4RGNB

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
213
Chain Sequence
EVNLIESGGDLVKPGGSLKLSCATSGFTFSAYGLSWVRQTPERRLEWVASISGGGSVYYPDSVKGRFTISRDTAGDILFLQMNSLRSEDSAIYYCVRDLYGDYVGRYAYWGQGTLVIVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 44
structure length 213
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnB01
3L95B 1FIGL 2LTQC 5F89A 3QFJA 3MGOA 3SBWC 2J8HA 2D4FA 2ED8A 5C0JB 3QUMH 3KG5A 1D5MB 4XCEA 5L8JB 1A7PH 4JO2H 2UY6A 3U4AA 5AZEH 2AQ2A 1F97A 1MHPH 4RIRA 5HSFA 4Z78A 2DLHA 2NXZB 3GM8A 3RVXC 2VXSH 3QO1A 3MJ9A 3FFCB 4QYOA 3X3GL 3SDAD 2DMCA 3FT2B 1N4XL 2DI8A 4HKZB 4UAOC 3OMZA 4LLMB 5IB4A 4FQLL 3U1SH 4H0GA 2IADB 1YMME 4CVXA 3K80A 5AWNH 1RVFL 1H3UA 2VDQH 4PJHB 4TSAL 1DN2A 1K5NA 5ERWB 1FFNA 4Y19B 1X4YA 1FNEB 2VC2L 2OK0H 1RUKH 2UWEB 5CEZH 3X3FL 3O9WB 1LP9F 4MNQB 4NWTL 1RZJC 1OTUD 3V6FB 1UKSA 5K9JL 3I3EA 1EFXD 1RZIB 3U82B 4X7EC 5FM4A 1EUUA 2X4UA 1Q1JL 4HLZH 1ZEAH 2BSRB 1F11A 1JJUA 3PG2A 3T2NL 4HIEB 3BKCL 1PDKA 4POYA 4A6YL 3MLSL 3K8LA 3I84A 1LDPL 4YGVB 5LGHL 4OLUH 5CWSA 1A8JH 4TUJA 2VIRB 5DMIH 4IHOA 3KJ4C 2E7CA 4HEME 3S88H 4MD4A 4HLZG 5HDOA 2QQNL 3A6BL 4X7SL 3MNVB 1EVUA 1P84J 2HJFB 1KEGL 5E1AB 5ID0A 1U95A 1OGAA 5C08D 3D0VB 2DI7A 3KS0J 5KANG 4U1SA 3TYGH 3JVGC 2EYRA 4YWGL 1LD9A 4MXQC 1L6ZA 2A6IB 4P5KB 2DLTA 1OAZL 3VXUA 1V05A 2CLRB 3T1FA 4CVZB 3JWDC 4NNPH 1YJDC 2EE3A 3WIFB 4ENEC 4DZ8A 3QUZD 1AQDA 1U8OA 4LFHG 1PY4A 1E6OH 3FCTA 4PY8J 5HYSA 3QXTA 1HH9B 1MVFA 5F3BA 4K94L 3PWNA 2NY0B 3W11C 4ZFFA 1IM3A 1OW0C 4URTB 1QBLH 1NFDF 4UT7L 3IFPB 4CMHB 1BJ1H 3B6SA 5D1ZA 2OP4H 3NACL 1YEGL 2IPTH 3KPRD 3C5ZC 3FONB 3SPVA 1XIWD 5J1TC 5JOPD 4XVSL 3X13B 1RI8A 5HD8C 1F13A 4Y4HB 3VD4A 4F7EA 1EJOL 25C8L 5DJDB 1VEMA 1S7QA 3QI9A 1MJJA 3ALXA 4OUOA 3T0WA 1B6UA 3NZHL 4Q6IB 2I07B 4MMXC 4KJPC 3LZFH 2YBRB 1MQKL 1Z5LA 3GMOA 2AGJL 1FZJA 4M48H 4NPYA 1MCSA 3M17A 2F53E 5D7JB 2EDFA 3QDGB 1NGXA 1MCEA 4J3OC 4OZGE 4RFOH 1DQJA 4XMLL 3ULUL 3VGFA 4QXGH 4PG2C 4YDKL 4ZFOL 1QLEH 1G6RA 5C0FB 3D3VB 2OSLB 3V9FA 4Z8FH 1G9MC 1VFAB 4OCWL 4L3AA 3B5GA 2R8SL 1N2RA 4ISVA 1L9MA 1PLGH 4XNXH 4FQXD 3NIDE 2YD5A 4F33B 1FL5B 4G8FB 1J05A 5IIEB 4GBXB 1G9NH 3FHQA 5FA3B 5HGBA 1JV5B 3ELAT 4HMCA 5MEOB 4OV5B 4JKLA 1P9MC 2IAND 5GS1A 3GUTB 1TQCC 3QRFM 4LLVB 5BVPL 3O6FD 2QBWA 3CSYB 3WDIA 3G6JA 5CEZL 4DAGH 4NDMA 3SKMA 2YPVL 2YZ8A 2WIIB 5CCKH 3OXSA 5E1HB 4DKAA 3NMEA 1G7JB 3KPLB 4OFDA 5C0ND 5I1GL 3VXRB 3H3KA 5HI5C 1S3KH 1H3VA 2NCMA 5D8JL 1UA6L 5ICXB 4MDJB 3Q1SL 4OF8A 3VGAB 3KXFE 3NAAL 3N9GH 3EJYD 2VZ3A 3GBML 3SGJC 2NTFB 2UVFA 3BYTA 3FB7B 1L9NA 2WINA 1MPAH 4HW6A 2F5AH 1I4FB 2VMFA 5BW7C 4F7MA 2GITA 5HHQB 1J9CT 4UT9H 5F96H 1KLUB 3BRGC 3LKOA 1K4CB 2O5XL 5DURD 1GXEA 3QXAB 4F7CB 2H2SC 2G9HA 1HOCA 4HUUA 4ZPTB 1GGTA 2V2WA 3T0ED 1G7HA 3F12A 4PRIA 3QFDA 4KK9C 3GSUA 3GIVA 5HHMD 2ED9A 5J7CC 5TQ2H 5EZIL 1A6WL 4WGVB 1TJIL 2VERN 4XPGH 4MAYD 2X09A 3SE9L 4ONHB 3UJJL 2PYEB 5FOJA 4PJ7A 1CZ8H 1NAMA 5IMMA 1OQXA 4AENA 3CZFB 2AEQL 3FOMA 1CBVL 5GS3A 5I76A 3SEPA 3S5LB 2P24B 2X1XR 1CFVL 2QSCH 3BPNC 2FJGB 4NFCA 1MWAA 1VHPA 4OLVL 3OKNB 5CSGA 3CLEH 5IEKA 4OZIF 3WD5H 1S5IH 2X4OB 5E99H 3DI2B 3PIQB 2OS7A 2C5DC 3VXPB 3MLVL 1DN0B 2VL5B 2WBKA 4PJBE 4P5MB 4LF3A 4KK8D 3BMWA 2V7HB 1SJEB 1LNUB 4HIJA 4HS8H 2YRPA 1AGEB 1REIA 3FTGA 4P2RB 3HC0A 1NCCL 3OQ3B 5H37H 4G42B 3T8XB 4JQIL 3ARXA 1IGTA 3OB0H 3H9ZA 43CAA 4CKVX 3GSOB 3REVB 5LBSL 4QHLB 3UTSA 3K81A 4WCYH 3QUXD 15C8L 4R4BB 4YR6B 3DRTB 5EUKA 3BVNA 1QQDB 2NTSP 4GMTH 4Z7WE 5JW4Q 1LQSR 5GSVB 4XNZC 5I1IL 2OJEA 2QSQA 3S97C 5C07E 2J4WL 4QXGL 1TLKA 1IL1B 5H37G 1TITA 1AY1L 3HE6A 3MLTB 3HPJA 1MH5B 4R0LC 1AXSA 5I66B 3ARBD 1MFBL 2WWMC 3HLAA 1FV1B 3LIZH 4E41B 1ZVHA 4DKEH 5CD5D 1PLGL 3OR7B 5L2KE 1CR9H 1E4XH 2HFFB 3UYPA 5FV1L 1LP9A 4PS4L 3EO0A 3PXHA 4PJEB 4TPRH 4LCWD 3DGGB 1FG2B 5DI8B 3DURA 2IAMD 4JO4L 5CCKL 5HHPA 2HAZA 5DC4B 2MQCA 3KLHD 5BVJB 3B5HA 3GSRA 3OKLA 4Y5VA 1NBVH 3TO4D 1HILB 1QD0A 3JTTA 1DVFA 5AAWA 1Q9LB 2R56H 5FB8B 1NC4A 2HN7B 5EUOF 3WXWL 4PP2A 1BFOB 3FHAA 4NJ9L 4UDUB 5E03A 1EO7A 4EN3C 2F5AL 1GZPA 4OCLC 4IRJA 5DQJA 2ZSWA 1IZKA 4M6OH 3OHXB 2XPGB 3HZYA 4XNYH 4YXHL 4DGIH 1Z9MA 1JZ8A 1NUDA 5DJCB 3GO1H 1MJ8L 5CIPA 1OHQA 4LDLB 4NQXA 4WI9A 5MP6L 4WW1B 3MFFB 4ELKA 4LLWA 3EKCA 4WI2A 3HZKB 4X4ME 4KI5D 2PW2A 2X4PA 4RWHA 1BLNB 1SHMA 3O2VH 5EFIA 4Z77B 3BEVB 3TT3H 3IDIB 5EOTA 4ZUUA 1NFDA 2R2HB 4U05A 5J57B 3MJ8B 4GQPH 3T4AA 3DSFH 3I3BA 4P2OC 1AP2B 5D96C 5JHDE 5TQ0L 3QUKA 1GC1L 3AC0A 4B41A 3G5XB 3WIIH 3VJ6B 1OCWL 4OBSA 4QXUL 4F57L 2RGSA 2X4NB 1N6UA 2Z4QA 3UZEA 4Y16A 4AG4H 2NW3A 3PWPB 4WNQA 2F19L 2FIKA 4XPTL 1JN6A 2Q8BL 5F1IB 4Q2ZA 2OL3L 2DQDL 1LO2L 1CU4L 5GGUA 2MQ0A 1KB5L 5DFVD 5HYQB 4R4FL 4ZO8A 3L3KA 4LLYA 1IBGH 3P3YA 1GGIH 1OVZA 2YXMA 5EB9A 4YHLL 2H1PL 3L3OB 2QHRH 4F7TA 3SE3A 2VLKD 3EOTH 4NQDA 3NCEB 1P84K 3LKPB 5I30H 1RZ8B 3TH2T 3LEXB 5IKCA 1SJXA 3CIQA 4J1UA 4P3CH 1C08A 3NCJL 4JRXB 3O0RL 3O3EB 1ORQA 5T3ZD 1OAXL 4NO0D 3VFSB 1FFPB 1IGYB 4GG6B 1B0RA 1I1YB 1HCVA 4BUGA 1HKLH 3O8XD 4YHYB 1ZVSA 1GIGL 3FRPA 2DJ4A 1TTUA 3MXVL 1QLFB 4YDIH 5I75B 3HZVB 4HBQA 1V5JA 5ANME 4KJYA 2YS4A 1S7SB 4OD2B 5F88B 2Z35B 3GKZA 1I8LA 3MRGB 4X80H 1A14L 2I9LB 4YC2C 4JVPA 5K9QI 3ZKMC 4GKNA 4K3HA 1R5IB 4XB7A 3L9RB 3CNKA 5IP4A 3IU3B 4R7NA 5DZLA 2JJWA 3FAWA 4ZFGH 1IAKA 2R0KL 1BIIB 2ORBH 1FDLH 4QOKB 1QACA 1P4IH 4KMTL 2AJVL 2HTLC 3V6OE 4GAGH 4QRSB 4HUWB 4GKZA 5FA4A 1MCRA 1VB9A 3RIFK 4M8QA 5A16A 1YEFL 3BGMA 2FD6H 3MROB 3WJJA 2ZUXA 1HEZA 2Z9TA 5I19L 1YN6A 3GNMH 2P8PB 4X99A 5I74B 4OI9A 5E5RB 1HHJB 1MRCH 3IJHA 1N5YL 1D5IH 4DGIL 4LSQH 5IHLB 3BT2H 4I48B 1LK2A 3QZWA 3VGAC 4GMSL 1KEML 3DVGA 3IXAA 2Q8AL 3LMJL 4YHNB 2MKWA 5IB3A 1QBML 1UH2A 3BAEL 3PWVB 4G6KL 1A6AB 3D85B 1RULL 4OZHB 2FIRT 1BAFL 1DEEB 4OZIA 2FR4B 3BQUB 1BFVH 5C07B 2UYLA 4B7IA 4UOW1 4PJXE 4IIQA 4DFIA 4U1LA 1CQKA 4WRLA 2DAVA 1INDH 4QTHA 1HH6A 4FQPA 3ZE0E 3T3PE 3FQRB 4XBPA 3VRLE 4XAKE 4JO3H 3DVNA 4FQJL 4P2QE 3UTZA 5E6IC 1M1SA 3N1QC 1BREA 4XP1H 3ARFB 2VQ1B 4LVNC 3OKEB 5FCUL 4EEEA 1ZLVH 5DVMA 4JG1L 3X11A 4FFZL 2MKLC 3C8KB 1OTTC 3Q6FB 4GOSA 4PBVC 4L8SC 2X89D 4YUEH 5T1DL 1HQ4B 4LOUD 3CDYA 1T5WA 1HWHB 2ICEB 3NN8B 4MCZA 4JVWA 3W82A 5I16A 5JO5B 2MPAL 5DD3H 1MAKA 1DJSA 2FX9H 5CD3A 1UENA 3LHPH 1H8OA 3KR3L 2EDXA 3VDAA 3K2MC 2P8LA 1KF9B 3RZCA 4RMWA 3ROOA 1KC5L 1OAKH 5LCVH 5J56B 1JNLL 4WFFD 5IFAH 3SDDC 1RIUL 2ITCA 4JHAH 5ILTH 3S36L 1G9NC 3VWKC 5ALCH 4U0RC 2VR4A 2B20A 3KLAA 4RBPH 3F65A 4HC1L 5BRZA 1ADQL 2ZPKL 4L4VD 2HRPL 3T09A 4X4YB 4MJ6B 4F2MA 3QEGH 4PRPD 3CH1B 3IF1A 1RZKH 1TPXC 2CIKA 3MA9H 3D25A 4N8VB 4LP4A 1A1NB 5E8OA 2CKBH 1T1XB 3BE1H 4KPHL 1PZ5B 3CPLB 3VD5A 3ILPA 1HHIA 2HRLA 4KKNA 4LSTL 3RZWA 4MB3A 3RNQB 2YC1A 2BRQA 2AK4D 1ZA6B 3MRRB 1JIBA 5IW1B 2K7QA 4Y4KA 3DO7B 4EI5C 1FSKB 5I1KH 4CMMB 3H9HA 4XRCA 4MXVE 3WNLA 1WEJL 1U3YA 3JV4B 2NX5B 5EUOA 3ZT7A 4TNVF 4PRHA 3TWCL 3PWJA 5T1LA 2YA1A 3I75A 1PZUB 1G6VK 4ONGL 1LEKB 2KBGA 1DBKH 4Y4FA 2VZSA 4PJIF 3VXSA 1EGJA 2W65A 5GGTA 3M1BB 5ETUB 4R8WL 3SCMC 3WLWD 5DLMH 5CJXA 3TN0A 1X5GA 1FQ9C 3LRSB 5EDXA 3VDBA 2BXZA 2AJZB 5ISZB 3DXAA 3DO3A 3DX7B 2D31A 2DD8H 4H25A 2IGFH 5EWIL 1VESA 2GSGA 2W9DH 1UJ3B 4NOBA 1T0MA 1U58A 2F5BL 1QRND 3GI8H 1WZLA 4JFED 4JFFA 2F8VA 1U8NA 3MRMA 4NCC2 1YY8B 5TDPA 5GGSY 4ZAKA 3WO4B 4P4RA 1Y0LB 1XGUA 2EDDA 3SOBH 4POZC 2ZCHH 3BIKB 1CDHA 3GSWB 1W8OA 3V0WH 3CXDL 3VWJD 1EXUA 1N8ZA 2E7LA 1P4LA 2Z31A 1IQWH 3TNMA 2I60L 4PJ8B 4UTBH 5J1SC 3G6AA 2D9CA 1DR9A 3VXTB 2BXYA 4YZFE 1AHWC 4DTGH 3I50H 5J12B 1PEZA 3DIFA 5FYJU 3F7PC 1JNNL 5T1KD 1DBAH 4Y1AA 3TA3B 4K71C 1NGQH 5FM8A 3TF7C 1CICC 5AYUL 4Q7DA 4NGHL 2NY6D 2BFVL 1UADC 5F1NB 4NRXB 3LV3B 1RZ7H 2UUDH 3DVIA 4L4TA 4LNVA 1A2YB 1YEIH 5C0IA 3KDMB 3ZDYE 1FNFA 1CTOA 1TZGH 2XOTA 1PD6A 1KTDB 4TTDC 1K8IB 5C9JA 2V5RA 2EDLA 3QJFB 4WWKB 4MNGA 3KPSE 2A6JA 1RU9H 3T0VA 4CNIB 5D1QA 2QSVA 1NGWA 1Y6NR 4PGEB 4PJ9A 2XNAA 5ILTL 3MLYH 1DFBH 4PYHA 4MS8D 1BVKB 5EO0A 5KSBF 5F1SA 4WO4A 1K2DB 5AUMB 1IC4H 5DHVB 1WWAX 4CW1B 3C08H 5EPMA 2V17H 4D0DA 2OBGA 3WE6A 3WS6C 4MJ4A 1RIVH 3L3HA 2AABL 5JLZB 3QXDB 1M7DA 2CLVA 1M7IB 1FBIL 3U30C 1VGEH 3BPLC 1KJ3H 4X6DF 5C0CE 1K85A 2DQCL 4Q9QL 3GMNB 3Q5YA 5EU6E 3RKDD 1K4DB 4BH8B 5I1KL 1J7VR 5F7KC 1AGBA 1HNGA 5JA9A 3MLRH 1FL6A 1FO0H 3BN9C 3MA7B 4HWUA 3TVMA 3UBXA 1QUNA 3IETB 1UKQA 2AXGA 1T0NB 3MJ9L 4X6CF 4PJXB 4K9EL 1D6VH 4JFZL 1LEGA 2A9NL 1CDCA 4U6HB 1UB6A 3FO2B 3ZYIA 3R0MA 4AIZA 3GRWA 1KLFA 5DLML 4UIMA 4OSUH 5A3IC 1W72A 3LS5L 4P2QB 2A0LC 2ADIB 2GCYB 2HG5A 3QQ3A 3DWTA 4NRYB 3P4OA 4W68A 1N5AA 2NXYD 4HF5H 3V5DB 5D6CA 1AO7D 4C55A 4XAWH 4MZ3A 3FB5B 3VFNB 1H15A 5CJOL 1F4AA 2J12B 2DL9A 1NLDH 4OGAC 5BJTB 3O6LH 1SEBA 1S9WB 2WQRA 5E2UL 4QRPB 2C3WA 2K9UA 1F3RB 3VXMB 3DROA 3BP7B 1KYOK 2H2PD 4FXLA 3PNWA 3L95A 5TGBB 3ZL4H 5TFSH 1IGFL 3MBEA 1E28B 3QQNA 2PXYB 1CT8B 2W9EH 1IGIH 2LQRA 4WEMB 4I3SL 1KN4H 1UQSA 5D5MF 5D9SA 3QI9D 1UXSA 2IQAB 5CBEA 1Q9OB 3FFCA 4YXLH 4YEFA 3QIUB 1UWEL 3AS0A 2C26A 5IM7A 4WIQA 1MNUL 2R23A 3AU1A 4HKZA 1EA9C 2H8PB 4XMKH 4MA1B 4HKBA 1PG7W 5IEHA 4PJHA 3NGBC 2VN7A 3PQYB 4ERSH 5JW5B 2Y7QA 3MXWH 5D2NB 4P2YA 3LH2H 4I9WD 3R0NA 2UWEA 2YMXH 1I85A 2PYFA 3MRKA 4PRDB 5JXEC 2Y6SD 3HNSH 1NBYB 5TPWH 2DOCA 4FQQB 2BSRA 3T1WA 1QYGL 4S1QH 4OCSL 3IDMA 1XAUA 3LEVL 3Q6GH 5IBUB 2NPLX 3QG6A 5M94B 1NGPL 4Z7UF 4NO3A 3VG9C 4WFED 4CU7A 3BDXA 2VAAB 3L3DB 5I8OH 2AVGA 3VFGH 5JHLL 4YFDB 1GGYA 3PDGA 1LE9B 3TIDA 2VIRA 3LY6A 3MRPA 3O3AA 2BY1A 2HT2D 2IFGA 5DK0B 4XVJH 1XGPA 1CGUA 4ZXBA 3MNVA 5JZ7D 5J3HC 4J4PA 5DDHA 2HJFA 2H26B 3I6KB 1NDGA 3MLXH 1KCKA 4Z5RA 1T7YA 2BJMH 4IOIA 3VFTB 1N6VA 5HHNB 5C0AB 1JCKA 1TTFA 3KHQA 3RVTC 1H5BC 2JB6B 1HINL 2XG4A 1KG0A 1BQUA 3GSVB 4PJIA 4XNQB 1G6RL 1CXLA 4N1HB 5D1XC 4HPYH 4F7PA 3VXQB 1KPRB 4K3GA 3BP4B 5FYKU 1KCUL 5C2BL 3EFDH 1CGTA 3IFLH 4HWBH 3MUY1 5I1JL 3DSNA 1SEQL 2HWZL 3ZTJH 4JZJC 1T5XA 5KSAB 3NIGF 1FYTB 3FT4A 1JF5A 3FONA 1SJHB 4K2UL 1WF5A 2O61A 2XYCA 1FN4B 5CZXD 5KW9H 1OL0A 3KYMB 5EOQL 3MV01 1L0XA 3STLB 1MF2H 4Z7VB 5DJDA 4ODTL 4KVNH 4MJ5B 3RAJL 3ZTJG 1OARH 3WLBB 1ZWIB 4JFYB 1JYVA 2H9GB 1KJ2B 2IF7A 2CLZB 3TO2B 1CVSC 4PY8I 5IVXF 3FQNB 4LAQH 2J6EA 4UUJA 1X5IA 4D9LH 2DRUA 4IJ3C 4DCQB 4M5YL 4L8DB 4HDIA 5D7JA 3U4BH 3P2TA 1GGBL 5F8RC 2C9AA 5E9DB 4RAVB 1IGIL 4W4OA 5IR1A 4UV7H 2RB8A 5A2JH 2XI9A 4JN2A 5CEXB 2Q86A 3T0EE 1Z0NA 1KIRA 2NQCA 2OSLA 2PO6A 4O2FA 4G6AD 5HHME 1KCSH 5DRXB 1CCZA 1TTGA 1HK6A 3QHFH 1NAML 4MSWA 5HPMA 4F33A 2J8OA 5C0CB 3WV0A 4FS0A 2KZWA 1DLHA 4MJIA 4WVRA 1M6OB 2P5ED 5IIEA 2VLLA 5J6GB 2AV7A 4OV5A 2IEPA 3C09C 1C1EL 1IM9D 1PKQE 1U3HB 2KPNA 1II4E 4XP4L 4XPBH 5FYLD 3O6KL 3CSYA 1E4XI 1YEKH 3NIFF 1RZGA 2P45B 2BNRB 3HE6D 4A6YB 5KSUB 3REWB 2ADGA 2X40A 1A64A 4HWZA 1QSFA 3VXNA 1LK3H 5KSBA 1FORH 5TH2B 3QUYB 3BZFA 4EJ1C 4MDJA 1I3RB 1NLBL 3D39A 3PV6B 3RHWF 2G5BA 1F4YH 3OAUH 2Q3ZA 3SQBA 4X5XA 4NN6B 4NKMB 3V6OC 1A1MA 4X6DA 2DQIL 4GRLA 1J8HA 3CLFL 5HYJB 1OOAA 5GRYA 3WFDH 1A4JB 4WWKC 3QXAA 4ZNCD 3RWEA 4H8WC 4ZPTA 2GEEA 4RNRA 2EEAA 4I3RH 4GQ9H 2AEPH 4Q74A 1AGCA 2MMXA 2Y9RT 3OZ9L 3P73A 4X6CA 3S35H 1HYSD 4YXKH 5FKAB 2CO6B 4N90D 5L7XL 1I1AA 4CVUA 2Q87A 3CZFA 4R26H 1RK0B 1H0DB 1U8QB 4P48A 1YA5A 2K3TA 4MD5B 5SV3A 4JM4L 5F70A 4OJFH 3QWRA 2R1WB 2GQHA 5F7WC 4RGNB 3TEUA 2HT4C 4G43B 4FRWA 5T33H 3VFOB 1D7FA 4WEBL 1QR1B 3QQ9C 5LGJB 3VMNA 1XF5B 1QFWL 1C8PA 5BMFL 4NZRH 3NFPA 3FRPG 4UQ2A 3GK8L 1JYNA 2CGRL 1DBJH 1MELA 1DN0A 4ZNEA 4P5MA 4KKCC 4NQEA 4X98B 1YECL 3MV9B 2JB5L 3RVWC 2NY4C 4ELMF 4KAQL 4KVNL 5TDNA 3LN4B 1T3FB 4P2RA 1CI5A 4ZTPL 5GXBB 1FNSL 4U3CA 1GPOH 1QA9A 1S9VB 1UZ8B 4QCIB 2H3NA 3L7EB 5GS0L 3GMMA 3T8XA 1TZHB 3V6ZA 1BQHB 3W9DB 2HFGH 3HNVL 4HIHA 1T2XA 4ZFOB 3RJDA 3IJYB 5T3XD 4YR6A 3TBWB 4OF5A 1QQDA 1IGJB 5ACZB 4DN3L 2AJSL 2QTEA 4XGZB 3B3IB 3PWUB 4P9HC 1VKXB 5MEQB 2DWEB 1UJTA 3TZVB 2X1QA 4R4NC 3MLTA 3QO0A 5DC9B 3RY6A 2NZ9D 5F44A 3QNZB 3WFEL 3QRGL 4UQ3A 2CMRL 4NQVB 3QHFL 3SKJL 2PUQT 3SE4A 3SQOL 4KI5E 3L3IA 1G0XA 4HFUH 4QRRD 1HHGA 3IAPA 3WDJA 1QFPA 3DX6B 4GAYB 2NR6D 3KPNB 3WKMH 5HVHB 3I6LD 1L4IA 2ZOKB 4KJWD 4MJ2A 2EC9U 2ZCLL 1NCAL 5GQBA 1P4BL 1P69B 3HE7C 1ACYL 2ADFL 4Y5XC 2E7BA 3CJJA 1Q94B 2GFBB 2VZOA 4OCYH 4FQ1H 4DOHE 1HILA 4MA1C 3JV6B 1YEDB 3AAZB 5IHZB 2EYTA 1A7RH 4QGTA 4GW5A 2HVKA 2VO5A 4YX2H 3KYNA 1U9KA 4Z7NF 4Z76B 5DK2A 1BPVA 3MRNA 1E6JL 4HX1B 1BVLB 4MQ7B 5I8KH 2BDNL 2ERJB 3C2AH 4OZFA 1E4JA 4BFEA 3OHXA 2XPGA 4HJ0C 3B8YA 5TDOB 3M07A 1QHOA 5CHNA 1UM4H 4FZ8H 4M7LH 3PGDB 2ZUTA 5DJCA 5BO1L 4M4PA 4F9PA 5L6YL 3C6LC 2VLKE 2Q7YA 2Y25A 2DIJA 1MHHB 1WLHA 3H9SD 2DMKA 5CLTA 4Y2DB 3MFFA 4LLDB 5JXAH 1SBSL 4OLYH 3HZKA 2NY3C 5DQ9B 5C8JB 1A5FL 4ETYA 3DETD 1CGXA 1DSFL 3S4SA 3MV7B 1FLTX 1WCBB 3SO3B 1MRDL 4Q97A 2NY2B 3QEQD 5KTEL 2H32H 1NC2D 3BEVA 3RWDB 3WL9B 3SJVD 4W70A 1TJHH 4PRAB 1JZ2A 2ZOLA 3BHBA 3P77B 3WIHA 1KENL 1ZLUK 1BBDL 5MENA 3VJ6A 3GIZH 3JWOC 4G7YH 3RDTC 1MFDL 3MLZH 3DBXB 4AEHH 1OAYH 4NZRL 3CFDA 1VFBB 2E9JA 2HKHH 4MXWL 5IVZA 3PWPA 3E2HC 5IBLD 4EXKA 1HIMH 4N0CC 1A0QL 3FN3A 3NCYP 5E00A 1J10A 1NCDH 3T65B 1KN2H 1DZBA 1IFHL 4ZDHB 3LQZB 5HYQA 3TLRA 1AD9B 4OKVA 4DK6A 5KSAC 3QDJE 3L3OA 4U1GB 2XY2A 3N0PB 1R3LA 2JCCE 1RZ8A 1CGVA 3MRFA 1FVCB 1Q9WB 4ZMAT 1YUHB 5T1MA 3UPRB 1JF6A 1VGKB 1J18A 1R3JB 3VFSA 3LKRB 3HC3L 1NDMA 4WW2B 4HCRA 4ZS7H 4IMKC 5ACMA 1IGYA 4U1JB 4BZ2H 4NQCD 4GG6A 2BOCB 1FZKB 4LIQL 5JR1L 2R0WL 1EEZA 1HHKA 2R29L 2MOVA 1RFDH 1QLFA 5I2IB 5DVNA 3PF2A 1J1XL 4P23C 4PTTB 1GOGA 3VFVB 3SGDH 1KELL 3PGCA 4HJJL 4LNRA 2Z35A 3TIEB 3MRGA 4ODVH 4HK3N 2CH8A 3D1MC 3HUJF 1AR1C 1GHFL 2FH6A 2BMKB 1EERB 3MRCB 1X5XA 1EHLL 3LKQB 6FABH 1R5IA 3KPMB 4OD1L 4P4KA 1NCWH 4JDTH 3ZSTA 3UO1L 3RZCD 3AM8A 1CGYA 5E8EB 1BIIA 2J8UF 1AH1A 2AJUH 1PSKL 2PR4H 1P7QA 4ODHH 4QOKA 4U7MA 4R9HA 4O2EA 4HUWA 5BRZD 5L2JA 3FQWA 4KTDL 3VMPA 4ENED 3MODL 1T03L 1AD0B 3LEYH 1HHJA 5FM5O 4YX2L 2AJ3A 2MQ3A 5EZLB 5I8EA 3RJQB 3V52L 5FO7B 4O00A 2HH0L 5E8NA 4NNYB 4M1DL 2HT3D 4Y4KD 4R7DA 3D18A 3HAEG 4H26B 3NCMA 1JI1A 5HHVL 1IEAA 4N0UB 4XMPL 3C5ZD 4UNTA 3SDAC 4C83B 5T3ZH 1A7OL 3MYJA 5HD8D 3K7UA 2GJZA 4YHNA 3CCHB 4MA7L 1C16B 1R24B 2D7MA 4XXCC 3VXSD 3RPKA 4XP5L 4XC1H 3MLWH 4WFFE 5HHOD 1A6AA 4YDLB 3QA3B 3S8WA 2AQ3A 3O11B 4NUJA 4KJPD 1TZIB 4P5TB 3R06B 1OD7A 5IG7A 3ARDB 1LE5B 3TJEL 3DXAD 4L4VE 5DMJB 1MLBB 1WAAE 4PRPE 3FN0H 4E5XB 2OL3B 4C56A 4LSSH 1RHFA 1A9BA 4UOW0 4U6XA 3VRJB 1DUZB 1KB5B 3AROA 5C6PB 3ARGA 4GLRH 4ODXB 4JFDA 3DMMB 5EC2A 2IBZY 4NZUL 4RGMB 3AGVA 1A3RH 2R9HD 3ARFA 3OKEA 2YEZB 4GJTB 5J13C 3PJSB 5LG1A 4H88H 1G1YA 4LLAA 1B0GB 4QRUB 3TYFB 5DO2D 3ZDXE 1A02N 1J0KA 3GJEB 2Q6WB 4BQ9A 3RWIA 4NT6B 5GGTL 4CVWA 1F2XK 3X14B 4Z0XA 1FPTH 4JKPH 4HZLB 4FMKA 2EDKA 4RAUB 3PP4H 3MACH 3O4LA 5F7EL 1XGYL 2EYSB 5GGRB 2VYRE 5LAXB 4FQ2L 5FF6A 1EFQA 1FNAA 3C5JB 1A7BA 4JRYA 1R3IL 1DUYA 5INDA 1RFDL 1ZV5A 3L1OH 1QFHA 4X4YA 5TF1L 2FX7L 1OF2B 1ZLWH 5DUBB 4L9LB 4KRPB 1A1NA 2DLGA 1CDUA 5LXGL 1PZ5A 4JFEE 4UINL 3S37H 5EBMB 4TRPH 1XIWC 1CL7H 1C5DB 1B88A 1XGTA 1ZA6A 3MRRA 3W39B 2FECL 3G6DL 4AEIH 3ISWA 1BZ9B 5FIEA 3MLUL 1MJUH 5GSRB 3JV4A 1S5HB 3W0WA 1KCVL 4GUPB 3VGGA 1LWRA 1XMWA 4KDTC 4M43H 3QAZB 1ZT1A 4PJDE 2DYPB 5IB5B 1ZE3C 4NWUL 4TSCH 4XCFH 3OKKB 4ZUTA 2NLJA 3RGVB 1CXKA 1ES0B 4I5BA 1SYVB 1Q0YH 3U9PH 3V8OA 2DLFL 5I17A 1CGSH 1N7ML 3QFJE 1UYWH 4NUGH 3P0YL 4YHKH 3CC5A 4Y5YA 5ISZA 1UFUA 4JPWL 5DJYA 4IRSB 2I9TA 5FUOL 1V3MA 4FQXC 5B39G 1OAQH 3QDJB 4HKJA 3UTTD 2OTWB 1XCQA 4WENB 4G9DB 4WU5B 4U4BA 1FFRA 3A67H 5IW6B 1K3ZA 2EEBA 1MIEL 3GSWA 5I18H 1HYRC 5EULV 4GSDH 1SM3L 3WHE1 4YNYA 5C0NC 1OM3L 3DJ9A 2R15A 2V2XA 3GHEH 1F00I 3T4YA 4YHZH 3K2UH 4KROB 1FH5H 2HJKB 3EJYC 5KZCD 3JTSB 1I7TA 1HSAA 4X4XB 1YC7A 4L3ED 3VD3A 3TA3A 4V1DD 3QNXB 2WUCL 5JW4N 2WWMD 3TFKC 1OQOA 1TNNA 3I6GB 3FB8B 4O02H 5IVOA 5CILL 4KRMB 5F1NA 4YDJA 4NRXA 2R69H 3QCVL 3LV3A 4I0PB 3C60B 1BD2D 3D2UA 5CZVH 1IAOB 5ESQA 3EOAB 1VACB 2NXZD 3GRWL 4O9HH 1KTDA 4P9MH 1VERA 4JR9L 5D72H 1W72L 1INEL 5IV2B 2C1PB 1C5BH 1JHLH 2VDOH 2FX8L 1S7RB 3B83A 4IS6B 4MX7A 3VCLB 1YQ2A 4CNIA 4R3SA 4PGEA 3KWWB 2MWCA 5KVGH 4HMEA 4FFVD 4M62L 2P5WB 4U1GC 3BZ4A 1X9QA 1ZHBA 4PGZA 4CW1A 3L1OL 4M7JL 1AO7E 5B8CB 3TGXA 4Y19D 1FCGA 5TE6L 3MMEB 2XKNA 1S8DB 2ESVB 2R4SL 3O9WD 4EN3D 4MNQD 2J8UA 3MRJB 2ENYA 4G6ML 3GHBH 1T66D 3GSNH 2WQ8A 1MCPL 1JUFB 1UGNA 3CFKB 3MOBH 3MTRA 2DQHL 3SDCC 3GMNA 3T2QA 3UJIH 4KK8C 3ZKXB 1K4DA 1IKFL 5C0BD 1CXEA 3EJJX 3BN3B 3ZLQC 3CDGB 3JVGA 1XGQA 3PDOA 4Q9CA 4ZUWA 1JWMA 1NGYB 2DL2A 1ZLSH 4ZO9A 1K9TA 3ZKSD 1UCBL 2RHEA 2VLJB 3OKYA 5DYOB 1FAIL 5CEYA 4U6HA 1LO3H 4JY4A 1ZLWK 1JYXA 2DJUA 3FO2A 2O5ZH 5H35B 3W2DH 3ULVF 1OW0A 3ARWA 1LO5A 5JPNB 4H1LA 1UCTA 2YK1L 1Z9OA 2ADIA 3ARBC 5C09D 1ZTXL 4WV1C 4C58B 5MERB 4I9WE 5EU3A 5CD5C 3QDAA 5JORB 5D2LE 3FB5A 3VRIB 1JRHH 4LHUD 5B3JE 5E8PB 3KYKH 2AW2A 4LCUB 3CSGA 1LEIA 2NY0D 5F7MC 5HDBE 3VXMA 2D7QA 1AC6A 3U0PB 1U92B 4U2YA 2IAMC 3QIBA 2DM3A 4NYLB 4WFEE 4PJ5A 3NABH 4LVOB 2FEEL 1IQDB 4GSDL 2X4RB 2GJ6A 2X7LA 3KLHC 4H20H 2W0LA 5C6TL 3GGWA 4Y4HD 1E28A 2PXYA 4QWWC 2GSIB 1YYML 2FLRT 3TO4C 4LARL 4BZ1L 3FQUB 2AS5M 3VH8A 4PLKD 5D7KD 2VDPH 4JM2B 1Q9OA 3TBYB 4PG2A 4FXGB 2YPLB 3WN5B 4YDLC 3TM6A 1FZMB 2NY5L 3QIUA 3OPZH 2H6PA 4P5TC 5HI4C 4MA8L 3C8HA 3RTQB 2FATL 4TUKH 1UC6A 4EDWH 3VFPB 3DV6B 4OT1H 4PFEA 4L4JA 4O58H 2VDNL 3QDGD 4PREA 3KHOA 4JHWH 5JW5A 5D2NA 2A83B 4ZUSB 2IPKB 4G8IA 1F6FB 1P9MA 4KI5C 4MLIA 5F6IB 4RGMC 5MHSE 2FGWL 3D3VD 2OR8A 4FQQA 4PJDB 3PP3K 2NY7L 1A6ZB 2HTLD 1P7KB 1D9KC 5GISL 2A74B 1JK8B 4L9DA 4TNVK 2JELH 2DBLL 4UB0H 2DQUL 3THML 5ALBL 2VAAA 4WI6A 1E27A 1DBBH 4GBXD 5F89B 3MGOB 2P43B 2D7TL 3KVQA 4IRZL 1P53A 1LO4L 5DJAA 5E8DH 4U1MA 2R0LH 2YD8A 5J6HB 3R4DA 1KFAL 3IFNL 3AB0B 3FB6B 4Z18A 4C4KT 5BW7A 4HXAL 3A0OA 1SVZA 4Z78B 2J6EL 3OJDB 3VXRD 4RISL 4QYOB 5C0AA 1JFQL 5H94A 1MFEH 2V9QA 2JB6A 5E08L 1IC7H 4GRWH 4JN1L 3EGSB 4ZTOH 1A6VL 5C0RH 4QTIH 4S0SD 3PHOA 1FFNB 3U9UA 1KPRA 1YNTA 1QBBA 5C86A 1ETZA 1QSEB 2XZZA 2FWOA 4DJMA 2X4UB 1X5FA 4L1DA 1WBZA 5FK9B 1F11B 5CP7B 4RGOL 5FYJD 5L8KB 2C3HA 2JJTA 2PYED 3RVVD 4EUPG 1I9RH 5FYLE 1FN4A 1NKRA 3SY0B 1F90L 4NP4L 4Z7VA 5CWSB 1JBJA 2FHFA 3RGVC 4TUJB 4PJFF 3OX8A 3ET9F 3BP5A 4MD4B 2V9RA 2H9GA 1KJ2A 2CLZA 5EBGA 1A4KA 4O4YL 3QCUL 3TO2A 2X6MA 5ID0B 2F54B 1U95B 3FQNA 1OGAB 4EZMA 1WIOA 2JJSA 4G5ZL 4P46A 4U1SB 4I4WA 4F37F 4IRSC 2G60L 3QP3A 1LD9B 3UAJD 3VXUB 1B0WA 3T1FB 4AQ1B 5E9DA 2EH8L 5EN2A 1WZ1H 5CZKA 5C70A 4DZ8B 4K3JH 4P2RD 5CEXA 5A2KH 1AQDB 5DEZA 5ELIA 3FCTB 5HYSB 4R0LA 1MIMH 3IJSA 5F3BB 4UIKL 1MRFH 2A1WL 3PWNB 1IM3B 2EXYD 4FN0A 4YGAB 5J9PA 4N90E 3B6SB 3DECA 5D1ZB 2IG2L 1B2WL 2JIXA 4JHWL 1I9IH 1U3HA 5IK3B 3SPVB 5ICZA 5IHUL 5BS0A 1H3PH 4DUWA 2VR5A 2HTKC 2B2XL 2BNRA 4A6YA 1JPST 4F7EB 3REWA 3TBVA 1S7QB 2VKXA 5IQ7H 2RAMA 5EBLA 1ZVYA 5TH2A 4S1RH 4HS6B 4E41D 2AJYH 3QUYA 4P3WA 4CUCA 2EDBA 4JY5L 3PV6A 5DGQA 2XZCH 5DZNA 3AY4C 4AQOA 4HUNB 3FMGH 1Z5LB 3GMOB 3B2UD 1GAFH 3IFOB 1DBBL 4BQ6A 4Y0GA 4BQBA 2B7DT 3M17B 3O41B 5HYJA 3P11L 1MWAH 5DD5H 2AJXL 1DQJB 3QJHA 2D7PA 1RMFL 2Z91B 4LMQE 4OM0L 1G6RB 3H6JA 3LQAH 5DT1L 3PV7A 4Z7OE 4M03A 4LEXL 4HQQL 4JB9H 5T3XE 4U6YA 4JLRA 4ISVB 4FP8H 5EORL 4M9OA 5IB2A 4AL8H 1KT2B 4IBLT 1J05B 4DZBA 4TQEL 1CYGA 1NAKL 3MBXH 4NFBA 5GS1B 3F62A 4NN7B 2R1WA 4N0RA 1A7NH 1MCQA 3G6JB 1RJYB 4KRNA 4NDMB 5I9QB 3AREC 3VFOA 4P2OA 1NUGA 3LQMA 3OXSB 2DTSA 4NQDE 4MAUL 5SX4H 4QRRE 1XF5A 3BPCA 3WUWG 2ARJA 4PG9B 3GKWL 4RRPG 5B3NA 1AFVL 4LPXA 2XACC 3I6LE 1VEPA 3MCKB 4X98A 5IGXH 4NKOB 4KHTH 1KXTB 3ZTNL 1P2CB 4F7MB 2F8OA 1NMBL 3QUMA 4OIIH 3CAFA 1MCOL 3HG1A 4LPUA 4XNUL 4XNMB 3LKOB 3B9KB 3IDYB 4MNHA 2F15A 1TZHA 4AYFA 3ARRA 4CDHA 2V2WB 2DQJL 3CVHH 1G7HB 3F12B 3PE9A 3QFDB 4OZGF 4PRIB 1FFOA 3GIVB 1M7XA 1V7NL 3TBWA 1GGCL 2J88L 3WNMA 3PWPD 5ADOH 4TTDD 3PWUA 4G80B 4JKWA 4K23H 4PJ7B 5LWYL 1NAMB 1S7TA 4S1SL 5IMMB 5TF0A 4ODSL 3NIDF 5CINH 5I76B 1JNHA 4FG6C 4PJGE 1WTLA 2WZPD 1MIML 1J88A 4EOWH 2EDWA 1JZ4A 3WLWC 4UT6H 1RAMA 4LVOC 4K3DL 1S7UB 2WK2A 2VXQH 5D7LA 4DK3A 2XT1B 3V5KB 5IEKB 1NMCC 4JRXD 1HI6A 3KPNA 2UVEA 3BPOB 3STBA 4OGXH 3SGDI 3U7WH 2HLAA 1J1PL 2HVJA 3WIHL 4DGVL 1FGNL 5D6DC 4HIJB 1MI5B 4N0FA 3H3PL 1Q94A 3RTQC 3FTGB 2GFBA 1MEXL 3TCLA 4LIQE 3HC0B 4WY7L 5HYEA 1YEDA 3MNZA 5JIHA 5IHZA 2F74A 2B4CH 5AD0B 1IGTB 3O45A 43CAB 1XZ0B 1OTSD 1DQLL 1EHAA 3I02A 3UTSB 1F4XH 1BM3H 5TE4H 1OP5H 4UI2A 2OMBA 1ERNA 3AS1A 3BVNB 5HGAA 4NZTH 2OJEB 4PB9H 3EO9L 4JVUA 1D5XB 4QOKD 3PGDA 1I3VA 4OV6F 5I1EH 1DQDL 2EDNA 3E8UL 1BZQK 5T3XH 5CP3H 1AXSB 3HFMH 5E94A 2A0LD 5E5MA 3Q5OA 1G84A 3N1MC 2P7TA 3HLAB 3NH7H 4BH7A 2CR3A 3GI9H 5JUEL 4HWEL 4HCRL 4FP8L 1T2QH 2H45A 3VDCA 2JJUA 1CLYH 2C4XA 4KVCH 1LP9B 2QHLA 4N1EA 2IFFH 1UWGL 4X9FA 4DQOH 3HNTH 3VFRA 4NO2A 4YLQT 5HHXL 4JE4B 5GHWH 5IF0A 3DURB 2EC9T 5FYKL 3P9MA 3MGAA 1GYAA 2EIDA 3H42L 4GAJH 5HHPB 4PB0H 3L5XH 3FO0L 1R0AH 1QRKA 4MCYA 3GSRB 4PJBF 4PY7B 2LAGB 4Y5VB 1DE4B 3OKMA 4HUVB 4PJFA 1UACL 2LU3A 3JTTB 4YQXL 1DVFB 3SE8L 1NC4B 1JPSL 4PP2B 2VXTH 1A3QA 3D85D 3T65A 4MGXA 3LQZA 1KLGB 1GZPB 2GI7A 2ICWI 5E6IA 3VU2A 4JPIA 3BQUD 4IRJB 1T04A 4GLRI 3LD8C 5DQJB 5C07D 2ZSWB 5BRZE 4OIIL 4CU8A 5M95B 4F3FA 1I3GH 1K3IA 2R0ZH 3HZYB 2E27H 2Z8VC 1ZA3B 4I2XE 4Z7WF 4X7FC 1DBMH 2OCFD 4L8SA 5CIPB 5DMGD 4XC3H 2B1HH 4NQXB 1YUHA 2BVTA 4HXBL 1NEUA 2ZUQB 1CFSA 3PABA 1VGKA 4LLWB 4ELKB 3LOWA 1R3JA 3HTLX 3TNNB 1MREH 3LKRA 3V4UL 1T6WA 2PW2B 1MFCH 2X4PB 4WW2A 3FN9A 3IAQA 4XWGL 5DGRA 1WCQA 2WAHA 5EFIB 1MJ7H 1FZKA 2BOCA 1L7IH 1UM5L 1J0IA 5EOTB 4ZUUB 1NFDB 3RHWK 3SDDA 4ZOAA 2DQTH 3T4AB 2A9MH 1CD1A 3VWKA 4ZSOB 3BUYA 3RU8H 3VFVA 3BKYL 3KPQA 2AK1H 3AXLA 4KDWA 4RWYH 1WT5A 3VXSE 3KPMA 5BZDB 4OTXL 4LVEA 1CE6A 1YC8A 3KPRB 1EV2E 3VW3H 5HHOE 5KVDL 2NW3B 4YHMH 5E8EA 2JK5A 4WNQB 2FSEA 2FIKB 4Q2ZB 5EA0H 4HGWA 3DXAE 1CL7I 4WHYH 4EI5A 3WXVL 1V7MH 5GGUB 1NMAL 1A7QH 3BKJL 5CGTA 4ZPVA 3RVTD 5JIIA 4APQA 4LLYB 1JYWA 5JW4M 2H2PC 4H0IA 1F58H 3CMOL 4OQTH 1IC5L 3MZTA 4JFFE 5F72S 4F7TB 2GKIA 1AJ7H 4PV9A 1OP9A 3CU1A 3SDXF 5FGCB 5IKCB 5FO7A 4J1UB 5DWUL 1ZHKB 1C08B 2AXFA 1ORQB 5FO9A 4PB9L 4NRZA 1CK0L 4L29A 3SCMA 4QY8A 3QI9C 1Z9LA 4H26A 5C3TA 3ESVF 4W81A 5I1EL 1B0RB 2NX5D 4X6EA 2GUOA 2P49B 3QHZH 3NFSH 5DUML 2VE6B 1DLFL 2VISA 4C83A 1ZVSB 1RZJH 2EKJA 4ORZC 1TQBB 1BF2A 3CCHA 3GI9L 5I1HL 1C16A 2OR9H 3RI5F 3GJFK 1R24A 2FGZA 3X17A 1V8HA 4JJ5B 1CIUA 4Y1AE 5IJKC 5HBBA 5FO8A 5KJRL 2O5YH 3IXTB 4K7PX 5K9OB 3O11A 1I8KA 4TVPD 2DWDA 2IANB 1BQLH 4R7NB 2Y6SC 4N8CL 1IAKB 5ISZD 4LCIL 2EDTA 5F9OH 2DDQH 2XN9B 3QPQD 2OR7A 4M8QB 5A16B 1DUZA 1IJ9A 3KPOA 4NBXB 3BGMB 2R1YB 1CLOL 2X1PA 1HEZB 5GGVL 1AHWA 1YN6B 3HMWH 4NN7C 1T7WA 1FG9C 2HT2C 5IJVA 2F53A 4I0CC 3IJHB 3PJSA 3JWDH 4QRUA 1YJDH 4OZGA 1BQSA 4XCCH 1AXTL 1CFNB 1WICA 3BO8A 3LPGA 4OIBA 4PJ8D 1G0DA 3GJEA 1IILE 5E0QA 3P4LA 1LK2B 3QZWB 4R97B 2XA8H 3DVGB 3IRZA 3ARSA 3NPSC 4HZLA 3IXAB 5ID1A 4KQ4H 4X83A 3AS2A 3TJHC 2F9BT 2AI0L 3M45A 4RAUA 3TA3D 2B5IB 5IB3B 2VDMH 5LAXA 3ILQD 4KZDH 4U6TA 1NCBH 3IDYC 4EKXA 5EG6C 4DVBA 4LKXA 3H2WA 5GGQL 4JDVB 2A9ML 4OZIB 2D9QB 2UYLB 3I2CL 4IIQB 2VUYA 3O2DH 4L9LA 3WJLA 1T1YB 1FL3B 4U1LB 3UTTE 1YQVL 4OLWL 5EBMA 5MI0B 2B0SH 4QTHB 3D9AL 1MUJA 1C5DA 4WWKD 5GJSH 3CFBA 5HY9A 1EZVY 3KXFA 5CZXC 2X10A 4DFHA 4XBPB 2WBJA 3T0XA 4OB5H 1BJ8A 1F8TL 4OI7A 2XZQH 3DVNB 3UTZB 5I6XB 5I1CH 3IDJA 1PYWA 4GUPA 4JY6B 4NM4H 2DQEL 3WFBH 3X11B 2Z8WC 1D6EB 3QNYA 2P1YA 3OG6B 2VDLL 2DYPA 1IAIH 5IB5A 2A2QT 4JANA 1AJ7L 1G9MH 4MCZB 3UYRH 5I16B 2LV4A 4V1DE 2YD1A 3QYCA 1QVOA 2FNBA 4YE4L 3UCRA 4JAMA 1N59B 2CDFA 4MVBD 4PR5B 2P8LB 3QQ9D 5K9KA 1YEEL 2ITCB 1B6DA 2UZIH 2I5YL 1FCCA 4G6AC 4MWFA 2H32B 4N68A 1CTNA 1SY6H 2IH1B 2FHCA 5LQBH 3S3PA 4RA0C 2OTWA 2CIKB 3JUZA 3RVWD 3D25B 3K4ZA 3FFCE 5ABDE 5FM5M 1KBGH 5E8OB 5IT2L 1RUMH 3MOQA 2PN5A 2R2CA 1HHIB 4JREC 4LQFL 5IW6A 4B0MM 3C8DA 1JRHI 1P6AB 1CQYA 2YOCA 2YC1B 4RX4A 1ITBB 3HE6C 4PJBA 2QQKL 3GMRB 4ORGA 4P2QD 4PJHE 1RUPH 4BFGA 3H9HB 2Z8RA 1BGXL 1K6QL 3EYSL 4XRCB 5C3LD 1DEDA 1YMHA 3T3PF 4XVTH 2UWEE 3WHE0 3I9GL 4PRBA 1JHKL 4MNQE 5EUOB 3VRLF 2VXVH 3JBG7 4NBZB 2GT9A 4WTWA 2BVOA 1U42A 4PRHB 3JTSA 3SDYL 5T1LB 3I75B 4XPAL 1NEZG 12E8H 2CJUH 2WWKO 3ECBB 7FABH 2MFNA 4QRPD 4Y4FB 3HMWL 3RX7A 4LSPL 2X9WA 3VXMD 2W65B 5EO1A 2R1XB 4JQVA 4Z7WA 3V4PH 1OPGH 1I8IB 2ZCKL 5ESVA 5C92A 3TN0B 2ITDA 3VA6A 3DUHA 1FNLA 3FFDA 1R3KA 2D31B 2QSTA 2YXFA 4H25B 3VGBA 3RWHA 1HYSC 1DVFC 2GSGB 4OM1H 5GS0C 4GKSB 3INUH 3HE7D 1CWVA 5L2KA 1T0MB 2JKXA 1YEHL 4XHJD 5JXEA 2X44D 3HI5L 3Q48A 4G8GB 4JFFB 4LCCC 1FYHB 1X6LA 1U8NB 5TDPB 3DPBA 4ZAKB 4P4RB 1XGUB 4PGJA 5A40E 1JPTH 4FZEH 3U6RB 1XEDA 2OXGA 4D3CH 3BSZL 2XQBH 2UZXB 4PJIE 4MQTB 5FV2A 3PQYD 5HDQL 2E6QA 3B2VL 5B8CA 3EUUA 1EXUB 5ITBL 1N8ZB 5GRUL 1P4LB 2Z31B 2UY7A 4IOFD 2ZJSL 5GRJL 4O5LH 3VD9A 3G6AB 3O3BB 4HJ0D 5C1MB 4MXVF 1FGVH 5DJ2A 1W2KT 3HAEB 3DIFB 5GS2D 1TJGL 2B4CC 2BNQA 5E2TL 2X70A 4UDTA 4HIXL 5DQDL 1UWXH 4KU1A 3VFMA 4WI4A 3SDXA 1UB5B 2ZWLT 5D7KE 1F6LL 5IUSA 5D1XA 2VLJA 4A2LA 4KXZH 4L4TB 4LPTA 4Y16C 3M8OH 4XCYA 2VDRH 2B1AL 1ZANH 4DUXA 2IJ0C 3QCTL 1FRGH 5DD0L 3EFFB 1I9JL 1SYSA 4MNGB 4AEEA 2DJSA 3TV3H 4BQ8A 5GPRA 2AERT 5F7HA 4DVRL 5D1QB 2HLFD 5BV7L 1NGWB 2NZ9C 4OFIA 4PJ9B 2XNAB 5E2VH 2YUWA 3O8XB 4WO4B 3SE3C 4N0CD 5JHDA 5EPMB 2RCSH 4D0DB 4M7ZB 3D3VE 2YN3A 3L3HB 2UZYB 3OBAA 1KBGL 3LSOB 1AI1L 2VQTA 2W0KA 4IMLA 1QP1A 1M7DB 3MOAH 1E4WL 2M2DA 4KJWC 1MAML 1U92A 1AQKH 4ZS6D 3U0PA 1IGCL 5KSAD 2CUHA 1FYTD 4ODUB 5TJWK 5E6YA 4WDIA 4LAJH 4YZFF 1BJ1J 1AGBB 1A22B 4LKCA 1FL6B 2GSIA 4AZ8A 4S0TD 1FNGB 1G7PA 4OCRH 4EBQL 3OG4B 5JA8B 2BSSA 3UBXB 3PHQB 1X6NA 4JM2A 1QSFE 4FXGA 2YPLA 3VXRE 4YO0A 4UBDD 1F4HA 1ZT7B 5KSBE 4KKLD 1FZMA 7FABL 4HBCH 2PF6A 4Z0BH 5IBTH 1LEGB 3ZSSA 1IGMH 1UB6B 3DV6A 1JGUH 4AIZB 5F8QC 1T7ZA 3IDXH 3T2PA 3ZDYF 3H7BB 2VITB 1W72B 3CU7A 4X6DE 3WO3B 4ZQKA 1J8HE 1CG9B 2A83A 3DTXA 3U7YH 4ZUSA 4QHUB 5E9DD 4LLQA 2HG5B 3QQ3B 3P4OB 2BRRH 4TNWF 3TH4T 5FOBB 3WJJC 3BDYL 5D6CB 1HHHA 1A3LH 5ANMA 4ALAL 3INUL 4JO1L 2E7MA 1H15B 2XRAL 3CSBA 4IDJL 1SEBB 1JGDA 2CKBA 5C0CD 4UTAH 5FYJE 4M7KH 2PYEE 3DROB 5EU6D 3GBNH 5FUZL 3OSKA 5DRZB 2Y07H 1QNZH 3RL2A 1KJ2L 5F9WB 1QBAA 2W60A 5J6HA 3V6OA 5J11B 3MBEB 4D9RD 3FB6A 2DMBA 5ADPH 4FFWD 1PVHA 5GRZA 5KVFH 4K7FA 4WUKH 5IBLC 1UQSB 3OJDA 5D9SB 2XQYG 5IHBA 1UXSB 5CBEB 1L7TL 2ZKHL 2VQUA 3QUYD 4U7KA 4LP5A 4LHUG 3S35X 1CE1H 4Q0XH 1M71B 2ZSVA 2AP2A 2PCPB 5IM7B 4KC3B 2R23B 3AU1B 4NIKB 4DGYL 4XPHL 3F6IA 2ATPB 3EGSA 1A6UH 4YBHA 1EO8H 5KG9B 4HKBB 4Y8AA 5IEHB 5MI0C 5E2WL 4U31A 2Y7QB 5AZ2L 4P2RE 2XIDA 3C6SA 1QSEA 4YFEA 4P57B 2PYFB 3MRKB 3JSSA 4OFYA 4FNLH 3HC4H 4NHCL 3TPUA 3HI6L 5FK9A 3LKSB 4LRNL 4XI5D 5CP7A 1OSZB 4GW1B 3IDMB 4LBEB 3IDNA 1G7MB 2YUVA 1FLRH 4M6NH 3QG6B 5E2VL 1WWCA 5GJTH 1BX2A 3SY0A 4NO3B 4JCMA 5SX4I 1E4KC 3Q2CA 3AUVA 2F58H 2EIZA 4LSVL 3Q3GB 2YKLH 4LASL 5AG9A 3TIDB 3PUCA 5IESH 1I7RB 5J0BA 3MRPB 3O3AB 4K07A 1XGPB 1MOEA 4ODBD 4RGND 4E41E 2YWZA 4ZXBB 3N85H 4JDZB 5DDHB 3IU4H 1QSZA 3RZCC 2F54A 1SBBA 4OF3A 3EDFA 2GK2A 4K8RL 2EDRA 1NDGB 3K74B 2AK4B 4D94A 4Z5RB 5F93C 1RUQH 4IOIB 4PJEE 4XP9H 1VPOL 1XF4B 4FXKB 4LU5L 5CFHA 1FJ1A 1KG0B 3MV9D 4WWID 4PJIB 2HYMA 1RUAL 2IALB 5IFHH 4F7PB 4JG0H 4L5FH 3ZYOA 3DNKA 4XBEL 2OZ4H 4LDEB 4AEFA 4NJAL 2HT3C 5D71L 4Y4KC 5BXFB 3ULUD 1J8KA 1IGML 3CXHJ 1WC7B 3PGFL 3WNOA 3T0DA 2P48B 4J12A 1T5XB 5TE7L 5GZOD 1INQA 5FHAH 2I26N 1IKNC 2MCPL 3ULVL 3FT4B 5IK3A 2NY1B 1XGRA 3ARPA 5L9DH 3IGAA 5KVEL 4NN5C 2O61B 3TZVD 4OF7A 4E42A 2AEWA 1Z3GH 3CFCL 5B4MD 3V7MA 4KZEL 4HS6A 3BI9X 5FYJH 4QF1A 4EQ3A 5EZOH 5CEZD 2QADB 4FTVA 5CJXC 5F21B 3BEWA 6CGTA 1HZHH 1Q0XH 4HS3A 3IFOA 1BZ7A 1MVUB 3IDUA 4UUJB 2APTA 5DR5H 4YFLI 3O41A 3QUML 4HDIB 3B9DA 2OJZH 4RFNC 3K4AA 2QQLH 1T89A 4R90H 1A7PL 2DI9A 4JO2L 4M93C 3IB4A 5AZEL 1BP3B 1MHPL 3F6LA 3H0TA 1T1WB 1FO0A 2Z91A 4WUKL 5IR1B 1KUMA 1NBZA 2Y5TB 2VXSL 4ZAKC 3P0VH 1WBXA 4JN2B 2Q86B 1KIRB 2R9HC 2PO6B 4O2FB 1CE1L 2Q76A 4DKFH 4Q0XL 3S5LG 3OJ2C 3PWPE 3MCG1 4MSWB 5HPMB 1KT2A 3MCLH 1MCJA 5DO2C 3U1SL 2E7LC 2Z31C 4KKBC 1FZOA 4MJIB 1DLHB 4LFHD 5AWNL 5I71B 2VLLB 1GL4B 2VDQL 2VZ1A 2AV7B 5HTSA 3AS3A 3E6HA 2GTWA 2X4SA 1A6TA 2OK0L 1RUKL 1W0WA 4GG8B 1RJYA 1I7UA 1FAKT 1RZGB 4FNLL 2ADGB 4HWZB 1PEWA 1QSFB 5DTFB 4XP6H 4Y2DD 3VXNB 5KSBB 1ZEAL 3RVUD 4PG9A 4JRXE 3BZFB 3BH9B 1OT1A 2Q20A 3D39B 4Z95H 3MV7D 2G5BB 3MCKA 4X5XB 2NY2D 3V95A 3OF6A 1AGFA 3VGEA 4NKOA 1T6VN 4GG6E 5D7SH 3DVFA 5JTWA 4JFXA 3KNBA 1BOGB 4OLUL 1P2CA 3MYZA 1A1MB 2KKQA 4X6DB 4GRLB 1J8HB 5DMIL 2Y4SA 3TFKD 5D93C 1W0YT 4HMDA 3S88L 4YIQB 5ITFB 4XNMA 4LPWA 3B9KA 2QR0A 2QQQA 3QG7H 1Y6MR 3RWEB 1ZGLA 1VDGA 3RRQA 2X9XA 4PJ9C 3TYGL 4RNRB 4ZD3H 3NIFE 4Q6YA 3RUGF 4HJGB 4WO4C 1AGCB 3P73B 4X6CB 5CBAB 4G80A 3B43A 4L3CA 1EMTH 4NNPL 3F7YA 1I1AB 5DJ6B 1TETH 4QOKE 2QEJA 5IMLA 3QPXH 4IMKA 1E6OL 5DF0A 3FJTA 3MSPA 1CFQB 2P46B 1S7UA 2KDGA 4EIGB 4I18A 4P23A 1QBLL 3NA9H 2BSED 3KPSA 4GXUM 3V5KA 2OP4L 2YSSA 4M4RA 2IPTL 2MSPA 3IYLW 3TVMC 4P59H 4XB8A 3NFPB 2JTDA 3OKOB 4UQ2B 5JQ6H 2ZZUT 4BKLB 4L8BA 3SDCD 2ZUUA 3SKUD 2NXYB 3DLQR 4NQEB 4JPVH 1V3JA 3HPLB 1U6AH 4Y2OA 1MI5A 5TDNB 4G6JH 4OKDA 3DV4A 4NM8H 1QA9B 2HJLA 3RBGA 3HA0A 2H3NB 2VWEE 3GMMB 4G9FB 1BJMA 3LZFL 5AD0A 3BGFC 1ZHLB 3V6ZB 1XZ0A 2C7UB 4YBQD 1QKZH 4HIHB 4M48L 1C5CH 5D5MB 3U4EA 4OZHE 5SX5H 3D6GA 4POUB 2Y36H 2N7BA 1D5XA 4RFOL 5DC0A 2W0FA 5M7QA 1CFBA 5JDSA 3K1KC 5CSZA 3HMXH 4H5SA 5IFJA 3QO0B 1QLEL 3T3MF 4Z8FL 1PX3A 3SDAA 4EUPB 4KUCD 4TULH 2E7HA 4UQ3B 4XNXL 2E8ZA 2D0HA 4PYGA 4C54A 3L3IB 4HWBA 1JMZA 1HHGB 3G5VB 1X7QB 1AR2A 2CK0H 2CD0A 3NFNA 5E70A 2R4RH 2MTPA 3WCYA 2XKUA 1G9NL 2A77H 3F5WA 4LCYA 2NXZC 3RX8A 4DAGL 4HKXA 1XR9A 4F37K 2ZP0T 4EVNA 5IROA 4Z7UB 3CK0H 4PY7A 1S3KL 1DE4A 1KTRL 1BBJB 4QWWD 5H2BA 4HUVA 1AE6H 4FFVC 5EOCJ 1B4JH 4HT1H 2I27N 3N9GL 4KI1A 2EYTB 1T22B 2V2TA 2YPKA 4GW5B 2HVKB 4P2CG 1U8IB 3KYNB 4YHPB 1ED3A 1I85C 5DK2B 3O9WC 1MPAL 3MRNB 4P5TD 1KLGA 5HI4D 1U8KB 4JRYE 3ARDD 1R5WA 1T66C 4UT9L 4OZFB 5F96L 3BZDA 3ZT5A 5CHNB 1U8MB 1ZA3A 2GYSA 1XF3A 5C08A 1Y6KR 2Q7YB 3UTOA 1N0XH 2FDBP 4ZD3L 2J5LB 5TQ2L 1F5WA 1C7SA 3RBSA 2PTVA 4XPGL 3TNNA 3DMMD 1OD9A 2FEDD 3S4SB 1CZ8L 2DQGH 3OAZH 1TETL 3BXNA 5EU4A 2WNGA 4Y88A 1X5JA 4ZXBC 3WSQH 1D9KD 3QUZA 2NX5E 4J4PC 5B21A 4KI5F 2CDGA 1MLCA 3CD4A 5DJ8B 4ZSOA 4KGLA 2QSCL 3MV11 2ZOLB 3BHBB 3PHSA 3V7AE 2G2RB 1S9XB 3S37X 5MENB 2V7NA 4F8TA 4F58H 3G04A 2NY5C 3CLEL 3CX2A 4TOYH 5BZDA 3WD5L 1EX0A 1S5IL 2FO4B 3QDMB 3KPRA 5E99L 2NNAA 3NPZB 3CFDB 1XIWA 5IVZB 4TVPE 3VE0A 3MLPA 2FJFA 4PLNC 5ISZE 5E00B 3HRPA 4XBGA 1U6AL 3P30H 4HS8L 5IVXB 2IQ9H 2NY0C 4YAQB 4OKVB 4CMHC 4OCXH 1DQMH 5T5NG 4KRPD 2V5SA 2APBA 4KDTA 1BWMA 1R3LB 1TMCB 3MRFB 4FFYH 4WCYL 1W0VA 4Y4HC 5T1MB 1ZHKA 1HSBA 1ZKAA 2VJXA 4GMTL 2DICA 3D0LA 2A73B 1IAII 1S7XA 4PLKC 1T20A 2VXUH 1NDMB 2VZUA 2Y36L 3QIWB 4LSUH 4WJ5A 3VI3E 2DTMH 1S7VB 2CSPA 4Q6IC 2VE6A 1MCLA 1YDPA 3WUWB 1EEZB 1HHKB 1J0ZA 1RIHH 3DRQA 3LIZL 3PGCB 4DKEL 4LNRB 5F3HA 2HMID 1CR9L 4RA3A 1MCFA 5FXCH 4JJ5A 1E4XL 3RGVD 5CMAB 5D7JC 3CXHK 3IXTA 5K9OA 2W0PA 4P4KB 2A77L 4TPRL 1IM9B 5F97E 2IANA 3OB0K 3EZ8A 3O6FA 3ALWA 2EH7H 4QHMB 3P4NB 1P7QB 2PO6C 4IRSD 1T21B 2XN9A 5CAYB 2GIYA 4O2EB 1BHGA 5L2JB 3FQWB 2BP3A 4CADA 1NBVL 3QDJD 1AKJD 2R1YA 2PW1B 2EXWC 3OTTA 2R56L 4GBXC 1J12A 3BD3A 5JDJA 1TVHA 2AJ3B 1RY7B 2ZUVA 2Y72A 1H3WM 3UJTH 5I8EB 4LLUA 5E8NB 4M6MH 1A1OA 3O2WH 1KIPA 2JCCF 4R7DB 3KLDA 4RMTA 3RUGA 1CFNA 4M6OL 3QBTB 1OGTA 3D18B 4XNYL 1IEAB 3GO1L 3T0EA 3BGAA 4KROD 5EOCH 1PG7H 1PJ9A 1N6QH 2CKNA 4MHHG 4GXVH 3MYJB 4HH8A 2HTKD 2GJZB 3UZQA 4MAYA 2IH3B 5CJBA 3R1GH 4GRLC 1A21A 1VADB 4N8VG 5C0DA 3MQIA 4EI6B 1EH9A 5HI3D 3O2VL 4G8EA 1PKQA 3TT3L 1J1OH 3QWOB 4NUJB 1UXWA 4JDVA 2KZ1B 1UVQA 1ZT4A 2Y06H 3DSFL 3GFUA 3MO1A 3C60D 4I0PD 5IG7B 1RHHB 2MHAA 3WIIL 1T1YA 1FL3A 3NVQA 4C56B 1A9BB 1CLCA 3BOVA 3HRZA 4U6XB 4U1KA 3RNKB 4TVPH 2D03H 2XTJB 5E4IA 4X7DC 4AG4L 5DEGA 3RVVC 3GJFB 1I1AC 4ELMB 3ARGB 1DCLA 2R2EB 1N64H 4J3VA 2I25N 4JFDB 3V7AG 2DLEA 4XVUC 5EC2B 1B4RA 4X9IA 4P49A 4PJAF 4JPKH 2VH5H 4QEGA 2G75A 1P6FA 4M5ZH 4Y7MA 3ZHLA 2J1KA 3KJ6H 1FVEA 2X5PA 2P5WD 4JY6A 4FMFA 2VDKH 3HCVB 4R2GB 5DRNB 3OAZK 1D6EA 1IBGL 1B3JA 1GGIL 1YNLH 2QJDA 2CDEB 2ESVD 2QHRL 4QLRA 3CFIC 3EOTL 3RWIB 1NSNH 4HAGA 5I30L 4QRPE 3UAJC 3VG0H 1FE8H 2FO1A 3QUXA 3VXME 4Z0XB 4P3CL 4XPFH 1J86A 4HPOH 3PL6B 3ARED 1N59A 5CKGA 1BF8A 2E9WA 5KN5A 4KXZI 1CDYA 3O4LB 4PR5A 3MV8B 5FF6B 3QQ4A 1WQVT 3ARBA 1HKLL 2H32A 4WI3A 4JRYB 5ICYA 5INDB 1DUYB 4WV1A 2IH1A 4FABH 4YDIL 4CBPA 2EXYC 3KAAA 4X80L 1HNFA 3NCYS 4TVSa 3WFCH 5BCAA 5GGRY 4I77H 3W5NA 4OGYH 1CDIA 3QEUA 4RSVA 1TVBB 3DUSA 5CUSH 4G7VH 1XGTB 2ZUSA 4LCWA 1Q8MA 4ZFGL 3GMRA 3RY6C 3PQYE 1QFUH 2ORBL 1CLZH 2IAMA 5D2NE 5K59E 1FDLL 2VABA 3UPCA 1P4IL 3K46A 4OD3H 3W0WB 4GAGL 2CIIA 2CQVA 5IW3A 3E0GA 4QKXB 3SE4C 3CX5J 4H8WH 1ZT1B 3B2UC 3E6FB 2FD6L 3ECBA 3WNPA 2IWGA 3GNML 3I85A 4TSBH 4ZUTB 4AH2A 2NLJB 4FG6D 4I5BB 2R1XA 5DHVH 1MRCL 3ZDXF 5C0EB 5JNYA 1H8SA 1NL0H 1F4WH 1D5IL 1I8IA 5I17B 3BD5A 4RMVA 3C9NA 3VA2C 3ES6B 3CC5B 1YN7A 2XG5A 4LSQL 4Y5YB 1HKFA 2ZUYA 3BT2L 5DJYB 2I9TB 2AEIT 3H9SB 4KUZH 4JM2D 4GKSA 3LPWA 2YPLD 4QNPE 2HFEA 2BC4A 3SKNB 4HKJB 2E9BA 4ONFH 3R1GL 1BEYH 4G8GA 1XCQB 4KV5F 5DUPH 3OV6A 5C0AE 3RTQD 3UP1A 3QEQB 2EDYA 1QLRA 3LPFA 3U6RA 1J5OH 3BKMH 4K7PH 4AMKH 1OP3H 3PWLB 3SJVB 4F9PC 4QHKI 5L0QB 1BFVL 3DX9A 1U36A 4YNYB 5T5FH 2J5LC 4OAWB 3B9VA 2V2XB 35C8H 1T2JA 3T4YB 3O3BA 1INDL 1CF8H 2D03L 4HV8A 1FC2D 1JTTA 1I7TB 1HSAB 3HAEA 1CDJA 1YPZF 1FYTE 1Q72H 2WANA 4JO3L 4ZOBA 4XP1L 5IMOA 4DUVA 3K8KA 4P9HH 4OLZH 1UB5A 3QFJD 4X6BA 3RI5K 5C6WH 4J6RH 3JV0A 4YDJB 4Z7VE 4UILH 4WHTB 4YUEL 3RL1A 2EZ0C 3B9EA 3D2UB 5F9AC 5JIKA 5ESQB 3TT1H 5CJ5A 5D70H 2LVCA 3HR5B 2P4AB 3EFFA 5DD3L 4OGZA 2FX9L 4NO0A 3X12A 1DL7H 4J23A 3LHPL 5C2UB 3R8BB 1KXQE 3BZEA 4OLXH 3TP4A 5DVLA 4MX7B 1JGVH 2APWA 1OAKL 5LCVL 3G5YA 4Q9RH 4R3SB 1GOHA 3UC0H 5IFAL 2P8MB 4JHAL 1A9EA 5ALCL 5E9DE 3HUJB 3O8XA 2L7UA 3F7RA 3BZ4B 1ZHBB 3RWJA 3D48R 1MFAH 5KAQG 1J0HA 3QEGL 3Q5TA 1RZKL 1QSED 3MA9L 2XKNB 1ZLVK 5L88H 3LSOA 3MUZ1 2CKBL 5DEFB 3BE1L 2J8UB 1LO0H 3KJ4B 1YNKH 4XH2A 4AIXA 2Z8SA 2COQA 3IAGC 2V9TA 2VAJA 5GGSA 4ODUA 2ICWA 4NFDA 4KTEH 4YHYC 4A2MA 5FHBH 3QWQB 5I75C 3K8MA 4LGSB 3AVEA 1HQRB 1XGQB 8FABA 3PDOB 1FNGA 5HJ3B 4OD3L 4D9RE 4ZUWB 1JWMB 2BNRE 3PHQA 4U6VH 5GS2H 1OTSC 1BECA 1ZT7A 3EYOA 3JXAA 2SEBA 2JCCA 4RBPK 1DBKL 4N5ED 3EYVB 3MREB 5CEYB 4D0CA 2F54D 4P0DA 1OGAD 4JY4B 5C7XH 2D7OA 4X7TB 3D69A 1F4WL 4OFVA 5DJ0A 3S3SA 4BSVB 4YHOH 3H7BA 4MQSB 5I15H 2VITA 2OM5A 5J06A 1LO5B 1UZ6E 1WFUA 4H1LB 1CG9A 2DF3A 4KHXH 3VXUD 3BWAA 5HYJE 2FB4H 4QHUA 3VFWA 5CJQH 1RURH 3V4VH 4LSDA 2DD8L 4XXDB 2IGFL 3C5ZB 1V3LA 2RFXA 5FOBA 5EU3B 3LS4H 5JIPA 3U0WH 2UV3A 4M1GH 2W9DL 5I74C 1ROWA 5SWSB 2HA1A 1KPUA 3JWOH 2OLDA 1PQZA 4NKIH 1BEYL 3GI8L 3OKDA 1RSFA 1X5HA 5DUPL 3HN3A 2DIAA 1LEIB 2VLRB 4S2SB 3BKML 3SOBL 3NTCH 4DN4H 2ZCHL 4K7PL 5D1ZD 1R3HA 3QIBB 3S34H 4PJ5B 5DRZA 3V0WL 5E24E 1KGCD 4YPJA 2GJ6B 2X7LB 3C87A 1IQWL 4N5UA 3GGWB 2EKSB 4UTBL 3LRHA 4RGNE 2JJVA 2VWEC 4PJAA 3VH8B 5A1AA 1IT9H 4DTGL 3I50L 4QXTA 1UM6H 2DS4A 5GRVL 5F9JA 1WTGT 3SGEH 1M71A 1DBAL 4RFEA 2H6PB 2PCPA 4BFIA 2Z93A 1NGQL 3BQUC 4GRWF 5DD1H 5B39A 2ATPA 1FIGH 2D3VA 3MV9E 5KG9A 2A6DA 2D0GA 2XFXB 1JF1A 4UILL 3GSXB 3MRQB 2X89A 4PREB 5DMGC 1RZ7L 2BVYA 1YEIL 4P57A 3ARGC 4G8IB 5BV7B 4PGBA 1TZGL 1TQCB 5FECA 4WFGE 3ULUE 5B22A 1ACZA 3ARFC 3LKSA 3X3GH 5DRWA 1RU9L 1OSZA 4GW1A 4LBEA 5D2LF 1G7MA 1N4XH 3UC0L 5B3JF 2QL1A 3MLYL 5DMKA 1DFBL 43C9A 4FQLH 5GRVK 1E27B 1RVFH 1IC4L 4BZYA 1MFAL 3Q3GA 4TSAH 4L4VA 1NEZB 3C08L 4K55A 2X2YA 2V17L 1I7RA 5HDBF 2BHUA 1MCNA 3TBTA 2VC2H 5DJAB 1RIVL 4U1MB 2KQNA 3X3FH 1DANT 2FJHA 4JDZA 5K9JH 1VGEL 1KJ3L 5CEZE 2UUDK 1Q1JH 2AK4A 2CRMA 3FT3A 5KS9F 3T2NH 3T0BA 3BKCH 3S9DB 4FA8A 1XF4A 5GRWA 4FXKA 2FBJH 3MLSH 5H94B 3MLRL 1U2CA 1FO0L 3TJHD 1KTKE 1LDPH 2PTTA 3EDJA 4Z7QF 5LGHH 3U46A 2IALA 3L5WA 4XWOC 1VA9A 3PHOB 3U9UB 3GSQB 1YNTB 2ID5A 2QQNH 3A6BH 3B9KD 4X7SH 1D6VL 1ETZB 4OFKA 2EDOA 1KEGH 5BXFA 5MHSD 5IB1A 1FSKC 3N06B 1WC7A 4D2NA 4PRID 3BPNB 3MNWA 3JZ7A 2FWOB 5KBNC 1WZKA 4N0YH 4YWGH 4OSUL 1WBZB 2J3SA 1OAZH 1WIUA 4RMQA 5HXMA 3L3JA 3RPIA 4HF5L 1CD9B 4IOSD 2DM2A 4XAWL 1ONQA 1O7VA 3OX8B 4D9QE 5EU7E 1NLDL 1QRNA 3BP5B 4TUOA 1OLZA 4KY1H 3O6LL 4OF0A 4K94H 1A4KB 1QEWA 4UT7H 3MV7E 3GSNA 1XR8B 4Y5YC 1WFTA 4MMZC 1MVUA 3NACH 1YEGH 4P46B 4I4WB 5C0GA 3VWJA 1MHEA 3ZL4L 5TFSL 3MPCA 3QPQC 4XVSH 5D7IF 4MYWB 1UJ3C 1YPZA 5DSCA 1KOAA 2W9EL 5EN2B 4XNZB 1T1WA 3O4OB 1KN4L 25C8H 5CGMA 2Y5TA 1MI5D 2BOBA 3CFEA 3WO4C 3T08A 1TNMA 1RJZA 4UV4H 5ESAA 3N1GC 5T1KA 3NZHH 4YXLL 4R0LB 3LKNA 4PJFE 3IJSB 1MQKH 2AGJH 1UEMA 1F6AA 4WU7A 3UTSD 4XMKL 3MRBA 5J9PB 4FQCH 4PJ8C 4NCDA 2JIXB 2R2BB 4ERSL 3MXWL 5ICZB 1BD2B 2CRYA 5BS0B 3LH2L 1EEQA 4XMLH 5J12C 3ULUH 2YMXL 1NQBA 4GG8A 4HULB 3ZO0A 3PDDA 4YDKH 2B39A 3HNSL 3TBVB 3WS3B 3TA3C 5TPWL 5DTFA 1A6PA 4OCWH 4RQQA 5EBLB 3ILQC 2R8SH 4S1QL 1MHCA 3BH9A 2APVA 3Q6GL 3OL2A 3H7LA 2APXA 2X42A 1BQHG 5I8OL 3VFGL 4JQXA 1B90A 1BOGA 2LFGA 3BIBX 4LPYA 2GTZB 4JFQA 5BVPH 4XVJL 4YIQA 5ITFA 1T83C 2BCKA 4EN3B 2YPVH 1JTPA 4NQSA 3QJHB 4AY0A 5I1GH 3MLXL 2IBZX 4XCNA 1UA6H 5D8JH 3WFHA 5MEPA 4HJGA 5C0BB 2BJML 1S7WA 4TNWK 3Q1SH 1DVFD 4KH2A 4U6YB 4JLRB 3NAAH 5CBAA 3GBMH 2FBJL 1KIQB 5GS0D 1NC4D 1UH4A 5IB2B 2YUXA 5DJ6A 1JVKA 2IC2A 2OTPA 3B9AA 4DZBB 4HPYL 3RWCA 4IRJD 2XWBA 1ZS8A 2O5XH 1U8LB 3U48A 1CFQA 3EFDL 3BP6A 4LPCA 4AJ0A 3IFLL 4HWBL 1X4ZA 3ZHDA 4P2OB 5D96B 4MVBC 4N0YL 5EZIH 5GIRB 1A6WH 4KKAD 1TJIH 3BPCB 2ARJB 4XHQA 1G7LA 4HUXA 3SE9H 3OKOA 3UJJH 3N50A 4BKLA 5C09B 3V6BR 3B4NA 5KW9L 1AO7A 4PGCA 2AEQH 3HPLA 1CBVH 4N0UE 1MF2L 4LHUB 4MD0A 1D5BA 4OBRA 1EEYA 4YFLF 1OARL 1CFVH 3QUMB 3HG1B 2VZTA 4KY1L 1N3NA 3ARZA 2WLYA 4M7LT 4OLVH 4MNHB 4G9FA 3UDWC 4WUUB 1ZHLA 2C7UA 3MRLA 4LAQL 2EEDA 2B8OT 4YDVA 4D9LL 3EHBC 1FFOB 4Y16D 4X5WA 2C3XA 4M61A 2FBOJ 5D5MA 5FDWB 3R8QA 3U4BL 5DJZB 4NC1E 2E6PA 3MLVH 4JFHD 1CFTB 1V3KA 1SVCP 1I75A 2YUZA 2FRGP 4M3JA 4Z7OF 4UV7L 1S7TB 2LAAA 4JKKA 4UV4L 5FDYA 1NCCH 3CVIH 1JNHB 4ZUVB 4U1HB 3HB3C 1KCSL 1VSCA 4EUPA 3DYOA 3QIBC 4JQIH 4NQDD 4GW4A 5LBSH 5FGBA 4WTZG 3G5VA 5D7LB 15C8H 3L6FA 1X7QA 4FQCL 5F1OB 2PXYC 1HI6B 4YC2B 5IJKA 5I1IH 1WBYA 2V5YA 4XPBL 2HLAB 2J4WH 2BERA 2HVJB 3ROLA 1SQ2N 2PETA 1YEKL 5DHYA 2L7JA 1AY1H 5D2LA 3MUJA 4XHJC 4NBYB 3QIUC 4LEOA 1DQTA 1MFBH 2WP3T 5SWZB 4Z7UA 4N0FB 1LK3L 1FORL 3TCLB 3CH8A 1BBJA 4PV8B 3LB6D 5E6ZA 3EOBA 2AXHA 3MNZB 1F4YL 3OAUL 1JZ7A 3ORJA 2F74B 1T22A 3MJ7A 3O45B 5D2NC 4PS4H 2W59A 4JFOA 1U8IA 3I02B 4YHPA 4IOFC 5BV7C 3UXFA 2ARWA 1U8KA 5HGAB 1JWSA 3T2OA 4ZYKA 3WFDL 5KS9A 2XXCB 4JO4H 3QSKB 4MHHI 1U8MA 3GMPB 3IKKA 2XN9D 4OIAA 5CGYC 3AFLA 2M1KA 4W4NA 5E94B 5E5MB 2DQFB 2P7TB 2VSDA 4GQ9L 2AEPL 2C4FU 4I3RL 4BH7B 3CUPA 3S35L 4YXKL 1DP0A 4QRQB 4NOFA 3WXWH 1EAPB 4PJGF 1IE5A 2ICWJ 4NJ9H 2DLIA 2PNDA 2WMPA 4R26L 2VOTA 1CIDA 4NO2B 3VFRB 1QSVA 3F7VB 4OJFL 5DJ8A 4YXHH 5J1AA 5H8DA 3MJ6A 5IF0B 5JW3H 3UX9B 2G2RA 3P9MB 1MJ8H 1S9XA 5T33L 4O2CB 1G0YR 3CFJA 5MP6H 1ULVA 2HLFC 3A6OA 2FO4A 4MCYB 3T04D 3CDFA 3QDMA 3OKMB 2PKDA 3GBLA 4PJFB 1DBJL 1RD6A 5HGDA 5F6HJ 5IVXA 5B38G 2YN5A 4YAQA 5E6IB 4JPIB 1T04B 4LVNB 1GPOL 4ZS6C 4F3FB 3NCCB 3EIFA 3KS0H 2Q7NA 5TQ0H 1GC1H 4D8PA 3EYFA 5D7IA 1OCWH 4L8SB 2HFGL 2JJTC 3MR9A 4QXUH 4F57H 2QLVB 4PTUA 4W6YB 1CFSB 3PABB 4YBLB 5SWQA 3EJZC 2A73A 3TC9A 2F19H 3LRGA 4XPTH 2YD9A 2Q8BH 1JGEA 2OL3H 2DQDH 3QIWA 1LO2H 1YMMB 1CU4H 1QFOA 4UBDC 1S7VA 4L8CB 4KKLC 1KB5H 2IPUG 4R4FH 3WUWA 2KH2B 2WP3O 3P40A 3CVIL 1TCRB 3SDDB 4RRPA 3VWKB 1CD1B 4U0RB 3G5ZB 4YHLH 3BUYB 2JJSC 4P46C 4U49A 3KPQB 2H1PH 4LHJB 1R5VB 3OR6B 5CMAA 4PRNA 3AXLB 4HFUL 5AEAA 4LRIC 2BVEA 1TPXB 2P5EA 3NCJH 4B50A 3O0RH 3WKML 1OAXH 1CE6B 2RIKA 1IM9A 3O4OC 3DGCR 1T80A 5BQ7A 5F71A 2JK5B 4NSKA 2FSEB 4R96A 4QHMA 2XTLA 3P4NA 4HGWB 1T21A 4EI5B 1WWWX 1GIGH 3MXVH 4PJCF 4ZPVB 2OTUA 4OCYL 4APQB 4FQ1L 3L5JA 2PW1A 1A14H 4KJQD 5D4QA 1VFMA 1A7RL 1MCKA 2R39A 1U3HC 2YRZA 4PV9B 3EW3B 3MUGA 3GB7A 3CVHA 1X44A 5ACLA 4UZGA 4CJ0A 3FQTB 4FFWC 4KGJA 2AXFB 5I8KL 5FO9B 2APFA 2P5WE 3C2AL 2IBGA 4NHUA 2R0KH 4NRZB 4L29B 3EDDA 4KK6C 3SCMB 3FRUA 4QY8B 1UM4L 4FZ8L 1LHZA 4M7LL 2FYYA 2AJVH 4KMTH 3QUYC 2ESVE 3SGKC 4X6EB 2GUOB 1UH3A 2VISB 4PRHD 1YEFH 3BW9A 2LE9A 5T1LD 3ZHKA 4NN6C 5JXAL 4OLYL 2IH3A 2XA3A 1ORSB 5I19H 1HDMA 1ZSDB 2BNQE 4BSWA 4Y4FD 1VADA 4K8RC 2CR6A 4EI6A 1Q9KA 2XWTA 5FO8B 5EU5B 3F58H 4LCCA 1N5YH 4MA3A 3QWOA 1I8KB 1BFSA 2DWDB 3TN0D 3SDXE 3W9EA 2OI9B 1RHHA 1TJHL 2FL5B 4D0BA 5JW3L 2VLJE 1G1CA 4XI5C 3GIZL 4GMSH 4G7YL 1KEMH 3MLZL 5DA4A 3RNKA 1NJ9A 2Q8AH 3LMJH 3ZE2E 4K94C 3GJFA 1OAYL 3KPOB 3L3GA 4AEHL 4ELMA 2W91A 1M4KA 2HKHL 2R2EA 4G8GD 1T1ZB 4JFFD 1HIML 1QBMH 5IWLC 4TN9A 1AHWB 3BAEH 4ZAKD 1NANH 4G6KH 3RGHA 3ULVC 1HXMA 5IJVB 1RULH 4EDXA 2F53B 1NCDL 2VLME 1KN2L 4RGNC 1BAFH 3O3DA 3MRIA 1KULA 4K71B 3HCVA 5DRNA 4OZGB 5EBWB 1CICB 3BO8B 2Z31D 4KKBD 2CDEA 1IC1A 3U0TA 5HVWA 2FHBA 3RIAF 1KPVA 5I73B 1XH3A 4DEPB 5CP3A 5ID1B 3PL6A 3OGCA 1QO3B 2BVPA 2AKRB 4Y1AD 4ACPA 3UMTA 3MV8A 4FQJH 4ZS7L 4BZ2L 2E9IA 4ODWA 5FCUH 1LGVA 4JG1H 4OQ1A 4FFZH 4ETQA 4DVBB 4LKXB 3ULUC 5T1DH 3G9VA</