4RGNB

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
213
Chain Sequence
EVNLIESGGDLVKPGGSLKLSCATSGFTFSAYGLSWVRQTPERRLEWVASISGGGSVYYPDSVKGRFTISRDTAGDILFLQMNSLRSEDSAIYYCVRDLYGDYVGRYAYWGQGTLVIVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 44
structure length 213
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnB01
2NY1D 4YWGL 1RJCA 1QACA 2ADIA 4HBCH 4LPWA 3TA3A 2G9HA 1KCSH 3HNVH 5J6HB 3EO9H 1EHXA 2YZ1A 4G6MH 5E6ZA 1WUNT 4IIQB 3HI1A 1ZLUK 5B39B 5FHBL 3FN0H 5DD6B 1VB9A 1JRHH 5F1IA 3SDXF 1XGRB 3VE0A 5BRZB 5ERWB 3HNTL 4Z77A 4PJ5A 1IM3A 4F3FA 3PWVA 4I18B 1T1ZB 2W9LA 4G8GB 1QVOB 1JGLL 1FYTD 2JJTA 5F6HJ 5H35A 1WBYA 5DHXB 2OSLA 1BM3H 2XQBL 5IJVB 4AZ8A 1ZA6A 1ZV5A 5DJXA 4IHOA 4XAKD 3KPMB 5FUZL 4H1LA 2PF6A 4K9EL 3HMXH 5A40E 5IMKB 3QXAB 4AH2B 1YEEH 4XMLH 5EZJA 2F53A 1CLYL 2XKNB 3MXWL 3U9UB 1A4KB 2MKWA 1F3JA 5HBBA 1KELL 5JOFA 5IJKC 2ZOLA 2FH8A 3P0YH 1C5BH 4XVTH 3QNZB 5HHNB 1G9NC 1DEDA 2VXTL 5C0ND 1RUMH 1G6RB 5I19H 4LRIA 1XR9B 1AGDB 2HT2C 3S3JA 2ZCHH 1A6WL 5HHPA 3LB6D 4BFEA 3UEZA 3OXRA 3MRFA 3WIFA 5HSFA 3F7VA 2P8LB 3RJDA 4DGIL 5DUPH 4HQQH 3WS3A 2FHFA 3QRFM 1CE6B 3EFDH 3K7UA 1XIWD 4L3CB 2WK2A 5DF0A 5HD8D 1KXTB 4KUZH 4LSSL 5DUMH 2CPCA 3QEHB 2VLKA 4WW2A 2OTUA 5FUCC 4WFGE 3P73B 1FZMB 4X5WA 1MF2H 4NKDB 1E6JL 1DQLL 5IVZA 3I9GH 1BFVL 4X9GA 2XTJD 4EN3A 1ND0A 1S8DB 3AB0B 3AVEA 3T3ME 32C2A 4Y8AA 5LXGL 5F3BA 1U8KB 4I3RH 1ZK9A 5DJCA 5IMMA 4IBLT 1EDQA 1JYWA 1CGSH 4KAQH 5ALCL 5BZDB 2A6IA 3FQRA 4HZLB 1KTLA 4MCZA 5DC4B 1KB5L 3TBTA 1KN2H 3VCLB 3CK0H 1JYNA 3TBWB 4IOSD 1IT9L 3HAEG 3QEQA 3GSOA 3SKNB 2X44D 5DRXA 3V5KA 4Y1AD 1Z2KA 5C0EA 2ICES 5HYJB 4G80A 4YWGH 2IGFL 4LVEA 4X4YB 3IJSB 5BCAA 4DN4H 4X6DF 5ID0A 3QI9A 3IF1B 3LQAL 5KSAB 1CDYA 2HJFA 3PV6B 1GHFL 1CBVL 1OGAE 4X0KA 3L1OL 5FHBH 2OXGA 3FFCD 4HPOL 3EO1A 1YY9C 2J6EH 2YMXL 3SJVB 3PGFH 2YHGA 1FO0H 4ZNCD 4CVWA 3KXFE 3IGAA 4CMHB 3TT3L 1T0NA 4WHYH 4HWZA 5EU4B 5MHSE 4UOW1 2X89D 2NY6C 2XQBH 2NY6B 5FUZH 4K9EH 3UTSE 4ONFH 2WBJB 3RVWD 3IDNB 1KELH 3P0VH 4L4VD 1I9RL 5C0RL 4NN7C 5B39G 1KIRB 2P24B 1PYWB 4NN7B 3RBGA 1KPUB 2VXTH 2Y07H 1FV1A 5E0QA 1U92A 1D6VL 1A6WH 4XVUC 1BQSA 1F2QA 5F9WB 4LARL 3FT4B 5JXED 2FGWL 3O3EA 4DGIH 2BCKA 4XI5C 1UB6B 4K7PL 2WUCH 3LH2L 1KXQE 1E4KC 2ZUQC 3GMOB 1HHHB 1RK0B 1IGIH 4X5XA 4NBYB 3QEUA 1Z0MA 4ZFOL 2YPLE 3UAJC 5KVGH 1E6JH 3R8BB 4WTWA 1DQLH 1X7QB 3C6LC 1BFVH 1I3RA 2OI9C 2CIKA 3C6LB 5IG7B 2EC9T 2X4TB 1JPST 5D7LA 5LXGH 2PR4H 3QNXA 4UI2A 3C5ZA 4JHBA 1MCHA 4LF3B 3HLAB 1FP5A 1I85C 1NMBL 4NC0B 2IBBA 4KDVA 2UVFA 5ALCH 3KPRE 3L5IA 3E6HA 1ZVHA 5EU3A 4APQB 1KB5H 1QUNA 4JPVL 1ZT4A 4W6YB 4XX1G 5GISL 3B3IA 1IT9H 3R06A 1MCPL 1X5KA 1CXFA 2H9GB 3WHE0 5DUBB 3MLPA 4ZG1A 5K93A 3IXTA 1T0MA 3VFPB 4H25B 4HWBL 2IGFH 2W59A 1VFMA 4PJFB 1XIWA 3V0WH 3C2AL 1AGEB 1DE4B 3JZ7A 3KS0J 5DRWA 1EXUA 2B1HL 4E5XA 1GHFH 1CBVH 3FZUC 1KLGB 1MLBB 3L1OH 3CC5B 3FOMB 4HPOH 3BT2H 5IR1B 2YMXH 3HRZB 3GB7B 4FQXD 4S1RL 3O6KH 5J1TC 4XCCH 2H1PL 4KJPD 3VFGH 3TT3H 3MRHA 2EZ0D 2QQNH 3M1BA 4ONHA 1P5UA 3C60A 3DBXB 2PNDA 2R1YB 4QRRD 1DANT 2DOCA 1J8HE 2QLVB 4YFEA 3U2SA 2NW3B 2AXGA 4NQTA 5DD0L 3HZVA 1I9RH 2ZUXA 5C0RH 1KLFA 4PR5B 1TNMA 5C07E 3NZ8A 3MNVA 3QFDB 4Y1AA 2PO6D 1RUAL 2PYED 5C0CB 5JMRA 5EO0B 1VERA 1PY9A 4LARH 5A2JH 1UB5A 4MAYB 4Y4HB 4Y7MA 2FGWH 5D70L 3P4OB 3DYMA 3FFCA 4K7PH 2XXCB 1PEZA 3B6SB 3LH2H 1G7JA 4LP5A 2BVEA 3PDGA 4ODUA 2C1OB 2A77L 3RNQA 4J1UA 4WFED 5I1EL 3QDAA 3RFZC 1SJXA 5E8OB 4WGVB 3QNYB 1TJIL 2OBGA 4QOKB 3DMMB 3MROB 4Z18A 4JCLA 4XP4L 4AMKL 1C12B 4J3OC 3B5GA 1OP5K 1YN6A 5D96C 1A3LL 3UTPD 1NMAL 2NW2B 2OP4L 1TVDA 5I71C 5KVEH 1DUYA 3ARQA 5D93C 5DDHA 4P59L 3HE6A 1NMBH 4QO1A 4QRTB 4MXQD 3Q6GH 5A3IC 3FFDA 4PBVC 1NC4D 1MRDH 1WWCA 1Q0YL 1J12A 4HLZH 3ZHKA 1BJ1H 2FX9L 4JZJA 5FYJU 1UACL 2DTML 4HWEL 3JWDL 4BZ2L 2FDBP 4LHJB 4OBSA 5ICZB 4Y16D 2G75B 4GG6B 2Y6SD 4KI5D 5LAXB 3C2AH 3RI5K 4BFBD 1BQHG 2B1HH 1K5NA 2B5IC 5HPMB 3VRJA 4D9LH 5JW5B 3PG2A 4MA3A 1SJVA 4MVBC 4I3SL 2EYSB 5CJOL 5J4MA 4BZYA 3IJYA 3BO8A 4MJIB 3DO3A 3NCJH 1C16B 4NKMA 5CD3A 2YKLL 3O4LB 3VD9A 1FAIL 1RHHA 5D2LF 3QYCA 4GW1B 4U0RB 4LLDA 5E2WL 5DD0H 5J12C 3CPLA 4I0PB 5SWSB 4M7JH 4NQEE 5J12B 3IFLH 5AZ2L 3EDDA 5FA3B 3TYGH 5C0FB 2BC4B 2VDLL 2ZSVB 4CVZB 1BBDL 2V9RA 1TCMA 4X4XA 1S5HA 3W9DA 5H8DA 3GSXA 5D70H 5FDWA 3S4SB 1PJ9A 2A77H 4FQXA 5ACMA 4IRSC 1D5ZB 2NZ9C 1IAOB 2QR0A 5GGTA 1TJIH 4KROD 4L9LC 4U7KA 3L9RA 3W5MA 5D9SB 3WEXB 2VLRB 4AMKH 4QRRA 1OAYL 5D7JB 1TENA 2HLFC 3VFTB 1WCQA 4X98B 3T4AB 1A3LH 5FF6A 2OP4H 3MO1A 1UZ6E 2Z9TA 4CW1A 4JRXE 4OBRA 4DOHB 5IVXA 5E24E 5DRZB 3X17A 4P59H 1UENA 5DJ0B 3C8KB 4PJHE 3OXSA 2PO6A 2PYEA 1DUZB 3EDFA 3GSNA 4RSVA 5ISZD 5JQHC 4LGSB 3NCMA 3VXME 3IDIA 4YDKL 1Q0YH 3L3HA 3QCVL 4JZOA 4GRLD 1WITA 1EO8L 3QHFL 4MD4A 3STBA 1E4WH 2ERJC 4XHQA 4O9HL 3QFJB 2DTMH 3VWKB 4HWEH 3S5LB 3JWDH 5L2KB 2ERJB 4BZ2H 4DTGL 5FHAH 5IW1B 5EULV 1CFVL 3L3GB 1CFTB 3G08B 5IFJA 4LVHB 1TTGA 2OL3L 3D1MC 3KR3H 2R0WL 4GRWB 5EG6C 5ADPL 2FEEI 3B9VA 2R2HA 1WBXA 2CXGA 2ZG1A 5D5MB 3LS5L 2F8XC 4JFEB 3WKNA 1A6VL 5GJSL 2ICWI 4I3SH 2FEEL 1IFHL 5B21A 4R0LB 5D6CA 1MQKH 5T5NF 1DEEA 1T7XA 4XNMA 1MAKA 2X7LB 1OD9A 5EZIL 4AIZB 1T04A 4DUXA 2YKLH 1U3HC 2E7LA 1FAIH 1IAII 4GW4B 4OGAC 1U3HB 4LOUD 5IQ7L 4KK8D 2IANB 3RY5A 3G04B 1NC4A 4PGDA 3S7GA 1E4JA 4OCYL 1AO7D 4UB0L 5E2WH 2X05A 1BAFL 2FJFA 3PHQA 2NY0C 3O4OC 4Y5YA 4Y16A 3GJFA 2KDGA 3RUGE 2WSKA 3O4OB 2VDLH 4JRYD 3D0LA 1BBDH 3V7MA 3DRTA 2FEDD 5EU6B 2DM3A 2KKQA 2VITA 3I02B 3BEVB 5C0IB 1LP9E 4K9EC 4XMPL 1WEJL 3DUHA 1T1XB 3ILPB 5BXFB 3HC4L 2DQGL 4JHZA 3SDAB 3VXUD 5HHQB 4PJIF 3SE8H 5DK0B 2GT9B 1Q9KA 4OFYD 2LV4A 5IOPA 2X4QA 3PDDA 5EZLB 4NT6A 1OAYH 1QKZH 3NABL 3IU4L 5GJTL 4AG4L 1A6AA 3FQNA 4PJAE 1YEHL 2J8UE 3BKMH 1JP5A 2DQUL 5SX5H 5LGKA 2X4UB 5HVHB 4FQQB 4UDTA 1IQDB 4IOFC 5T1LD 5JLZB 3MLTB 2XZZA 3MRNA 5J11C 3S4SG 1WGOA 4Q6IA 3CDGA 4MNQD 1AD9B 3DYPA 3A6OA 5BQ7B 2EKSA 4DAGH 4YDKH 3NIDE 4CMMB 4Z7OE 1RZ8A 3QCVH 3MJ6A 4WI7A 1W2KT 1FYHB 1EO8H 5C0AB 4HBQA 2GJJA 4HUUB 4O9HH 5KS9A 1RHFA 1SYVB 3BIAX 3MRKA 3B8YA 4DTGH 4Y4FD 4Z78A 3BGMB 1F58L 5KSBF 1DLHA 1MI5D 4P5TB 4V1DA 4WIQA 2R9HC 4WV1A 3WL9B 5IP4A 4PJEE 2AJZB 2OL3H 5ENWA 2R0WH 1CXHA 4ELKB 3FAWA 3O3DA 4RAHA 5C0GA 5J06A 5C0DB 3EYQD 4PB0L 4NNXB 5I17A 4OLWH 3VG0L 4KZDL 3CFKB 2BOBB 3LS5H 5MEND 1A6VH 3F5WA 5AD0A 5GJSH 1G84A 1F4YL 2X70B 1IFHH 3NA9H 3P4LA 3U83A 1KB5B 3SKOA 1NAMB 2UY7A 1KTKE 5K33A 4YAQA 4K8RL 5DK2A 3BZEB 2GIYA 1HOCB 2Z92B 2R56L 2UWEF 4WWKB 2V2TB 5E00A 1IM9B 3MR9B 4OFDA 1MNUL 4R4NC 5GS3A 1M7DA 2NR6D 3DROA 1MPAH 2FL5B 4JQXA 4UB0H 4F8QA 4GRLA 5FOJA 2L4OA 2F58L 5DURB 1BAFH 4NRZB 4KTDH 4OF6A 3B9KC 4JY4B 2XICA 3RWEA 3HE7B 2ADGA 1HE7A 3RL1A 4H5SA 4ZS6C 4RNRB 3BPNC 3S88H 1IQWL 4XMPH 2GW5A 3BIKA 4F2MA 2DBJA 3HC4H 4PV8A 5E2VL 4P4RB 2P5WE 4X7TA 4Z76A 2DIAA 4G9DB 2RIKA 4PV9A 3LN9A 3PGDB 5ICYA 2R0LL 5BS0D 2Z8RA 4JO4L 4LSVL 1I9JL 3IU4H 5GJTH 3PWJB 4ENED 1ZT7B 1HXYA 4AL8L 4JCMA 2DQUH 4C54A 1GGCL 5E8EA 3MLYH 4HIEB 3TZVD 3V5DB 4HUVA 3T65A 3ZYOA 1AO7A 4OV6F 4WHYG 3DXAA 3ZKSD 1A1NA 1NBYB 4ODVL 4CVXA 3TV3L 3T0XA 1IGYB 1LMKA 2W0FA 1K8IB 1AIFA 1UCBL 4HJJL 2DQFB 3QXDB 4XZUA 2CRYA 3W0WD 1MEXH 2YA0A 2AEPH 2PW1A 3BQUA 2DAVA 3MZTA 1NKOA 5TF0A 4TVSa 4ZFOB 4EIZC 5KSUB 1JWSB 1F58H 1MCKA 3NFPB 1MCJA 3D3VB 3C5JA 4ZPVB 5D6DC 4IMKC 5C0NC 4NRXA 2N1KA 4QHUB 1UYWL 4MXVE 4PB0H 3BP6A 4MLIA 3FQTA 3VG0H 5I9QC 4PIRF 4KZDH 3D87B 5CJ8A 2DKSA 4U6HB 1RFDH 1F4YH 3UTOA 1H9VA 4YNYA 1QFHA 4J3UA 4HFUL 4I77L 5FGSA 2EYRA 1VFAA 4K8RH 5T1LA 2R56H 3IFPA 5DJ6A 5GGVL 3CFJB 4RA3A 5HD8C 5E2UL 3CSPA 2LU4A 4MNQA 2NYYD 1UXWA 2C1PB 4QHMB 1UJ3C 2GYSA 1MNUH 1NDGA 3O45A 3QZWB 4TRPL 5JA9A 3QPXL 1JL8A 1SYSA 2EDEA 4Y19E 2GKIA 3EYFA 4UBDD 4HX1A 4TNWK 2XTJC 1L7TL 4M1CD 5ANMB 5BVJA 4P2RD 5E08L 4Q7DA 3O81A 1M1SA 1VGEL 4R2GB 5DMKB 1A64A 1MI5A 1BZ7A 2IPTL 4JM4H 4W81A 2EIBA 1DSFL 2GTZA 3IAQA 3KLSA 4I4WA 4YHKL 4AEFA 1RUPL 5HYQB 2HT4C 1IQWH 3MV8B 3Q6FB 1JHTA 1I1RA 2ZUVA 3FO1B 4U1HB 5MENA 5EU7C 4M7LT 5GGRB 1ETZA 3AS1A 5MEPA 5E2VH 2A2QT 2G5BB 1F4XH 2FO4A 2ITCB 1RZGA 3UZEA 1KIPA 1RK1A 1GIGH 3TVMD 2I27N 4LKXA 3O6FD 2LAAA 1GAFL 4Z7VB 2D7QA 3VFWB 1A5FH 3C5SA 1MHHA 3O2DH 2BOCB 1B4RA 5DQ9A 1NGYB 4ODVH 3UTTE 3TV3H 1A1OB 1JFQL 1QEWA 3PJSA 3OKEA 1R5IA 3HKFA 4WI3A 4HJJH 1AXSA 1NAKL 4HS6A 3HCVB 4RWYH 2FX8H 3VG9B 2R4SL 3GSVB 3UJIH 1PEWA 4U49A 1LVEA 3C9NA 2H2PC 4JM2C 3L5WA 3VFOB 4JM2B 3O3BA 2WV3A 1HHKA 5ESQA 3UBXA 4X6CA 2IWGA 5LGJB 1UFUA 3JV6A 1CLOH 1L6ZA 1OCWL 1INEH 4EI5C 5C9JB 2AEQH 1UYWH 3DECA 5F7WC 4CU8A 1PY4A 2Z4QA 1U8LB 5BS0A 2IH3B 3L3KA 1Y18B 3SBWC 1A2YB 5JXEC 4HFUH 3MLUL 4XRCA 3AS3A 2W60B 3BXNA 2GI7A 4L3ED 2X4OA 4KMTL 4KUCD 1RJLA 2PYFB 4JPIA 2OYPA 2IALB 3IFOB 3JWDC 4BZ1L 3H9ZA 3BOVA 5GGVH 4H26A 5DHYB 4M5YL 2H6PA 4NOFA 1S9VB 5EBWA 3WUZA 3MACL 2QSQA 5SWZB 5BRZE 5BW7A 1QA9A 3DRQB 3W0WA 5I2IA 4AK1A 3AAZB 4TRPH 4U6XA 3F7QA 1EHLL 2A38A 3GMMB 3QPXH 4XCEB 4HS8H 3NFNB 2WUBL 4M93C 5ILTH 5E08H 1MCRA 1WC7B 5I76B 3RBSA 1VGEH 4K3DL 4TTGA 2IPTH 1DDHB 4PRIB 4HLZG 5T3ZL 1DSFH 1GGIL 4QHLA 4GXUN 4GMTH 4YHKH 2D7OA 2NY5L 2AJXL 2BFVH 1OAQH 2WNGA 4PRPB 4OZIE 1YMMD 2IMMA 4YE4L 4MX7B 3QZWG 1EAPA 4HS3A 3GUTA 2PCPB 4HV8B 1F13A 3ELAT 1U8PB 3X11B 1ZGLA 3V6ZA 2DQJL 1U58A 2BVYA 4MDIA 3U0WL 2VH5L 5F7FA 4G43A 4JDVB 4A2LA 2NX5D 1FLRL 1NJ9B 4Y5VC 5BO1H 2E9IA 4G6FB 3UYOD 5CIPB 1H15B 4N1CA 4Y5VB 3QUXB 4LMQI 3SGJA 4ODTH 2VLLB 1GOGA 3RZCA 4N8PA 1JFQH 4JFOA 4RGNB 5J0BA 3DV4B 4P2RA 3CH8A 4TQEL 5FUCE 4P48A 2GJ6B 1NAKH 3OG4B 1FCCA 2R4SH 3T0VA 5EC1B 5TE7L 1EV2E 1UVQA 3FONB 1I1YA 5C9KA 4WI6A 5CJ5A 3VXRE 2F54A 2PETA 3LDBB 2VDML 3MODH 1CXEA 1BIHA 1KCUL 1S5IH 4Z7QE 4POYA 5K59E 4QYOA 2DJUA 5I73C 5HDBE 3BP5B 1OCWH 3V6FA 3TVMA 1NEZA 3LD8B 4QTIL 1AQDB 1LDPL 2P44B 5H2BB 1T5XA 5CAYB 3KPOA 4JFFE 1CD1A 3LKRB 3KPLB 5A2KH 4JAMB 1P6FA 2WQRA 3U6RA 5HYJE 2D9CA 5JHDA 3SGDI 1OSZA 3AY4A 1AKJD 5EA0H 4BZ1H 2YPVL 4EI6B 3EOBA 2VMFA 2L0DA 1ZHBB 5HJ3B 5C08E 3FB5B 5GIRA 3MACH 2CDEB 3VXSE 3ZKMD 3QXWA 1R6VA 2JIXA 2BNQA 4BSVB 2E7HA 2MNUA 3OR6B 5IHLB 1EHLH 4HHAB 3REWB 1ITCA 4LBEB 3ROOA 1FGNH 2WUBH 1FNLA 4NQCD 4WU5B 5FUOL 4YDVB 4K3DH 3ALXA 1XAUA 4XP5H 2I9LB 1R3LB 2ICWB 5IB4A 2R0ZL 5GSRA 1GGIH 5FYJD 2NY5H 2AJXH 1FFQA 4OZGA 1KJVB 1HHGA 2FB4L 3Q2CA 1PG7X 2D4FA 4HK3J 4GUPA 2YRZA 3GMPA 4P5MA 1T1YA 2ZSWB 4YE4H 5EU5A 1N59B 5AYQA 4EXKA 2EYTA 4L3EA 2APVA 1Z9LA 3RNKB 2BK8A 1T21A 4JFPA 4NBZB 2UYLB 3MZGB 2Y6SC 3WNKA 5C0BD 4I48A 1S7XB 2A73A 3BE1L 4G8IB 4IOIA 3HG1B 1EVUA 5EN2A 3EO0A 3LY6A 2P48B 5EC2B 5CUSL 4NJ9H 3JV0A 1B0RB 1U0QA 2RQ8A 3GJFK 2GUOA 2HT3C 4L9DA 4MXWL 4D9QD 1X4YA 4LSRL 2Q8AL 5ITFB 5DI8B 4KQ3L 3AROA 1UZ6F 3MCLL 4P2QB 3MRPB 5D2NC 1KENL 2KZ1B 4TQEH 3ZZ1A 1TZGH 3D39E 4FTVE 2FHBA 5F7EH 4LHQB 2NXZD 5C71A 5L6YL 4PJHF 1MHEB 3CFBB 5TE7H 4TUOA 2EDJA 2YRLA 1XR8A 2JCCA 4ZO9A 2YD4A 4HXAH 4MB4A 3TIDB 2VDMH 43CAB 4MYWB 5FGBC 3OKNB 4PLKD 1R3KB 4L29A 3LRGA 4NQXA 1U9KA 4EIGB 3LAFA 3P40A 4UTAH 2HRPL 5GRXG 5DVMA 2KQMA 4MA1C 2XXMB 1LDPH 1INQB 4P2YA 3B4NA 4XC3H 3PL6D 1BD2B 5GRWA 2V5MA 1YPZE 1CFSB 2MQCA 1TTUA 1X5JA 5BOPA 4J4PC 4XCYB 2NX5A 4AJ0A 1MUJB 4PJFE 3WXVL 1Y6NR 5L2JA 1WJ3A 1OPGL 2YPVH 4M61A 1LEKA 5GZNC 2BVOB 4U1LA 1ZLSL 5ALBL 4WEUD 1KCRL 2YD6A 3ZT5A 1NGXA 1P2CB 2HJLB 3SGDH 3G5XB 3D2UA 4OTXH 5J13C 4ELMB 1Q9LA 3C09C 3EGSA 3H9HA 3I3BA 4RFEA 3F6LA 2AK1L 1S7SA 2P7TA 4XPTL 1H5BC 1OY3B 1Q0XL 1H5BB 4JQIL 2Y9RT 3HPLA 4GW5A 4TYUA 2AV7A 1T3FA 5DLMH 3ARFD 4PJDB 1OAUL 2GHWB 2DWEB 3GGWA 4WU7B 3BSZH 4OI9A 4K8RC 1DQJA 3DLQR 5FCUL 1OAKH 1CFQB 3RUGF 3IAPA 2FB4H 1DQQB 4LRNL 5FB8B 1H3TA 4WFGD 5F6IC 3U30B 1S7QB 2XT1B 5C0CE 2Y06L 1QSEB 1LP9F 4HGWB 2C7UA 3B5HA 3MRCA 1LNUA 4LP4A 1A6TA 5KVDL 4CBPA 4OT1L 1MJUL 3QXVA 3HB3D 3CX5K 3SE4A 1K3ZA 5F3HB 4WI2A 1I8LA 2ZG2A 2I5YH 1K6QL 1I9EA 3GSWB 4N0RA 4KJWD 2VZSA 3PABA 1D5XA 4ZNEA 2ENYA 1JZ7A 2YD1A 3TP4A 4FFWC 4LSRH 2Q8AH 2P5EA 3NTCH 2XKSA 2J8UF 4KQ3H 1JZ5A 1D5MB 4QOKE 3CVIL 3LQZB 5GRUH 2PTTB 4PJCE 1PKQB 4NQCA 1KENH 5IROC 4HK0A 2E9WA 4U6VH 3WDHA 2BNRD 5FECB 4XBEL 4P23D 5L6YH 1R3IL 5EPMA 1NCCH 2HMIC 1OWRM 2VC2H 4JLRA 2IF7A 4LOUC 5I8CA 2C4FT 3NIDF 4Z7OF 1VFBA 1QSFB 5C2BL 2BNUA 3CFEB 1KULA 1ORQB 4PRNB 4JKLA 2DKMA 5HHME 3PP4L 1DN0B 2HRPH 1HXMA 3V0VB 1LEIB 4YDJA 2VAAB 3KXFD 4PJEF 3G6JB 5JOPD 3RDTC 5HHOE 5E94A 4PJ7B 4WY7H 4ZD3L 3LPWA 2PUQT 3UTSD 3GIVA 3AREB 1N5YL 3WXVH 1F5WA 2VDQL 5C8JA 5E6IB 1OPGH 5I8EA 5A2IH 2HTKC 5ALBH 4H8WL 1KCRH 5TGBB 3SCMB 3GFUA 5GS1B 3LN4B 4XXDB 2AK1H 3MOBL 3OKLA 1JTTA 3UDWC 2H26A 4XPTH 3A6CL 1YN7A 4R97B 1VACB 4XCNA 2A6KA 2IFFL 2CDGB 4D0BA 4JQIH 1SM3H 3IVKA 1PBYA 2PXYD 3O4LE 1A6ZB 3EJZD 4KZEH 1FGVL 1NGZB 5JIKA 3WO3B 4DK3A 4U1NB 5FCUH 3PQYB 2DBLL 2VZ3A 2E8ZA 4ISVA 4JN2A 3RWJA 3PL6A 3VFRA 2PTUA 3ZDXF 3WJLC 5MP6L 3VXQA 2YPLD 1DVFC 2Y06H 4IRJB 2ZUTA 1J0IA 5GZOC 2R1XB 4YIQB 4YHNA 4Y4FC 1X9QA 3C6SB 2GSIB 4OT1H 3EAKA 2DD8L 4MSWA 5ID1A 1I8IA 4N90E 4ZDHA 5HGGS 5IGXH 2R2EA 4ZMAT 3QQ9D 3O3AB 5IW6B 3MYJB 1K6QH 1MJ7H 4YFLF 3EYQC 4O00A 1DBBL 2K3TA 1MREH 3KPRD 4L8BA 1G7HA 4MAUL 4WHTB 3CSYB 1ZHLA 5CP3A 5I1GL 3HPJB 4K94L 2CDFB 2WWKO 2ITDA 1V8HA 2J7LA 4KHXL 5ACZA 3T0ED 4JANA 4X6EA 3SN6N 2RJMA 3BN9D 5FYJH 4N8VB 4BQCA 1R3IH 4WTZG 1FFNB 4DOHE 1MHCB 1ODAA 5DVLA 3CVHL 3Q48A 1C1EL 1F4WH 4GS7C 4B50A 2NR6C 3B2UC 1X5GA 5C2BH 5B3JF 2XZQL 1CU4L 3TBYA 3FO0L 2VSCA 1OW0C 3DSFL 1OQXA 5JDSA 4L8DB 3PP4H 4HCRA 3QO1A 1TVHA 4Q9QL 4WENB 2GJZA 4WO4C 1U8HA 3QFJE 3MRDB 4HUWA 4QGYA 1XF2A 1IAKB 1JV5B 2Q8BL 1S3KL 3CD4A 4HUNB 1VKXB 4K3GA 4FP8L 1FNSL 5TDPB 4ZD3H 5GS2D 4BKLB 1J8HD 3A0OA 1FSKC 1TZHB 4G7YL 4RX4D 2VDQH 4F7CA 1FSKB 3C08L 2IFGA 5FO9B 5EOQL 4U1KA 5D5ME 4BA8A 4JFEE 4YHYC 5DJDA 3H0TB 5CZXC 3MOBH 4NNYB 2YN3A 1J0ZA 3WNOA 3A6CH 3O11A 4KRMB 1CD8A 4QHKJ 3OKMB 1CGUA 2IFFH 1PSKL 2OJZL 1N4XL 2OTWA 1RJYB 2J4WH 2VISA 3TZVC 1OGAA 4JREC 3Q0HA 4F57L 4JREB 4BUGA 5IHZB 4OQTA 4WHDA 3OAYK 1IGTB 2DBLH 5JOEA 5EIIA 3QDME 3KXFA 1TJHL 1ORSA 4X6BA 3S35L 5CSZA 5E95B 5MP6H 3VA6A 3F12A 1L4IA 3QRGL 3QO0B 1E0OB 1QRNB 3MCKB 3UTSA 1S7WA 2P8MB 1FH5L 2J8HA 5EU6E 5J8OA 5EFIB 5EBMB 2FX7L 3QPQD 4NQDA 1D6EA 4DKEL 1TDQA 4QHKI 3QP3A 1IBGL 4U1MB 4KH2A 3JVGC 1DBBH 2V9TA 4MAUH 2FSEA 2NY5C 2I07A 4S2SA 1JNNL 1F3DJ 2Z91A 1HHIA 2MHAB 3DX7A 1QBBA 2C3VB 3S96A 4K94H 1UT9A 3D69A 3DURA 3OGCA 3BWAA 3K4AA 3RWIB 4KHXH 1SEBA 4IDJL 1G0DA 2F74A 2Q76B 4O2FB 4R96A 1EVTC 4MA8L 4UT9L 3DX8A 3QUYB 4K7FA 5E7FA 3F7PC 2VLJB 4OM1H 4UZGA 2A0LD 2NYYC 4PJGE 4BK4A 3VWJC 1OTUC 1BZ9B 2NZIA 4PRBB 1IZJA 3CVHH 1C1EH 3VWJB 2VIRA 4HPYL 2XZQH 2DLIA 2YPLA 4KXZI 4QXTB 3FO0H 1F42A 1FFOA 3MV9B 5HGAA 1J0JA 2FBOJ 1AQKL 1LK2B 1U8MB 1PZUB 3I6KB 2Q6WB 3IU3B 4KHTL 2XG5A 2Q8BH 4LVOB 1IEAA 1JHLH 2EDBA 4Q0XH 3D5OF 4FP8H 1FNSH 1OVZA 4N1HB 1JZ8A 4Z7WB 3KPRA 1ROWA 4YO0B 3SQBA 4G7YH 1KLUA 3BESR 4JY6A 4X7CC 4PJXA 4NJAH 4BFIA 3OJDA 3MRBB 5F71A 5MEQA 1DP0A 4NQED 4QY8A 1VSCA 1SBSL 1KIQA 3O6FC 5HGBA 1ES0B 1RULL 2GSGA 3X14A 4I9WE 3ZYJA 4OCXH 1WZMA 1PSKH 3RWCB 1U42A 4LASH 2OJZH 3GSNL 4FABL 1N4XH 4PJBB 5D1ZD 1BOYA 1FZKA 2F5AL 3BDXA 4KK9D 1F45A 4I2XE 4P9HL 4F57H 4PJ8B 4YHPA 5DMJB 1PX4A 1ZWIA 4PB9L 3ULUL 3P77B 3K74B 4FZ8H 3DARA 1TJHH 3S35H 4U31A 4E41E 4LNRA 2CRIA 3LPGA 4HIHB 1LE9B 3MUGB 1JF1B 2FCBA 1MCWW 1MCQA 4RMVA 2XY2A 1FH5H 1MCLA 4JRXD 2AK4D 4ODXA 3H9SE 4XGZA 4L1DA 3RY6A 1AY1L 3U4BL 1ZSDB 2EIZB 5FKAA 4DKEH 1YDPA 1Z0NA 2I26N 2BXZA 2X09A 5IW3A 2QQKL 5C07A 1IBGH 2VERN 5JO5A 1T83C 1VADB 2BVPB 2ZPKH 3OHXB 3K3QA 1FG9C 5CMAA 2YC1A 2ADIB 4URTB 2H32H 3TA3B 2G9HB 1NFIB 4Z7UA 1TIUA 4M7ZB 3SY0B 2RCSL 3HI5L 3QIWD 2CH8A 4IDJH 4MA8H 2VQUA 4XP6L 3LIZL 5F1IB 3ROLA 3VE0B 2IADA 1P4IL 1TNNA 4Z77B 1IM3B 4YK4C 1KPVA 3WSQH 4F3FB 3PWVB 4GMSL 1WBYB 3RIFF 2NY2B 2OSLB 3BW9A 1FYTE 2V17H 4NM8L 3SKMA 3ULSA 1ZA6B 5DJXB 4IHOB 3ZKXB 4H1LB 3F7RA 4KXZH 2VDPL 4Z7QF 5EZJB 1BFTA 2F53B 1YECL 3TJHD 1QYGL 4KHTH 5JOFB 1URLA 4X8JA 5KVFH 1EAJA 3D3VE 4FS0A 5JNYA 4HEPG 5FKPA 1A8JH 1MJJB 5HHPB 1U91A 4HIJA 4HKZA 4NUGL 2QHRL 3OXRB 3WIFB 1OF2B 3KYOA 1A7RH 5CZVH 3F7VB 1V3JA 1FNEA 3ARUA 3TCLA 3WS3B 4QRPE 3N1MC 3WJJA 2WIIA 2DTSA 2F5AH 4G8EA 4TOYL 1HYSD 3ZE2F 5AUMA 1HZHH 4P9HH 3MRLA 5BMFL 2VLKB 5JW4R 4G42A 1JI2A 2CR6A 4HLJA 2OTUB 4WW2B 3EYSL 4X5WB 4PFEA 2HFFB 4OUOA 5IVZB 3ULUH 4PB9H 3WBDA 4QRUA 3QQ3A 3RWFA 3ARGD 4R90L 4EN3B 1ND0B 3IJHA 1H0DA 5HI4D 5L0QC 4U6YA 1OD7A 3OR7A 2IQ9H 2XTJE 32C2B 2B2XL 3NA4A 3PE9A 4ZXBC 5F3BB 3TJEL 5DJCB 5FM8A 3U0TA 4DFHA 5IMMB 3LEXA 2CUMA 2FGZA 3QJHA 1T2QL 5FEBA 1RAMA 2OS7A 4HT1H 1BLNA 4LIQL 4U6TA 2A6IB 3FQRB 1MY7A 4MCZB 1KTLB 2DQCH 1AY1H 2WP3O 3PWNB 1RI8A 3TBTB 3MV8E 3RVUD 1EJ6A 3EZ8A 2J12B 4TVPL 2QQKH 3HUJE 3MRGA 5EU7E 3S6CA 3QEQB 1U3JA 3GSOB 4PJ9A 3VXNA 5DRXB 3V5KB 4LVNC 1AGFA 1CL7I 5K9JL 3SDCD 4G80B 3IYLW 1DBJH 1A47A 5D1ZA 1LDSA 3QI9C 1CL7L 2APBA 3QI9B 1G7LA 2HJFB 1N7ML 5IB2A 4X0KB 1NH6A 3EYUL 5CS7A 4Y0GA 3EO1B 5ADOL 4FZEL 1TPXB 4XVJH 1G1CA 4KJQC 1EGJA 3IGAB 4GMSH 3G5ZA 4P99A 5CZKA 1T0NB 5ESVB 2J1KA 3BKJH 4NM8H 3SE9H 4BM7A 1G7QB 4YXHL 2AAVA 4JRXA 2VNCA 3DSNA 5BV7H 1UQSA 2VDPH 1KJ2L 5E70A 1YECH 5F7HA 4L5FL 1QYGH 2B4CL 4PJHA 5JUEL 4RAVA 3WXWL 1I7TA 1YPZF 5IBLC 3VXMA 1MFEH 3QIBD 1XF5A 1FV1B 1U92B 4PJFF 1TTFA 3LEYL 4NUGH 2QHRH 4LLVA 3QIWA 5F88A 5DC0A 3O3EB 3U7AA 2BCKB 5EO1A 4S0SD 4WEMB 3NACL 1QD0A 4ZS7L 3MJ9L 2ILLA 1CDHA 5E4EB 4HJGA 5T5FL 1A3RH 4X5XB 1SEQL 3QCTH 1WV7T 3QEUB 2ADJA 2E9JA 3BJLA 5SWZE 4F9PA 3EYSH 3OG6B 1QPXA 3ZE0E 1CDIA 1I3RB 2FZ3A 2K7PA 2CIKB 2OR9L 3LKPA 2NXZC 1RUQL 1OTTC 3O9WD 5D7LB 2IMNA 2B2XH 3QNXB 3TJEH 3C5ZB 4PRIE 1T2QH 1A14L 2XN9D 4YR6A 4UQ2A 5CLTA 4LIQH 4I8DA 4X9HA 4CVUA 4FQCL 4OB5L 4EDWL 1KT2B 3ARBA 2VZTA 4XNXL 4P9MH 1ZT4B 3B3IB 4TVPH 3R06B 4I3GA 1HQ4A 5BVPL 1XCTA 3RUGA 3IKCA 4DKDC 5K9JH 3QCUH 3IXTB 1T0MB 3EYOA 5DQDH 1I1AD 5J3HC 2Z0BA 3SGKA 4AEIL 1G0XA 5DRWB 1EXUB 1LP9A 1HSBA 3RL2A 1FVCA 4E5XB 3NPZB 1UA6L 4S1SL 1N7MH 3EYUH 3ZHDA 4KK5D 3G5YA 5D1QC 3LPFA 4NM4L 4NWTL 4PTTA 2V7HA 2YZ8A 3IRPX 3EHBD 3ARGA 1NKRA 2VXSL 3C60C 2OQJA 3MRHB 4Y2DA 3S37X 3IDYC 3M1BB 1JWMB 3MNWA 4O4YL 3C60B 4ZSOE 4YXHH 4PJAA 1OL0A 4WNQA 5JIIA 2J8UA 4FXGA 4K94C 4O02L 4LKCA 3FT3A 1JZ4A 1KJ2H 3U2SB 4M6NL 4MNGE 5EB9A 2AXGB 2B4CH 3MUJA 4JFQA 3HZVB 5JUEH 3U0PA 1RVFL 3OWEA 3WXWH 4XNZC 5DJYA 4J3XA 3NZ8B 3MNVB 4QKXB 1W72L 3SDCA 3IFNL 1T4KA 3CMOL 3BMWA 4GSDH 3MTRA 2X9XA 3LEYH 4JFYA 1FC2D 1UB5B 2J5LB 4XCFH 4R7NA 5HDLA 1ZXQA 3HB3C 3TO4D 3G5VB 1T66C 3BJ91 3FFCB 3MRIA 1G7JB 4ODUB 3MC0A 4G7VL 4NN6B 3NACH 5B4MD 4Q97A 3RNQB 4ZS7H 3MJ9H 1ZT1A 4J1UB 5F72S 4X4ZA 4V2CB 5T5FH 1GGBL 1SEQH 4KPHH 3EBAA 1ONQA 1OP3H 3LVEA 1WAAA 5IEHA 3UBXI 4OD1L 2G2RA 5DYOA 1FZOB 3EW3B 4I1NB 5I1LA 5I1DA 1FCGA 1HNGA 2OR9H 1T89C 4P23C 3BUYB 1FE8L 5IBTL 1TXKA 3WNPA 1RUQH 2DLHA 4YHML 5DSCA 3HE6C 1DUYB 2R4RL 5DDHB 4JFDE 2AJSL 4A6YH 3HE6B 3RTQD 1B90A 2CUHA 4L8SA 3QIBA 3FFDB 1AC0A 3UJTL 5L8KB 4EDWH 4ZUUA 3UTTD 4EUPH 3LV3A 4XNXH 1X5IA 4QRSB 4JZJB 1NGPL 2AJUH 1HIML 1MWAL 4OCRL 5CKAA 1P4BL 4N0YL 2JB6A 3FAXA 4MD0A 3BPOB 2UUDK 4KKNA 4LCWD 4PRHE 2VZ1A 5CJXA 4GLRH 5JW4Q 4AEIH 1S7UA 3FO2A 2EIDA 2L7UA 1V3MA 1K5NB 2W65A 1UA6H 4S1SH 1C7TA 4U7MA 5SWQA 1ZLVH 3VRJB 1CWVA 2ARJB 2P5WA 3GRWH 4MA3B 3D6GA 3OKDA 2EDYA 1NANI 3L3OA 4NM4H 3N1FC 4UIMA 4OFVA 2A6JA 4P5KA 3B9DA 3IJYB 4N0UE 3BO8B 4NOBA 4PTUA 2VXSH 3O9WA 5F1KC 4NKMB 4KGJA 5CD3B 3O6LH 5D2NE 5DJ2B 4O4YH 3VFVA 3ZSSA 1RHHB 4O02H 2VE6A 3TO2A 5DXWA 1A7NL 4M6NH 1EFXD 4LLDB 1TZIA 1FIEA 4X7EC 3CPLB 5I1KL 1NGQL 1BFOA 1RVFH 1M4KA 5BRZD 5JPMA 1IKFL 1C08A 3B2VH 1W72H 1WWAX 3FRPG 4PBWD 2H41A 3ARDA 3CMOH 1UM5H 5FYLL 4X4XB 1S5HB 2UZIH 4GRWF 4P4KC 5KSVB 4C57C 3W9DB 3NCFB 2IC2A 3RGVA 1QNZH 2YD9A 5SX4I 1T03L 1H3PL 5D5MF 5FDWB 4XPAL 3RWDA 3QQ9C 5F7NC 3MBXL 3WHE1 3PWLA 1PZ5A 2QR0B 5DVOA 3GBMH 4AEHL 4OD1H 4JHAL 2Z35A 3X13A 4ELME 3L9RB 3CSGA 1VFOA 1GOHA 4QRRB 15C8L 4S10A 2HT2D 3T0EC 5BOZG 1GC1L 3R1GH 1BVKA 3BN9C 5FF6B 1NC2A 1EZVY 3MO1B 3T8XA 4M3JA 4CW1B 4NP4H 1FE8H 2PN5A 5IBTH 2W9EL 5I30L 2MPAH 3FQXA 1H8NA 3IS0X 4YHMH 5IVXB 4PJDE 3P9WB 2Y36L 2R4RH 1ZGLM 2A83A 2BHZA 1BECA 2AJSH 3KPSE 2PO6B 2PYEB 3GSNB 2MCPL 2GAZA 4OLXL 4Y19A 4P9HC 3IDIB 2AQ3A 3L3HB 1OT1A 4HC1L 3VDCA 2Q87A 5ISZE 1SY6H 4JZOB 4YXKH 1J0KA 1NGPH 4MD4B 1Q72H 2GTWA 1HIMH 1MWAH 4OCRH 1P4BH 4HEME 3ULUC 1JF5A 4OIIH 3VI3E 4N0YH 4NZTL 3SDXE 3V52L 4IEFB 4M5ZL 2EDTA 4XNYL 3N1PC 1C5DA 1JK8A 5D8JL 1E28A 1YC7A 1UJTA 3D25A 4W4OC 3MNZA 3FHQA 4MQ7A 2XFXA 4Y5XC 3QIUA 3WIHL 1LWRA 2R2HB 2FH6A 5TDNA 3TNNA 4LCUA 3OPZL 4L8CA 1ADQA 4FFVD 4JFHE 5FYKL 3U1SL 4XBPA 3FCTA 1XCQB 5D6CB 1T80A 2E7BA 4XNMB 4NN5B 2YUVA 1N8ZA 1PKQE 1KEGL 1FDLL 1NANH 1T04B 2H3NA 3RQ3A 2FR4A 2K1MA 2HH0H 3WNNA 3NCEB 5HYJD 3RTQA 1TFHA 1ERNA 1F90L 1NC4B 2QADB 4F9LA 3H9YA 4PGDB 3UTTA 5JHLL 4XPHL 3QUMA 3HAEA 1NMCB 5I1KH 2CLZA 1NGQH 5H37H 2B0SL 1ZS8A 2FJFB 3MJ8A 3SJVD 3PHQB 4RAUA 4AM0A 1YY9D 4JY5L 3G9AB 1IKFH 4NGHL 4Y5YB 5E8NA 1K4DB 4Y16B 3GJFB 2R69H 4P46A 3D0LB 4YGVA 3DRTB 5FYLH 2IQAB 3U48A 4HDIA 1R5WA 2VITB 2OMBA 3TM6A 3QPQC 2NY6D 1T03H 4DCQB 3OKKA 1J10A 5BV7C 2N4IA 4ESKA 3NPSB 1C7SA 3QH3A 2WBJD 4PGJA 2V6HA 4NNPL 1S7RA 3HN3A 1NLBL 4AEHH 3E2HC 3VXUE 1MFAL 1Q9KB 4JHAH 5IOPB 2X4QB 4NT6B 15C8H 1CICA 3RP1A 5J6GA 3BDBA 5GRZA 2R23A 1A6AB 3FQNB 1GC1H 4OKVA 4P3WA 4XVUD 2FBJL 1E6OH 2FATH 4YXLL 5T1KD 1EFXA 4UDTB 2A0LC 2Y36H 3MRNB 4Q6IC 3SO3C 3AS0A 1CFNA 2IBGA 4KFZC 4Q6IB 3CDGB 5BRZA 4RMWA 2L7JA 3SO3B 2MCPH 4R26L 1MRFH 4OLXH 5F97E 3UPAA 1FL5A 3IDXL 4OAWA 2EXYD 4HC1H 3AMLA 1RZ8B 4X5LA 1WCBB 1UWGL 4S1QL 4X6DE 2ARWA 3TN0C 5KS9B 2BJML 3TN0B 3MRKB 4Z78B 1IAMA 2EDOA 4NZTH 3V52H 4M5ZH 1EUUA 3C6LD 1DLHB 4V1DB 4XNYH 3I50H 3KJ6L 3FN9A 5D8JH 3PWUB 1E27A 3QUKA 1H3XA 5ENWB 2JKXA 3O3DB 3THML 5C0GB 3WIHH 5F7KC 4KROB 1JHKL 5I17B 1J1PL 5GS0D 3KDMA 5TE6L 1G6RA 3QWRA 4OZIA 1XR9A 3F5WB 5FYKH 3U1SH 5AD0B 1EPFA 1JNJA 4UUJA 3SKOB 3STLA 2P4AB 5D1XC 4NUJA 5F1SA 4YAQB 1KEGH 4PUBL 5DK2B 3TBVA 1N6UA 2HP4A 3BPCA 4M6AA 5E00B 3WFBL 4MDJA 3DJ9A 4L3CA 1P4LA 5EOTB 7CGTA 1JPFA 1M7DB 4FQHA 5INDA 1F90H 2NY4C 3C8HA 3DROB 4OGYL 2VYRE 5JHLH 1MOEA 2NY4B 1H3WM 4CDHA 3P73A 2ZUUA 3RY4A 3FZUD 2B0SH 5AEAA 4JY5H 3SPVB 3V8CA 3RWEB 1YYML 3BDYH 1XGYL 2ED7A 4X99A 2K7QA 2ADGB 4RISL 1I3VA 5IESL 3CNKA 4H5SB 3RL1B 2IG2L 1U8KA 3VXRA 3P9MA 2WIMA 5IWLA 2WW8A 3BIKB 4MA7L 2HTLC 4F2MB 2SEBA 3OB0H 4XMKH 4WDIA 4X7TB 4Z76B 3Q1SL 1YUHA 4NNPH 1KJ2B 2J88L 3HR6A 2B4CC 4PV9B 1NLBH 1IE5A 5GXBB 4YBLC 5JXAL 1MFAH 3NCYP 3TIEA 5ICYB 4JFFA 2XQYG 3BMVA 5C0CD 3IT8D 3JTTA 1NCAL 1HXYB 4MAYD 4Y4HD 2FBJH 5E8EB 4HUVB 3T65B 4YXLH 1AO7B 2ZUWA 3DXAB 1A1NB 5C08A 4HGKC 4CVXB 5DD1L 3VXSA 4ZUWA 2ZCKL 3CXHK 5J57B 1AIFB 4XZUB 4R26H 4GBXC 3IDXH 1QLRA 3TWCL 4GBXB 1UWGH 1ZTXL 2PW1B 3BQUB 4QOKD 4S1QH 4OFKA 3GMRB 1OGTA 2CGRL 3TJHC 1QRNE 2APXA 4HMDA 1JZ6A 4D9RE 3B43A 4YEEA 3RAJH 3PP3H 3P30H 3KJ6H 4PG9A 4Q58C 3M17A 2VKXA 3C5JB 3MRQA 1IC4L 4NRXB 1KIRA 2P24A 1JHKH 1QBLL 3BP6B 1J1PH 3FQTB 1MLCA 2EC8A 5TE6H 4Z7VF 5HHMD 3ZT6A 2BRRL 2IAMC 5A3ID 3ZYIA 4JGJA 2HA1A 2VDRL 3NIFF 1VFAB 4PUBH 5HHOD 5T1KA 5IT2L 5T1LB 2MQ3A 3IFPB 5DJ6B 4PGBA 3T3PF 4WHCA 4HAGA 4QHNA 5F9DC 2X1OA 3FRUB 4G5ZH 4MNQB 2VLJE 1HHHA 1E4KA 1UXWB 2CLVA 2EDXA 3TPUA 2VABA 3BZDA 5HDQL 1QFOA 3RPIA 4NHCL 3SE3C 1NDGB 3O45B 4UMGA 4OGYH 1SYSB 3UTQA 4XP9H 5DJZA 3QQ4A 4KV5F 4PREA 5CEXA 1HILA 3EYFB 4HX1B 3D39A 3MV9E 4FOMA 3LRSA 4FTVA 5BVJB 1FVDA 2F19L 4JM2F 4MVBD 3KLHC 5HI4C 3U9PL 3C6LA 1J05A 1YYMH 1MI5B 1XGYH 1BZ7B 3BISA 4PLJC 5DMGD 5IESH 1BQHA 2IG2H 4XPFL 4I4WB 1VEMA 3O4LD 4GKOA 3PNWA 4LMQE 4C83A 4DWHA 3NFSL 4XPBL 1JHTB 3RVUC 4OD3L 4W68A 5MENB 1I85A 4X9IA 1ETZB 2M1KA 5MEPB 4C4KT 3Q1SH 2J88H 2FO4B 3DIFA 2RB8A 2W9DL 1KIPB 4I0PD 1RK1B 5SWSD 5JXAH 1MIML 4LKXB 1YPZA 2DDQH 4Y2OA 5JQ6L 1W72B 4PJFA 1XZ0A 5EOCL 4K71C 3X12A 3C5SB 4KTEL 1MHHB 5CGYD 1JGEA 4N90D 4XHJC 5DQ9B 4NO3A 1LEGA 3NH7H 2CO6B 1CGTA 5DD1H 1QFWI 3SKJL 1QEWB 3PJSB 4M7LL 3OKEB 3UYPA 1R5IB 2ZCKH 1AR1D 3DYOA 4MZ3A 1AXSB 4F7MA 5IMOA 4HS6B 1UM6L 2CD0A 1Y6KR 3P9LA 5E2TH 5GGVY 4IS6A 1QFWL 2NZ9D 4M8VA 3QXTA 3WV0A 1XT5A 5AG8A 3C9NB 2VLRD 5F9AC 3BAEL 5JORA 2R1YA 3QUZC 4ZO6A 3L5WB 3BP7A 5D7JD 1HI6A 2OZ4A 2CGRH 3H3KA 3QUZB 1NPUA 3O3BB 1HHKB 1WZ1L 3CZFA 2HLFD 5ESQB 3UBXB 3MLRL 1MCNA 4X6CB 3QHTC 3I85A 3JV6B 4YX2L 3QWOA 3NGBC 2QQQA 1IC4H 1W0WA 5FK9A 3BPLB 4RGMC 1QBLH 2Z4QB 5BS0B 4GG8B 4RGMB 3L3KB 3VXPA 2BRRH 5GGSB 4W70A 4EDXB 4XRCB 3BXNB 5D2LE 1N2RB 8CGTA 2X4OB 5KOMC 1PG7W 1RJLB 3QFJD 4JPIB 4XB8A 5IT2H 4M9PA 4YPGB 3KYMA 4F15C 3LMJL 2QEJA 4H26B 2VZUA 2H6PB 2O5XL 4JG1H 5EBWB 3DGGA 5KTEL 4K3JL 2D7PA 4L1HA 1NUGA 1QA9B 5CINL 3W0WB 5I2IB 3QNYA 4U6XB 1XF1A 4PJCA 4JFED 1D5IL 4CKVX 1KIUA 4JDZA 1P7QA 3QDGE 2F19H 4OSUH 5EZOH 3U9PH 4WW1A 4EUPG 1M05A 1V7NL 5DA4A 4MQXC 4QHLB 5GS0H 4RBPH 1EHAA 3NFSH 4GAFB 4XVSL 4XPBH 4C58B 1G7IA 1U3HD 4OD3H 3ETBF 4M1GL 1NCDL 4HS3B 3GUTB 1FFRA 2W9DH 2LQRA 1YMME 2O5YH 5HHOA 1MIMH 3DWTA 3AGVA 4IRZH 3V6ZB 1U58B 2HVKA 3VGBA 1I1AC 5JMOC 3HA0A 4G43B 1A22B 3ZTNH 5JQ6H 4LSUL 5EOCH 1DQML 5EU6D 4KTEH 2DYPA 4J8RA 4N0FA 5HY9A 1JTPA 2P45B 1LK3L 2D0FA 4DK6A 2VLKE 4XC1L 1PW3A 3RZCB 1TQCB 3BWUC 3EHBC 4KRPB 4JFOB 3SKJH 2EYSA 4BUHA 4P2RB 2VQTA 3ARWA 1TQBC 1WTGT 1UM6H 1TQBB 3LS4L 1F2XK 1CK0L 2E9BA 1CFBA 1N0LA 1UVQB 2E27L 3O4LA 4Z0XA 1I1YB 2GK0A 4MQTB 2F54B 1GC1C 1WZ1H 2ATPA 2DQEL 1QLEL 1JI1A 5CP7A 4QYOB 1BMGA 3V6FB 4IOFD 1NEZB 5EWIL 2FYYB 1T5XB 3KPOB 3VD5A 5JA8B 5C0FA 1CD1B 2BC4A 4LSTL 1KFAH 3TO4C 3U6RB 5AWNL 4OCWL 5JHDB 5ETUA 1OSZB 1YY8A 5B4MC 3EOBB 3LMJH 3HMXA 2YSSA 3BKYL 5KTEH 4K3JH 2JIXB 2BNQB 3M45A 1IAOA 1X5LA 4GAYA 2X4NA 4GXUM 5CINH 4AIXA 4IRSA 1NFDA 5I66A 1EEYB 2O5ZL 1BBJA 4F7TA 3WEXA 4L9LA 3ROOB 4WUUE 1LO5A 4YUEL 3FT2A 4P49A 3OZ9L 3FMGH 2YK1H 4PJIE 5DRZA 5A1AA 5IB4B 1V7NH 3DNKA 1FN4A 4LLWA 1IM9D 4OZGB 4XVSH 5FYJE 1HHGB 3H7BA 4GKSA 1F3RB 1IEBA 2DM2A 3WN5C 4GUPB 3GMPB 5DJ8A 4P5MB 1FIGL 4ODHL 1I7UA 4R3SA 1NCDH 5EU5B 2EYTB 4L3EB 1OAXL 2Y1VA 3P4MB 5L88H 3QFJA 1RIUL 1T21B 4JFPB 3WUWA 4NCDA 2E5EA 4I48B 4DGVH 1FQ9C 2A73B 2WM0A 3L3GA 4IOIB 5C0BE 5EN2B 3EO0B 4LSUH 4PG2C 4ELMF 4ZODA 1DQMH 4ZS6D 3MLXL 1LK3H 1JPTL 3JWOL 1J8KA 3L7EB 1VESA 3F7YA 4PJDF 5KSBE 3HZKB 3RZWA 4R7DA 1CK0H 4X9BA 3H3BC 4G3YL 2E27H 5H37G 2KBGA 2CSPA 1XR8B 2JCCB 4FQJL 3HI6L 2PW2A 1MHPL 4RFNC 5FO7A 4IIQC 2DQEH 2HRLA 4RFNB 1CXKA 5HHXL 2FD6L 5DEGA 5E7BA 1K3IA 4L29B 4NQXB 4YZFF 5GRVK 3QDMA 3VI3F 4HH8A 5I1CH 2BHYA 4I18C 2DMCA 2J6EA 2UWEE 3NIGE 3OKYA 2ID5A 2MSPA 4U2YA 4LSTH 1JNHA 5AAWA 1FO0A 2VXQL 4BQBA 4OIBA 2NX5B 5EU6A 5AWNH 5L2JB 3WS6C 3BEVA 4F58L 5C0IA 4M00A 1ZLWH 4M61B 1LEKB 4U1LB 1T1XA 3WE6A 3ULVF 4D0CA 1NGXB 3WDJA 3D3VD 3D2UB 1MQ8A 3T4YA 43C9A 3EGSB 1RQ5A 3H9HB 4RFEB 2Q7YB 3SGEI 1CZ8L 1S7SB 3KPQA 2P7TB 2FJHA 5DK0A 4LPXA 1NEZG 1RUKH 1B4JL 2O5ZH 4K23L 5DRNA 3MV11 1YQVL 4EOWH 3HPLB 4GW5B 3IDGA 1T3FB 3OZ9H 4BSWA 1UM4L 4QRPD 3GGWB 1F4AA 3LZFH 1Q8MA 4PJGA 1FL3A 1GZPA 2A9NH 2RBLA 3B9EA 5F6HI 4NZRL 1KN4L 5KANI 1I1CA 2XV6B 2RGSA 3G6JF 5KZCB 5BQ7A 4HKXA 4ODHH 4PJ7F 4QF1A 3CXHJ 3GJEA 1OAXH 2C7UB 2DJ4A 3MRCB 1LNUB 1A6TB 2XNAA 3F58L 3SE4C 1SHMA 1RIUH 4CU7A 2VDKH 3MRJA 3BGMA 3AB0C 2YA1A 3I84A 3WLBA 3BD3A 4GRWH 4MJ4A 4EEEA 1WZLA 2LVEA 2CJUL 3PABB 1D5XB 4LL9A 4FFVC 4NKIL 2QJDA 3MLXH 3MV8D 4HJ0C 1DL7H 1SVCP 1JPTH 2BOBA 4LSQL 2HT4D 3JWOH 1DQDL 2P5EB 1NAML 3RIFK 3T04D 2X4PA 5DC9B 3SQOL 4NQCB 1KB5A 4HK0B 3T1FB 1K2DA 1TITA 5F1NA 3IDMB 1P6AB 4PP2A 5EPMB 5ICXA 4JLRB 5DD3L 2BNRE 4G3YH 3V4VL 4QTHA 4I2XA 5I8CB 3HI6H 4ZQKA 1NBZA 1MHPH 1VFBB 1TVBA 5KSAC 3HZYA 4ETYA 2BNUB 3E8UL 2FD6H 4ONGL 1GH7A 1U8OA 3BD5A 5DS8A 3ARZA 2W38A 1HXMB 1W0YT 4E41A 2YXMA 4LDOB 4YDJB 2DQHL 3HNTH 1J86A 4CMHC 1FJ1A 2EDWA 5C7XL 1JGLH 5E94B 2E8YA 3FO9A 2J2ZA 3B9KA 4LHUG 1MAJA 4ERSL 5JOPE 1R24A 3GIVB 3H9SA 1AXIB 4C55A 4CADA 2WBJC 2H2PD 4JM2D 4AENA 3VRIA 1RIVL 4O51B 5IK3A 1CLYH 4MCYA 3MXWH 2Y5TA 3WFEL 4LPUA 4G9DA 2R39A 5I6XC 1CZ8H 3OKLB 5K9OA 2VLMD 5I6XB 2H26B 1YN7B 2X41A 4XCNB 4EI5D 3L6FA 2A6KB 1B4JH 4K23H 5L9DL 5F9WC 4LLAA 4D0BB 5LCVL 3SGEH 1YQVH 1P53A 3IVKB 1P9MC 1PGRB 2E3VA 3D9AL 4J6RL 4D8PA 3MLZL 4FA8A 1UM4H 3EJYC 4U1IA 2CMRL 3LKQA 3ZKQD 3N06B 1I3UA 3MGAA 4LDLB 3TYFA 3VFUB 1A3QA 4F7EA 4NZRH 4ZPTA 1KN4H 4ISVB 4WJ5A 1CIUA 1LD9A 4JN2B 3RWJB 1CN4A 4E42A 2EXYC 5TFSL 4LSSH 3HR5A 5SWZD 3VFRB 1FYTA 5LVEA 3VXQB 1HH6A 4J3VA 1MELA 4JO1L 4YHNB 1I8KA 3GHEL 4MSWB 1I8IB 3WD5L 4FHBD 1T22A 2R2EB 3MV7E 4L4TB 4PRID 5D7IE 2OK0L 1HK6A 2NY3B 5IB1A 5GS0C 2C3GA 4L8BB 1G7HB 4NKIH 4IMKA 4APQC 1QOKA 4TNVF 1I3GL 1ZHLB 4LSQH 1DQDH 1NAMH 3SQOH 5KG9A 2ITDB 4PRPD 4D0DA 1L0XA 4O2EA 5DEFA 1N6VA 3UX9B 5ACZB 4JANB 4X6EB 4QRPA 3TF7C 3WFHA 1WTLA 3T0EE 3UC0L 1ZAGA 3WIIL 1ZHKA 4KMLB 5DD3H 3V4VH 3RI5F 1RZJL 1OHQA 4U1SA 5A43C 1UJ3A 3LQAH 3E8UH 4G6FD 4ONGH 4KRLB 4U05A 3T2OA 5T33L 2HKFL 2Q86A 2H8PA 1A4JB 3QO1B 3H8NA 1TVHB 4RGND 2DQHH 2GJZB 4DW2L 4NO2A 1U8HB 4QWWD 2Z31C 2ATKA 5F7YC 4HUWB 4YBHA 4J3TA 5C7XH 1XF2B 2Z31B 3OTTA 4ERSH 2FJGA 3ULUE 1JGDB 4YC2B 4FQ1L 4YHIA 1RSFA 5AYUL 5K9KA 3P4NA 1RIVH 4JHWL 4U1KB 3HUJA 1B6DA 4U3HA 1L0YA 5DJDB 3KYNA 4GT7A 3PGCA 2ITCA 2F8VA 1S78D 3O11B 5M7QA 2QSCL 5L9DH 4JEGB 5LCVH 1D6VH 2OTWB 4MAYC 4Y4HC 2BVTA 1BGXL 4G8FA 1OGAB 4QXGL 3MLZH 1MH5A 3CXDL 2YEZA 1A21A 2CMRH 4JG0L 4PLOB 3KNBA 3CJJA 3PV7A 5EIIB 3V2AR 5DJAA 4OLUL 1ORSB 3CAFA 5CSZB 5TFSH 2JK5A 1UH3A 3DMMC 3HCVA 3F12B 3P2TA 2HJKA 2X89A 4Z7WF 3UTSB 4ZO8A 1S7WB 2YUZA 2APTA 3V6OC 4ALAL 3GHEH 1PG7L 2EDQA 2EE6A 4NQDB 35C8L 1D6EB 4LEOA 5I0ZA 4JFDD 3D18A 3C87A 4L4VA 2E6JA 5CEZL 3U7YL 5EUKA 4OZFH 2FSEB 4PGEA 2I07B 3VW3L 4S2SB 4EI5A 1I3GH 2IH3A 1A9EA 5FV2A 3DX7B 3S96B 4PJBF 4HH9A 3D69B 4JPVH 3DURB 4TSBL 3OGCB 3BWAB 5GISH 1MCPH 3SBWA 2F74B 3KPNA 5JXEA 4R96B 3WO4B 3DX8B 4K7FB 4PRHD 3MJGX 4UIKL 3DO7A 3UC0H 3WIIH 4P57B 3U82B 1RZJH 2D0GA 4HWBH 5J1SC 2VIRB 1YMHA 3BP4A 1EUTA 1U8IA 2YPLB 1FFOB 4WI8A 5T33H 2HKFH 4LQ1A 1DBKL 5HGAB 2HT3D 3T1WA 4FXLA 2Z93B 3J7HA 1KOAA 3QAZB 3MUHL 4RDQG 2LAGB 1WBZA 4MHHI 3SDDC 4S1RH 5DMGC 2H1PH 3SDDB 2CO7B 1CR9L 1JIBA 4U1GB 3VU2A 3CU1A 3WYRA 1VA9A 3QEGL 1G7MA 3S97C 2AJVL 1JYXA 1KLUB 4JY6B 4PJXB 1NEUA 4BFIB 4U0RC 4JHWH 4P2OC 5MEQB 4FQ2L 3DV6A 3ECBA 5T3XL 4I0PC 4P2OB 4QY8B 3SOBL 4LIQE 4RQQA 1KIQB 2ZZUT 5I1IL 1CLCA 3BZFA 1P1ZA 3X14B 3GI9L 1RUAH 1IARB 4TVPE 3V9FA 1BD2D 2M26A 5ELIA 3ZMRA 4XB7A 2AXFA 1FZKB 5CGYC 5CD5C 4QXGH 1BGXH 3KS0H 3PWPE 3T2PA 3RJQB 3CXDH 4UT7L 4J4PD 4YHPB 4JG0H 2MWCA 1EFQA 3KLDA 2AI0L 1AR1C 1QHOA 2EDHA 1EHNA 1V3KA 5BZWA 4NQUA 5GZND 5I1EH 4CN4A 1BF2A 4QXUL 4YBQC 4ZSOA 4LNRB 5CEYA 1KTDA 1UC6A 1G9ML 4EJ1C 5D7JC 3IXAA 4XP4H 4RIRA 4ALAH 3CZJA 4ODXB 1T7VA 1RZKL 1PG7H 4XGZB 4MNGA 1NMAH 4XP1L 3X3FL 3RKDC 2AK4E 35C8H 4L4JA 3MYZA 2ESVB 5FKAB 1YDPB 3Q5TA 5C07B 4S1DC 5CEZH 3KPSD 3U7YH 4K8RD 1MAML 1T0PB 2GFBB 1ZE3C 3VW3H 4MNHB 2YC1B 4NFBA 3UXFA 4TSAL 4JVUA 4Z7UB 2Y25A 4PY7A 3F65A 4TSBH 2FX9H 3QUML 1MVUB 3VWKC 1X5AA 4KWUA 1UACH 3QWQB 1Q9OA 2GY5A 1T7YA 4GXVL 4WW2F 1T7WA 2IADB 2AEWA 4LVHC 5HJ3A 1FLTX 3FB5A 3E3QC 4E0RA 4CNIA 5I18L 4XNQA 3I6GA 4R4BA 1M7IB 2APFA 4C56E 2GEEA 1L6XA 4JFHD 3ILQC 2OL3A 4OI8A 5DR5L 3BW9B 4NO0D 5EUOA 3SKMB 3AXLA 3ULSB 1DBKH 4R0LC 5ACLA 3JWOC 4FFWD 5CJOH 4BQ8A 4M4PA 3BKCL 3IAGC 4ZFZA 4JFDA 2EEAA 4QEGA 1CR9H 1JMXA 12E8L 3D48R 1XGPA 4ZFFA 1UH4A 2HKHL 4X8JB 1XH3A 1CGWA 1F6FB 2ICWA 2HG5A 2LVCA 5JNYB 2OXHA 2HMID 4UT6L 2DICA 1KJVA 1MCOL 2X1WL 1QSFD 2JJWA 5SV3A 4OZ4A 1U91B 5IB5B 4FQ2H 1IAIL 3EFFB 4HIJB 5T3XH 1Z9MA 3SOBH 2NNAA 3NOIA 4HK3N 3KYOB 1FNEB 4PRHA 3TCLB 5I1IH 1DTUA 2D0HA 5AZ2H 5I1HL 1N0XL 2WIIB 3RDTD 4G8EB 4Z6AT 5CIPH 2X4RA 5AUMB 3MRLB 3ARED 4UT7H 3TEUA 4G42B 4K3EL 4ZYKB 3QDJE 5IKCA 2C3HA 5E6ID 3UYRL 1PLGL 1QLFA 2AI0H 5I8OL 2XA3A 3SDAC 4N0UA 4QRUB 3QQ3B 3CGTA 2HTKD 1R3HA 3RWFB 2KPNA 3IJHB 5D2NA 1H0DB 4U6YB 2ADFL 3OR7B 4JGMA 5FM5O 1G9MH 1UWXH 3GM0A 3LEXB 3OAZH 3U46A 3QJHB 1CXLA 1L9MA 1QPPA 3BI9X 1NSNL 3BFOA 1KBGL 4BQ9A 1BLNB 1RZKH 4UNUA 4MJ2A 5HVHC 4XP1H 1GPOL 3X3FH 4DN3L 2IPKB 3EUUA 3O8XC 4NQSA 5FGBA 4CGTA 3MRGB 3CMGA 1QFUL 2EICA 3O8XB 4YHOL 3PQYD 1A7OL 4PJ9B 3VXNB 3KLAA 4WGWB 1IL1A 3OJVC 1OTSC 4WI9A 5SV4A 4KKBC 1CFSA 4NCC1 2R8SL 3QHFH 2BP3A 4IRJD 5JIPA 1DVFD 1KYOK 4DGYL 1G7LB 4OV5A 4J4PA 3MPCA 5GZOD 5IB2B 1HYRC 4P5TC 4IJ3B 2FLRT 1CFVH 1REIA 1U95A 1JPGA 1SVZA 4DEPB 1P2CA 4ZUSA 5I18H 4ONOA 1A02N 5ADPH 3G5ZB 1U6AL 2MQ0A 1RU9L 3ZDZF 4LEXL 3AS2A 3SO5A 1WQVT 3UCRA 4JRXB 3F62A 1UQSB 2HFEB 2GITA 3S9DB 3BKCH 2EH7L 3ZDYF 5EZIH 4WWKC 5DTFA 12E8H 2PTVA 1X4ZA 4PJHB 1B0GB 3S5LG 2AJ3A 2DL2A 3NIGF 4RAVB 3WCYA 2I24N 3B83A 3KPSA 5K9QI 3WDIA 3EDKA 1I7TB 4N5UA 4KY1L 1ZLUH 3VXMB 5IQ7H 3RVXC 1CQKA 1XF5B 1N3NB 5ISZA 4OM0L 3T0BA 2BVQA 3B2UD 5CBAA 1JYVA 3LQAC 3FQUA 4OCYH 1IAIH 5DZOA 4KVCL 4LLVB 4TNWF 5F88B 2B7DT 1K8DA 3EZJB 4XNUL 4YJZL 4KK6C 4Z9KB 3SDXA 4KDTC 5EO1B 4WTZA 3HE7C 1N0XH 2DI7A 1F11A 4XTRC 3G6AA 3R0NA 4WO4D 3FB7A 3UPRB 1YC8A 1FZJA 4JKPL 4HJGB 3RX5A 3ZDXE 1LO0L 2ADJB 2MFNA 4K3EH 3I75B 3WLWD 4NO0A 3ULVL 1WEJH 3UYRH 3VGDA 1Q1JL 2DQGH 2FWOB 3MGOA 2FZ3B 3NN8A 1DBML 1A7PL 3LKPB 3TNMB 1KPRA 2AP2A 2M8XA 5CZXD 5IROA 2ADFH 5ESAA 2BMKA 1U8JB 1CDJA 1BWMA 4YR6B 3NABH 1KBGH 4I0CC 4UQ2B 1T20A 4AG4H 4X7FC 5IV2A 4YPJA 1EEZB 1MFDL 2XN9E 3ARBC 1YEHH 4KKCC 1GPOH 1GSMA 1PQZA 3ARBB 2R2BA 4DZ8A 3O2DA 1S9XA 5EBLA 1DR9A 1QFUH 4J12A 4YHOH 3V0VA 1HQ4B 1DJSA 1XCTB 2VN7A 3IKCB 3RUGB 4GO6B 3EYOB 5DVKA 4JRYA 3RDTA 3VGGA 5B3JE 1LP9B 1HSBB 3RL2B 1FVCB 5JW4N 1QRND 4DGYH 3RA7L 4D9RD 2W07A 3G5YB 5FYLE 5DD5L 1D5BA 4NZDA 1IZKA 2LTQB 2VKWA 3GSQB 4PTTB 2V7HB 3TGXA 4ZFGL 3QA3A 3VXUA 3ARGB 4OKDA 2Y4SA 3KYKL 4Y2DC 3CUPA 4LCCC 2DLFL 4KRNA 4JDTL 2B39A 4OFYA 2OQJB 4Y2DB 5T3ZD 1RU9H 4LCCB 2DN7A 3MNWB 2X40A 3TFKC 1VACA 4OZFB 4LEXH 3UDWA 4PJAB 4M7KL 1S9KC 2CDGA 4UOJA 1BIIB 4WNQB 3DETC 3V79C 3VGFA 4PD4K 1HHJB 3FT3B 4LKCB 1RJZA 1WK0A 3ORJA 2EH7H 4AIOA 3QUYD 5KANG 2CQVA 5CSGA 3U0PB 5I1AA 1RZ7L 2VLJD 5E56A 3ARPA 1RZJC 3B8SA 4KY1H 3RWGB 1OTUD 2YUWA 3VWJD 1T4KB 4JO3L 4OM0H 4X6DA 1UXSA 1IJ9A 3AMKA 4JFYB 3WJLA 3MV9D 3FB8A 5I75B 4R7NB 4M62L 1DVFA 2F58H 4XNUH 1Q9WA 4QT5A 4UTBL 3FQWA 4R2GC 4OF3A 3MRIB 4Y4FA 5F9OL 3AFLA 3WFCL 4KTYA 1ZT1B 4JKPH 5IW6A 3DTXA 1L7IL 1ONQB 5IEHB 4JVPA 2G2RB 4TUJB 3K0WA 4G9FE 5DYOB 3UZVB 2V2WA 4B5EA 5KVMC 2BNQE 3MV01 3ULVH 2RR3A 1WSST 3CSYA 5I1LB 2CK0L 4H0GA 1Q1JH 1IC7L 1EK3A 1DBMH 1IGCL 1J88A 4LCYA 5FDYA 5FYKE 2B1AL 4YDLB 2R0LH 4LSVH 1HINL 4JO4H 3VFNB 1I9JH 2YPKA 1RURL 1MHCA 1WT5A 4FG6C 2DM4A 1U8NA 4L8SB 3GMLA 1MFDH 4AL8H 2CRZA 4ZUUB 1GGCH 4PJ8D 3LV3B 5E99L 2AXHA 3ARVA 3QSKB 4Y89A 3TLRA 1NDMA 1OW0A 5CLWA 2WQ8A 3VJ6A 2JB6B 2FIKA 1KF9B 5GHWL 4MD0B 3VG9C 5D7IF 1JGVL 1UCBH 3C2SA 4WO4A 2X5PA 4QGTA 2EE9A 1IRAY 4LCWE 1S7UB 3FO2B 1LQSR 1F8TL 2W65B 5C09E 1F97A 3KYAA 1TZHA 5SWQB 1K9TA 2JF1A 2P5WB 2DQDL 4FFYL 4TPRL 3L3OB 3BZ4B 5AZEL 2YWZA 1KGCD 4ZFGH 4UIMB 3K4ZA 2A6JB 4X7DC 3KYKH 1GGYA 2DLFH 4PTUB 2EEDA 3O9WB 4JDTH 2JELL 5IVXF 4LSDA 3TH4T 3VFVB 4GAGL 3M07A 3BGAA 3DGCR 3TA3D 1BZQK 3HC3L 2GCYA 5EORL 2VE6B 1RJYA 3OMZA 3T2NL 3TO2B 3UROR 4I77H 5BJTA 1VHPA 3TZVA 1KSRA 2VTFA 4WI5A 1TZIB 3D85D 3LKOA 1J5OL 1RZ7H 1BHGA 1BFOB 1T2XA 1O5DT 5E2UH 3V6BR 5JPMB 1ZANL 1UCTA 5GGQL 3ULUF 3GBLA 4P3DA 3VFMA 3ARDB 1VENA 4XWOC 1P7KA 1CG9A 4JPKL 4G8GE 2NY2D 4O58L 3VGAB 5DFTA 3QDGD 1NCUA 3QULA 4M62H 1QRNA 1WZKA 2HYMA 5GGSY 4MMZC 3RGVB 4JFXA 4OZFG 1L7TH 4UTBH 4ZUVA 4ODWA 5F9OH 3RWDB 3WFCH 2F53D 3VFSA 2NQCA 1A9BA 4QLRA 1XGTA 4QXWA 3PWLB 4NRYA 4N1EA 4XAWL 4JZNA 5C0JA 1RUPH 2Z35B 3JVGA 3X13B 4WUKL 3LSOA 2EDNA 4ODSL 3F6IA 2C3VA 1KCSL 4X83A 1IC7H 1S7VA 1BVKB 4FFZL 1JRHI 1NC2B 1IMHC 4JJ5B 1IGCH 3T8XB 3EO9L 2Y7QA 1O7VA 1W0VA 1VPOL 3IB4A 1WISA 3FQXB 4OJFL 1HINH 2A83B 3IDJA 2VLJA 1JRHL 4XBGA 5DA0B 5HXMA 1GAFH 1RURH 3K80A 3LRHA 2W0KA 3LQMA 1HQRA 4F7PA 4X6FA 4Y19B 3QUXC 2VLKD 4XWGL 5E99H 3MV9A 4PRAA 4RGNC 4XX1E 5E5MA 4QWWC 3HMXL 1HSAA 5LKNA 4XMLL 5GHWH 5LQBL 1FVEA 5L8JB 3K1KC 1OP5H 1C5DB 1JK8B 2EC9U 1E28B 4ZOBA 3D25B 3QIUC 1G9MC 3MNZB 3MREA 3P0YL 4MQ7B 2XFXB 4ZXBD 3QIUB 1F8TH 5TDNB 3LDBC 3TNNB 4LCUB 4NDMA 4L8CB 3M8OL 1RZKC 2DQDH 5CJQL 4XBPB 3QT2A 3FCTB 4YHZL 1HH9A 4RGOL 5CWSA 2P5EE 3LD8C 1S78C 4HW6A 4Q74A 2YRPA 1N8ZB 5INCA 2MMXA 1FL6A 5DUPL 2FR4B 4PP1C 4YHLL 3O6FA 3EFDL 1AGCB 1JUFA 4GAGH 5MEOB 5SX5K 3S34L 4ACPA 4HUXA 1KCLA 3HC3H 4G6AD 3T2NH 1A1MA 3MLUH 4MZ2A 4KMTH 3QI9D 3UTTB 3QUMB 1F6AA 3KJ4C 5F21B 2DB8A 5FAAA 1J5OH 1AD0A 2CLZB 1ZS8B 3KJ4B 5IF0B 2DL9A 3MJ8B 4HWNA 5KS9F 4M5YH 4RAUB 4AM0B 1ZANH 4NHUA 1DZBA 5DGRA 5E8NB 1KNOA 3SJVE 2BY0A 4P46B 4KJQD 4YGVB 3BX7C 2EDKA 4M48L 5DO2D 4HDIB 1R5WB 3ZE2E 1LE9A 4WUUD 4O58H 1SJHA 3OX8A 3MMEA 1DANU 2E6PA 1CF8L 5E5UB 4KAQL 3OKKB 2D9QB 3QH3B 1RZIA 1KN2L 4HZAA 2AV1A 1S7RB 5T3ZH 1I4FA 4DKAA 5DK3A 2NXYB 2VOTA 2HWZL 4WUKH 3AU1A 1T83A 1SJEA 1J87A 3BVNB 3CDFA 3E0GA 3STZA 2HVJA 4HFWA 1CICB 5J6GB 3WFDL 5IBLD 2R23B 5D2LA 2A1WL 4EQ2A 1NFIA 3RHWK 3SY0A 1CT8A 2Q3ZA 4FFZH 4OKVB 4EVNB 5E8DL 4DN4L 1VPOH 1M6OA 2C3WA 1EFXB 4P0DA 3D85A 4O2CA 5E03A 4OF8A 4OJFH 1MRCL 2DQJH 2J6EL 1KYOJ 3U0WH 1CFNB 2VH5H 3PGFL 4ZUTA 1BX2A 1FO0L 1HDMA 1FLRH 4WCYL 1FL5B 1D9KC 4N0CC 4OAWB 3KWWA 4XWGH 1XGUA 1D9KB 2HN7A 2LU3A 4Q9RL 4MHHG 3QDGA 2R1WA 5J7CC 2P49B 2JLLA 1YYLL 3S36L 3T77A 4ONFL 5LQBH 2APWA 1B6UA 2C26A 4KJYA 4B53A 5D7LD 3P0VL 1E27B 3QUKB 5EO9A 1N26A 1OTTD 4RMQA 2QKIA 3C5ZD 4L4TE 2Y07L 3M8OH 3KDMB 3UPCA 1JBJA 1CTOA 4RZCA 4OZIB 4F8TA 5CJQH 5GSVA 1KCUH 1MJJA 4UUJB 4AY0A 5JIHA 1YMMA 4KVNL 4YHZH 4RGOH 3STLB 1OF2A 1CTNA 1EJOL 1U93A 4NUJB 4ZAKC 4QTIH 2V7NA 3TBVB 4ZAKB 4YHLH 2IH1A 2WUCL 4JKWA 3BPCB 2HFGL 3S34H 4LPTA 4MDJB 4KMQA 3WFZA 1P4LB 1IGIL 1JPFB 5B8CA 5INDB 4FQHB 5J3HD 3S37L 1QR1A 3DUSB 3IS1X 5IBUB 4X9FA 5KVGL 2HFFA 5D1QD 3B9AA 3QQNA 1AGBA 5FIEA 4J3SA 4GRMA 4X99B 5HGDA 4M48H 2PR4L 3VXRB 3P9MB 3C60D 5IWLC 4ZXBA 1NLDL 5IVOA 3W39A 1CF8H 4U3CA 4M03A 2SEBB 4Q2ZA 3PWNA 3L3JA 5FUOH 1G7PA 4WDIB 3MBEC 1NL0L 1YUHB 3MOAL 2JJUA 1GGUA 2W91A 4NFDA 3MBEB 2VXVL 3I2CL 2R0ZH 3E6FA 1KC5L 3L3DA 2JJSC 2HWZH 3TIEB 4JFFB 2OLDA 3ES6A 2WAHA 1OB1A 4LPYA 3U30C 3SDYL 3WFDH 3JTTB 3RWHA 3V0WL 2A1WH 1X5ZA 5E8DH 5EH1A 3VMPA 5C08B 1AKJA 4PGCA 4KKLC 1MRCH 3OF6D 3BT2L 1T66D 4JJHA 4M1DL 3VXSB 2D31B 3BE1H 2VL5A 2XWBA 3BH9B 5EDXA 4ZUWB 1Q38A 3MFFA 3KPPA 3O6KL 4U1JA 2AXJA 4MD5A 4XCCL 4WCYH 5CUSH 3VFGL 1QLRB 2ICEA 2KL6A 4OFIA 1CCZA 4MXWH 2QQNL 5ESVA 4H1LH 4WUUA 4Q9RH 1OGTB 1G7QA 3ULVC 2WINA 5IFAL 5F9JA 2NTSP 3MCLH 2ZJSL 2R0KL 1YYLH 3S36H 3Q5OA 4PJIA 1CE1L 4PG9B 3M17B 1QBAA 4PD4J 5J1AA 1MY5A 3V6OE 4J2XA 4LFHG 4NQDE 3MRQB 3V5HA 2VUOA 3HE6D 2XOTA 5FOBA 5FYKU 1MLCB 4F80A 1WWBX 4MWFA 3JTSA 1XF4A 1VFUA 4U7SA 4KVNH 1BJ1J 4XXCC 1CDCA 4HSQA 1EJOH 5T1KB 4KI1A 5C0BA 4PGBB 2BSRA 4QHNB 1G9EA 2HFGH 4OCNC 5F7LB 2CLVB 3AREC 4JN1L 2ZUQB 3TPUB 2VABB 4H20L 3FOLA 2BSTA 3RPIB 4GG6E 3S37H 3U4EA 5E6IC 3OKOA 5A2LH 3UTQB 5DJZB 3QQ4B 4PREB 5CEXB 1HILB 3SCMC 1R5VA 1V7ML 5KSBA 4X80L 1ZLSH 5GS1C 3D39B 3LRSB 3EOYG 1HKLL 4FTVB 4DKFL 1FVDB 1NCWL 4ETQA 2XA8L 3V95A 3QG6B 5IHBA 1J05B 4RRPA 2OI9B 4X6CF 4R97C 4QCIA 2Q20A 5KVEL 1BQHB 4Y4KC 1Q0XH 3GEWB 2GQHA 3PNWB 4MJIE 1NLDH 4Y4KB 1TCRA 2XZAL 4C83B 4OZHB 3Q6GL 1OAUH 4YQXL 3TBSA 1MRDL 1HWGB 1KT2A 4PJXE 1NL0H 3MOAH 5C6PB 3DIFB 2VXVH 3I2CH 1QQDB 2UWEA 5IBUG 1KC5H 5F89A 1YPZB 5SWSE 4LRNH 3SDYH 3EIFA 4IRJC 1XZ0B 3X12B 3CDCA 2MKLC 4LGRB 3IRZA 4X4ME 1NBVL 1I1FA 1JGEB 5JTWA 4P4KD 5KVDH 4NO3B 1MJUH 1LEGB 4D9LL 3MV7D 5HVFB 4RFOL 4M1DH 1I7RA 5D1QA 5KN5A 1J18A 1LE5A 2HLAA 1ZHNA 4ZOCA 3FRPA 3PHOA 4HMEA 5HTSA 4F7MB 5IMOB 1MFNA 5E8PA 3P9LB 1LILA 2VDNL 4IS6B 3NCJL 4K2UL 2DMKA 1JWMA 5JORB 4JB9L 3ZKNC 1WFNA 4AT6A 3BP7B 5IFAH 1HI6B 4JQVA 2BSSA 3CVIH 2ZJSH 5E9DB 2R0KH 1K4CA 2VLRE 3ARFA 3CZFB 3V8OA 5LWYL 1XMWA 2E7CA 1CE1H 1A6PA 5K9QG 4XBEH 4M8QB 3QWOB 1CGYA 2ESVE 2MTPA 3H7LA 3ARRA 1W0WB 4M7JL 3G6DL 5FK9B 3IFLL 1B3JA 1TJGL 4OF5A 3TYGL 2V2XA 3CVHA 3VXPB 3MJ7B 1NGWA 4Z7UE 1BQLL 5JR1L 3G5VA 3KYMB 1UEYA 3OF6A 5FM4A 4NQVA 3ULUD 3AM8C 5L2KE 5E6YA 1SMAA 2YUXA 3DGGB 3VH8A 4NO5A 5J9PA 4JN1H 3REVA 4H20H 2XWJA 2B20A 1Q94A 3WLWC 1N5YH 4GRWE 5IMLB 1FZOA 1OT2A 3E3QE 4PJCB 1H3GA 1V7MH 4X80H 2VQ1A 4JDZB 4H8WH 1HKLH 1P7QB 4DKFH 1NCWH 2XA8H 2BY2A 4TTDD 5D96B 3BUYA 1BVLA 4WW1B 1T89A 2XACC 2BNRA 4MB5A 5A2FA 4P23A 1M05B 1JN6B 5I71B 4HKJB 2XZAH 4HD9A 5D93B 3CCHB 1G7IB 4AEEA 2O93L 4ORGA 1FGVH 4YQXH 3L3IA 5HHMB 3DVIA 2QADD 4TNVK 4LLYA 5CKGA 1V05A 2IANE 3MXVL 4QRSA 3I6LE 1Z9OA 1E4WL 5DGQA 5F8QC 5GGUA 4ZTOL 5HHOB 5FHAL 1OOAA 1EEQA 2HVKB 3GIZL 3VGEA 5IM7A 1H3UA 1YNTA 5MERA 3KR3L 2DYPB 4J8RB 4N0FB 1NBVH 3EOAA 3ET9F 5HY9B 4UQ3A 1PFCA 2DD8H 2ZNWA 2ARJA 2B5IB 3GSRA 5TJWK 3DX9A 4RFOH 2IPUK 1BVZA 4GKZA 1MQKL 2P47B 1U8QB 2VDNH 4K2UH 1BOGA 5DJ2A 4Z0XB 1UG9A 5I1GH 4JB9H 2GK0B 2PKDA 4OZGF 2QQLL 2PXYA 1IKNC 2V5SA 3QUYC 2H32A 2ATPB 2WWKT 5LWYH 3EYVB 3NCYS 5CP7B 4YLQT 4KUCF 4TSCL 3G6DH 2DQIL 1TJGH 1CU4H 4M3KB 3AC0A 3DSFH 4LDEB 3SEPA 5KSVA 1YEDA 5ETUB 1GYAA 2IBZY 4P4KA 1BQLH 2BVUA 5JR1H 3TN0D 4Q9QH 3IETB 1YY8B 2EIEA 3MV7A 5C0AE 1RZFL 3DX6A 4LVOC 5D7IA 4ZTPL 4V1DD 3BHBA 1S3KH 2YSSB 4S0TD 5GGTL 3D0VA