4RGNB

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
213
Chain Sequence
b'EVNLIESGGDLVKPGGSLKLSCATSGFTFSAYGLSWVRQTPERRLEWVASISGGGSVYYPDSVKGRFTISRDTAGDILFLQMNSLRSEDSAIYYCVRDLYGDYVGRYAYWGQGTLVIVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 44
structure length 213
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnB01
3V6OC 2P43B 4XI5C 3GM8A 3RY4A 2AK1H 2YBRA 3MRQA 1EV2E 5DQDH 3EO1B 1CE6B 1LK2A 3VGDA 1W72L 2X89D 4RGND 3HB3D 5EOQL 2MPAL 3KS0H 3OAYH 2IQ9L 2DLIA 1CD0A 1PW3A 4MJIA 3IJSA 3U2SA 2J4WH 3V4PH 4GAGH 5DS8A 4V1DB 2Z8WC 4RDQF 1FFRA 1X7QB 5I76B 2DB8A 3L7FA 5LG1A 1EEZB 4QHMA 1KB9J 4I0PD 3VWJB 2I60L 4NO5B 3WL9A 5KSAC 1Q9OB 2YRPA 4OQTA 3QJFA 5C71A 1LD9B 4X8JA 1WQVT 1OF2B 6FABH 3PWJA 1UCBH 4TNWF 3OJDB 4MNQB 2EE3A 3VG0L 4HIXH 5I1HL 4PB9H 1TQBC 4OD3L 1FZOA 4LLVA 5JOFA 3PJSB 3V5KA 1I3GL 1YY8A 5AZ2H 5EZIH 2AI0L 4KAQH 3ZL4L 1N6QH 2J8OA 5E9DD 1JZ2A 3OXSB 4ODHH 4PB0L 5JORA 2O5XH 4NBZB 4J4PD 4Z7QF 1F02I 1IJ9A 3IU4H 4M8QB 4GSDL 2DJ4A 2Z4QA 1KEGH 2WQRA 3QCUH 5ACZA 3NZHH 1A9EA 5A2IH 3V4VL 5AUMB 3MRMB 3LN5B 4NKOB 3WCYA 4DGIL 1X9QA 3ZSTA 1P4LB 3JZ7A 4P5KA 4UT9H 4M00A 3T0WA 2Y07L 4YHZH 4KXZI 3VXUB 5HI3D 4Y4KA 4WI6A 2VXSH 1CE1L 5BRZE 1BOYA 4H1LA 3RVVC 3T8XB 2C4FU 1AKJB 4Y16C 4ZD3L 2YXFA 3VH8A 4HUXA 1CTOA 1GZPB 5FGCB 3WSQL 1I3VA 2Z91B 1JWMA 3L9RA 1CICA 1U8QA 3U1SL 1VHPA 2DWEB 3T08A 3ULVF 2QBWA 1C1EH 3ZDYF 4ZUVA 4DW2H 4X0KB 2IPKA 3HHRB 2ICWA 5IQ7L 5A2JH 4HKZB 1C5DB 5C0CA 4HIJA 5EDXA 2EDBA 1G9EA 1Y18A 5I19L 2DYPD 5EUKB 2H9GB 3QDJE 4P5TD 1FSKB 3GSRA 3HAEA 4M6AA 3H0TA 5D7SL 1R3IL 3GRWH 1RMFL 4HUKB 3WS6C 1AXIB 3C8HA 3L95B 4LCWD 1S7UA 2YZ1A 3E0GA 3DURA 4PGJA 4P2QE 1R3KA 3U79A 5FYJL 3L6FA 4FQJL 1VFUA 2VISA 1QLFB 1PZ5B 3PDDA 4JM2F 1K6QH 4PJ7F 4DCQA 4DVBA 2ICEA 3ROOA 4Z7NE 2UY7A 2J7LA 1RU9L 5DHVB 2L7JA 1A0QH 3GSVA 3AS3A 3MCG1 1F2XK 4XTRC 5DD5H 1CDYA 3FO1A 3HNSL 4PIRF 1ZLUH 3TCXA 4J1UA 4ZFGL 1RQ5A 2XTJC 3SDAB 1F4WL 3CNKA 2P8MB 5J11B 1FNGB 3SQBA 2HTKD 4ISVA 4XXDA 2A6KA 4XAWH 3O3AB 1GZQB 2HRPL 1A6VL 3P77B 5DJYA 5J3HC 5TJWK 3HE7B 1N0LA 4R7NB 5D2LE 4KJYB 3UBXB 1YPZE 3DXAD 3LKSB 4YXLL 5HHNB 1QFWM 3I3DA 3K8MA 4K07A 3MV7E 3MOQA 4G8FB 3DX9B 3WN5C 1L9NA 3RP1A 3Q1SL 2XN9D 4XNXH 3DMMC 1HINL 1YY9C 4WO4D 4R90H 4RMVA 1Q94B 3FQRB 4X5WB 4TNWK 4EI5B 1QZ1A 1MFEH 2X4QB 4JHWH 4JM4H 2IBZY 1EXUB 3MLSH 3IJHB 5C2BH 3QXTA 2B4CC 3MLZL 3C5ZA 4QRTA 3PL6A 1MRFL 5EO0A 4EDXB 5I1EL 1MHCB 1D5BB 3RI5F 3SKNA 4RAVB 2P47B 2BRQA 1WT5A 3QQNA 4J8RB 2F53E 2RCSH 4LGRB 3SY0A 1G6RL 3OMZA 5ETUA 4JFFB 1IMHC 1SVZA 43C9B 4E42B 1BIHA 1WGOA 5GRVL 4QXUH 3ULUF 3N1FC 2XWJA 4ZFFB 5DQ9B 1I75A 4HUWA 1QRNB 1IFHL 4OGXH 3FB6A 1TCRB 3O9WA 1NCDL 1N3NA 2GFBB 4YUEL 5BRZA 2LTQB 1CFQB 4UV4L 4Z8FL 3GSWA 3QCVL 3QG6A 5FKAA 1A9BA 4F58L 4NWUH 5DD3L 5ESVB 1M1SA 2R29L 2JJWA 4Z0BH 1PKQE 4NKDA 2VC2L 1BQHB 1S7TA 2XZAL 4YFDB 3L3DB 1MCIA 3QDJA 4HUVB 2GW5A 4Q9BA 3KXFD 3ZYZA 2OX5A 1TZIA 4GW5B 2R0WL 5B38G 1P6AB 4OLWH 4PG9B 1M71B 1ZLVK 2E9BA 3W9EB 5E03A 2F8XC 1BEYL 4P2QA 1X44A 4FXGA 3WEXB 4JB9H 4Z7WF 1ZHBA 5BW7A 3P4NA 1TENA 1H15B 3V0WH 2Q87A 1KT2B 5I1LA 4EEEA 3UZVB 5K9JH 4Y4KC 1NKRA 5C07E 2EDWA 3BP6A 1RJZA 1ORQB 2H32A 3K80A 4WCYL 1G9NC 4RGNB 1NLBH 5DJXB 4JKMA 5CINH 5F3HA 1ADQH 5DMGC 2IJ0C 3SJVE 1X3DA 1CICC 4GKSA 1KEMH 5GRXG 3M1BB 1IAKB 2VQTA 4XBGA 5DGQA 4JZOB 2R23B 3QIUB 4EUPA 5C9KA 2IFFL 2GAZA 4ZO8A 3GSNA 3O6MH 4RDQG 1D7FA 1NCWH 1QFUH 3ZKNC 2DKMA 4JFHE 1KNOB 1E6OH 3F6IA 5D2LA 2E6QA 1LHZA 1SBSH 3U1SH 3GIVA 3EDJA 1JUFA 1DN0B 2CO6B 3HC3H 4JE4B 3L1OH 4PJIE 1FDLH 5D7JA 4QHKI 1G7LA 3V6ZA 4KHXH 4XBPB 3V7AE 2A2QT 5H37H 1CFTB 5C0GB 3SKMB 2AKRA 2XG5A 1A2YA 5BJTA 2XWBA 1EERB 1X4YA 3HCVB 3RWJA 3ZTJH 4AQ1B 4POYA 5JO5A 5J6GA 5MEQB 1IAOB 3VXQA 4Y1AA 3AUVA 5DJAA 3WNKA 5L0QC 3PGFH 1NEUA 4KQ4H 5IFJA 4LCCA 5HDLA 5IJVB 4YZFE 3NBNA 2X4TB 4D0CB 2GK0A 3QZWG 3RI5K 1J11A 1JGEB 1INEL 4KRMB 4ZXBB 1MRCL 1HXMB 4GW4B 1EUUA 3RWDB 3D0LA 1OAKH 3D69A 1JZ4A 1CYGA 3QDMA 1LDSA 5E1HB 4KJQC 2B4CL 4K3EH 3VCLB 2F5AH 2IANB 1MFBL 2MCPL 5D96B 3WHE1 4YHPA 4KRNA 2AXFB 3KPNB 1JWSB 1S78C 2EDHA 2E7LA 1KTDB 1PG7L 2C4FT 1OP3K 2VLRE 4XCFL 3OKKA 1VENA 4M1DH 4M4PA 2N4IA 3DJ9A 2DYPB 1A6ZA 3E6HA 2VB5A 4FQXA 4G6FD 1TVDA 4D9RD 2MCG1 2YD1A 4QCIB 1YMHB 3RRQA 1I8MA 1NH6A 4ZFOB 1PKQA 2EE9A 5CEZD 3JV4A 3CFEB 4PGBA 1M4KA 1ZK9A 4JQVA 5JPMA 5DWUH 3RKPA 2Y7QA 2R9HD 5F3BB 4OZFB 4Y19B 1N2RA 3PL6C 3U0PB 5GRWA 1ZOXA 5DRZA 1AXSA 3L7EB 4OQTL 3OBAA 1WT5C 3FRUB 1QR4A 3P9MB 4KC3B 2CQVA 4L9LA 3X11B 1EHAA 4LEOB 4PRAA 5CUSL 5GZNC 3P9LB 5T5FH 4GAYA 2QQKH 4GJTB 1LO0H 2P5EB 2Q7YA 1HWGB 1MRFH 4F7CB 3Q48A 3VWKA 3FT3A 2HFFB 5EPMA 1HXYB 4CN1A 1FFNA 2DQHH 1MFDL 2G9HA 5CBEB 1FG9C 2X9XA 3AB0C 2QSVA 3O9WC 3UTOA 4MSWB 4PJ8D 1BVKB 3TIEB 3MBED 1YYMH 2BVQA 1NDMB 5TDPB 1MOEA 3ZKXC 1ODAA 4N1CA 2X1XR 4RGOL 1JYVA 1WEJL 4W4OC 4CVUA 2FZ3A 1OTUC 5EH1A 4NT6A 2VLKD 4NKIH 5CGYC 4KTDH 1LNUB 3D3VE 4H25B 4GQ9L 1RUAH 3EDEA 4ZSOA 4OIAA 2BDNL 4G7YH 4J3VA 4RFOL 1J1XH 4UNUA 1FL6A 4TQEL 4MCZB 2G2RB 1G9NL 1JZ3A 2UVFA 2Z35A 1A6TB 1MCCA 3WIHH 4TSAH 4S1QH 4PJIA 2R1XA 4U6YB 3ZT6A 4DZBB 5J9PB 3KWWB 12E8H 5DK2A 3OKLB 1OGAB 3MZTA 4ELKA 2XZAH 5IK3B 2BY1A 5L2JA 5HGHA 1N6UA 3CFCL 5EFIB 1HI6A 2BVOA 4YFLI 5C0IA 3H3BC 5F6IC 2E9JA 5HGDA 1ZWIB 3WNLA 2ZCHL 1WK0A 5BW7C 1L0QA 2IMMA 3JV5A 5FEBA 2EDTA 5CJXA 2ZNXA 5K59E 1XGQB 1DL7H 2M8XA 1OM3L 5IMOB 2OR7A 4P23A 1UENA 4JREB 3C60A 3G08A 3ARGB 4KU1A 4JJ5B 3D5OF 3HS0A 5D7IE 1RK1B 2FX7H 4NSKA 5GZOC 3DSFH 1QQDA 1UWEH 2XZQL 5FYLE 4ZOAA 1PLGH 4P4RA 3GBNH 1EAPA 2UWEE 3R8BB 4OIBA 5IKCA 1ZS8A 3MACL 4LRNL 5IBUG 3MGOA 1RIVH 3QSKB 1ZSDA 2DTML 3NIGE 3X3GH 4OLVL 3RIFF 2OL3B 1MCKA 1JHLH 1YEDA 2VQ1B 3DBXB 1CXFA 5JIHA 2F15A 4MLSA 3U9PL 5EBMA 1IGYA 2VLRA 5JDSB 1IGFH 4MS8D 5K9OA 4PGDB 4L4TB 1QFWL 1J10A 1EBPA 3GJFK 3ILPA 4GLRH 1OAQH 1XEDA 3GMQB 2PCPB 2X42A 3TA3D 2HN7A 5GGQH 4N8VB 1AGEB 5EZJA 3C8KA 3O6KH 4ZAKA 4G6JL 2NXZC 1UB6B 2DQJL 4LCCC 4KKBC 3EGSA 5KVMC 5GGRA 2RAMA 4DAGL 2CMRL 5C0NC 4J2XA 2GTZB 4LSPH 2VZSA 3G6JA 5GS0C 3RZCD 1FV1A 7FABH 1N64L 1T20B 1KF9B 3NH7L 4NO0A 4QKXB 3W11D 3OB0K 5KAQF 3QUMA 4G42B 5BO1L 3GSQA 4LSSL 3BP5A 5KS9E 4BFEA 5D5MA 5C3TA 4PJEE 1S8DB 4NKQB 4MXWH 4G9DB 4XP9L 4NIKB 5I66B 1J8KA 1P2CB 1A7OL 4MA3B 4XZUA 5T1LB 5BVJB 1LDPL 1NL0L 2E7LC 2UUDH 1IM9B 1QSEA 4CGTA 4U6HA 4N0UA 3R1GH 3QNXA 4OZHB 3BDBA 5C0RH 1DQTA 5ECJE 1KYOJ 2EDYA 2OM5A 1FAIL 4LLWA 3QH3B 1SEBB 4FQXC 5BV7C 1I7TA 4HULB 2E27L 3CFBA 4QRRE 4L29A 4L4JA 2KL6A 4O02H 3D3VA 5E4EC 4CVWA 4OKVB 3BRGC 1I8KB 1YA5A 1P7KA 4O5LL 1YC8A 2HT4C 1A7QH 2XY1A 4JQVC 1OD9A 1CGYA 4MA7L 4PRHA 5B4MD 5MENA 3RL2A 3H7BB 2ZKHL 2E8YA 5EBGA 5E8OB 2DLFH 4BK5A 3V52H 5FO7B 3ALWA 1UJ3B 1KB5B 4OKDA 4JDVA 5CSGA 5F70A 5C0EA 3MCKA 3QFJB 4L9LC 4V1DE 1FL5A 1J0JA 5FHAL 2H1PL 1LP9A 2OP4H 3EOTL 4A6YH 3VWKC 5A16A 1YNTA 4GXUN 5I8KL 4U6TA 5GS2D 2R0KL 3TGXA 4F7TA 4NHUB 2LU3A 1QKZH 1BIIB 5C9JA 3AROA 4EKXA 5CJQH 4MNQE 5T1KB 2APXA 1FYTD 1HZHL 1LE5B 5CHNB 1HQRB 1QFWI 4Z95L 5T3XH 3C6SA 2DQFA 4IDJL 2QHRL 3IRZA 4WDIB 3SGDH 3GFUA 1VESA 2UWEA 5E5MB 5IHUH 3MA7B 4XP6H 4YBQD 4X9IA 3U4AA 2ATKA 1NUNB 4Q0XL 3B2UC 5MEOA 2EIEA 4WW2B 2ORBL 1MRDL 1F11B 2Z93B 3U7AA 1CLOL 3BGMA 3QUXB 2FH8A 5LCVL 4XPTL 4KMLB 4ODUA 4U1IB 2DWDA 3OHXA 3IGAA 2MSPA 1G9MH 2VN4A 4XMKL 1WBXA 1U8MA 3VXUE 5JW4N 2P5WD 3VI3E 1UEYA 4MDIB 5TDOA 4HLZG 1XR9A 4WU5A 1PBYA 1O7VA 4B50A 5F7EH 1CXHA 3GSNL 4QXTB 3B43A 1BWWA 1KG0A 5FGCE 3F7RA 4TUJB 4LSVL 3QNYB 3HFMH 3KPRD 2DQUL 4IBLT 3V0VA 5CJXC 5CD3B 5IWLA 5CJOL 1DBAH 4ORZC 1F4YH 3QXAA 3QT2A 4P23C 4U1JA 1MVUB 3VFNA 3C60C 4JZNA 4WFEE 1X6LA 1MFAH 2F54D 1ZTXH 4YO0A 5SX5H 3MBEB 5IESL 1HH6A 2OR8A 3UYRL 4OCMC 1K5NB 4PJEA 3OJMB 1Y0LB 4OZFH 5GRJH 4Y7MA 3MFFB 3RA7L 5JLZB 1NCTA 3SDYH 3V8OA 4LU5H 1Q0YH 2XZQH 5SX4I 3BKMH 4DN4L 4JRYD 4XNQA 3M07A 5DVMA 4GRWB 5GS0L 1SMOA 5C3LD 2QLVB 5GPRA 2Q1EA 5HD8D 4RMSA 4GXUM 1I9EA 1FGVH 4R7DA 4MHHG 3O8XA 4QRRA 1FNEA 3S96B 3KJ4B 5IMKA 2B20A 4M6ML 3G6AA 4FMFA 4IMLA 3BO8A 4K8RC 1MF2L 4B5EA 2JB5L 1XGYL 1A4KA 3DRTB 1LO2L 4ZAKC 3GMPB 4RNRB 2FYYB 4IOFC 5DMYA 4L5FH 1CE6A 5T5NF 4XB8A 1WTLA 4OCWL 1Y6NR 2X1OA 1DQJA 1JN6B 5BV7L 1JI2A 1I7UB 1HNFA 2I9LB 3MLTB 4V1DA 1B4JL 1P7QA 5TF1L 1X7QA 3VXTB 5IJKA 1EEZA 3VRLE 3ZDXF 1C16B 2EYSB 5I74B 1EBAA 3VWJA 4NO5A 1Q9OA 2ENYA 2NY0B 4HWNA 1E28A 3MLXL 5DO2D 1LD9A 5CJ5A 4FFVC 5JW4M 1HHJB 3EFDL 1PFCA 3DX7A 1AD0A 2CLZB 5F1IB 3V6FB 2V2TB 3Q0HA 5JUEL 3BJ91 3J8F7 4MJ4A 3DWTA 4MMZC 3OXSA 3ZDZE 3ZHLA 3QRGL 3T0ED 1CVSC 1YMMB 1KPVB 3W9DA 3SO5A 2HFEB 4PLOB 3VFUA 3DGCR 1J0YA 4JFFE 4AEFA 5HVGB 2VSDA 1HEZB 5BZDB 5INCA 3LN5A 4NKOA 3QWOA 5F6HJ 4Q9CA 1N59B 4K2UH 1FVDB 1G7HB 3ARZA 1QRNE 3BW9A 4NNPL 3VG9B 2NY2D 2A9ML 1IGCL 3T8XA 1AKJA 3DROB 4CVXA 4L9DA 4FFWC 2EC8A 1MCBA 1GZPA 5FOBB 1B2WH 1PSKL 2Z91A 4JY6A 3IYLW 1JZ5A 2DDQL 3DX6A 3EOAB 1PVHA 3SKOA 3N9GH 1QFHA 5IB5B 3DSNA 3FONA 5LBSH 5K9KB 3U7WH 3H3PL 4X0KA 4LLQA 2EO9A 2VDLL 1IGJB 2K9UA 1BAFH 3I3EA 4XPBL 3WXVH 3UTTB 2H9GA 1BM3L 1N7MH 4U0RC 3TIDB 3ZKQD 1AGDB 4OJFH 5FCUL 3SOBL 1EEYA 3UEZA 3ZE1E 1F6AB 3WFEH 3BDXA 2V7HB 2F58L 3HTLX 4ACPA 4JCLA 4ZTPL 3VGFA 1J88A 3EFFA 4G7VL 1QLFA 2Y5EA 5EZLB 1JNJA 1ZHLA 1JYNA 1DZBA 2GCYA 4MD5A 1CLYL 1BREA 2BCKA 3TV3L 3MV8D 3TVMD 4HUUB 5DHVA 3GK8L 1BQUA 2DQDH 2Q86B 1JPGB 5AZEH 5IF0A 1L9MA 4RGNE 1QR1B 1RJYB 2BY2A 1ITCA 3SDAA 1A6UH 4XCYB 2P8MA 3CH1A 5FYKU 1FNGA 1XT5A 4YPJA 4RX4D 3LB6C 4OSUL 1RIHL 2W65B 2E8ZA 1J0IA 2ZJSL 5E6YA 3O3AA 3INUH 1S7VB 1GZQA 2DBLL 2JELL 5I1GL 3P77A 1AQKH 4XVUD 5TE4L 4X4ME 3HE7A 4R7NA 4HH8A 4LVNC 5ID1B 3NGBB 3UBXA 4BUGA 1EO8L 1MQKL 3OB8A 2A6DB 5HHNA 4JRXA 1EA9C 3D6GA 4G8FA 4XMLL 1LEKA 1U93A 2J8UB 3DX9A 5SWQB 3UDWA 4ORGA 4MB3A 4KMQA 3BP7B 1KUMA 3BGFB 5T3XE 3KPSD 1Q94A 3FQRA 1KB5H 3NTCL 3QEQA 3F7YA 1BJMA 2EH7L 3HG1A 3MNVB 1ZA3B 4OLXH 5IMMA 4G8GD 2NY6B 1EXUA 1REIA 4RISH 1Z5LA 3IJHA 3SDXF 4NGHH 4ZUSA 4QEGA 1TVHA 3F7VB 4NCC2 4O9HL 3HZYA 5F7DA 5C0AA 4MAYB 3O8XC 3RVUC 3CGTA 3AXLB 5DJDB 1XCTB 4EDXA 5ISZD 3CFJA 5CZVL 1CLCA 1ZMYA 1A22B 3F7PC 3ARWA 4GT7A 1OT1A 3EJJX 1E4WH 3P2TA 4XRCB 1BJ1J 4JFFA 1FL3B 4E42A 3RNQB 4ZFFA 3EW3B 4FFYL 3W39A 1QRNA 2BVUA 5EBWA 3S4SB 2IANE 1T66C 4NWTL 2KPNA 2GFBA 5IEHB 4Z7OE 1VKXB 1CFQA 3EO0A 4PJAB 4K3GA 4TVPD 1XF5B 5IJKC 4X6FA 5HI4D 5IBTH 4HFWB 3X12B 3UYPA 2BC4B 3VFWA 4OCWH 4HWZB 5JXED 1JHKL 4PV9B 4K3JL 4APQB 1FE8H 2V5TA 2W0FB 1ED3A 5TFSL 1B4JH 1JF6A 1MJUH 4WHCA 1XMWA 1ZVSB 1BQHA 3K4AA 2H8PB 1OB1A 1UXSA 2FHCA 3BD4A 3L3DA 4X4YB 1XGRB 4Y19E 3I6LE 4C56B 4YHOL 4F7EB 1EO5A 4Z6AT 1DFBL 4DZ8B 4Y4FD 5GIRB 5GSVA 5ESQA 5HYQA 3SGKA 4P2OB 2P5EE 1FO0H 3Q6FB 3BISA 1IKFL 1I9IL 5ELIA 5FYLL 5KVEL 1KT2A 3LHPH 4DGYH 4P59L 2BHUA 5HHQB 1MY7A 5L8JB 1ORQA 2X89A 5DR5L 3TBTB 2FEEL 2BY3A 1ZAGA 3KDMB 4GG6B 2XA8L 4DKDC 4YWGH 2H2PD 5T5NG 4GRWH 1RZ7H 1U8JA 3W0WD 1IAKA 1FVEB 2R23A 5JQHC 2X6MA 3QIUA 4KK5C 4ODXB 4Q58C 2EDNA 4PGZA 1A6AB 4EOWL 1IC4L 2UV3A 4OCRH 1FGNL 1KNOA 5L6YL 5CBAB 4M7ZB 1E4KA 2XFXB 1PEWA 4X9BA 5D7LD 1MHEB 2YSSB 1DN0A 5FA3A 5EOCH 3UJTH 1QBLH 3NAAL 3O6FD 1YJDC 4HK3N 4IRZL 4AJ0A 2VAJA 5E9DA 1OGAE 3SKMA 3SO3C 4J4PA 3T2PA 1MCWW 1FNHA 3HCVA 5IOPB 1BFVL 5MEQA 4YZFF 1JPTH 2R56H 2MHAA 1HNGA 2PKDA 3FQNA 1ZVHA 2F8VA 1UKQA 4KRPD 1ZA6B 4YJZL 1INDH 3L5JA 4QHNB 1KN4L 3IDYC 3MODL 3TYGL 5GQBA 3HMXH 3U4BL 3SDAC 3RWCA 3TP4A 3QR2A 3K7UA 5EBLB 1OAXH 1HXMA 5I71B 4NQVA 1Z9LA 4G8IA 3ULVD 4XP4H 2V5MA 3BUYA 4P2CG 4HIIB 3BPCB 1A6WL 5TE7L 2NX5D 5E94B 2VDPL 5ENWA 2CJUL 5TE6L 3LY6A 1EGJH 2XZZA 5F9OH 3VCLA 2IANA 3IRPX 2XPGB 3T2OA 1R5IA 3HE7C 3C2AL 2AXFA 1NMCC 3JWDC 3ZE0F 2BNQD 5BZWB 3RNKA 4M7LT 4JG1L 4QYOB 1WFOA 3U30B 4DGVH 5HDQH 1RULL 4L8CB 3CVHH 1CXLA 4FQQA 2DYPA 3GMOB 4L4TE 1OARH 4PJBB 5DD1H 3UDWC 5HY9A 4B53A 3ALPA 4P5TA 1NBZB 3DTXB 2CLRA 1ND0B 4LKCA 4LPWA 3EHBD 3IS1X 4X6DB 1JIBA 3MJ7B 4JM2D 5DEZA 5AYUL 3QIBB 1AY1L 1FFOB 2FEEI 4YEFA 4DTGH 5KSVA 3SBWA 1WCBB 5I18H 3RQ3A 4U1SB 3L5WB 2Q3AA 3NTCH 2A73B 2VDQL 1RHHA 1F3JB 4LSRH 3FRUA 4NCC1 5CZXD 3P9MA 2RQ8A 3V7MA 2V6HA 3X11A 3LN4B 1ZHKA 3T04D 3DGGB 1OGTA 3MBXL 1BD2B 1TZHA 1RIUL 4OCYH 1XCQB 4O2FB 2IPTH 3CAFA 1ORSB 5T3ZH 4HPOL 4ZS6C 1MCPL 2VLJD 2XG4A 4KI5D 4MSWA 4LEXL 4YHML 3MRCA 2LTQC 4ZFZB 5SWZB 4XX1E 1NDMA 2RJMA 3QXDA 1M05A 4OZHE 3PWPB 1JNNL 3QJHB 5HHVH 1NGQL 4M62H 2X7LB 3KYNA 2FD6H 1NGPL 4KKCD 1NCUA 2XQBH 5IHZB 4LGSB 2NY4D 4HK0B 4U7MA 3WUZA 3DXAA 3IDIB 3OF6D 1UWGH 2NY3C 2P4AB 2D2OA 1LNUA 4H25A 4JFEB 1MCLA 1DBML 4P3WA 3GIZH 5T33L 2XN9A 3RU8H 5B39G 1D9KD 3D25B 1HCVA 4LARL 5HHXL 4XHJD 3WUWG 4PREA 1OTSC 4MCZA 2G2RA 4TULL 1A6TA 2ZOKA 3B2VH 2YN5A 1S7RB 4KGLA 4U6YA 4NNYB 1YEHH 4H0IA 4FRWA 3OKLA 1OGAA 4GBXB 5LJYH 3C87A 2I5YL 3D87B 3QFJE 3V4UH 3K74B 3SGKC 5KG9A 3TT3L 5D72H 5FGSA 1TJIH 5DJ0B 1ZWIA 4JKWA 4X4XB 1OVZA 1IQDB 1V3JA 5D7IF 1XGQA 1FNAA 4OI8A 1AR1D 5J06A 4U3HA 1KCUH 5EU7C 1JZ7A 1S7WB 2OZ4A 3MV11 4RGNC 3HB3C 1NC4D 1T2QL 3TF7C 5IVZB 1YJDL 4JJ5A 4XXCA 5AG8A 1G7JB 1E4XL 1T0MB 2AP2A 1WAAE 3M17B 3O2DH 5I6XB 4GS7B 3FQUB 2B1AL 1NBVH 5IIEB 1CGUA 3KHQA 2H2SD 5D71H 3HI1B 4M5YH 5D7KD 2PXYD 4IDLA 3HZMB 5B38B 2OI9B 2OL3A 2NZ9C 2VQ1A 3DBXA 1E4KC 4TTDD 4NRZB 2C3XA 1R3JB 1JFQH 5JDSA 5FM8A 3ARFD 4PGDA 2JK5B 1QACA 2EKSA 4X99B 4LFHG 4LDOB 4L4TA 1DBJL 2VITB 4DN3H 3BKYH 4J4PC 2PCPA 2CDFA 3K1KC 4NDMB 4D3CL 1GC1C 4GRMA 5KZCD 3RAJL 1AGEA 5J6HB 3NCEB 5FUOH 3RY6A 2KQMA 3MXVH 1UB6A 4GAJL 3JWDL 4NQEB 1OCWL 3N1QC 2ZZUT 3BUTA 3D9AH 3MA9H 2VUOA 2I07B 2VZOA 3IJYA 2W60A 4NQSA 1IGIL 1T20A 5KS9F 4OT1H 5HI3C 5JPNA 3RWFB 3GUTB 1JPST 1ZLUK 1OSZB 3CXHJ 3MXWH 4HQQL 4G42A 4U2ZA 3G5XB 3S8WA 1H3UA 4LHUD 1EJOH 1HDMA 3PG2A 4H0HB 1NUFA 1T80A 1S8DA 3W0WB 4G9DA 1T4KB 4M7KH 4M02A 4MA3A 5T1LA 5TPWL 3LRGA 2VDKH 1RJLA 1IM9A 4GRWE 3LEXB 5IFAL 5KSBA 4XMPL 4A2MA 3FOMB 4P57A 1P84J 3QH3A 1WBZB 5DJ6B 1JNHA 4P5TC 5L88H 2IGFL 2CRZA 4I9WD 1UM6L 3AFLA 4TSBL 4YDKL 2APWA 4NN6C 5D70L 3T2NL 4E5XB 3EO9H 3QZWB 2AJYH 1DUYB 2FJGB 3VGAC 1IBGH 3VMPA 1YN6B 4UIKL 5J4MA 4HXBL 3H7BA 3SBWC 2Z9TA 5BXFA 1IL1B 2NXYD 2Y36H 3A6OA 1GAFL 1UJ3A 3WIIH 1EMTH 4FTVD 2V9QA 4EIGB 1MWAB 3VI4F 2J2ZA 3QAZB 5EIQA 4WWKD 5JW3L 3OAUL 1GGBH 1HSAB 3B5TA 1MJ7H 1TZGL 1VB9A 4RMTA 1U8IB 1KCRL 4N8CL 2C3VB 1NJ9A 2HTKC 4NHUA 4CADB 4FS0A 5EORL 9CGTA 5JHLH 3HPLA 4ELMA 1C5CH 5T1KA 4I77H 1TXKA 3CPLA 4S1RL 5CHNA 5GJSH 5CCKL 3TBWA 1OW0A 3RDTD 4FOMA 1C8PA 1LO5A 4M61B 4WDIA 1WZ1L 5DQJB 1DLFH 4JCMA 4YBLC 5EU6D 4YDIH 5E5MA 3TN0D 3MA7A 3PP3K 1ES0A 4LAQL 3KLHD 1MCDA 1YMME 4F57H 2HJFB 3MOBL 5E7BA 2DQIL 3TBSA 4XVSH 4WO4C 1F11A 4NQDD 2VO5A 4P2RD 2DMCA 5ACLA 1H8OA 2L7UA 3QUXA 5IB4B 4HF5L 1CD8A 1YQVH 1U41A 4PJ7B 4U1IA 4N90D 2FBJL 5BS0D 5FUCE 1CLZL 4K7FA 3GI8L 4OB5L 3K1DA 5CS7A 2BVEA 4MDIA 4IIQA 3L5XH 3NA4A 1BZ9A 4M7LH 5ESAB 5CJ8A 4CU7A 1NBYA 1UM4L 3QEUA 3VDAA 4OTXL 5CD3A 2AXGB 4LQFH 3HNTL 1D5ZA 4DWHA 3SPVA 2AEPL 2FRGP 1XAUA 1CQKA 2NY7H 5E2UH 1CVRA 4JDZB 1NSNL 5HPOA 4LOUD 3DOSA 4NQXB 5GGTA 3MRIA 3UO1H 3T65B 2EDJA 3UTTE 5HHOB 3MBEA 3TNMB 1GC1L 2WUCH 1KPUA 4GXVL 5T3ZE 2ARJB 5EU4B 3T0BA 3UAJD 3LEYL 1K5NA 3AS0A 1A5FL 1Y0LA 5IV2B 5JLZA 1V5JA 2FBOJ 3WFDH 4B7IA 1SM3L 3LKQB 3FTGB 2HVKB 1OLLA 3SE9L 3OWEA 1S5IL 4N5UA 4Y16D 3RUGA 1XGPB 4LKXA 4XP1H 4BSWB 5D6CA 5ILTL 3IFLH 5FKPB 3NZ8B 4Y89A 3NIDE 1LGVA 1H3PL 3S96A 4K94C 3X13B 4E41D 4JANA 4BH8B 2RBLA 3DO7A 3C5JA 4JHZA 4KUZL 2IG2H 1QSVA 2J6EA 2Q76B 3OKEB 2VIRB 2R0ZL 3RY6C 4S10A 3GMPA 4RNRA 2V5SA 3WXWH 2FYYA 1JZ8A 2A77L 5FYKH 1JCKA 4HLJA 4ODVH 1HQ4B 3QP3A 1KIRB 4HW6A 1JN6A 3ROLB 4XVJL 5IBUB 5KJRL 3MLTA 1CBVL 4HJ0D 4C83B 3MFGB 1DLHB 2O5ZH 2JIXD 3PQYB 5JR1H 5D93B 2APVA 4HIEB 3PNWA 2J8UE 4J3UA 1U3ZA 1KXQE 5DC9B 1N5YL 2IPUG 2YWZA 2Z8RA 5HVHB 5F1IA 3V6FA 1KENH 2PXYB 1OT2A 4XWGH 3JTTB 1Z0NA 1O5DT 4H5SB 5C1MB 4X5XB 1TQCB 3L3IB 2OJEB 4HAGA 4R0LB 2CLVB 3T3PE 3VFPA 4OAWB 1FP5A 3GGWB 3RIAF 5IM7B 2HFEA 3SDCD 3AREB 5DVOA 1EHNA 4DFIA 4LPUA 3TA3A 1N4XL 4Q6YA 2EXYD 4Z7WB 1FVDA 1G7HA 4UB0L 1UJ3C 3LRSB 1CZ8L 4YH6A 1MFNA 3JVGA 5FM5O 2Y06L 3DROA 4PJAE 1YY9D 3QXUA 5JZ7D 5C7XH 3KPTA 3ME0A 5DRXB 3BSZH 3RZCA 3V5HA 1AJ7L 1IGML 3GMLB 1GGUA 5AEAA 3EOAA 3FL7A 1T03L 1DBKL 1MJ8H 3WKNA 2AJVL 3PF2A 3BT2L 3CFDB 1I3UA 2VXUH 1KLGB 3C9NB 3FO0H 1AQDB 2P42B 3TPUA 4P5MB 1IGJA 1XGUB 2VE6B 2XNAA 1OW0C 2R39A 1U8KA 3BH8B 5A2KH 3I2CL 3R4DA 3UTTA 1BQSA 4QTHB 4RMWA 3ES6A 2LU4A 1RUKH 2E6PA 4WUUB 5LAXB 3TIDA 4C56E 3A6CL 1UZ8B 4YFLF 2LV4A 4FZEH 1F6AA 2V7HA 4NO3A 4DKFH 4MJID 3ISWA 1JPSH 3QUXC 1AO7D 1D3CA 1IARB 2OZ4L 1J8HD 4FQCL 5EZLA 4WEBL 4R4ND 4U1HA 4FXKB 2BFVH 4BELD 4HDIB 2R9HC 4YLQT 4HUUA 4NN5B 1ZKAA 2A9NH 3ARDB 4R4BB 2Q86A 2J1KA 3DARA 1YYLL 4IIQC 4HC1A 2KZ1B 2R8SL 4GG6E 5ACMA 5IFHH 3LD8C 5C0BB 4XCYA 1U8OB 2EIDA 4PJCA 4LCYA 5CP3A 2OL3L 5H94B 2CKBB 1MLBB 1JV5A 3DUUB 5KN5B 2UYLA 4PJ9D 4NQCB 1MEXH 4JO4L 2ZCLH 1MCOL 1U6AH 2DKSA 4K94L 5ID1A 3QDGB 5D8JH 1XF4A 4Z7UF 4JO1H 3MBEC 4Y5VB 2YR3A 4LLYB 2A6DA 1B90A 2WINB 1ZLSH 3KPLB 2YMXL 4PG2A 2X1QA 3GKWL 1R5WA 5SWQA 4YXKH 3KLAB 4WFGE 3GJFB 4M5ZH 5DDHB 3KR3L 1YEEL 2P7TA 5KVFL 4KDWA 5EU6B 2GEEA 3TN0B 4M4RA 2DAVA 4H26A 1KCKA 4G80B 3OPZL 3SKUD 4XCEB 3MNVA 4M9PA 4HGWA 4G5ZL 5CEXB 4F80A 4HMDA 3MJ8B 5DMGD 1DQDL 3TH3T 1DVFD 3UX9B 4MAYA 2P45B 3MLWL 5DUPL 3KJ4C 3AXLA 4JVUA 1XCTA 5DJDA 3U82B 1F97A 3QQ9D 4UV7H 5BS0B 3N50A 4EBQL 2HVJA 1A1MA 2BRRL 2P5WA 2VR5A 1C08B 3RIAK 4Q6IB 4J3XA 4XRCA 3FO2A 1T7VA 3HC4L 5ILTH 3FN0L 4R96B 1FL3A 4HSQA 3NIFE 5TH2A 3OX8A 2JB6B 4HS8H 4ZQKB 1BWMA 2DTSA 3RNQA 1KFAH 3S35L 1HKLL 4NQTA 1LO3H 2AABH 3S4SA 4QRQB 5IEHA 3H9SE 1FBIL 2AGJL 4PJAA 1CR9H 1XF5A 4WHTB 1KULA 1BGXL 3MJ9A 2EDQA 4HFWA 5I74C 2VXQH 1CGVA 1I7RA 2BC4A 1QG3A 2F54A 4PJBE 2H3NB 3U83A 3MO1B 4PV9A 1U3HB 4H88L 1MI5D 2IH3B 4X6DE 4JFDB 1ZVSA 2WWKT 4PP2A 4P48A 5EUOF 3LV3A 2DIJA 1BECA 1PJ9A 2H8PA 1UVQB 4JHAH 2G5BB 3QPXL 2HWZL 4JRYA 4MXVF 1N5YH 3FB8B 5ICXA 4R2GB 3LQAC 5DEFB 3MRDB 4D8PB 4MS8C 4G8EB 4F7EA 3QUYD 5FK9B 3EOBB 5DMJB 4TUKL 4UQ3B 5GIRA 3BQUB 3CCHA 3KYKL 5C0FB 4N0YL 3QIWB 4NKMA 1A1NB 3L5IA 1T0PB 1BD2E 3SQOL 3TA3C 3DNKA 3F5WB 1BHGA 3GHBH 2WP3T 3MV01 4YHKH 4BQ8A 1BF2A 2DL2A 3QPQD 3VG9C 3L3OA 2EEBA 5CSZB 3JVGC 4ZUTB 3FAWA 5SWZE 1MCWM 5E2WH 3ETBF 3RZCC 1FORH 3PWPE 1IT9H 5MP6L 2BSRB 3W11C 3FFCB 1Q8MA 5F9JA 2QSCH 5LWYL 5HGAB 5ITBL 5LGJA 4JFEE 3C5ZD 3WDIA 1KBGH 3MLRH 1A6AA 3CK0H 3H2WA 1AJ7H 4LDLB 4XPGH 4DEPB 3B9DA 4KTEL 4PGCB 5EA0H 1JF1B 1MHEA 5BMFH 4LCUB 1FNSH 1YECL 4GMTL 5EO9A 1AD9B 4HFUH 5C92A 4JFZH 3D85B 1K4DB 4KVNH 1TTFA 4AIZB 3A67L 2VDNH 1JPFB 4XNZC 4E0RB 2ITDB 1OAZL 4JAMB 4OI7A 3I6GB 5IOPA 5DMIH 1J5OH 4N5ED 2YD5A 4UILL 4YE4L 2BVPB 2GTWB 5JHDE 2KDGA 3FO9B 1BZ7A 4N1EA 3BPNB 5B4MC 1ZA6A 2MJWA 2VDRL 4B7LA 3MGTB 3OKYA 4QHNA 2LAGB 2CIIB 2BP3A 4OIIH 3SE8H 4X7SL 1UB5B 3UC0H 3WO4B 1L7TL 2B2XH 2XXMB 2YK1L 3QQ3A 1HHKA 1RVFH 2VL4A 2D31B 5EBLA 3KLSA 2CK0H 3UTSB 1SMAA 3U46B 4F33A 1T04A 4HIIA 3BPCA 4OCXH 1I3RA 4YNYB 5E94A 1FIGH 2D3VA 3QDJD 3TH4T 3WE6B 1ETZB 2HG5A 3QG7L 4LLUB 3S36H 4U3CA 2DRUA 4C55A 1UJTA 4WI8A 3VXNA 3BD3A 3NGBC 1SJEA 5DRWB 5BZWA 3D39D 1GOHA 5DTFB 2VABA 2D7MA 4URTB 4P2QD 4PG2C 3HNVL 2J6EL 4P49A 2R69L 5I15L 3GMOA 1HHIA 4C4KO 3QQ4B 1AP2A 4U1KB 1H9VA 3N85L 4X6DA 1T89A 3O3DB 1IEBB 5DF0A 2NY6C 2EDDA 2PR4L 1FFOA 3IDXL 4NQEE 1U8NA 5GZOD 1MIEL 1J8HB 1WCBA 4MAYC 3NFSL 4U1SA 25C8H 4R3SB 2Z8SA 2E7HA 2A73A 3DX8B 3MV8A 2VTFA 2QADD 2VZUA 1F3JA 1KGCD 1QEWB 3K2UH 1BOGA 3BPOC 4KKAD 3QNZB 1CT8A 5E99L 4ZOEA 4UTAH 1CFSB 4IJ3B 4M9OA 4F9PA 4X7DC 5IHBA 4KZDL 2D7OA 3RGHA 4W81A 1XCQA 2IWGA 4AEHH 2NLJB 2NW3B 1X5KA 3BN9C 4RX4A 1HILB 3W0WE 1ORSA 3MV7D 1XIWD 4HBQA 5D7JD 5KTEH 3LQAL 4PTUB 4C59B 4ZFZA 5SWZA 1P4BL 4AEIH 5DC4B 4DKEH 1WFUA 3T4AB 3O3UN 3KNBA 2X7LA 3MUY1 4QRPB 4KK6D 4QHUB 5AD0A 5EC1B 3EAKA 2BVYA 1CS6A 2B1HL 4HK0A 4X98B 4BZYA 1UZ6F 2NYYD 4JFXB 4LIQL 5ALBL 4JFEA 4Z7QE 5K9QI 1F8TH 4KKBD 1RUML 2BJML 1A7NH 3CLFH 4I3GA 1LE9A 3HZKB 2A74B 4Q9RL 4JFOB 3D25A 3K46A 2IBGA 3KPSA 1AR2A 2F53D 3X14B 2PUQT 3WIFA 3BWAB 5DA4A 1ZANL 5DT1L 3IFOA 3O11A 4G8GA 2CKBH 4ESKA 1S7RA 2AJ3B 2EIBA 5HD8C 1I1RA 1UM5L 2R2HB 1FZKB 3FOLB 4X80H 2VZVA 5DI8B 4M6OL 4XNUH 4OZIF 3VXRB 1T2XA 5IW6A 4PUBH 4HV8A 5L7XH 2J5LC 1ONQA 3EBAA 1NCCH 1Z9SA 2VDML 3ZDYE 1URLA 3GJFH 1S7WA 4M1GH 2FIKB 4HG4K 4DQOL 1EFXB 2K1MA 3QO0A 4TPRH 5IVZA 4JPWL 3GMNB 3VH8G 3GBML 3H42L 1F4XL 1G7JA 2F74B 5HHMB 4HLZH 3NMEA 3HC0B 3FQUA 4BQBA 3B5HA 2J88H 3P3YA 1CGWA 1A3LL 1U9KA 3G9AB 3L3GB 5BOZG 4PRBA 4WFHE 3QXWA 5DO2C 5B38A 2EECA 4AL8L 4RMUA 4M7ZC 2BX5A 4HC1L 1DBBH 3TBYB 4MQ7A 5ID0B 5CEZH 2EDXA 4NRZA 1R3JA 1HYSD 3LS4H 3O3EA 4PJ7E 5GGUB 2AQ2A 3OB0H 1MAML 1DE4B 4LPCA 2JK5A 3HAEG 1H5BC 4X99A 2ZUQC 3WHXB 2P48B 2RFXA 5JOEA 1I4FA 2VITA 3CU1A 1QBBA 3O4OC 1ZT4A 4NC1C 3TZVD 4KTEH 1GGIH 4NDMA 3GI9H 2PYED 5C07D 4JPKL 2K3TA 3CMOL 2P44B 3GSUB 3VXSB 3NFPB 5J6HA 4N9GB 4ZPTA 1GL4B 3SJVD 4EQ2A 3EDKA 2DD8L 5E2TH 4KQ3L 2HAZA 4BFBD 5E5RB 3RWHB 2EC9T 2NY2C 4F37K 3GUTA 5EWIH 4UTBH 5I75B 5HHOE 1OSZA 4I2XB 4TVSa 3PP4H 3G5XA 1V7NL 1ACZA 3QHFH 4I13B 2PYFB 4X7SH 1SBBA 3QFDB 3W0WA 2FIRT 4MA8H 2OR9H 2FJHA 2A1WH 5JXAH 4DVRL 4N0FB 1YNKL 4P46B 3LEXA 3U30C 5F9AC 1LO4L 1GPOL 4UAOB 2HH0H 4UBDD 5EU5B 1NDGA 2AJUL 4NHCH 4UIMB 4OF8A 4S1SL 1VPOH 3WS3B 5D7LA 4LSQL 1T2JA 4HJJL 4KMTH 1AGFA 1T89C 5KOMC 3ZT5A 3O6FA 4P23D 1JTPA 4GW1B 4EN3D 5IB3A 1DN2A 4YDVB 1JGLH 2PW1B 2R4SL 2FJGA 4HWBL 4OZGB 3MJ9L 1IL1A 4JPVH 3ULUE 3Q3GB 4NJ9H 2WUBL 1U58A 1TJHH 4IRJB 4QRUA 1QOKA 3IAQA 4B0MM 2F19H 3CDCA 4I48B 1MWAA 3TFKD 1BJ1H 2NY5C 4FQ2H 1EHLH 3E2HB 4F9PC 1J1OL 3PQYE 3BAEL 2AJZB 4LVHB 4R4FH 1D5IL 3WFHB 4Z77A 1U8IA 2VLRD 1FZMB 3ESVF 4QTIH 1KCSH 4MD0B 4OM1H 3MRJB 3LQZB 1RUPL 3CXDL 3PXHA 3ARXA 5AG9A 3VFSA 2NX5A 1S9WB 4LDEB 5E8DL 1VGEL 1YEKH 4YGVA 2Y25A 4QO1A 4K8RD 4XC3L 1NLDL 5EC2A 2Q8BH 3HI5L 5CP7A 4A2LA 4RWYL 3DI3B 1CQYA 4LSUH 5FUZL 2EDEA 1X4ZA 3D39B 4O2EA 4X6BB 4GH7B 4Y8DC 2F5BL 5CILL 3V6BR 1KLUA 5J13B 5E6IB 4PGEB 3MOAH 2HJFA 1V7MH 3LMJH 1VFMA 3LIZH 4MDJB 5F9WC 5IB4A 4O00A 3TNNB 4JM2A 4Z7WE 5D2NB 3WLWC 2ICWJ 1MFCL 4MNGA 2L4OA 4OLUH 1MCQA 3C08L 5HPMB 4GG8B 1J1PL 3H9ZA 2XXCB 1PAMA 4YDLB 3QUZB 1HOCB 4ZUUB 2QADB 3ARBD 1FCCA 4XPAH 2MKWA 2VL5B 4P3CL 4L8SC 4WFFE 2ZUVA 2YPVH 3OKDB 2CSPA 4WWID 2AV7A 4JN1L 1DQQB 2V17L 4BZ2H 1TMCB 2FR4B 1T0NB 2FO4B 5D5MF 4TN9A 1IEHA 2X4SA 1K8DB 2QHLA 3I6KB 4JDZA 5GHWH 3D3VD 4R6UA 4YQXH 4NQXA 2VLJA 4XC1H 3RVTC 3LEVH 1A3RL 4XH2A 3T65A 4JPIB 5HHOA 5ABDE 2FJFA 5B39B 1J0HA 1NAMB 3TNMA 4GS7C 5HI4C 1ACYH 2C1PA 2ARJA 4WUUE 5EU4A 3WUWB 1QYGL 3QA3B 4KY1L 1RZ8A 4OZ4B 4EUPG 5IV2A 1CDHA 3L3JB 5JXEC 1JBJA 2Y5TB 3OF6A 4ODTL 3LKNB 1S9XA 4OD2B 2E5EA 3DYPA 3MLUH 5F44A 1Q9WA 3FTGA 4XAKE 3OKOA 4Y4HD 3NCYS 3KPOB 2HFGH 1XGPA 3SDXB 4FFWD 4FQLL 1JHTB 4BSWA 5FKPA 1R5VA 3X13A 1LEIB 4U1GB 1CK0H 4BH8A 1JRHL 3FZUD 5F96L 1MIML 35C8L 1BX2A 2R0LL 3EIFA 5C0BE 2QEJA 4MCYB 2Q76A 2RGSA 3OKEA 2VMFA 4G43A 4U6XB 1CWVA 2FLBT 3QYCA 4CN6A 4KPHL 5FYLD 1LP9F 4J3WA 4PRNB 1HQ4A 3ARVA 4NQCE 1B0RB 4WY7L 4FNLH 3ROLA 1ZLWH 5GS2H 1G7MB 1H8SA 1KELH 1SEQL 3CZFB 3QDGE 5SWSB 4C83A 4PJGB 1NC4A 3EYSL 3O6LL 3RKDD 4HIEA 2H2PC 3LZFH 3QI9D 3S34L 2VWEE 3S98A 5JIIA 4S2SB 3FHAA 1KJ3H 2Y6SD 3U36B 2PXYA 3JWNC 5I30L 3JTTA 5EG6C 4BQ6A 4QY8B 4OGYH 5I2IB 3MRFB 2BNRB 4X5XA 2NY5L 3CUPB 3CVIL 2OJEA 1FVCA 2AEQL 4X7TA 2CLVA 5DHYB 5J1AB 5BS0E 1FLRL 1QBML 4IS6B 4HS6A 3O6FC 3B9KB 3D0VB 3DUSB 4OAWA 2OJZL 1NCBL 4KROD 4CNIB 5GRUH 2H6PB 5HSFA 1Q72H 3AREA 1CD9B 5L2KB 1MUJA 1DQLH 4ONFL 4F15B 2PYEB 2Q20A 3G6DH 4Z7WA 4LLDA 4EXPX 2GUOB 5IQ9A 2WIMA 3JV6A 3U4EB 3LRSA 1TLKA 3SJVB 4KRPC 5D1ZD 3QAZC 1WF5A 2FGZA 4Q74A 1FRGL 4JY5L 4U49A 2W9DH 1A7PL 3M8OH 3P11H 3GMLA 1TETH 4Z7VF 1RK0A 3NABL 3AU1A 2D9QB 3ULVC 4POUB 5MHSE 4N0CD 4BKLA 3CFDA 1FFQA 3ULSB 3V2AR 4JFDE 3RL1B 1KLGA 2FX9H 4QRRD 1UXWB 2R1YB 1AQDA 5EN2A 3LS5L 4ALAL 3IDNB 3BH8A 3GSOB 1CXEA 1L7IH 4LP4A 2NY1B 5L9DH 4NRYB 3PE9A 4LNRA 4FZ8L 3O2VL 3D18B 1JRHI 1NANI 5E95B 4QHLB 5I1IH 2YEZB 4OV5A 4WUUA 5LAXA 1KB9K 1QSZA 3IDMB 1UZ8A 4O51B 1Q0XH 3TM6A 2C5DC 4HEME 3FQTB 5CSBA 4TUOA 3IKCB 1P1ZB 3EHBC 4FQIH 5DD0H 2D03H 4HT1L 1OWRM 1FN4B 1S9VB 1T22B 4JM2C 4LLMB 4AG4L 5LQBH 2CRIA 4NN7C 1KN2H 3O3BB 4XGZA 1WWAX 2DQTH 1NAKH 4HDIA 5EIIA 1Q9LA 5ALCH 3U0WH 4PY7B 3VWJD 3S3SA 3DV4B 1Q9KB 4TVPL 5I1JL 1JMXA 4K7PL 3S5LA 1Q1JL 4QXGL 2XI9A 3S3JA 1JNLH 3EYUL 5I8EB 4FTVA 1FQ9C 4FFZL 4HCRA 4MNQD 5DZOA 1U8OA 4JQXA 1CTNA 5CZXC 3TO2B 4FQ1L 4WWKA 2EYTB 3FFCE 3ZLQC 1MLBA 3P0VH 4PPTA 4O58H 1M7XA 2QQLH 3ILQD 3DUUA 3WFCH 5KN5A 3BVNB 3BRDA 1J12A 4NQCA 5JMRA 2GITA 1W0VA 4O4YH 4NJAH 4DK3A 4PJXB 1I8IA 3OR6B 4KI5C 5A40E 1MHPL 1YNLL 4Y5VA 3NPZB 4LLYA 3KPLA 4XVTH 4TNVK 3PWUB 4LMQE 5MERA 1OAUL 3ZZ1A 4KKCC 2ERJB 1YEJH 2FDBP 3AAZA 2NY4C 1NMBL 1DEDA 1KJ2A 5EU6A 4R9HA 3TN0A 3CX5J 7CGTA 3VXUD 4G80A 1GCFA 2VKXA 1RZGB 1AKJD 3GHEL 1D9KC 4OLEA 2O5YH 4XHJC 5TQ2H 1NCNA 2AJXL 2ENSA 1A21A 5C0DB 4XP5L 5L8LB 1VEMA 4NM4H 1W0WB 5BS0A 4KK5D 4OCSH 2GT9B 3T4YA 1C08A 4MD4B 1QA9A 4Q6IA 4WFED 3UTSE 2LQRA 4R96A 2A38A 2JB6A 4ZO6A 3ULUC 2YUVA 5F7LB 4CU8A 3CU7A 4YK4B 1NFDA 3BKJL 1KTLB 3I9GH 3TWCH 1AR1C 1MCNA 2WK2A 1F4HA 3F62A 3KPQA 4I3RH 3KG5A 1S7SA 3CFKB 4W6YB 5D93C 3RGVD 2GSIB 3OAZH 4QT5B 5GJTL 2IADA 4IHOA 5CKAA 4M48H 4M7JH 4F7MB 1U3HA 4Y2OA 2VAAA 5CEYB 5I1DB 5J89A 3G04B 5GSRA 5HVHC 3P4OA 3AY4A 1MCRA 3UPCA 1OTTD 2PXYC 2XRAH 2G5BA 3KYMB 4WU7B 3WBDA 1MWAL 3HI6H 4YEEA 2VXVH 3SDAD 2MQCA 3FB8A 4TTDC 2ZUUA 4M6NL 1MH5B 1J8HE 5CMAB 5DEFA 3WD5H 4D8PA 4G8EA 1FZJB 4QF1B 3EOBA 1NC2B 3MRRA 2VXTH 3ULVL 3VRIB 4OFIA 4HKBB 3AREC 3FB7B 4RZCA 1QUNA 3HE7D 3AS2A 4XPFL 3SKJH 1CF8L 3OZ9H 2XYCA 3F5WA 3MRKB 2PW2A 4KJPD 2HKHL 1NAMH 4K23L 1A1OB 3QWRA 5D7IB 4ZUTA 4GUPA 5J12C 4UI2A 3WJJC 2V9TA 5CIPB 3E6FB 4WNQB 2VDOL 1BFOB 1KC5H 1GJIA 4EI5D 1RI8A 3MRNA 5ITFA 3S36X 4QRPE 1UACL 4ETQA 3W2DH 2BSRA 1M7IA 3EYFA 3OKNB 4YHNB 3C6LB 1W72B 4TSCL 2KUTA 4PTTA 2IAMD 4UU9A 2QKIB 1MPAL 4X6CA 3N1PC 1OSPL 1CGXA 2DJSA 1NGWA 4RIRB 4PRIB 4F3FB 1I9JH 1XF2A 3FMGL 4GO6B 1B6DA 1T1YB 4L3AA 3NACH 2Y1VA 3H3KA 4JFFD 5ADPH 3EDDA 4R26H 1RZKC 2BERA 4R8WH 4Q9QH 3TJEL 1JPFA 1QRND 2BOBA 3HR5A 3I6GA 2V9RA 4BH7B 5GGVL 1DDHB 2V2XB 4F7PB 3VXRE 1K4CA 5TGBB 3NN8A 5E70A 2BVPA 3SDCA 2GKIA 3FO9A 4XPHH 4NN5C 5E5UB 3TT1L 4YX2L 3ARYA 3WV0A 3MGTA 5AWNL 2E7MA 1TJGH 2Y72A 4G6KH 2CIIA 2NXYC 3ARTA 4U33A 5K93A 1I1AB 5KS9B 2D31A 4HPYH 5I73B 4JQXC 2EH8L 1AFVL 3PDOB 5HHME 3QCTL 4XHQA 1E27A 4WWKC 4HS3B 3U46A 3REVB 4ZO9A 1F58H 1P9MA 1N6VA 1R3LB 2B0SH 4NPYB 4FQHB 2A0LD 4YIQA 2AV1B 2C26A 1C5BH 2YD6A 5DRWA 1YEIH 4OLZL 1CGSH 3VGGA 1IAII 4M43H 1JGUH 4LBEB 5HYJB 2JJSA 1TNNA 4MJ6B 5DYOA 4IRSB 3IFNH 4I4WA 3QUKA 3LDBB 3QQ4A 5I1KH 1BQLL 5KANG 3TN0C 5E2VL 5FA4B 3ULUL 3KLHC 3VXSE 3VD4A 3VE0B 1IEBA 3MPCA 2VZTA 3P4LA 3W5NA 2HLAA 3P73B 4ZTOL 5GISH 4JDTH 1AO7A 4X4ZA 1J8HA 4EIZC 4TYUA 2QQNH 4EQ3A 4R3SA 1I9RH 3NVQA 3E8UL 3IVKB 4KWUA 2X4RB 2C9AA 3DX8A 3QIUD 1OPGL 5DLML 4LVOC 1QEWA 3OGCA 4YFEA 4JG0H 1ZEAH 4Q6IC 3UPRB 4I2XE 4TRPH 1CFSA 3ZDXE 2NZ9D 1DANU 3QHZH 2ZUTA 5ADOL 2L0DA 2NW3A 2IH1B 4G6MH 1T3FB 5T1DL 4PTUA 2OTWB 3VRJB 5C86A 2JCCF 4PJ9A 3ZYJA 2DM2A 4UT7H 3BEVA 1JYWA 1SJVA 3PV6B 5T3XD 3T4AA 2FB4L 4LHQB 2ZCKH 1VFBA 5DUMH 4WUKH 3BZEB 2PO6B 4LOUC 2CDGB 4QHUA 4CN4A 4JFXA 4ERSL 4BYHA 3VFTB 1MCJA 3O2WH 3UAJC 4WTXA 5EOTB 5GS1A 1AE6L 2A74A 3LKOB 3HMWH 4JFOA 1ZV5A 4H8WC 1U8LB 5D1XB 3VA6A 5DK0A 2YUWA 4ZXBD 3GO1H 5I0ZA 4OZGE 4AH2B 5F7MC 1JF5A 5CGMA 1CL7L 5E00A 4JO2H 1RURH 4LASH 4MAUL 3VD7A 3KJ6L 2X4PA 2VH5L 4NRXB 2AJ3A 2D7TL 4EVNB 3U0TA 2ZG3A 1DVFA 2R2HA 2HLFD 3FOLA 3LSOB 4QOKD 2FO1A 1RZFH 1GIGH 3PABB 4NNXA 2IAND 1B6UA 5DI8A 5E8EB 3CMGA 5DJZB 1EPFA 2RR3A 3VXRA 1AI1H 5TDNB 1HWHB 1IAIH 1AIFA 5C08B 4DOHB 1UH3A 4CMMA 3BE1L 4ZOBA 4EDWH 2MTPA 5KSAB 3EYVA 1QNZL 1SJHB 2PNDA 4TOYH 1RZKL 3ESUF 1RV6X 1G6RB 1BVZA 1WISA 2IBZX 3THML 2F74A 1A14L 1CCZA 3MREB 4HJ0C 3IETB 5KSUB 3D39E 1TQBB 3HC0A 3D1MC 1LEGA 3CJJA 5KW9H 3PWVA 3RGVB 1G1CA 4UINH 4P9HH 4Y19D 3OKMB 4F8QA 3I6LD 4CKVX 1HHGB 1FPTH 4OFKA 1CU4H 1Z3GL 3FQWB 3MJ6A 1EFQA 2NNAA 1MI5A 1KIPB 2BOCB 3D48R 3B6SB 4OF0A 3LH2H 2HKFL 5D2NE 5GGUA 2X5PA 1DE4A 4HCRL 2P5ED 4AK1A 4U6VH 3VXOA 1G0DA 3WHXA 4UUJB 2DQGH 3CLEL 3RPIA 3V5DB 2YKLH 3M45A 1LK3H 1MNUL 2OTPA 1WFNA 3QUYA 4AMKL 1XF1A 3GSUA 1XF3B 1KGCE 3Q5YA 3NA9H 5FHBL 4N9GA 3RX7A 3SDCC 5H8DA 2R2EA 1MJJB 4K9EC 2WWKO 15C8H 2EXYC 1KJVB 2ED8A 3P4MA 2YPLE 3UJIL 1F5WA 3LKRB 1QLEL 5IBLC 1SYVB 5I1CH 3MROA 3F58H 5DJ8B 1KJ2L 5H2BB 4I5BA 3D2UB 2D0FA 5DMKB 1G7IA 2CO7B 4GKOA 4I2XA 4EI6B 4PJDF 5JZ7C 2E7CA 3S7GA 1P9MC 1PY4A 2PYFA 4KXZH 5TQ0H 3IU3A 4GMSL 1WIOA 2EE6A 5DJCB 2EH8H 2MQ0A 3NPSB 1G0XA 3FQXB 1CL7I 2IAMB 4MXQD 1OGAD 2WP3O 4N0FA 1DEEA 5IGXH 2DQEH 2CUHA 3VFGL 1C7TA 2JJSC 3I50L 3SDXE 4QRSA 3IXAA 4UIMA 1K85A 4HKXB 2DLTA 4HKJB 3STLA 3C2SA 2WANA 3GNMH 4KHTL 5E1AA 4GW1A 1OP5K 3BDYL 4PJFB 5CIPH 3ARGD 2O61B 1BLNA 1F6LL 1F13A 1EIBA 1GHFL 2XTJB 4R4NC 3Q3GA 3OR7A 1YEGL 3PP3H 1W72H 3MYZA 5EOQH 2MPAH 4I48A 3RVXD 1KIQA 3IDUA 2IQ9H 4OFPA 2KZWA 5SWSE 4PJGE 3VW3L 4U7KA 5GGSB 5DFTA 2AJZA 2QSQA 2HFTA 4HMEA 4H8WL 2I60H 4K3DL 3LQZA 4L4TD 2ZNWA 4JKPL 3RWGA 2CH8A 4PJ9C 4HBCL 3HR6A 4FMKA 2FGWL 2H26A 3DMMB 1IGTA 3VG0H 5I1HH 1T5WA 2NW2A 1T83A 4J7RA 4OD3H 2BNRE 2C7UB 3D39A 1CXKA 3K3QA 1I3GH 3ZL4H 4X6BA 2AI0H 2FX8L 4LSTL 2ATPA 4PB0H 1T1XB 3BIBX 5GS1C 2X40A 1UFUA 5HJ3B 4LQ1A 4MDJA 43CAB 5KOVC 5L2KE 4GSDH 2PYEE 4NZUL 1WUNT 1NGYB 3TNNA 4BSVA 1HIML 2ZSVA 5D2NA 3N1MC 4G9FB 3V4VH 4PRDB 1WLHA 4NZRL 4DGIH 1KYOK 1SY6A 4OD1L 5CWSA 3MRQB 5AAWA 1DVFC 1LK2B 5HPMA 2Y07H 1V3KA 3QQ9C 3QUZA 1HOCA 1CE1H 5T1LD 4KVCL 1IM9D 4ZD3H 3T1FB 1WZLA 3Q5OA 3FRPA 5HYSA 4RFEA 1AGCA 3WSQH 3P0YL 3OKDA 4A6YB 4QHMB 3IF1A 5FV2A 1YPZA 4PYGA 1CDIA 4HMCA 4WGVB 2YD7A 2ZPKL 3QJFB 4KK8D 1VADA 3N0PB 3MV7A 1XIWA 4KUCD 5IQ7H 5HTSA 3MCLL 5CLTA 2C1OB 4NUGL 4JPIA 4Z7UB 1NAMA 5I19H 3DECA 3TO4B 1FZOB 4LLVB 5ICZB 5JOFB 2GYSA 3QA3A 3V5KB 1H3WM 4NP4L 1NUDA 3L3JA 5D7SH 1R3IH 1RMFH 2Y5TA 5CFHA 1W8OA 3LKNA 4K9EL 3MNZB 4OD2A 2DI7A 1G7QA 1CG9B 4NM8L 4RGMB 3QFJD 5FYJH 4FQJH 1BBDL 4YC2C 2P46B 3SDXA 4UT6L 3UZQA 3A6BL 3O0RL 1JHTA 2F53A 5IT2L 3UTZA 1RU9H 2WIIA 1LEIA 1EO7A 1VSCA 3BESR 3QUYC 3NCYP 1DQML 3VD3A 3HNSH 5T1KD 4QOKB 4Y4KB 2AQ3A 4U6XA 4ZFGH 4JR9L 1F4WH 3L3HB 3VH8B 2DL9A 2AXJA 4D9LL 1SYSA 2BNUA 1B0RA 3L9RB 1CICB 1U8QB 5AYQA 3QPQC 1G7MA 4P9ML 3DVIA 4PJXE 4ZUVB 2HRPH 1A6VH 1BBJB 4ZDHB 3ZE0E 4ZG1A 5I75C 4ELMF 2CDEB 5C0CB 4HIJB 3WFBL 3UROR 2XWTA 2Z31D 4PBWD 3QUXD 4LCIL 3GEWB 1Y18B 4NZTL 4YXLH 1AXTL 2EKJA 5DGRA 1BMGA 3BEWA 3F12B 4M8VA 3GSRB 3HAEB 4U05A 2FSEB 3Q1SH 5LXGL 1HINH 3C5ZC 2LVEA 1T7ZA 1S7UB 3BMVA 4AM0A 5EUOB 4QY8A 3DURB 4WGWB 2FECL 4HEPG 3SDDB 1I1FB 1IC5L 3L6FB 2BNRA 2VISB 2Z92A 3CUPA 5DEGB 5C09B 5L0QB 3MLZH 4G3YL 2ICEB 3EDFA 3ROOB 2X70A 5DHYA 1FH5L 4HH9B 1UYWL 4IS6A 3B9KA 3DUSA 4WEMB 1RZIB 5I1EH 4PS4L 3TZVA 3BXNA 5L2KA 1T1ZA 2OCFD 2AK4B 2AQ1A 3FO1B 4D0BA 2PYEA 4J1UB 5C07A 1G6RH 4N5EC 4JN2B 1G84A 4UDTA 4JGJA 1S5HB 5KVDL 1D6VL 1G6VK 2PTVA 3U4EA 3SJVA 3T0VA 4XXDB 1IE5A 4N1HB 3O41A 1IFHH 1FLTX 2Q8AL 2DM4A 1NCDH 4BZ1L 3E2HC 4YUEH 1R0AL 3PGDA 2NZIA 2VLLA 4UV4H 4YHLL 4Z8FH 5BQ7B 1RZJC 2BSTB 5C70A 3SHSA 3QCVH 2IBBA 3LCYA 4JGMA 3VXMD 4F58H 5DD3H 1F90L 2YD9A 5BVPL 2R29H 5FDWA 4D0DA 2R1YA 4OCLC 4I0KA 3QULA 2VC2H 1T83C 4NRYA 4WJ5A 3D18A 2BMKA 1UQSA 4QHLA 1BPVA 2D4DA 3IDMA 4JFYA 4O51A 5E2JA 2YRLA 1A7RL 2GHWB 4U4BA 1TITA 2R0WH 4L8BB 3PL6B 5EO0B 3IKCA 1P1ZA 3SKNB 5DFWH 3WLBA 1CFVL 1FN4A 4LLMA 5D2NC 1BEYH 4EN3A 4PYHA 3O3BA 2Q7NA 2OK0L 3HRZA 5EZOL 1DP0A 1Q9KA 1QPXA 5J56B 2NY0D 5B8CB 4Z78A 5GRZA 3QUZC 3JWOC 3FB6B 2QADC 3IFPB 3AB0B 4WCYH 1R24A 5DD6A 2EEAA 4XNMB 3O9WB 4BFIB 1N3NB 4XBEL 3BJLA 1J0KA 2FL5A 4KKAC 2EYTA 3ZKXB 3NCJL 5FKAB 1A9BB 2AJSL 1JYXA 2IFFH 3BGAA 4NO2B 1XIWC 2W38A 5DURB 1YMMD 3OR6A 2UZIL 4PRIE 5D7JC 3R0MA 5JW4Q 4LPYA 3AGVA 3BH9B 4XCCL 3PWUA 5JA8B 3KYAA 5D1QD 1Z0MA 1MHHA 3S37X 1XZ0B 4KK6C 2NTSP 2W0LA 5IG7A 1JGDA 2NYYC 1A47A 3MLYL 3GRWA 4JQIL 1AC6A 3X3FL 2ICES 4U3XA 5D9SA 1S3KL 2FATL 1YDPB 1ZT1A 1NFIA 1OQOA 2YRZA 3TYFA 4ODSL 4WI7A 2A6IB 3S88L 2LABA 4LF3B 4W6XB 1RJZB 1KCVL 1INEH 3QDHA 3UJJL 1MRCH 3ARBA 5F3HB 3UTTD 1P4IL 32C2A 3BYYA 2X1WL 1OOAA 4GKSB 5T3ZD 4G6AD 4OM0L 3CC5B 4OV6F 2B4CH 2GAZB 1MFBH 1QTYT 2MCPH 2ICWI 3GSNB 5HYJE 2GSIA 4HK3J 4QT5A 1PG7H 4XCFH 1MREL 1RUQL 3Q6GL 5E08L 2YUXA 1N0XL 4FABL 1JUFB 4U7SA 1LILA 5CEYA 3RHWF 4JFQA 4FP8L 2AXHA 1R6VA 1G7LB 3UYOD 2JE8A 3FCTA 1CDGA 3BZ4B 4WU7A 2AKRB 1A2YB 2XWBB 3ECBB 1UA6L 1MH5A 4U1MA 4Y4HA 5CMAA 1WBYB 2VNCA 1HYSC 5LXGH 2FWOA 4Y1AB 5DJAB 2BK8A 4QF1A 4XWOD 1RZJL 4F8TA 3VU2A 2NXZB 5IFJB 2XKSA 4HGKC 4N9OB 3B9KC 4LCCB 1IC7L 1B0GB 2ZUSA 3VI4E 4HKBA 1DR9A 3TZVC 4OQTH 5FYJE 3FB7A 4O2CB 4L1DA 4OZIB 3LPGA 5CUSH 3MRKA 4OUUA 4PJCF 2V2WB 1IKNA 5GRYA 1RD6A 3FKUS 1A1OA 5D7IA 4MJ5B 3U6RA 3BIKB 5MEPA 3D69B 1MFDH 4DUVA 3QEHA 3OJ2C 3QDMB 2HT3D 5M95B 4WNQA 2G60L 2PN5A 1QLRA 2DBJA 2B7DT 1JGVL 3ZTNL 4RGOH 4YHNA 2NY6D 1WEJH 4I3SL 1S7XA 2XKUA 2W9EL 2Z31B 2QKIA 1I1YB 4MAYD 4HD9A 1SY6L 5BV7B 3E6HB 3MUZ1 4QNPF 4GQ9H 3QI9A 1I8MB 4ZMAT 1X5JA 4F3FA 2CGRL 1T1YA 1U3JA 2BDNH 5E4EB 1HHHB 3FN9A 3S37L 3RVWD 2OTUA 4RFOH 4H1LH 2VKWA 4YHYC 1E0OB 4IOIA 4TQEH 1G9NH 2R4RL 3V6OE 2Y7QB 4UBDC 4P2YA 3NFNB 3T77A 4HWEL 3BN9D 5F89A 1DSFL 5DRZB 4BH7A 3JUZA 1NCAL 1AXSB 4ONGL 1DDHA 1YEFL 3MRHA 4N8PA 4CW1B 4EN3C 4HXAL 2W1NA 3CFCH 5KVGL 1KOAA 5C08E 4KK9D 4DOHE 4J6RL 1FO0B 1PY9A 2JJTA 2ZCHH 4ZS7L 3K2MC 3VWKB 3FT3B 4WENB 1OM3H 4APQD 1I1AA 3HAEH 5CLWA 5KS9A 5D1ZA 3MRLA 2HMID 5I8CA 2WLZA 3JXAA 3TFKC 4HS3A 3GBLA 1U95B 4C58B 1ADQA 1JTOA 4NPYA 4FQHA 2X4NA 2FZ3B 1AHWA 3MACH 4NT6B 4LRNH 4C56D 2AV1A 5C8JB 3VXMB 2P8LA 5K9QG 4U1NA 1SVCP 2DTMH 4ZSOB 4MVBC 4OLVH 5C6TL 1RFDL 2DI8A 1L6XA 4P2OD 1JK8B 4LBEA 5HYJA 1E6JL 1OAYL 3U9PH 4MJ6A 3KAAA 2XZCL 1X5YA 2YPKB 4NFBA 2Z35B 5F7HA 4X6EB 1QFWH 3RHWK 2R1XB 3EO1A 3VE0A 5JTWA 4L3ED 2K7QA 5HGGS 5B3NA 3BHBB 2Z0BA 1HI6B 3I3BA 5LKNA 2BVOB 4G6JH 5C0IB 2DQCL 3BZFB 2D0HA 2DQJH 3F8UB 5I76A 3IVKA 4L3CB 1RY7B 4DAGH 2CMRH 1IQWL 2UZXB 3DYMA 1N64H 4H20L 3NH7H 5HDBE 1OF2A 2ADFL 3ARBC 3OJDA 4MNQA 3ZO0A 4NSKB 3U7YL 2WBKA 5BO1H 2IH1A 4LSSH 4YXHL 3PJSA 5FM4A 1EAPB 4WFGD 4KTYA 5IKCB 3VRJA 4XP9H 1GGCL 5LGHL 1A7OH 5I8OL 3PV6A 1LDPH 1ZSDB 1NL0H 1ZLWK 3MNWB 5CD5C 2PO6A 2CDGA 1YEDB 4M8QA 1ZGLP 4JHBA 3LKPB 1FAIH 5K9OB 1GVIA 5AUMA 3MRMA 5D1QB 2E27H 3CVHB 5EOTA 4OZGF 2AK1L 1P4LA 5JDJA 5DQDL 4PJFE 4O5LH 3EYOB 4NZDA 3VXUA 2HN7B 1TPXB 4MQTB 4Y4HC 2XTJE 4MA7H 1WC7B 4AH2A 5EZJB 2J4WL 3V4PL 3V6OA 4C4KT 4GAGL 2ZKHH 2GJ6B 5SX4H 1NGZB 2G75B 4EVNA 1NEZG 2DJUA 5GGRB 3LSOA 2GSGB 1GOFA 4ENED 2DWEA 5E8EA 1QVOB 5DJZA 3G6JB 3FZUC 3H9SD 5HYFA 2KH2B 1H3GA 2DLGA 4HKZA 1C5DA 6FABL 5FHAH 2H1PH 3SGEI 2WLYA 1IKNC 1UCBL 3EOTH 4PRPD 1IM3B 2N7BA 3GMRB 1PKOA 4HIXL 4PB9L 4X9HA 5I8KH 2R0KH 3GSQB 5EUKA 3BP5B 5D5MB 3IDJB 5AZ2L 5EZIL 4KAQL 1N6QL 1M7DB 5DVNA 3DUHA 4ODHL 2DMBA 2O5XL 3HE6D 1HZHH 3L95A 4LK4A 4XZUB 3JTSB 4OCNC 4Z95H 5I9QB 4IDJH 2QHRH 1QSEB 3IETA 4U6HB 3VGHA 4N0UB 3IU4L 3QIBD 3QNXB 1KEGL 3RKDC 2I9TB 3RGVA 4PJHF 3QCUL 1PZ5A 4LLWB 3NZHL 1HHGA 3QI9C 1P5UA 4L29B 2ADGB 4Q0XH 1KIPA 2BOCA 5FO8B 3UCRA 4UT9L 2ORBH 1MRDH 3GSXB 2Y6SC 4YHZL 4G9FE 1CLOH 5LCVH 1BD2D 2VXSL 4XPTH 2KQNA 4UUJA 4PRHB 5MENB 1WZMA 3V5DA 2D7NA 4XMKH 3WIHA 5IWLC 4QLRA 1XGTB 4S0SD 5SWZD 4EUPH 4PV8B 1OL0A 1C1EL 4KROC 3GSNH 3PWPD 4DW2L 1BF8A 1GOGA 1FL5B 4LSVH 1MCSA 1N26A 2JJTC 2Y9RT 4L4VD 1LP9B 2DQUH 4KJYA 5A16B 5CJOH 3LKSA 4K8RL 3LKRA 1I1AC 4JFED 1RHFA 3CH8A 5D1ZC 4WI5A 5I73C 4M93B 3GRWL 4RFNB 4Z7UE 4EI6A 2D7PA 4MWFB 3RX8A 3C6SB 4X5WA 4EI5A 4P4KD 2DQFB 3O81A 2WV3A 5IVXF 5IESH 1AHWC 2X4QA 3DVFA 2BZDA 4WV1B 3WLWD 3UYRH 1YQ2A 5E6ZA 5DJCA 4N0CC 5EOCJ 2AW2A 1K6QL 4U0RB 2IAMA 4UMGA 3QUML 4GBXD 3RA7H 1MHCA 1D5BA 4DN4H 5F71A 1A0QL 4RAVA 5GS0H 5DD5L 4IM8A 1JMZA 3VFOB 2XKNB 4J8RA 3BGMB 2XTLA 3G5VB 5JHDD 3SGEH 1I8LA 2IQAB 3OHXB 3R0NA 3IGAB 3CD4A 43C9A 1NFKA 4M6MH 1U8MB 5DQ9A 2OMNA 4QOKE 4XAWL 3O45B 1MF2H 4NYLB 5TDOB 2O61A 1TCRA 2JB5H 1XGYH 3RVTD 1LO2H 1KG0B 1HN1A 1EEQA 4PJGF 3H8NA 1TDQA 3V0VB 3VWJC 4D9QE 3QXAB 5ESVA 4WVRA 5BV7H 3HPJB 2G5RA 3VFNB 5C0CE 4XNXL 2GQHA 5TF1H 2VERN 4Z7VB 4LVNB 4R90L 4YO0B 5ERWB 1S7QB 3QB7C 1MFEL 2W92A 3DHJA 4JHWL 4N0RA 1X5FA 3ILQC 1HH6B 3MLXH 4JM4L 3MLSL 5C2BL 2P49B 4HUVA 1UWXK 5EUOE 3EFDH 4GW5A 5I17B 1PGRB 3FAXA 4PG9A 1M71A 4MXVE 5JUEH 3CXHK 3W9EA 5C09E 2APBA 4NQED 2RCSL 3OAZK 3WEXA 2EXWD 3QRGH 4NCDA 4R7DB 1F3DJ 5SV4A 3O8XB 1H15A 2WBWB 4QXUL 2AK4E 4IMLB 2ED9A 3BO8B 4OGXL 5FB8B 1A4KB 4PRDA 4L3EB 4LPXA 5DJXA 4WI2A 1P84K 4NNPH 3M1BA 2JKXA 4NWUL 3VGEA 2A9MH 4JZOA 1IGCH 1DQJB 4NOBA 3B9VA 1PEZA 2CD0A 4Z0BL 3DRQB 1WITA 5B3JF 3T1FA 1P7QB 1PSKH 4X4MA 4A6YA 2DDQH 1FSKC 1V05A 1E28B 3H3PH 2C1OA 3WKML 2VDLH 2GI7A 4XBPA 4Z7UA 1KSRA 3DX7B 1AD0B 1CFTA 4XPBH 5C0GA 4OLWL 4PD4K 5FFLA 3TO4A 5ICZA 3RGVC 3E1F1 1BM3H 1WWWX 1IAOA 4UOW0 4JB9L 3MNZA 5FCUH 3SOBH 5IJVA 1CG9A 3W9DB 2F58H 3EKCA 3V0WL 3FT2B 4KGJA 2X4TA 4ZTPH 4D0CA 1OTTC 5K9JL 4E9LA 4G7VH 3VFUB 1JGEA 1O0VA 5INCB 3QWOB 1NLBL 1CLYH 4ZXBA 5J11C 3WNOA 3TV3H 5CINL 1Y6KR 4GW4A 1ADQL 3RWDA 3GK8H 1C7SA 1X5IA 3LAFA 2ZSWB 5J1SC 3BW9B 4Q2ZB 1KEML 4R97B 1XH3B 4QOKA 3OXRB 4CVXB 3L3HA 3O6ML 4PJXF 3H9SB 1WWCA 2EDFA 1JWSA 1NCWL 1QFUL 3KPNA 4OSUH 1RIHH 3PWNB 2ESVB 1JL8A 4JY6B 4KJPC 1E6OL 1W2KT 1KTDA 4OF3A 2ZJSH 3DX6B 4PRPB 1SBSL 4WI3A 4PJ5D 1CXIA 4DUWA 3SKOB 2DBLH 2JELH 3FONB 5I1GH 3HC3L 1BBJA 2MQ3A 4GOSA 4ZDHA 4WFHD 4LLQB 3L1OL 5CAYB 2LFGA 4QCIA 1FDLL 1YMHA 2CDEA 5TE4H 4ZFOA 4KHXL 4EI5C 1HYRC 1EO8H 1MQKH 3HE6B 3CFEA 1QFPA 4K8RH 5CKGA 4XMLH 3F12A 3NPSC 2FSEA 5F3BA 2IAMC 4OZFA 3PGFL 4Y19A 2B5IB 4KQ4L 5F97E 4BFGA 4S11A 1EEYB 3U0PA 1VEPA 5EUOA 1CFBA 3SO3B 1FIEA 2EH7H 3SDDA 1I1FA 3L7EA 1EK3A 1EH9A 4FXLA 2EZ0D 3EFFB 4NQUA 5DEGA 1I8LC 3ZKMD 1ZHLB 4FQPA 4LEOA 5C09A 1U92B 3P9LA 2GCYB 4O9HH 4MD5B 3QUMH 2P5EA 4HH9A 2BCKB 4F7CA 4MJ2A 1RZIA 2HFFA 4JRWA 1HXYA 5CZVH 1A02N 1OAKL 5DC0A 5IF0B 5CBEA 2AK4A 2Q6WB 3IDYB 5E0QA 4K3EL 4JN2A 5HYEA 3OJVC 2F5AL 1BVKA 3TIEA 5HHOD 1S5HA 3CH1B 5TDPA 1H0DB 1TTUA 4MGXA 4FFYH 4L4VB 1U8HB 1K3IA 4NWTH 4M1DL 1U2CA 4V2BA 1VACB 3SE3A 4JO3L 5BQ7A 2BSTA 2J8HA 4XCNB 4KI5F 1NMCB 5JOPE 3OL2A 1UZ6E 4J3OC 4QXWA 3T1WA 2DI9A 4JRXB 4P4KB 1LEKB 1IRAY 1JHKH 1U93B 4K3JH 5DWUL 2R1WB 4RMQA 4UNVA 2A0LC 4ORGB 5TFSH 5KANI 4RRPA 4N68A 4AEEA 3A0OA 4DZBA 5J9PA 3KWWA 1JWUB 3QEQB 3F7YB 4LGPB 1AGBB 1QP1A 3HG1B 5IK3A 4Y1AE 5IMMB 5EFIA 5DFVC 1Z5LB 3WYRA 4ZUSB 3ULUD 1TVHB 5C0AB 2QQKL 4YHOH 3HZYB 1LO0L 4L8BA 5F7DB 1IC1A 5T5FL 1DFBH 5JHDB 1Z2KA 3BFOA 3CFJB 5IMOA 2XIDA 2DQHL 3I75B 4OZIE 1T1WB 2QR0B 3HUJF 4GFTB 3PQYD 3ARGA 2VUYA 2ZUXA 1BVLB 4MQXD 1YYML 1RK1A 1IKFH 1I9IH 5FYLH 5KVEH 4P59H 3VFRB 5B8CA 3QDME 3W39B 3QIUC 5EBWB 3IFPA 5DR5H 1U2HA 3VMOA 4XNMA 2P8PB 4BFIA 4NKIL 3O4LD 3QDAA 2XA8H 4KTDL 3EO0B 1RUAL 4X6FB 2X05A 4G7YL 3VFWB 4W4OA 3RWEB 1PG7X 5D4QA 1J1XL 4NO2A 2NY3B 1ED3B 4EOWH 1IC4H 3WIHL 4TSAL 4S1QL 1QHOA 2UY6A 1FGNH 3BH9A 4Y0GA 5L6YH 3GMQA 3ARED 12E8L 1CD1B 3TO4C 2H41A 2YA0A 5DA0B 5A2FA 1OB1B 1UXSB 1XZ0A 3MV9B 4N8VA 2WBJD 5FM5M 3MLPA 4KV5F 1LQSR 3F7QA 3NAAH 2W9LA 3WKMH 4IRZH 3X17A 4RGMC 2GTZA 1NGXB 1UKTA 1DL7L 1V3LA 1BFVH 4HJGB 5GSVB 5ESQB 5GGSY 5HYQB 2IALB 4DK6A 3DETD 1YDPA 3ET9F 3S9DB 5F7NC 4ZXBC 5F1SA 2FX7L 1G9MC 4WFFD 3BPLB 3DSFL 1UWEL 2A6IA 3JV0A 1PLGL 4ZYKB 3GBNL 4LF3A 1KN4H 2HLFC 3MODH 4OLYL 3TYGH 1K3ZA 3U4BH 5I66A 1P2CA 1UH2A 2EYRB 5JNYB 5D96C 1RIVL 5BVJA 1PDKA 1D5XB 3X3GL 3T0DA 1JHLL 4PFEA 4OZHA 1A6WH 1U8JB 4WUUD 5TE7H 2VDPH 2CJUH 3VXME 5TE6H 1IGFL 3CC5A 1SEBA 4OF7A 4I0PB 2JCCB 5MI0B 4ZSOE 5I0DA 3C2AH 4YAQB 1GGYA 3B83A 3K8KA 1OAQL 4XAKD 4OKVA 4YR6B 4JG1H 1I8KA 3NOIA 4PBXA 1PQZB 1RULH 5GGQL 5FA3B 3ARDD 3AMLA 3O6KL 3Q2CA 5E8OA 4J3TA 5E9DB 4KDVA 5FO7A 3BZ4A 1E4XI 4OF5A 3SDDC 1KB5A 4LSPL 3ECBA 5C0BD 5AYUH 1WBYA 7FABL 1AY1H 3QFJA 2MHAB 4PD4J 3FQNB 5FV1L 4RA3A 3REWB 1YN7B 4NQCD 2BHYA 1B0GA 2VDQH 3R06B 3WMSA 3BOVA 1T21B 4HX1B 4O2CA 1ZHNB 2YUZA 1BIIA 3CSYB 4OZIA 3QDGD 4MXWL 3RWCB 3BI9X 3VD5A 3MBXH 1LE5A 2V2WA 1HQRA 1RIUH 4NQVB 4G8IB 2IPUK 4MJ5A 3BIKA 1ZE3C 3R1GL 3BUYB 1WAAA 3DVGB 5C0RL 1VA9A 5ENWB 1A3QA 4HPOH 1MCPH 4YGAB 3T09A 4YHMH 4LEXH 4PJ5B 2O26U 3SE3C 1R5IB 2E9IA 2AVGA 2JJUA 2HRLA 4O02L 1JNNH 3UBXI 1NGQH 4WW2A 3RNKB 1NGPH 3EJYD 2Z93A 2B39A 1WSST 1F42A 2Z31A 1A7QL 1I1YA 5JIPA 2BSED 4FQQB 3IAGC 2WAHA 5HY9B 1DBMH 4P5TB 4JO3H 2CLRB 4LKCB 5T33H 2DLFL 4CJ0A 4Z5RB 3V52L 1HHHA 4MXQC 4LCWB 4LARH 5HHXH 4NN6B 2GJ6E 4TULH 4QXTA 3VGAB 3NFNA 4TUJA 5KSVB 3QNYA 2OP4L 4A6YL 3G6JE 2I5YH 1RHHB 4KH2A 4CW1A 4JREC 2X10A 3TT3H 1MVUA 5TF0A 1J0ZA 1QKZL 1B0WA 5CJQL 3ARGC 3W81A 5CZKA 1B3JA 1ZHKB 5EO1B 3UP1A 1FO0A 1OGTB 3TJHC 1TZHB 4XXCC 3B4NA 5T3XL 4FHBD 4GLRI 5D5ME 1U3HD 4JEGB 5B8CC 5MHSD 1NFDF 2MNUA 4XT1C 1T7XA 2X4OB 4JFDD 5IHUL 1T2QH 3IS0X 3RVXC 3DV6B 3MRCB 4XP6L 3MFFA 1YJDH 1QSEE 4PJDB 4ZO7A 4N0UE 1U95A 2R15A 3QXDB 1E4XH 1M05B 3BKCL 5EIVA 4D2NA 4LPVA 4MLIA 3KYNB 1V8HA 1S9YB 2E9WA 4AIXA 4R2GD 1J87A 4CMHB 2B1AH 4YBLB 3DXAB 5C8JA 3VXMA 3P30L<