1JCKB 1ML0D 5KIXA 4DR7Q 5FK9C 3CF5A 4YTNB 2LXCA 2TMPA 3U4ZA 4X64L 1IKLA 3AU5A 2PZTA 4JI4L 3PCOB 2K75A 1F2MA 2NBUA 2C35B 1CSPA 1TBEA 4B9WA 3BK1A 2KENA 2IO3B 1K9MC 1VQ7A 1UE6A 2F0KA 1IBML 1SEBD 3AV8A 3N1XC 2UXCL 2EE1A 4FHJA 1XLPA 3MXNB 3PZ7A 2N88A 5IGDA 2LUEA 3WAPA 2PKOA 4A76A 1ENCA 4FXGC 2LGXA 2ZW1A 4AOFA 4ARIA 2X6LA 4A3EB 3SXHA 1A3UA 3QWNA 4LUVA 4NXNL 3K5MA 1UBQA 3ZDTA 1GB1A 3R66C 3PS6A 2F0OA 1PRTC 3IAS1 2JU6X 4DAVA 2WXRA 4URKA 1WCMG 3J7ZC 1VQIA 1D4BA 2KXJA 1JICA 2Z0EB 4ANUA 1C79A 4JI4Q 2JA6H 5T1IA 4DBGA 3VRBB 4ZAIA 4X3SA 5ELCA 5IP9H 1WJ4A 1T0SC 2IGGA 4OZBA 4DV2Q 3DBLI 4JI7Q 3OWEB 1EU4A 3GTKH 3KLRA 1CHQD 2GB1A 1A2UA 1KL9A 3G6JB 3MWYW 1VQ4A 3MTNB 4LDTD 5D6JB 1TJEA 2FIDA 1WH3A 4OIKA 2MNAA 4BA1I 2NVYB 3TBIB 3KYHC 4MJSA 3CSTA 5KNDA 2B2TC 4EQOA 1PTOF 1CA6A 3PO0A 2F3VA 2NUCA 4MDKE 2L1BA 2AWNA 1Q3LA 4DR6Q 2AEHA 3GTQH 5J17A 1Y69U 4ZOHC 3VUWA 2KN5A 5JH5C 1T5EA 3LJ3A 3LNNA 2V1CC 1SB3C 4EX5A 2VZAA 1PA6A 1C4CA 4DF7A 4ABNA 2J0JA 3O13A 2RR9A 3ABVB 3Q6BA 2AKWB 1XTCD 1E90A 3I70A 1PZJD 1WCMH 2JA7H 4B0EA 3GOEA 1DZ1A 4XDCA 2GRIA 3AE1B 3ULJA 3E9SA 4W9EA 3DWMA 3OAWA 4M0WB 3L0OA 3FDTA 1B9NA 4QL5A 4DK3C 1EFWA 4B6WA 4WRDA 5ISRA 1UZXB 1RCVD 1YVCA 1LT4D 3KW5B 2D0OA 5CV7A 2EJFC 2O6VA 3A56A 4A3CH 2J42A 3QIJA 1J8CA 3G71A 2YYZA 1XCTL 3AQQA 1S5BD 2PJHA 1ZXTA 2D3GA 5AJ3L 2OEDA 1QNKA 5C1ZA 3BDLA 4Q5VA 4G0NB 1BCPF 2NTTA 2ZZPB 3QHTA 3ZLZA 4K0KQ 3MEHA 4ZKCB 3JSVA 1K52A 4YWLA 4NY0A 3M4PA 5G3LD 4RKBA 3ULLA 2MLBA 4KGTA 2R7ZG 1FJGL 4DHZE 1SNDA 1CHPD 2VH1A 3M63B 3ER0A 5BN4A 1XYIA 1S3SG 4G50A 2B39A 5L95C 3P1HA 1RFAA 1CFMA 3FC4A 1VQMA 3U2SC 1EYCA 4QJFA 2E2IH 4HKQA 3CWIA 3VDYA 3A5UA 1Q1EA 3QJYA 5EE1A 4A55A 3BIID 5EPLA 1TWAH 2B29A 4DV4L 4DAPA 2L05A 2J52A 2JT4B 3Q3FA 2K5VA 5IYDH 3NTKA 2EKEC 4NZLB 4GDLA 4GXBA 3MXGA 3UI3A 1J8IA 4XYOA 4KX6B 1WSPA 2HQEA 2IX3A 1TWCH 4JX1C 2VB2X 1HZCA 3QG1A 1S1QB 1X3EA 4DUZL 1RRBA 1FJGQ 4IUQA 3PO2B 2WDTB 3IG3A 4MM3A 2L5TA 2G4DB 2OQKA 1QKZA 3N1YC 2IHFA 2K6AA 4H0LC 3AFPA 2CWAA 2R93B 4QAYA 4WQMA 1PHJA 3NBHA 2E3TA 3CIRB 4HJGE 4N59A 4C7YA 2L15A 5IGCA 2V0GA 3ZDMC 1D5MC 1L0VB 1DOKA 1NNXA 3E9HA 2VQEL 1I4PA 1MVKA 2JZZA 4K81A 2QSDA 1QVGA 1Y1WB 1F9JA 3N20C 2WX0A 5EDSA 3DMUA 2Z6BA 4N8FA 3GTGH 1BMLC 1RTNA 1FM0D 3Q8BA 4PYZA 2BE5D 1SMXA 1AE2A 1WE7A 3BWUD 1UE7A 1MPEA 2K5WA 1WTWA 4N9TA 1GUGA 2F4IA 2K1BA 4J8QA 1V43A 4K7UA 5JPMC 5J3BA 3RUZA 1TKEA 1EWIA 5D65A 3DXJC 3S2HH 4E71A 4A3JB 2UUBQ 2LEKA 1IL8A 3A9KA 5HURA 2QEXA 3K7UC 1AARA 4KKSA 4FJZA 4A90A 1KLVA 4LNFA 2VQEQ 3RNGC 3CCMA 2I1JA 1C8CA 1U4MA 1SJHD 1D7QA 4MGKE 2KEEA 3A7AB 1SE2A 1A63A 1MD2D 2DYMA 4XGAB 2ZNVB 5H92C 4CKCA 4DV1Q 3AI5A 4TQ1A 3M85A 1UEBA 1EY9A 2F3WA 1TWGB 1R4NB 2NTSA 2IWHA 4DXAB 1WJNA 2F4VL 1QOBA 1YQBA 3ZGZA 4JI8L 1YITA 3VR9B 3CC4A 3VXWA 4AJYB 3K0XA 1HFGA 3OIQA 2BQQA 3VYSA 1OQRA 2OOBB 1S3OA 1EY5A 1KC8C 3QC8B 1WXSA 1BOSA 1X3QA 3BZKA 4DU9A 1S5CD 3T1HQ 3DHQA 2XBBC 3PUVA 2NVQH 2K4KA 4OL7A 4W9KA 2NYZD 3CMAA 4OIJA 2BS3B 1C3TA 3X23A 4FVMA 3WCQA 2E75C 1YJWA 1IYJB 1U4PA 2F0FA 5A35A 4GNXC 4A3DB 5C0XJ 1VD2A 2G4SA 3J81i 4E3CA 1GC6A 1K50A 2FHTA 2EIFA 3G7LA 1FCCC 4IM0A 2CQAA 5C4JH 2INPE 2O2LD 4A3BB 4JBWA 2LHEA 2BOSA 3PO3G 4KK7A 4B9KA 2JA8H 3TP6A 2DBYA 3V05A 4GDLB 3N30A 1JRUA 5C23A 4IWPA 3HOYB 5E1FA 2INCC 3W1SC 1Y8OB 5BYQA 2IX1A 3AE3B 2CKHB 4IWQA 2FCMA 2AQ3B 3NS1A 1FVIA 3NE5B 1N5WA 1K3BC 1T0QC 2ZPNA 1KAWA 4B3SL 4YCVA 1KFYB 3QQ8B 3EIVA 1SXTA 1LFDA 1GUWA 3AMZA 1BVSA 4MM3B 3LXFA 2MX2A 4OW0A 3M3JA 1WXVA 1EIYB 2LXJA 3HOXH 4R8IA 2BA0A 4ODGA 4IPHA 2QCPX 2PW9A 4HAEA 2CJNA 1MSHA 4K5WA 1S5DD 1LTGD 2KQ7A 3DUZA 1UNSA 2UXBL 5D14A 1EZ6A 4B08A 4FJVB 2RSOA 1HR0L 4L63B 4A3LG 2KK8A 1U9RA 4P6VF 4LMQD 1JRPA 1MJCA 3NSWA 4LK0M 1R9TH 4LFAQ 1WZ0A 1YBYA 4K2KA 3W1GA 4MGIE 3HOZG 3R93A 1Q0WB 1STNA 2WB1E 1NDDA 3A9KB 4EZKA 3AEAB 1C4PA 1N36Q 4DR3L 1FXTB 4OZCA 1VQ9A 2A6EC 3R2TA 3K5OA 4DK6C 1SMYD 1LQBA 2N9PC 1S5ED 1F0ZA 2J0KA 2RHQB 3ZTCA 1L6VA 3TEHB 4REZA 1YEZA 3NEMA 1WMHA 3TEYA 1B44D 1RYJA 2A73B 4C3IH 4L1BA 1LUZA 4A75A 4LJPB 1ENFA 3H94A 2WDQB 3Q8EA 2CWPA 2W3SA 1UUPA 1D3ZA 2K5PA 1HR0Q 3VTVA 2E2JH 2BYTA 2LWPA 3CCJA 4KJOA 2N4FA 1IW7C 1JQ4A 3M3YB 2L9HA 1MI2A 4XYCA 2WWZA 3PRZA 4PYUA 3M4QA 4JPBW 5J1ZA 4JWSC 2EMTA 1JWSD 4IPCA 1K83H 4MSQB 2DENB 1B70B 3S2DH 1JB7A 2D62A 1KIXA 1UBIA 5EE0A 3LX0A 4A3LH 5M5WB 1HPCA 4ZRJA 4RG1A 1N34Q 3S1QH 4NDXA 3MTSA 3DVNU 4MHEA 4DN4M 1W2BA 3ULPA 1FGBD 2IJ0A 1Q46A 1QUQA 2ZT9C 1JJ2A 3HOZH 4CKEA 2JZPA 2WXHA 1UWVA 1WI0A 2GN5A 3DWQA 3MP9A 3FPPA 3PUZA 3KF8A 2X8XX 2Z6KA 3NZSA 1GM5A 3KQ4A 5EKLA 3I4MH 2KWDA 3NOBA 2A68C 3P75A 2MBOA 3PSEB 3CCRA 4NKLA 1MSGA 4PQXA 2D2QA 3MHZA 1QILA 1LTRD 1YNNC 1PUTA 4ITKA 2F0GA 3SVMA 1YOVB 1O80A 1JMCA 3NHHA 1JQYD 1V9PA 1X32A 4A3MH 4DGZA 2X6GA 1XMOQ 3AMUA 2KVRA 2ZCBA 2ZPYA 2MBQA 3P2BA 4JI2Q 1K8GA 5M3MG 1U4RA 2CCZA 1WX9A 5K36H 2HD5B 4DR1L 4JLCA 4BOZB 1VQGA 1V2YA 4EZLA 3D32A 4A8XC 2RHSB 2FNJB 3VH3B 1L2NA 4KIKA 1XLOA 4C00A 2CHWA 1TWFH 2EDGA 4KHPQ 3OPOA 2QHOA 5BYSA 1F9QA 2AYOB 3PLUA 3ZQ4A 2IYDB 2SEBD 4X66L 5JOBA 2DZJA 1PH7A 2NN6I 3UQBA 2ZXOA 4KSKC 1WD0A 1FRRA 3RD4A 4EOYA 4I65A 1QWYA 1EIGA 1O7ZA 4S3SA 4A3IG 1RF2D 3S1MB 1U4LA 2KC1A 2LFIA 5I2XA 3M7GA 3HRZC 2HJ8A 4EZJA 4CDDC 3WALA 1JB3A 2JRHA 4A3GG 2K6DB 3CC2A 2BB6A 1DYQA 5M9OA 2G3QB 3BY4B 3NTIA 4KHVA 4C3HH 3KYDD 1XWEA 4MNOA 3RUIB 2JXTA 1VQEA 4GN3B 5I6WA 4KZ0A 4YXDB 1OXVA 1TQOA 4GS3A 1L4DB 3AEFB 4XTCS 1K0SA 2D07B 2ZTCA 5FO7B 4H02A 3K7AB 2VQFQ 2A8VA 3HOWB 1WGRA 4XZ4A 2PMVA 4Q0FA 3A1QA 1PFMA 2NN6G 4RWSC 3D31A 3MEFA 2L00B 2NBWB 4BKSD 1D2BA 2B76B 3GTOH 3ZJUA 4NW2A 4FJYA 4CDEC 1WMHB 3U7DA 2QW7A 3NQTA 1RTOA 3NTHA 4BWGB 1SF0A 3AE2B 2GI9A 1LT6D 4GIVA 2K39A 4KLKA 5KGUA 3R3MA 2BS4B 1V49A 4F7ZA 1PH1A 1TR5A 4WFN3 3J81j 5C0XG 4JBMA 2MQHA 3UIPB 2CR5A 4CO7A 2F0HA 3W5VB 4DR2Q 4F1SA 2JYEA
chains in the Genus database with same CATH topology
1FCLA 1ESFA 1JR0D 3J7AV 1XF5L 5NUCA 1C77A 1SMYC 2BDNA 3TMEA 1FXIA 2EVBA 1HZ5A 5CORA 5E4WC 1RM6C 4HEA1 4X3TA 3BVMA 1QNUA 1JWMD 1IKMA 2NN6H 1EYDA 3L4PA 4G4KA 1JMLA 3TP5A 4CQNA 3I57A 4Z9CB 4XQJA 2W54A 1NR2A 5HG2A 1EY8A 2ICEC 4C56C 5C0XH 5DM63 4KD4A 2D5GA 2RQXA 4K2LA 1UAPA 3I73A 5JXVA 3OSOA 1D5XC 2ACZB 4FYDA 1EEFD 2N7JA 5D7GA 3TN2A 3L3OC 1VZ8A 3FILA 4TKOB 2F0IA 2ENBA 4KJNA 2H1EA 2RMMA 5H8YE 2YU9B 4RHSA 4J3OD 4IDIA 4U673 3W3AA 2EYMA 3TZDA 2WXOA 1TVXA 4ZKBB 1G2SA 4Q2JA 1LTID 5E3FA 5C5MA 3I4NB 3A55A 1LT3D 5M3FB 2NZ1D 2N9LA 5EE3A 2DYOA 1AEXA 4HEDA 1FEHA 3PIO3 4XE0A 1NENB 4TQ0A 3RLFA 2AQ1B 2CW0C 3Q23A 4RAUC 1PFNA 3P20A 1D1IA 2M0AA 1E0ZA 1GPXA 3NP8A 2IPKD 4CJ2C 1AYFA 1HEZE 4QIWB 1KRHA 4RGTA 5JVH3 4DAYA 4IUUA 2JSVX 3URYA 3BDOA 3DEOA 3BZDB 1LTAD 1TU2B 1PRTD 4MH8A 3NPPA 3W2DA 4YTPB 3K5NA 3FVQA 3JAME 3C3LA 1H9SB 5FOBB 2HTME 1KDAA 3TDQA 3T53B 1SYFA 3A7LA 3IFDA 4JK1C 1FMAD 3K5LA 3A8KE 2KMMA 1HRJA 4H13C 5COYA 2XVSA 1PGXA 1EU3A 1XX8A 1LTTD 4HCSA 3D8GA 2JA6B 4K8JA 2PZWA 1I4XA 4JE3B 5DNFA 1TS4A 3P4SB 1HQRD 3FILB 3GTKB 1CK1A 1Q90A 3A8JE 3B2FA 5AUKA 1HA5A 5DEHA 2KHSA 1F2ZA 2HDEA 2H89B 2FINB 3VR2A 2ONQA 2AUJD 3Q24A 2BCOA 4KKTA 4KHZA 2VZKD 4NJCA 1DXMA 3GTQB 3SFEB 5D3IB 4KY6A 1STEA 2HDLA 2XRQD 1PTOH 3IT4B 3U52E 5EPJA 1YN3A 3Q6SA 1TS2A 1WCMB 4X3UA 2JA7B 4C3JG 3HZXA 1FNWA 2F0NA 4MT5A 3SR1A 5D3DA 1E7PB 1EY7A 2SNMA 4H44C 4LK1C 2V4IB 4ZYSA 4DK0A 1FNUA 3VQIA 1ZOYB 1PDQA 3HS0C 2EKIA 4MACA 4B0MA 2F0WA 2BTEA 1VF5C 3SK5A 4HMJA 1CJEA 2WU2B 2Y5CA 3V96A 1EQVA 1C48A 2B2VA 1CTMA 2MJ8A 2EPBA 1C9FA 2E2IB 2EYFA 2KQ3A 1FNVA 1TWAB 1K53A 4BS9A 1Q10A 2B8GA 2J7ZA 1SNQA 2QDBA 1JE4A 1K51A 4M8AA 2E6XA 1WTRA 4FO2A 2WXKA 1P7EA 2KJXA 2WB1B 1BR9A 3MAQA 5I9PA 3P63A 3I9V1 1F77A 4J1MA 5HFYA 2JWUA 1HUMA 5C2TB 1GXDC 2RDFA 1I4QA 4HSVA 3E5SA 2BBCA 1AN8A 3GV3A 3HUIA 2V3PA 2Y3AA 1PYWD 1E2ZA 3NXWA 5KYIA 1F9PA 2N0SB 5HHDG 2F1MA 3C2PA 3NWSA 3GTGB 4DFAA 1OXSC 4DXFA 2L52A 3TEZA 5G3LF 1NEKB 4IUNA 3S2HB 5JPNC 2VXWA 1FFUA 1HTPA 1YJIA 2HDMA 3Q8FA 3T51B 3LB8C 3NVWA 1O78A 2WXJA 1SYEA 2KECA 2XWBB 3EA6A 2PTLA 2QMTA 2IGHA 2CVRA 1QF6A 4PNYA 1A70A 4DNRB 1II3A 3MXPA 4IALA 2NVQB 2WKDA 5EGTA 5G5HA 1DOLA 3OOCA 4C1NI 4D2KA 3KWLA 1KNEA 3TUOA 5C4JB 2F0PA 2NMQA 1PTOD 4IOIE 2JA8B 4RA8A 1ZP0B 3HP3A 4KMUC 5KNBA 2PO4A 5EPKA 1GB4A 4V190 1I4RA 3R8BA 2NWGA 4RGNA 1EWYC 1GHJA 5C4HA 3GS2A 1PDXA 2A74C 2E2DC 3CRKC 3HOXB 3P42A 2EYPA 1NUCA 4YSZB 2O5JC 5CGKA 2A6ED 2G9HD 1PLFA 2EY1A 2RDGA 4RKLA 2A5HA 3C1EA 1M4VA 2IX0A 3CHBD 4KGSA 4HMIA 3NRZA 4NAMA 1KTKA 1IW7D 5C6AA 3J80L 1R9TB 1LABA 2D2CC 1Z47A 3OHXC 4WWMA 3JAML 2M19A 3RPFC 1BO0A 3HEJA 2XSCA 4A9AA 1TYGB 1WTVA 5HI1A 2F0VA 3FMCA 3H8HA 1S5FD 4YSYB 1PXUA 4LLGM 1QJOA 4KKUA 4RCNA 3EGRA 1EIHA 2B2TA 4C3IB 2EZVA 5DM73 1Z7TA 5JEAJ 1B3AA 1G8ZD 2MH7A 2A68D 1J7BA 4F7XA 4US8A 4JPSA 2E2JB 4RNAA 1YNND 1MBYA 1EOTA 1KH0A 4G7OC 3VRAB 4ID6A 3N52A 4EGVA 4F88A 4QB4A 1WTXA 1K83B 5BN3A 1TS3A 3S2DB 4IN3A 1NCVA 3GTPB 2A69D 3S1QB 2FMCA 1I4GA 1ONLA 3T13A 4HTHA 3V3XA 3TEWA 1CQVA 4FF3A 1WYGA 3HOZB 1KF6B 2DNCA 1T5XD 2RVLA 2Q8IB 4H7BA 1JALA 1RWSA 4P16A 1EY4A 2PQEA 3I4MB 1V1OA 5ELDA 5C5LA 2QEJC 4ZUJA 1RDPD 2RA4A 2A6HD 4EQPA 4A3MB 3MJ5A 1IYVA 1MHHE 3ITPA 2WAQB 2B2UC 1FRDA 5M5XB 2NB0A 1Q8IA 1HZ6A 1SIJA 3WOEA 4FXCA 4NAWB 1TZOA 5G5GA 1TWFB 2WDVB 1PTOC 2WLBA 4CHTB 2FMMA 1PRTB 2PVOD 3QO2A 1STGA 3J7AF 4HRSA 5CYUA 2EELA 2PW7A 4C3HB 1KDBA 3MXUA 1WTQA 1G291 2JX5A 2K33A 3N6RA 3HVZA 2QF7A 3FPUB 4AQ7A 1JC7A 5E6JA 3A8IE 4A3KB 1O7YA 3BG3A 3PZ8A 2PMZB 3P4RB 3U4EG 4LTUA 4FF4A 1N62A 4ILWA 1BCPC 2K32A 3NQIA 4OGQC 4ULLA 2Y0SB 4YT0B 2EYOA 2PW5A 1B1ZA 5IODA 2KEDA 4HCEA 4HSPA 1QQRA 2I2YA 4C1NK 4TRDA 1LV9A 2B63B 3AU7A 1PFDA 1HCZA 4GDKB 2N9KA 3HG9A 1DJRD 4FNFA 1CI3M 1TY2A 1XCQL 2FBWB 1O7LA 5DAUA 2MEKA 4US9A 2JXMB 1V8QA 4K14A 3D3RA 1RD9D 3B9JA 2BDOA 1LTSD 4L2YA 5BMGA 2O5IC 3ONAB 1B50A 3CRLC 1HFNA 2N55A 2D9UA 2IDYA 2A69C 1TS5A 4BBSB 1V8CA 3K6OA 1STBA 3NVYA 1A15A 2L1AA 2EY2A 1Y1VB 2CHBD 3VR6A 1JORA 1VR9A 1SSOA 3W1SA 2BB5A 4XWWA 5CV4A 3K58A 2H88B 3SK6A 4NP5A 1VRAB 3K57A 3BK2A 2A6HC 2CW0D 1ZYRD 3EJIA 1R4PB 5JEAG 2Q8RE 5C0XI 2FJ2A 3OIPA 3AE8B 1KDCA 5EKIA 5ELFA 1YQ3B 1YNJC 2K22A 3KUPA 1JOQA 1JWBD 4P2CB 2SOBA 3LWEA 4OHJA 4QUFA 1BUIC 4AYBB 5JVG3 3TSSA 3AEGB 5K5PA 4RF0A 1L6UA 4O42A 2SDFA 1EFID 1WTPA 2KACA 4WIPA 3B2GA 1BUVT 1UGJA 1H9KA 5M5YB 2DNEA 1E9MA 5JEAH 1OXTA 4IFDJ 1FD7D 3E56A 4DQOC 3D4RA 2Z4IA 2BA1A 2B2WC 1LTBD 1H9SA 1GJXA 1STAA 2K05A 4PV1C 5LHY1 1ZDVA 1HQMC 3HOVB 2V4DA 1SYDA 2CU3A 2F0TA 2L83A 1EQTA 4O1NA 1AZQA 2B2YA 1F2LA 2WV6D 4C80A 2ICIA 3IL8A 1BBXC 3R2IA 3TZUA 1A3TA 1L4ZB 4HKZE 1IUEA 1A2TA 3BVGA 1NVID 4FXDA 2IT1A 4IQZA 5F2DA 1XLNA 1ENAA 4CJ0B 5KEEA 2JYOA 3H0GB 3BYTB 1IBXB 5IIFA 2SNSA 4KKJA 3WDNA 4ZQ3A 2J4XA 1DM0B 5E4XA 5CV5A 1MI0A 2ID0A 5JJZA 1FR3A 1F2RI 1PGBA 2MGSA 5FLXE 3V2TA 5AFWA 3NUCA 2OXPA 4ME5A 3IAM1 1PRTF 3P1MA 5KYLA 3T3OA 1DCZA 1OQQA 2Z4HA 1YN4A 3BDCA 1GUNA 3I72A 3Q8AA 4YSXB 5LL6S 3NUHB 1Q1BA 4BY7B 4M1UB 4RCOA 3D4WA 2KOLA 1PFBA 4XXEA 3PV0A 3FKIB 1MHXA 1ZYRC 1SE3A 4ZRQA 1SAPA 1ROEA 3EVQA 2LKVA 2PPBC 3AEEB 1DOMA 4RFBA 2EYHA 4CJ1B 1I6HB 4DA2A 1AFPA 3AEBB 5A2QE 4J6HA 2LJIA 1MGSA 3P4QB 1AZPA 2BS2B 4FP5D 1KNAA 1QOGA 4YWGG 3VYUA 1FO4A 3ZYYX 4FF2A 3R3OA 5EJWA 4EVOA 1YN5A 4BBRB 1ET9A 3U7ZA 1JOOA 2WXIA 2C5CA 1ILPA 1IHZA 1B53A 3OW7A 1HXYD 2DLBA 1BQQT 4TQUS 1HUNA 1FFVA 1Y8PB 2M00A 2HCCA 4A93B 1VF7A 2WU5B 3SDZA 1T3QA 3Q69A 3SE0A 1EYAA 3Q0AA 1XEEA 1TIID 3KLSX 4DXGA 2PVGC 1SJED 2L11A 3QIAA 2O4XA 2C9OA 1YQ4B 1GAQB 2PIAA 4MN3A 2QIEB 3GP7A 3AEDB 1SNOA 2MPMA 1CQFA 1SE4A 1WVLA 5J22A 2K28A 4IFDG 2EXZA 2F0LA 1E10A 4AS1A 5IGBA 1RFKA 1DOIA 1C4QA 1H9RA 2DY7A 2K3UA 5C3XA 2W3RA 1G91A 3VA5A 2JA5B 2YEPB 1PGAA 5C3WA 1SYBA 2E74C 2K0PA 1JOKA 1GUOA 1W6JA 2GA4B 4X3KA 3SK4A 4XIGS 2NVTB 1H9JA 1ZKOA 2JEAI 4JWUC 2WIIB 4N58A 4XYQA 3A54A 3DWAA 4ZHPA 2KUMA 1TWCB 1E2WA 1QG7A 2L12A 2XIWA 1VDZA 1JWUD 1TT2A 2X69A 2RPVA 3NWTA 1RJTA 2L55A 3SK8A 3T16A 5I9OA 2LFNA 1A6XA 1I4HA 1TKYA 3ND9A 4KKIA 2R7ZB 2R61A 2OF1A 1EZ8A 5EKKA 1FXAA 2FFKB 2NBFA 1EEID 1XXGA 3NZ3A 3E6ZX 2X38A 5EQ0A 4IKGA 3GTJB 3IXSA 2M9VA 1XO3A 2MJDA 3QOLA 1M8AA 3U9OA 2PYKA 2RDHA 2E76C 1KAAA 2D5DA 3FRPB 4ZRZA 5FKAC 3RZDB 3W9CB 1P7FA 2KA7A 3K59A 5CR3A 3SFDB 2H4OA 4R8NA 3EFXD 1ZUD2 3PUYA 3T56B 1KLGD 2K04A 5MPOA 2J0TD 1T6BX 3T4AC 2G9DA 3LWUA 3NVVA 5FLXL 2Q5WD 4USAA 1ZXIA 3PMFA 4L23A 2NVXB 2QKIC 4A6QA 3S15B 1QT9A 2JQRB 3AB9A 2OT2A 1DOXA 4CBVA 5FO8B 4XDXA 3GD7A 1L0YB 2OHFA 1R4QB 5J39A 3S14B 1STYA 2LUMA 1CZPA 3L7ZC 2EJMA 1LT5D 4B9XA 5BN5A 2V3NA 4QCLA 3AECB 3DWPA 4OZAA 1IYUA 1AWDA 1AP0A 4GZYC 1G6ZA 1D1KA 1SFOB 5A2QL 1BCPD 5BMIA 2K7VA 4KTAA 2KCCA 1SNCA 3M4YA 3J81E 3IT6B 3PO3B 1QOFA 5BYRA 1DONA 3D6CA 1ZEQX 2G1EA 5ELEA 1N60A 3H3VC 3AE4B 3KK7A 4XT3B 4H2AA 4ARCA 1TY0A 1GHKA 4CGYB 5EE9A 3W5UB 2EY5A 4ZK9B 4IURA 3DEPA 4G7HC 3SR6A 2WXMA 1HTLD 2XNAC 5IOCA 2DY8A 3S16B 4N6EB 4OVZA 2WXPA 4KN7C 1F2RC 3KBXA 1OFFA 4MIUA 2L4NA 1I7HA 4HR7B 3RZOB 4RH6A 1PMRA 3D4DA 2YEPF 4L8JA 1CZGA 5IT9E 3E0JA 1EY0A 2PZUA 4QF4A 3GO5A 5IGFA 2J53A 3PIP3 3UI2A 4OO1I 2Y5PA 3MFGA 3LYYA 1TWHB 4RGOS 1NYQA 3EQLC 3BS1A 1SDFA 3AB5A 2LMCA 3CQZB 1G2TA 1IGDA 1UWMA 1ILQA 5EBCA 4IUTA 1ZDXA 5LNK1 2ZXPA 1D6EC 1FYCA 2Z8LA 5LL6X 4OO1G 5CMDA 3C8YA 1YNJD 3TEXA 1D5ZC 2DN8A 2TSSA 4KY7A 4WH4A 2F0MA 3AE5B 4XQNA 3EUB2 2BW2A 1CZWA 1W6KA 2IGDA 3HRDD 3AH7A 2I46A 2RSNA 1DD2A 4ZUIA 4RGMA 2JYTA 2WXLA 1PZID 4C3IG 2W55A 1ZXHA 1NAPA 1BXTA 4XDDA 1SBBB 4KV6A 1QE6A 2AWOA 2K5QA 5I6YA 1VLBA 5C3JB 4IUPA 5KNCA 1SYGA 2EJGC 4UDUC 5M3MB 2WXNA 3MA2B 5FO9B 3IFTA 3GTOB 1VMCA 2RBMA 5CBAE 4OO1H 3HKZB 2OEOA 3X3MA 4KN4C 2EYLA 4IUVA 1E6EB 5AUIA 3HGBA 1SNMA 2F0QA 4KGRA 1WD1A 1C4AA 2MJEA 2F0UA 1QCBD 1VCIA 5BMHA 1BF4A 1V1PA 4A3IB 3ZJTA 1SYCA 2M2LA 3KLSA 3GTLB 2BE5C 5CV9A 5T8IA 4A3GB 3VR3A 3CKIB 1WGKA 2QJLA 5IGEA 2MP1A 5K36G 4DNTB 1QB5D 5ELBA 2VZKB 3MC0B 3I8ZA 1VDVA 4PT5A 1FIQA 2B2YC 3P7JA 4F8MA 3VYTA 1AW7A 1GOZA 3VA7A 3EROA 2LMCB 1H9MA 2F0SA 1C76A 4ZRPA 3S1RB 2MJ3A 3IAYA 4L6TB 4K8IA 1J9OA 2IW3A 4N9PA 4WORA 1NI3A 2WXFA 1A3VA 4XT1B 3VR4A 4CKBA 2VUMB 1RHPA 3N9YC 2RKSA 1N61A 4C3HG 2WXQA 1Z6HA 1IBXA 4K5XA 4DK1A 2AX5A 2JEBI 2K9XA 2AQ2B 2MUYA 3OWFA 2EOTA 4LAAA 2EY6A 2SAKA 2WACA 2PLPA 4RHRA 3DWGC 2B2UA 2KDMA 3GQBA 2XWJB 2XRSD 2INNE 1KLUD 1QOAA 3C46A 2B8FA 1WRIA 4WJWA 4K5VA 4QMGA 3S1NB 2KAJA 4PMWA 4BA2I 4PMCA 4TSSA 1JWAD 1K8OA 1K8MA 2IL8A 3H09A 2K03A 3FAHA 3I90A 1J7AA 3NVZA 3ND8A 3FEWX 4U68A 2XN9C 1F9RA 1F2YA 1I3QB 4KD3A 1DOYA 3VR5A 2F0JA 4TMAB 1V1PB 2L0CA 3DM1A 3I4LA 3T3NA 1SSNA 2ON8A 4RF1A 1B4OA 3SEBA 3NBIA 1CM9A 3QOJA 5CBEE 1OO9B 5EBDA 3RFZB 3OMGA 1YJJA 3J81L 1LLRD 3KWVA 1ET6A 3OMCA 2KN4A 1BDOA 2QILA 3MVVA 5T1GA 2CJOA 4XWTA 4C7ZA 3IKJA 4HN7A 3AM9A 3K0YA 3VYRA 3AN1A 3I91A 2JE6I 2Z1CA 2L32A 2WP9B 2HCIA 4Y7NB 2M56B 2FE8A 1XLQA 3QB3A 1TKWB 2Q8TA 3GV6A 1WWTA 1WTOA 1HHVA 1RKNA 2EYJA 1B2TA 2LHDA 1GUSA 3H91A 4KY5A 4UAIA 1N5XA 1EWHA 3C1FA 1L0XB 5FR3A 3HOUB 3HVDA 4KI0A 5HGTA 1ESRA 5IT9L 1ZPSA 2KQ4X 3TP8A 3AE6B 3X3NA 1TKGA 3ETRA 1Q12A 1STHA 1IGCA 2WP8J 1ICWA 3BVZA 1V97A 2FUG1 4PMBA 4E6IA 4F87A 1PTOB 2ZXRA 3AE7B 1J7CA 2VNUD 1KABA 5TSSA 1EL0A 2ZW0A 2WXGA 1CT1D 1B9RA 5I2YA 1E2VA 4K6DA 1VMPA 1PZKD 1JROA 1ZE3D 3SHLA 3L9AX 2R92B 2MHVA 4C2MB 1UEAB 3P4PB 4I7ZC 3H6MA 3ZJVA 3VR8B 4QUCA 2R6GA 2WKCA 1S4ZA 4A3FB 3MFYA 5C44B 1DGJA 1NR4A 4YIJA 5JAVA 3Q22A 2I38A 2WQYB 4ZHOA 1LO5D 2LY7A 3GB1A 2I07B 3J9CA 4G57A 2B2VC 1BCPB 4WURA 3M7NA 1YNTE 1LACA 3I3CA 2WDRB 2F0EA 3AE9B 3S9WA 2LGIA 2HUGA 2KVMA 3CU7A 4C3JB 2LS01 4NMZA 5C4ZA 1WXQA 3WOFA 5IGGA 4K6LA 3MZ5A 3D6WA 4G7ZC 3BYYB 1BNZA 1Y8NB 1Y56A 3J80E 1I50B 2PCFB 2WNMA 4IZ8A 1VZ7A 1YMHE 2B2WA 2JSOA 4V0BA 3MHBA 3NK9A 4R3DA 3KBGA 1HA6A 3MXNA 4EE2A 4BY1B 4XQQA 3J7YW 2VB3X 2E2HB 3TP7A 4FXKC 2KCNA 4IFDI 3PUWA 2K01A 2K5DA 1OXUA 1RODA 1ACCA 4ZLTF 1QLBB 5I4DA 3ERQA 1FD6A 3Q8CA 1X3PA 1VZ6A 2WINB 3GTMB 5CC4A 4GLSC 1VJKA 5GXGB 4R9WA 3PUXA 2F0DA 1E0BA 1N63A 1R7SA 1CA5A 2BT6A 2DWQA 1JW9D 1OXXK 3F2UA 4YTMB 1C78A 1QOHA 2PNRC 3S17B 2WS3B 1EWCA 1I6VC 4EQNA 3RMHA 2JP1A 2F03A 1L5PA 1GUTA 5C4XB 4WAFA 3U9SA 4M0WA 5C3EB 3M4OB 4FF1A 1EM7A 1NSNS 4HROA 4LJZC 2AUKA 1B9MA 5CV8A 1UWXA 1EY6A 5KRUA 1NYRA 5CV6A 2W82A 1F9SA 1SNPA 4IFDH 2R3ZA 1JCKB 1ML0D 5KIXA 5FK9C 4YTNB 2TMPA 1IKLA 2PZTA 1F2MA 4B9WA 3BK1A 2F0KA 1SEBD 3AV8A 2EE1A 1XLPA 3PZ7A 2N88A 5IGDA 2PKOA 1ENCA 4FXGC 4ARIA 2ZW1A 2X6LA 4A3EB 3SXHA 1A3UA 3QWNA 3K5MA 1GB1A 2F0OA 1PRTC 3IAS1 2JU6X 4DAVA 2WXRA 1D4BA 1JICA 1C79A 5T1IA 3VRBB 4ZAIA 4X3SA 5ELCA 2IGGA 4OZBA 3OWEB 1EU4A 3KLRA 1CHQD 2GB1A 1A2UA 3G6JB 3MWYW 1TJEA 4OIKA 4BA1I 2NVYB 3TBIB 5KNDA 2B2TC 4EQOA 1PTOF 1CA6A 3PO0A 2F3VA 2NUCA 2L1BA 2AWNA 1Q3LA 1Y69U 4ZOHC 1T5EA 3LNNA 1SB3C 1C4CA 4DF7A 4ABNA 3O13A 3ABVB 1XTCD 3I70A 1PZJD 4B0EA 1DZ1A 4XDCA 2GRIA 3AE1B 3E9SA 3DWMA 3FDTA 1B9NA 4WRDA 5ISRA 1RCVD 1LT4D 5CV7A 2EJFC 3A56A 2J42A 2YYZA 1XCTL 1S5BD 1ZXTA 2OEDA 1QNKA 3BDLA 4Q5VA 1BCPF 2NTTA 3MEHA 4ZKCB 1K52A 5G3LD 4RKBA 4KGTA 1SNDA 1CHPD 5BN4A 1XYIA 2B39A 3P1HA 1CFMA 3FC4A 3U2SC 1EYCA 4HKQA 3CWIA 1Q1EA 3QJYA 5EE1A 4A55A 3BIID 5EPLA 4DAPA 2J52A 3NTKA 4NZLB 3MXGA 3UI3A 1J8IA 4XYOA 4KX6B 1WSPA 2HQEA 2IX3A 4JX1C 2VB2X 3QG1A 4IUQA 3PO2B 2L5TA 1QKZA 2K6AA 4H0LC 4WQMA 2R93B 3NBHA 2E3TA 3CIRB 4HJGE 4N59A 4C7YA 5IGCA 2V0GA 1D5MC 1L0VB 1DOKA 1I4PA 1MVKA 2QSDA 1Y1WB 3DMUA 1FM0D 1BMLC 3Q8BA 1RTNA 2BE5D 3BWUD 1MPEA 2K5WA 1WTWA 4N9TA 1GUGA 2F4IA 4J8QA 2K1BA 1V43A 5JPMC 3RUZA 1TKEA 5D65A 3DXJC 4A3JB 2LEKA 1IL8A 5HURA 4KKSA 4A90A 1C8CA 1U4MA 1SJHD 2KEEA 3A7AB 1SE2A 1MD2D 2DYMA 5H92C 4CKCA 4TQ1A 3M85A 1EY9A 2F3WA 1TWGB 2NTSA 2IWHA 1QOBA 3ZGZA 3VR9B 1HFGA 3OIQA 3VYSA 1OQRA 1EY5A 1BOSA 1X3QA 4DU9A 1S5CD 3DHQA 3PUVA 4OL7A 2NYZD 4OIJA 2BS3B 4FVMA 3WCQA 2E75C 4A3DB 1U4PA 5A35A 2F0FA 2GI9A 5C0XJ 1K50A 2FHTA 3G7LA 1FCCC 2CQAA 2INPE 2O2LD 4A3BB 4JBWA 2LHEA 2BOSA 4KK7A 2DBYA 3TP6A 3V05A 4GDLB 3HOYB 5E1FA 1Y8OB 5BYQA 2IX1A 3AE3B 2AQ3B 3NS1A 1N5WA 3NE5B 1KFYB 1SXTA 1GUWA 3AMZA 4MM3B 3LXFA 4OW0A 4R8IA 2BA0A 4ODGA 2QCPX 2PW9A 4HAEA 2CJNA 1MSHA 4K5WA 1S5DD 1LTGD 3DUZA 1UNSA 5D14A 1EZ6A 4B08A 2RSOA 4L63B 1U9RA 4P6VF 4LMQD 1JRPA 3NSWA 4LK0M 4K2KA 3R93A 1STNA 3AEAB 1C4PA 4OZCA 2A6EC 3R2TA 3K5OA 1F0ZA 1SMYD 1S5ED 1L6VA 4REZA 3TEYA 1B44D 1RYJA 2A73B 4L1BA 1ENFA 3H94A 2WDQB 3Q8EA 2W3SA 1UUPA 2K5PA 2BYTA 4KJOA 1IW7C 1JQ4A 3M3YB 2L9HA 1MI2A 5J1ZA 4JWSC 1JWSD 5EE0A 2D62A 3LX0A 5M5WB 1HPCA 4NDXA 3MTSA 4MHEA 4DN4M 1FGBD 2IJ0A 2WXHA 2ZT9C 2JZPA 4CKEA 3DWQA 3MP9A 3FPPA 3PUZA 3KF8A 3KQ4A 5EKLA 2KWDA 2A68C 3P75A 4NKLA 1MSGA 4PQXA 3MHZA 1QILA 1LTRD 1YNNC 1PUTA 4ITKA 2F0GA 3SVMA 1O80A 3NHHA 1JQYD 1X32A 3AMUA 4DGZA 2X6GA