4RGNB

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
213
Chain Sequence
EVNLIESGGDLVKPGGSLKLSCATSGFTFSAYGLSWVRQTPERRLEWVASISGGGSVYYPDSVKGRFTISRDTAGDILFLQMNSLRSEDSAIYYCVRDLYGDYVGRYAYWGQGTLVIVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 44
structure length 213
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnB01
5EU7E 1JF1A 4DGVL 3NN8A 2P24B 3QHFH 3N9GH 3MACH 3QFDA 5EFIA 3ZYJA 5I19H 4L3AA 2IEPA 1MAJA 2NY7L 5JXAH 1RY7B 4Y5XA 4F7MA 2NY4C 3FQUA 1AQDA 3CSYA 3DSFL 2YK1L 3GNMH 5T3XE 1KJVB 1OTUC 3NIDF 1KYOK 3Q6FA 4G6AD 5D1QC 3EDJA 3AROA 4HS6A 1RIVL 2OLDA 4GRWE 2HP4A 4OKVB 4OD3L 1OAZL 1YEJL 3VI3F 3MJ9A 1NCAL 4G3YL 2XXMB 4IHOB 4YZFF 2IBBA 4OIIH 1LO3L 1IGFH 2BJML 5E5MB 2O5XH 5KVDH 1CLYH 1C5CH 1VFMA 1V05A 1JUFA 5HDBE 5K9JH 1R3KB 5FYKD 4BSVB 5HVHC 4ZO6A 1B90A 3L3HB 1Y6KR 2N7BA 1IL1B 4V1DE 1BBJA 4O9HL 4OLYH 4POUB 2QR0A 1CDGA 2EYSB 3TIEA 3H9SD 4XMKH 3QIWD 1L7IL 1II4E 5GRWA 2VAAA 3ALXA 3I3EA 5HHMD 3KNBB 4P2QD 1NCCL 1AHWC 3X14A 2IAMB 3C6SB 2EYRA 5F7WC 1GHFH 4U1HB 4F9LC 1OGAB 4RGMC 2XT1B 5EUOA 1YA5A 4AEIH 4R2GC 2ED8A 2A0LD 4GG6E 4G7VH 1AC0A 5GGUA 1Y6NR 1CFQB 1JGUL 4PV9B 1FHGA 4I1NB 3RAJL 3CMGA 4ESKA 4OZGE 1UEYA 3JWOH 5KW9H 4XP5L 1K5NB 1MRDL 2AAVA 5JIKA 4PD4K 5C0IB 1AKJD 4WVRA 2MTPA 1CFNB 4KV5F 4L1DA 3O0RL 4XPFH 4GW4A 3CFDA 2ARJA 3OJDA 4KRMB 3B2UD 3SPVA 1C08A 4XBGB 2PYEE 4AK1A 5JLZA 2VH5H 5TE6H 4OLUL 1OWWA 4RGND 1I85C 3MA7B 4Y1AB 1JMZA 3O9WC 2BFVH 3DO7A 4OD1L 2L7UA 4NO3A 3ZDYE 1EFQA 5E2VL 4H0IA 4X9GA 2GSIB 1F4HA 1IGCH 4ZS6C 2DLHA 1MWAB 4HIJB 1XCTA 5KAQF 5BO1L 3TGXA 5CD5C 2YUZA 2EDEA 5C0ND 2ENSA 3G5YA 5TJWK 1UXSB 1K6QL 2W65B 2D9CA 5E94B 4RFNC 4U6VL 2FWOA 2VN7A 4GUPA 1T04A 2XTJE 3KYNA 4U2YA 4U7SA 2NLJB 3O45B 2YUVA 2UZIL 3H7BA 1CDBA 5GS2H 1C12A 2GTZB 5C7XH 3BPOB 3ZT5A 3P73B 4GXVH 5DZNA 1UQSB 3OTTA 4FQLL 3T4YA 1JPSH 1K3ZA 5F3HA 1JPTL 1RUPH 3V52L 4QNPF 1H3PL 4LEOA 4U1MA 1I7TA 4G6MH 5ISZA 4XRCA 5J13C 5E08H 3QDAA 1NQBA 1M7DA 4XAKE 4D9QD 4NCC1 3ROLB 3HPJB 4QRRD 3QDME 5DMIH 2R0LL 1C5BH 3WFZA 3BW9B 1CT8B 1Q0YL 5F88A 1HINH 1OL0A 2VXSL 1N6UA 3FTGB 3RZCB 5D7JC 3IU4H 1HIML 3SN6N 1TJIL 2H8PB 4UTAL 3LIZL 3BP4A 3DRQB 1IC5H 2Q3ZA 1KYOJ 1GGBL 3I9GH 4F7TB 4ONFH 1Z9LA 5I0DA 1HCVA 3EDKA 1PLGH 2KKQA 5HHOE 2ZOLB 4HWBA 3SDCA 4UI2A 2EDNA 2Z8SA 4R0LB 3FO1B 4G5ZL 4NIKB 2F5AH 5GGQH 2XQBH 4HJGB 5GS3A 2OX5A 2Z31A 4N0UB 3SGDI 4HIXL 1U8OA 3FFDB 2AS5M 3L7EA 2A74B 3SE4C 3IJSA 4HDIA 3EYOA 4J2XA 3FCTA 4YGVB 43C9A 2V5TA 1EHXA 4LCIL 3TF7C 3B83A 2ZG2A 3GB7A 3BJ91 1RSFA 5GS1B 1IJ9A 5J9PA 4CADA 1BD2E 4FQCL 3DXAA 3QDJA 2X42A 1QG3A 1MNUH 1JI1A 5D1XD 3GI9H 2P8PA 3OKEB 3M8OH 2JB6A 2BVYA 1GC1H 4MJ2A 1IAOA 4TSCL 3L7FA 2DLIA 1OCWH 4OLZH 4Z7UF 5KSBB 4G8IA 4NQTA 2C3XA 1A6ZB 5D2NC 1WAAF 3PGDB 4HUWB 3GMQB 3RDTA 4F7PA 3O4LD 2GAZA 4JANB 3THML 4S1SH 5FYLD 2OXHA 1EFXB 4PD4J 1MHHA 1YPZB 4X6EB 1A3QA 1LE5B 3PWVA 3X13A 4LLMB 3F58L 3IETB 1JMXA 3E0GA 4TQEL 4JRXB 3R8QA 1YN6B 2BNRA 1S9YA 2D7PA 2VZOA 3FB6A 3PQYA 3WJJA 4IRJA 1D9KA 1TVBA 2R23B 5EZIH 4YR6B 1M7IB 4KKLD 2Y4SA 3FZUC 5DURD 2PKDA 1UFUA 4OAWB 2VWEE 4EIGB 4BQ9A 1IM3A 2HTLD 3GMLA 1JWMB 3U1SH 4ODVL 4IRSC 2X40A 1JNHA 2OZ4L 3MLTB 1X44A 4I4WA 1FPTL 2PW1A 1IZJA 5ICZA 4OCWL 1S7QA 4WI3A 5I1CL 1FNSL 1EXUB 2ICWA 2QL1A 4M43L 3QISA 2Q8BL 4XBEL 1EGJA 3UPCA 2YEZB 4YDVA 1P7QD 4H1LB 3C60C 5AWNL 3I6GB 4M5ZH 5KG9B 5H94B 4TPRL 4WUUD 3GBML 3D2UA 5DEGB 4XP9L 4L3ED 4MA3A 2YXFA 2JCCB 4J1UB 4NZUH 1JZ2A 2NY6B 1RZKL 1HXYA 1D5ZB 1HEZB 2WUBH 3GDBA 4HS3A 3T77B 3GSRB 3KPNB 5C0AA 4YHMH 1QA9A 3QEUA 4BQCA 3OKLA 3N9GL 3MACL 2ZUQC 2WSKA 1G1CA 2BVQA 4XPBH 1J05A 3SJVE 4LLQA 1X5FA 2Z35B 5JXAL 2WWMC 3V6BR 1T2XA 4U1IA 1EUTA 3KYMB 3S88H 5D96B 3FFCB 3CFKB 2J8UE 1W2KT 1R3IH 3QA3A 3ZDZE 3GNML 1IBGH 2V9QA 5ISZD 3WSQH 12E8H 3BQUD 3B9VA 3U0WL 4DZBB 4UB0H 4WJ5B 4HWBH 1J87A 1U3ZA 5DD1H 2FHCA 3SCMB 3F65A 5DT1H 4I9WE 4CU8A 1S8DA 4J23A 1IGFL 3FB5B 2O5XL 5AUMB 4N5EC 1JZ5A 4Y16C 5KVDL 1CLYL 1C5CL 2ZNWA 4EVNA 2HMIC 3GMOA 2EC9U 3DURA 1XF2B 4PJEE 5B4MD 1CGUA 1A6TA 4ZOEA 5DQ9A 3BIKB 3FN3A 4Y4HD 1UADC 4M5YH 3UXFA 4OLYL 1GZQA 1INDH 5A2JH 3AAZA 5HD8C 3PHQB 3VFUB 5L2JA 2H2SC 3KXFA 4GKOA 1Q94B 4XMKL 2IPUK 3KPSB 1CN4A 2C5DC 2XWTA 2Z31D 2AJ3A 5E9DE 2F5BL 1HH9B 2X9XA 3VRJB 3I75A 1GGIH 4J3VA 4HLJA 3KPPB 1BOGB 3ZDXF 5F9AC 2BSRB 1FO0A 4AEIL 4JFXB 4QHKJ 3ARTA 4G7VL 3X17A 4P4KD 1LEIB 1I7ZB 2HJFB 4ZXBD 4P4RA 4WW2B 1YY8A 4WWKD 3A67H 1IVLA 1A1MB 4OZGF 1BJ1H 5INDB 3QDJD 3LKOA 1FP5A 2XWJA 2JTDA 4ODHH 3O11A 5IMKB 1QHOA 1P4IH 4XPFL 4UV4H 4YDLB 1LILA 3T4AB 4F9PA 4MD0A 1G9MC 5JDSB 1MHCB 5BJTA 4M7LT 2VH5L 3NZHH 2BZDA 3RDTD 5TE6L 3HAEB 4Y5YB 1ETZA 2DBJA 2QHRH 2VLJA 1AP2B 5CLTA 1A6UH 1LP9A 3E1F1 1YECH 1AIFA 4GBXC 3ZDYF 1IGCL 5CIPB 2CXKA 1Q38A 5DJCA 2LAAA 2GY7B 5EUKA 1DANT 1JHTB 1TZIB 2ICEA 4I13B 5DHYA 1EGJH 2BNRD 4IRJD 1AGFA 1D9KD 4L8CA 3OGOE 1Y0LB 3PWNB 1CK0H 4QHNB 3BH9B 5JMOC 1DUZB 4M1CC 4HCRA 2GITB 2DB8A 5EDXA 2A9NH 1MCIA 5DEFA 5F7MC 3F6IA 5C7XL 1CXKA 4GXVL 3SY0A 3DI3B 1EEZA 5DHXB 5I8OH 1OARH 1HDMA 1JPSL 4KC3B 4JJHA 3UAJD 1RUPL 2VZ3A 2EIZB 3OAUH 3KDMA 4X6CA 5LGHH 4Y2DC 3HE7C 3MRBB 2ZSVA 5E08L 4YPGB 2AJZA 1K4CA 3QXWA 4FTVD 4JFEE 1TQBC 1F11B 1HQ4A 1FRGH 2C3VB 1JYXA 4WHYG 4GKZA 1C5BL 1RIUH 5TF0A 1JBJA 5FKAB 4LVOC 5TE7H 3UPAA 1FFPB 4HLZG 4KAQL 1PEZA 2LABA 1HINL 3FJTA 4MAYB 4G9FB 1UZ8B 4K71C 1IC4H 3FN0H 3MJ9L 1CR9L 3IU4L 1KPRB 3C2SA 4AEEA 5J57B 2EZ0C 5FHAH 3CPLA 5C0AD 3QFJD 1G7IB 1IC5L 5FOBB 2YC1A 4QRSA 1U95A 3RNQA 3I9GL 1EHLH 4ONFL 4AIOA 3NGBB 2DM3A 5I73B 3G9VA 1J7VR 5C0CA 5TFSH 1YEGL 4MCZA 4WO4C 3TVMD 4HV8A 1CFVH 4ZUTA 5IQ9B 3EAKA 5D7IA 1KTRL 5MEQA 1IGTA 4Y4FA 4ZAKD 4D0DA 1XGRB 2XQBL 2P5WD 5C86A 3D1MC 3AMLA 2PYFB 1U8QA 3LHPH 1YEHH 4OF5A 4YFLF 3P11H 3PL6A 2VXUH 1WZ1H 1IEHA 2R0ZH 1FQ9C 3VWJD 4JLRB 4PY8J 5DJDA 2B20A 4PG2A 2XKSA 1OB1A 1P9MC 3C5ZA 4JHWH 1YMMA 4YPJA 5KS9E 1FO0H 3T8XA 1Y6MR 1N2RB 2B0SH 1UVQB 3QUZC 2DKUA 1EEYB 4ZUUA 4XH2B 3GI9L 2UYLB 3SE3C 5E2JA 1A7OH 2NXZB 5ACMA 3VJ6B 1N3NB 3W0WA 4KKCC 4NNYA 3M8OL 2HAZA 1GC1L 5FF6B 2VLRD 5EORL 1OCWL 4OLZL 5F1NB 4Z6AT 4FN0A 5ADPL 5IW6A 2BHZA 3GMNA 1X3DA 2W38A 3OF6D 3DBXA 2YD2A 1A64A 2VDMH 4W4OC 5LQBH 5HXMA 1VHPA 4Y4KD 1CIUA 5IKCB 5E70A 1TZHB 4S1SL 2XN9A 35C8H 3MRNA 1TTUA 5DJAB 1A3LH 4EDWH 3HFMH 3RRQA 1BJ1J 4ZO7A 5EU4B 5LGKA 3B3IB 3FMGH 1F5WA 4K9EH 3SDCC 1KIQB 3U7AA 3OX8B 4BSWB 1N8ZB 1WCBB 4PJXE 3PDDA 1N6VA 3PGCA 1T7VA 5CS7A 4LDLB 5DQDH 5EZIL 3H9HA 4QY8B 1FVDA 3JSSA 4D8PA 2K9UA 2FJHB 4AQ1B 4P5TD 4HCRH 3VH8B 1H8NA 5DRZA 3U1SL 4JZOB 4OZIA 2PXYD 5BV7H 1J1OH 3F5WB 1E28B 4WHYH 3UTQB 2CH8A 2ICWJ 2DLFH 1N7MH 3OZ9H 3QUXB 5IVZA 1HN1A 3X3FH 3DV4A 1RUQH 2EIDA 3K4AA 5GGRA 2V7NA 3N06B 5CSZA 4M5ZL 4NQEA 4YHKL 1WWWX 2R8SL 2OK0L 3BGFC 1NGYB 3NFNA 4LCYB 3QEQD 4NZUL 5B39B 4KKNA 4LBEA 1G1YA 3UTSE 1KCVH 4YBLB 3S37X 2G9HB 5I74C 2WUBL 4K7FA 4Q7DA 5EOQL 2OMNA 5D71H 5SV3A 3MFGB 1CLCA 3QAZC 2VABA 5HYJD 3L6FA 4IJ3B 1JYVA 4OLVH 2G75A 4ZPTB 2XRAH 3VFWB 3LS5H 4HUXA 3WJJC 4Y5VB 2W60A 1ND0B 3LQZB 1R3IL 4LKCB 2J8UF 1IBGL 1D5XB 4EN3B 1PD6A 3LEXB 3T2QA 5E5UB 3WSQL 12E8L 2B1HH 4PPTA 1AD0B 5IB2A 5IW1B 4UB0L 4HWBL 2PF6A 4JFFA 5I1EH 4OFDA 3DNKA 5DD1L 1QBBA 3BSZH 4FS0A 3EYFB 4TNWF 4NZTH 1VFAA 1CVSC 2W9LA 1U93B 3PDOB 5FCUH 3FOMA 5C09D 1T89A 4ODUA 1LO5B 5FB8A 1MCKA 2IANE 3E6FB 1YDPA 3TZVC 1F90H 3K1KC 5DI8B 4JY4A 2FR4A 2QTEA 2FX7H 5C0CD 3VA2C 3HMXA 4OTXH 1NSNH 2X4TB 3SOBL 5ANME 1INDL 2Z4QB 3ARRA 4OV6F 3QBTB 1I9RH 3IKKA 3O2VH 3WXWH 4Y4FD 2KBGA 2MQ3A 4KU1A 1FC2D 2LFGA 1WFOA 3O3DB 1KLUA 3PL6D 4M4PA 4NGHH 4WFGD 3UZEA 4XNMA 2MPAL 1GGIL 2A73A 5BVJB 1QQDA 3RWGB 2ITCA 1H3UA 1U6AL 3W81A 1HCFX 4M6OL 3FO2A 5HGDB 3V8OA 3K1DA 1TVHA 1EAPA 4RFEA 4CVXB 3A67L 2BSSA 2FLBT 1BWMA 1UWXH 1NC2B 2ZKHL 3OKDB 1XGQB 2BX5A 4D2NA 4ODHL 4ZNEA 1R5VB 1UWXK 2XQYG 4YHPB 4RAHA 4HQQH 3MRKA 2DQCL 2EICA 1A14H 2AJVH 5I1KL 3QQNA 2EKSB 2NW2A 4O2CA 5JMRA 3ARDC 3SEPA 3SDXA 5JIIA 3VWKB 1BHGA 5EULV 3UBXI 3NZHL 3VXOA 3JBG7 4E9LA 2EDJA 1MLBB 1JZ7A 4NRZA 2QHRL 3ES6A 1A6UL 4PRPA 4WI7A 3VXSE 1YECL 4X5XA 3MRMB 1ZEAH 5C92A 5IIEA 1WIPA 2FIRT 1JHKL 3HRZA 4JQVC 4C58B 4F8QA 3T0BA 4NNXB 3V95A 5I1IH 4YHLH 2D7QA 2X4QB 3TWCH 3ET9F 2WQ8A 5JPMB 1EGJL 1IKFH 3WKMH 1KXVC 1EO7A 4UT7H 5C6TH 3BUYB 1MCPH 1P4LB 1CK0L 2E27H 5CKGA 1I4FB 3DSNA 3A6BH 1DTUA 5AYQA 1LWRA 3D85D 3PNWA 4H5SA 2A9NL 4I18B 3PWLA 4XP6H 3ZLQC 3V7AE 3WN5A 4KY1H 4NHUB 1I1FB 4XGZA 4ZQKB 3NFSH 4FZ8H 4P49A 5DO2D 5I8OL 1MFBH 1OARL 1P69B 1A1NA 3FRUA 3WBDA 3LPGA 2APVA 3OAUL 3T0EA 5FOJA 5LGHL 1NC4B 1GPOH 5CLWA 2BERA 2NNAA 3MLWH 1B0WA 2H26A 4OCYH 4PJ9A 1FRGL 3BPCB 4LHUA 4LGSB 4S1DC 5D1QD 1QD0A 3L3JB 5TE7L 4EI6A 5CEZH 3INUH 4WU5B 1IC4L 3FN0L 5D7LA 2C1PA 5A2IH 4P57B 4Z76B 4ELMA 4I0PA 4Q9RL 1BFVH 2OR9H 4LEXH 5I6XB 1EHLL 5AD0A 5BS0B 5HHXL 2AK4E 1QRNA 3UJIH 1W0VA 3MYJA 2ZNXA 1WK0A 5TFSL 1UM4L 1OVZA 1CFVL 3IYLW 3HMXH 4DGIH 3VXTB 1P2CB 5KBNC 3B9KC 4FQ1H 3KPQA 2R2EB 2O5YH 3LHPL 1YEHL 2R2HB 1XIWC 1A7QL 43CAB 3R0NA 2VXUL 1WZ1L 4FXKB 5FO8A 3Q3GB 4XNUH 2R0ZL 4PGCB 4N1HB 4PJBE 3DJ9A 4B7LA 5I76A 4MNQE 4RAUB 2YD1A 2NTSP 4HIIB 1ZS8B 2CLRB 4YEEA 4PGDB 4KDTA 4BYHA 1Q9OA 3UZQA 2QBWA 4KJQC 1NJ9A 4JHWL 1A9BA 4G8GE 1QBMH 1FO0L 5TDNB 2YPLB 3QRFM 2B0SL 4GLRI 5ITFB 2D9QB 1LK2A 4U1KA 2CMRH 2CDFB 5FIEA 1A7OL 3WFBH 2DQFA 3E3QC 3MMEB 4MS8C 2CD0A 1L9MA 4X4ME 1LDPH 2D7MA 2NY3B 1M6OB 3AS3A 3O3EA 3QWRA 5KN5B 4LSDA 2VDPH 4FFVC 2WWKO 2VDML 3ARUA 3LS4H 1R5IB 3Q5TA 4HGKC 3ZSTA 5IV2A 5LQBL 1I9JH 2BXZA 1A8JH 5E8PA 2H6PB 2CKBB 35C8L 3HG1E 3PWUA 5E2UH 1A3LL 4LQ1A 4EDWL 2E7HA 4OCRH 4WFHD 3FMGL 4K9EL 4HWEH 4G9DA 3CLFH 2VTFA 4CN4A 2F54E 2F58H 5FGRA 3VCLA 5C0BB 1G9NH 3MBEB 5C0EB 5LGJB 1QYGH 3IFLH 5C0GA 2NX5B 4PJXF 5DMYA 5GZOC 3AXLA 4MA7H 2CK2A 5CD5D 4C56A 4NRXA 2FH6A 1MHEA 3UZVB 1P6AB 4ONHB 4HCRL 4IM8A 3QNYA 3ARYA 1BF8A 4MD5B 3D18B 1J1OL 2C4XA 5BV7L 4XNZC 1H8SA 3QUYC 1S9VB 2DLFL 3OZ9L 1N7ML 3GEWB 2XZZA 3RGVA 1ZE3C 1QVOA 4PB9H 3LKSB 1WFNA 1RUQL 4AT6B 1HHIB 3QSKB 4LRIC 4NSKB 4XXDB 3HS0A 5IVNA 4UNUA 3ZSSA 4TUKL 1OGTB 3PG2A 4QCIA 1B2WH 1DEEB 3C6LC 1KCVL 3AREC 3MR9A 5E6IC 5LCVL 1KIPB 1K4DA 3WHXA 4YQXH 4XCNA 5IWLA 5FM4A 5GS0C 1NAKH 4RX4A 1IAIH 4JFQB 4GOSA 3FQTA 2YWYA 4PP2B 5D7JD 5K9QG 3U0TB 1UXWA 4OLVL 4U1SB 5ID0B 1PY9A 3LS5L 4UDUB 3A6OA 1WISA 4M3JA 4K3HA 3WL9A 3T0ED 5GGVH 5ESQB 1HHHB 5B21A 5DDHA 2DM2A 5HVWA 4RMWA 4W68A 2B1HL 1OTSD 4J3SA 3RVUC 2DWDA 1FFRA 4GMTH 5SX5K 2H3NA 4XPAH 3DVFA 1CICA 4LHUD 5EUOE 4KKAD 3BSZL 4PV8A 4HIEB 1MVUA 3O6MH 4K07A 1NMCB 4NZTL 1VEOA 3TN0B 1F02I 3D39D 5D7LD 5FCUL 2BOCA 1E4KA 1V3JA 4OZHF 5BW7A 3WNMA 3MCKB 3SDDA 1IZKA 5DQJB 3IDMB 1F90L 2JJUA 2XXCB 2DN7A 3BE1L 4QLRA 5J1SC 1LE9B 1Z3GH 4A6YA 2FX7L 1SVCP 1GGYA 4PJ5A 1LEGB 3CFEB 3DX7A 4OTXL 1NSNL 1OHQA 4OSUH 3WDIA 2YA0A 4NQXA 1NBZB 3TNMA 3QIUC 1FNAA 3CNKA 1I9RL 3O2VL 3WXWL 4JPVH 1J8HA 5E95B 3U4AA 1KJMA 4Z7WA 4U6HA 3MGOB 3DHMA 3MREA 5EU5B 1TFHA 4HWZB 4NGHL 4GAJH 4I3RH 4OCSH 3NOIA 2AJSH 2BC4A 1G7JA 3KJ4B 4X7EC 2NCMA 5I8EB 5F8RC 3V5KA 5HHMB 1GH7A 1Q9LB 4JM2A 4NDMA 4PJFA 2NR6C 4JO1H 5FA4A 4Z78A 5CSGA 1U8PA 4FABH 1T5WA 5I17A 4PRHD 4JO4L 1Q9WB 3ORJA 4HKBA 1QFHA 4L29A 4HQQL 1EEQA 2VR4A 1RJYB 1A14L 2AJVL 4GT7A 5FO7B 1HNFA 2VDLL 4BKLA 1AKJB 1EH9A 1S7XB 3FZUD 3BXNB 3QWRD 4GRLA 3DVIA 3UTTA 1Q9KA 4JY6B 1FSKC 1U91B 3SGKC 2GJ6A 3WNNA 3BD4A 1I1RA 1NFDA 2DJUA 4X6BB 1JF5A 4MJ4A 1ZEAL 3C08H 4QXTA 5HYFA 2J6EA 4D0BA 3P0VH 4RGNB 5IFAH 4MYWB 5I1IL 4YHLL 2JK5B 1KULA 3TWCL 4OQ1A 2XKNB 1XH3B 3TO2A 1IKFL 5C0RH 4M6AA 1F3JA 3WKML 4NKOA 2A83B 4UT7L 2UWEF 1MCPL 1MJ7H 5FV2A 4J3XA 1LEKB 2E27L 4YHIB 1KTDA 4NUJB 5EU3B 3D25A 3IDGA 1OSZB 4X8JA 4S0TD 3A6BL 1UB6B 1U92B 2CDEA 4DVBA 4MQXC 4JZJA 5I66A 2LTQB 4XP6L 4GMSH 4LSPL 4KY1L 3MX0A 2B4CC 5I1LA 1H5BB 2HLAB 4MQTB 4PJIE 3ARFC 4J6RH 4HH9A 3GRWL 1I7RB 3QR2A 1UJTA 1RFDH 2PN5A 3L3OB 5HY9A 3TNNA 3BUTA 4L4TA 5DFTA 3LKQA 5FCSH 4YX2H 2G5RA 2JE8A 3LAFA 4XVUC 4KH2A 4F37K 3RTQC 1EHNA 2WM0A 3VGAB 1KN2H 2O5ZL 3CU7A 1JWSB 1WVZA 1VGKB 4XWOC 3LQMA 2NZ9D 1U2HA 4OCYL 4NKIH 3HI1A 3QO0B 3OKMA 2D0HA 3CVHB 3RGHA 3X12B 5CEZL 4LKXB 2BNQB 1F2QA 3I3BA 1MUJA 5MEOB 3DUHA 3DXAE 4NC1C 5IK3A 5MERA 1ODAA 1RMFH 3HZYA 3V4VH 4RX4D 3BKYL 3E6HB 1WSST 1N26A 5I9QC 1CDJA 2MQ0A 5E8EA 5EBMA 1BFVL 1SBBA 1I8IA 4MZ2A 5EZJA 4N9GB 3DX8A 4N5ED 1W0YT 4Y16D 4Z7UB 4JREC 3UJIL 1WBXB 2HMID 3BAEH 2V5SA 1ES0B 5JW4Q 4A6YH 5KSAA 5D70H 3GSWB 3HMXL 4JVWA 1EJOH 5GGTA 2O5YL 5HD8D 3WN5C 2WINB 3IJYA 1D6EA 3QJFA 2G5BA 4MJ6A 2H2SD 1CICD 5JZ7C 4I48A 3IGAB 4XNUL 4GG8A 4ZDHA 5KTEH 4PJBF 5JOFA 5JPNB 5J3HD 4JRYB 2Y23A 3F7RA 3T3PF 3ROOB 4JR9L 4X9FA 2AKRA 4MA1C 4PJ7E 4NRYA 5DWUH 3PQYE 3C8KA 3NA9H 1NCNA 4XXCA 2CLZA 4Z8FH 1QBML 3QI9C 4AY0A 1GGCH 1Z6JT 4JQIH 4PJ9C 1CFSA 2CMRL 1ZHNB 4JEGB 3WFBL 1DJSA 1PX4A 4ZODA 4KRPC 4DN3L 3HC0A 4MX7A 5D1XB 2PW2A 2MNUA 3JUYA 3JV4B 4Z7QF 1OPGH 2VQ1B 4MDJB 3GSXA 2VDPL 4XI5D 4F37F 3LS4L 4R4BA 5TGBB 1I9JL 1BZ9A 4BK4A 2PR4L 1RZ8A 4YEFA 5E2UL 1CYGA 5D5MA 5D93C 4CGTA 3K81A 3O3BB 1FFNA 4JM2D 4JGMA 4OCRL 1HQRA 3JWDC 3O4LB 4HWEL 3CLFL 3GSUB 1FZJB 2F58L 2J6EH 1G9NL 1ZLWH 1C16B 4O58H 2Z91A 3IFLL 1BZQK 4Y8AA 4MA7L 4KDVA 3TIDA 5IOPB 1AGBA 5E8NB 1A21A 5JW5A 4QTHA 4QOKA 3TESA 4NZRH 3V5DB 3VFNB 5TDPB 1G9EA 2DQDH 2GJJA 4GRLD 4QHLB 5ALCH 3AMKA 4M1CD 4PG9A 2GJ6D 5ALBH 1S7RA 2PUQT 1DQDH 2GEEA 3SDAA 4ETQA 4ZSOA 4PB9L 4LU5H 5INCA 1SYVA 4JGUA 4LPVA 1OTTC 4JZNB 3DRTA 3VXRE 2PO6C 3BN9C 1A6VH 5AZEH 1LVEA 1LO4H 2B5IB 2VLKA 3DMMA 4BFGA 4H8WH 3KJ6H 1MI5A 4Y2DD 3HE7D 3KPRA 4FQPA 3SKUD 2FL5B 1P7QB 5IHZA 4TSBH 1FCGA 3MROA 4JE4B 1NAMA 1FZKA 1B2WL 4WUUB 5HHPA 4DK3A 4L3EB 3DVNA 4EOWH 4PY7B 1QBLL 4R7DB 4BFEA 2F19H 4V1DB 4ZFZB 3RL2A 1PQZA 1NAKL 1IGJA 1IAIL 4EI5C 1HK6A 3G6JE 2EZ0D 2P49B 3VFSA 2Q6WB 1G7QA 3KXFE 3R0MA 4LLDA 2DI9A 2YOCA 5KZCD 1QFOA 5D2LF 1B88A 2P5EE 5JHDE 1JCKA 3DX6B 3NZ8B 5EO9B 5GGVL 2VQTA 4HK0A 5C71A 1U3HD 3FO0H 1JV5B 3F12A 4WO4D 2F8OA 3WFHA 1BX2A 3VMNA 1IGMH 2VE6A 2ADIB 4GMTL 2RGSA 4LSQL 4XPAL 4Z0BH 5EUOF 5D8JH 4ZOAA 1AFVH 3B9AA 3DTXB 4LSUH 1YYLH 4UQ2B 3MRQA 4OZGB 1I8MA 4P46A 1IQWL 5D6CA 2WP3T 3TCXA 3W2DH 1NLDH 3BP7A 4K2UH 2X44D 2OMBA 5HI3C 4AM0A 3JUZA 5J6HB 1Z3GL 1QOKA 3LKRB 2PYEB 5MHSE 3L95A 3WYRA 2EDHA 2FX8H 2DTMH 1QSFD 4PJHA 4OSUL 1IARB 4AIZB 4HFWB 1VB9A 4IIQB 3QUZD 4CU6A 3IT8D 3U9PH 1K8IA 4HD9A 2R0WH 4JPVL 4HMEA 4Y4HB 4HXBH 4P3WA 3EUUA 1XGUB 2VLJE 4KKCD 4DKDC 1LP9E 2Q76B 2XG5A 1EVUA 4GAJL 3MV9A 3ZTNH 4I3RL 4OCSL 4MB5A 1FL3A 3HE6C 3OGCB 1BVLB 5C07D 2OQJA 4P59H 5DD0H 2Q20A 1J0ZA 1FJ1A 4E41A 1NUNB 1NLBH 3KG5A 1K8DB 4X7TB 1ZT1A 2XTJB 4FABL 3BDBA 4ODXB 4ZXBB 4NQCA 1V8HA 2I25N 4M7JL 4L1HA 4JDTH 1I8KB 2P24A 5EBWB 3CDGB 5ETUB 1N64H 2ATPB 2NYYC 1ZMYA 2P8MB 1X5GA 2IFFH 3LZFH 4J4PA 4LVHC 3UYRH 1GVIA 3VXUE 5I18H 4X6CE 1OAKH 1KJVA 1JYNA 2CKNA 3C08L 1L4IA 1SEBB 2MWCA 3N1FC 5DJZB 3P0VL 5IFAL 1CI5A 4ZS7H 5L0QC 4OKVA 1HWGB 4QWWC 1U42A 5HGHB 1ONQB 1WBYB 3E3QE 2AJXH 4IHOA 4WU7B 5C0RL 2X4OB 4KMLB 2RHEA 5E5MA 3O6FD 5FDWB 5BZDB 4R96B 5F70A 4MJID 1C5DB 1JZ4A 2EDFA 3VXPB 3KLAA 3IFPB 1R3KA 3OXRB 3L3HA 1NAMH 2YD5A 1N5AA 3ARPA 4GMSL 5E8DH 4TTDC 5HHOB 3ETBF 4PLJC 1IL1A 3HMWH 4NUGL 4PJIF 4J6RL 3RWIB 3KGRA 2B8OT 2Z8VC 3ARSA 2EYSA 5D7IE 3SDAD 3BZFB 4PBWD 1RFDL 5E2WH 2QJDA 1DN2A 2YUWA 3BPLC 4X9IA 4YBQC 1D5MB 3B6SB 3ILQC 2VXTH 4YX2L 1I8LA 3KNBA 2NY2B 1UJ3C 1K3IA 4JKWA 1KN2L 2APBA 2VLKD 4NQDA 2IAMA 3C6SA 1FNFA 3NPSC 4NKIL 3UCRA 1OGAA 4J3WA 1FYTD 1AXSB 2V2XB 1GYAA 1FL5B 1CFQA 1YMME 1BD2B 1G0XA 4PV9A 2YPVH 1RMFL 1T3FA 1K5NA 5ACZB 1R24B 5C0IA 1L6XA 1CFNA 1NANH 3EJYD 1H9VA 5FYJH 1NH6A 3QFJB 4XBGA 4UAOC 3BAEL 4HZLB 4A6YL 5D70L 1SJXA 3D6GA 1FG9C 3MCLH 4UU9B 2DQIH 4P5MB 1EJOL 3MA7A 4Y1AA 5CZKA 1DBJH 2XN9E 1UENA 1KTKE 2GSIA 3IXTB 4DUVA 5FGCE 4LDOB 1U58B 3SGJA 5KTEL 4ZAKB 1MWAA 2VUOA 4HIJA 3UTPE 3PE9A 2P5WB 4MZ3A 4P46D 2XTLA 1TETH 4H0GA 5KOVC 3MLXL 3B4NA 1UXSA 5E94A 2W65A 3MV7E 4PJ7F 3VWJB 3NA9L 4Z8FL 1EZVY 5FYJD 3AGVA 4R97C 1IEAA 1CDIA 3DECA 1XGPB 3UX9B 4TVPH 1GGCL 4M48L 4WI2A 1F2XK 4JQIL 4M93B 4XC1H 4DEPB 5HHQB 3C2AH 4QHMB 2GTZA 3P73A 5F7DB 4OZIE 1RJCA 1UQSA 2V2TB 3BGMB 1OPGL 4APQC 2D4FA 3MV9D 5DXWA 3FQNB 2VLRB 1S7SB 5EOCJ 4L4VD 1T1YB 4M3KB 1OF2B 4NQEE 2WLYA 2ORBH 2W9DH 3MLUH 5D4QA 4E41D 2FSEB 3QG7L 4Y4KB 2R2BB 3HPJA 4EXPX 1V3LA 5HHVH 5I75C 2EDYA 1Z9OA 3RBSA 3BW9A 1CT8A 4CVUA 3P30H 1CE1H 3FTGA 3RZCA 4KUCF 1I3RB 2Y7QA 2C7UB 1TJGH 1MQ8A 2YR3A 1OSPL 2H8PA 3L3IB 1ACYH 4NQCD 3NBNA 1CBVH 4JKMA 5DJ8B 4DFHA 3DRQA 2X4NB 2DQDL 4F7TA 4POYA 3U2SB 5E4EC 5ALCL 2J8UB 4KK8D 4NKQB 5ALBL 1TXKA 4UQ3B 1DQDL 4LFHG 5IEHB 3IF1A 4UUJB 4LU5L 2KL6A 3FO1A 4R0LA 3JWNC 3O2WH 2O61B 2PTUA 2ADGA 5CEZE 2VSDA 4HJGA 4JFFE 3CU1A 4N0UA 8CGTA 1A6VL 2HYMA 5AZEL 3FFDA 1LD9B 1QTYT 3IRPX 2A74A 2X2YA 4YXKH 4HG4J 4K94H 3V6ZB 1LO4L 3RIAF 4H8WL 3KJ6L 2ESVE 1V3KA 1PBYA 2WP3O 4TSBL 3QDGE 3H7LA 5GS1A 5K59E 3RPIA 2DQGH 4BZ2H 4S1DD 3REVB 2EDTA 4JO3H 3ABZA 4IBLT 1YQ2A 3RNKB 3G6JF 1RZ7H 1GXEA 2AV7B 4N0FB 2X9WA 3OKEA 1B0RB 3VE0A 4JHBA 1JHLH 4KI5C 5F9WC 5KSBA 2EXWD 4Z77B 4LSRH 4B41A 5HYJB 1A6ZA 3OR6A 5E9DB 3PGDA 3GMQA 1MPAH 1U8LB 1MSPA 1RZFL 3RX5A 5IUSA 2Z93A 4JANA 5CFHA 1FVCB 2Y07H 1IGML 1OGAD 1MJJB 3FQRB 2BVPB 1EFXA 4Z0BL 5GGTL 5MI0B 5D8JL 3RY6C 1BJMA 1YPZA 2BVOB 3B9KD 2V17H 3W5MA 3UP1A 4LSUL 1YYLL 1LE5A 4LLMA 3IETA 2OJZH 1XIWD 2D4DA 1NDMB 3MGTB 1MWAH 4FFZH 1YN6A 3W2DL 1NLDL 4K2UL 5SV4A 4PS4H 4BFIB 2FGWH 1QSEA 2R23A 2ZSWB 4YR6A 1M7IA 4N68A 1KLGB 3KYOB 4KJQD 3VMPA 4OAWA 3DMMC 1QSZA 5FFLA 2FX8L 4OF0A 1ZGLB 1PJ9A 4DCQB 1RZJC 3SDXE 4JN2B 5HI4C 4YC2B 2I60H 4XT1C 3OJVC 1QNZL 1JWMA 3U9PL 5D72L 2R0WL 4Y1AD 1EIBA 3LRSA 4ORGB 1HHKA 3MLTA 2X9YA 3ALWA 4HXBL 2QADC 1HXMB 4N1CA 1JGEB 4PRPE 1LP9F 3DARA 4CRPA 3ZTNL 1EXUA 1OP5K 4NC1E 5TE4L 4UT9H 1D7FA 2YEZA 5DD0L 5I1HH 4H1LA 4NNPH 3WUWB 3I6GA 5KG9A 4HFUH 1UKTA 5H94A 1FZMB 5E1AB 4WTXA 5IB5B 5DEGA 3VDCA 1NLBL 1OQOA 2VC2H 2JCCA 4J1UA 1L0YA 1SQ2N 1OAXH 4NFCA 1D5ZA 2ZUVA 4NQCB 1HEZA 3NFPB 3GSRA 3KPNA 4JDVA 4QGYA 5GZOD 4JDTL 2VLME 5DC4B 1KN4H 5I15H 3H0TB 4H1LG 3S34L 4FFWC 2Z35A 4D9RE 3KYMA 1Q0XH 1N64L 1KBGH 3FFCA 4Y88A 3ELAT 3CFKA 1V5JA 2IFFL 3LZFL 3UYRL 5I18L 2WNGA 1OAKL 4X6CF 2EE2A 1L9NA 2UVEA 3GJEB 4X4ZA 4JFEB 3X3GH 2YN5A 3LN4B 4WJ5A 4YGAB 5DHVB 4DZBA 4ZS7L 3I2CL 3NPZB 2DMCA 2AEPH 3QUYD 3SCMA 4LFHD 3RZCD 4I77H 3FB5A 5AUMA 3NACL 1DBMH 1INEH 4ELME 4FQXA 3ARBA 3CMOH 1IGYB 5EC2B 5DRWB 5KSUB 3RVVC 1QRNE 1NGPH 1VSCA 3BIKA 3W9EB 3HMWL 5IHBA 1IC1A 3ULUH 3GBNL 3D85B 3PHQA 3EO9H 5J12C 3AB0C 5GS0D 5D7IF 1DQLH 1Q94A 3PABB 5JW4M 3KPSA 3P9LB 1CE6B 5E2WL 5F7KC 4K8RH 4JFHD 3M1BB 2DMBA 3UBXA 2C1OB 3VRLF 1JN6B 3MV7D 1L7TH 3QO1B 3V6OC 1HH9A 1MFCH 5ECJE 3VRJA 1PEWA 3RU8H 2GTWA 4J8RB 3KPPA 4OI8A 2AP2A 4NC0B 1CTNA 4JFXA 2NY4B 4AH2A 1RUKH 5I1AB 3MRPB 1ZHBB 1I7ZA 4EDXB 5FUZL 2YPVL 4WW2A 4M8VA 1A1MA 3ULUD 1A7PH 5INDA 5D1QB 3TA3C 1M4KA 1HILB 3UBXG 5IMKA 5T1MB 4DKEH 3QZWB 4MAUH 5J6GB 2IQ9H 2NTFB 4M00A 3T4AA 2GFBB 1KJ3H 5FYJL 1HKLH 1SYSB 3QXUA 4YFLI 1MHCA 3P9MA 5JDSA 5IMOB 1ZVSB 4X9BA 2BSTB 4PJGF 2OI9C 4NHCH 1N5YL 2W91A 4OD2B 1RK0A 3MCLL 3HAEA 2DQIL 2X41A 4K7PL 2ICWI 4Y5YA 3ULVC 5HVHB 1DBJL 1AP2A 2DIJA 1S9XB 2ARJQ 4PJCE 1FDLH 1EFXD 5C8JA 5CIPA 4MXQC 5I8KH 3P3YA 1SJEB 3LKPB 2MQCA 1NGZB 5DJ0B 3D3VE 1TETL 4JRXD 1TZIA 4NYLB 1RK1B 3WFCH 2WBJC 4H1LH 1E6JH 5TF1L 4C56E 1Y0LA 2BP3A 3PWNA 3HAEG 4QHNA 2YRZA 1I9EA 4TVPL 3BH9A 2NR6D 1AHWB 4XC1L 4IDLA 2GITA 1MAKA 3C2AL 3MO1B 4RGMB 4R2GB 4LPCA 4YIQB 3OL2A 1IAKB 1SBSH 3IS0X 3PGFH 1CLOL 5TQ0H 3CCHA 5DFVD 3AS2A 2ESVD 1U8JB 2EIZA 4QHUA 4I5BB 4XP4H 1JYWA 1X7QB 3K8LA 3N85H 1J0HA 4YPGA 2ORBL 2W9DL 2FEEI 1NCUA 1MCCA 1LNUB 1F11A 4UV7H 1I3GL 5C08E 3SO3C 2C3VA 5HHVL 3HCVB 4HBCH 3F7VB 5FKAA 3EZ8A 1X5LA 1FFPA 3UTSB 3CDFA 4MAYA 3P30L 4G9FA 1UZ8A 4U2ZA 3O9WB 4G42A 1TJGL 2VISB 1KPRA 3GSNB 1CBVL 1ACYL 4OT1H 4ZFGH 2W0LA 2YWZA 2BRRH 3IDIB 1T22B 1ZLUH 1OQXA 4RZCB 3EOYG 5CZXC 5T33H 3NH7H 1ZT4B 1ZLUK 1FV1B 3FFCD 1OAYH 4MQXD 4PUBH 4RFNB 3FQXB 3ECBA 5IQ9A 1U8KB 1P1ZB 5T1DL 2ADFH 5I1GH 2EE9A 1TENA 3ARFD 1XGRA 3O2WL 3B8SA 4XVSH 2PYFA 1MCOH 2HKFH 3SCMD 4YXKL 4K94L 3B5GA 1J1PH 3EYVB 4JLRA 4HAGA 3EYUH 1BVKB 4OZHB 3RTQD 4ZNCD 3ZKNC 2IANB 2WV3A 4O5LH 4IOFC 4F2MB 5K59F 4XWOD 2EEAA 4BZ2L 1N2RA 1UVQA 4FOMA 5J13B 1ZSDB 2R4RH 4PJ5E 5ANMB 1EEYA 2EEBA 4XH2A 2UYLA 3VJ6A 1N3NA 2YPKB 1T4KB 4HGMA 3G5VB 3TYFB 5FF6A 3LMJH 1JHLL 3KPSD 1J8HE 5F1NA 3PHOB 4Z7WE 4LSRL 5D7JB 4QXGH 1RZIB 1MPAL 4KRNA 2P42B 4MXWL 5DK3A 5IJKA 3TC9A 1X5JA 4E0RB 5IKCA 1TZHA 5GRVK 3BZEB 3HAEH 4NBYB 1WIUA 1NUDA 4NWTH 1ERNA 1I1AA 5EU4A 4PJFE 4KQ4H 1KCRH 1NCWH 2V17L 3B3IA 5JQ6L 3O6KH 2OP4H 3GIVB 1KIQA 1KFAH 2FECI 2OJZL 3OX8A 5CIPH 3S9DB 2VR5A 4BSWA 3KPOB 4FFZL 1MWAL 1WCBA 1GGTA 4WFED 4I2XB 5GJSL 4HPOH 3VFTB 4PS4L 4X5LA 1A1OB 3D39B 2VMFA 5DMJB 1N0XL 4QY8A 2V9RA 4TULH 2HG5B 3L1OH 5DMKB 4NP4L 1D3CA 4R8WH 5HYEA 1OAQH 1IKNA 3QI9D 2FJHA 1PG7W 3EOAB 2I60L 4JFDD 3VH8A 3UTTE 4LSVH 3BIBX 1YNKH 4JZOA 5DUMH 3MC0A 4S2SB 3F5WA 1E28A 3UTQA 3QUXA 4KRPD 4QXWA 2WZPD 4GH7B 1JF6A 3RHWF 2ZPKH 2V5YA 3V0AC 4UT9L 3BP5B 2NY1C 3V5HB 3DV6A 5I1HL 5HDOA 4M03A 4DUWA 1A6AB 2JJTA 2QEJA 4NNPL 2J88H 1LMKA 2UWEB 1U36A 5CZVH 4NN6C 3HLAB 2Q86A 2BK8A 5D2NB 1NGYA 3VH8G 4LCYA 1BVZA 1S9WB 2VC2L 3HA0A 5B39A 3QIBC 4F33B 2IH3B 2ZZUT 4AG4H 4HZAA 5IMLA 1OAXL 5CD3B 4Q0XH 3DHJA 5L8LB 3O81A 2EDDA 4PRIE 4G8FB 3KR3H 1FC1A 1KN4L 2Q7YB 2X1QA 4WGWB 4ZPTA 3VFWA 4ETYA 2EXYD 1G7LB 1Q0XL 4Y5VA 5C0JB 4KDWA 1CD0A 2GCYB 1KBGL 2VITA 1ND0A 3I6KB 3LQZA 4GLRH 1A5FH 1J18A 2HVJB 4L4TE 4LKCA 5MEND 2VDOH 3I50H 4NC2B 3MLPA 1D5XA 4EN3A 5B39G 3LEXA 1AD0A 1GRWA 3X3GL 5K9KB 5IFJB 5IW1A 5GRZA 1ITBB 4UT6L 3VFPA 5LJYH 4BM7A 2AEPL 1QLRB 3EYFA 3QQ4A 4J3TA 4IRSB 1OTTD 4MAYD 4RMVA 4G9FD 3HR6A 3L5IA 2PO6D 3BN9D 1U93A 2Z8RA 3PDOA 4I77L 2WMPA 4KKBC 1S7TB 3AM8C 3VXQB 3BFOA 4G6FD 3EGSB 1DBML 1IC7L 1INEL 1LO5A 3E6FA 2EH7H 2QQQA 4XWGH 3CMOL 4F15C 5FYJU 2AK4B 3EJJX 5DI8A 3WIFB 3C60B 4N8CL 1LO0H 1NGPL 2Q87A 4Q9QH 1AJ7H 4FZEH 2X4TA 2A9MH 3FT4B 3S97C 2Z4QA 3ARGC 3TBTB 3EO9L 5LXGH 2YSSB 1XF1A 1DQLL 1JL8A 4XPTH 2HT2C 3RUGE 4K8RL 2APXA 3L3GB 1O7SA 3GSVB 1NFIB 4JJ5B 1L7TL 2VXQH 4PJBB 2E9WA 1YEDB 3R06B 4U1NB 1MFCL 3VD5A 2A77L 3VW3L 3RU8L 2ZUQB 5BVJA 3VFOA 3RWGA 1T66C 4HGWB 1RUKL 2EIEA 3Q6GH 5GIRB 5HGDA 2XA8H 3VA6A 1A7PL 4RISH 1NC2A 3OKDA 4LAJH 4KVCH 4WY7H 4IMKC 3QQ3B 1O5DT 1NUFA 5HYSA 5I71C 1R5VA 4DKEL 4YHPA 4KJYB 4HUKB 4MAUL 2IQ9L 4KK6C 4YJZL 1OP9A 4LPWA 4X0KB 3SKOB 1KJ3L 2AXFB 1R0AH 2EKSA 5IM7B 5HI3D 2LU7A 3VWKA 1FZOB 4NHCL 4CVZB 4FQXC 3ARBC 5JOPE 4Y16B 3G9AB 3G6DH 5AEAA 3HG1B 2N7AA 1FDLL 4PJCF 4YAQB 2GSGB 3MRMA 1CG9B 5DMGC 4JRWA 4NJAH 5I8KL 2F54B 3KPLB 5HYSG 4NNXA 1UM5H 2VOTA 3EW3B 2X4QA 3CSGA 3WMSA 1ZA6A 3GFUA 3WEXB 4MB4A 5BRZE 5JPMA 3WFCL 5F9OH 4CMHC 1E6JL 2IADB 2XY1A 1ZK9A 3BUYA 4F7EB 1KSRA 1JF1B 3ULSB 5IBUB 2IMMA 3J7HA 4QOKE 3QFDB 3Q0HA 1I4FA 1JGLH 4LMQI 2GHWB 3BVNB 4NHUA 2A38A 1T2JA 1I1FA 1JRHI 1G7PB 1P5VA 5A40E 4ZQKA 1IGIH 1SBSL 3U7WH 2JJSA 3PGFL 1EEUA 3TBSB 1V3MA 2CUIA 3UYOD 4HS6B 2E6QA 2AEIT 1UM6H 2VRAA 1KLFA 3BJLA 3Q1SH 5FV1L 3SDYH 1KEML 4MA8H 2XY2A 5E56A 4XP4L 3N85L 4KQ3H 1QLEH 2NYYD 2WUCL 5D7KE 1HNGA 1KJ2B 3QH3B 3UO1H 4UV7L 1MI5E 3KPRE 3BPCA 3D5OF 4HBCL 1GL4B 2VIRB 3L3JA 4NKDA 1JUFB 2WW8A 4U1JB 2AJUH 5JNYB 1I3UA 3CUPB 2BHYA 4QWWD 1TMCB 4GBXB 3ZMRA 4OT1L 4P57A 4ZFGL 2BRRL 5DLMH 3G04B 5BS0A 5T33L 4X7SH 3NH7L 1A2YB 4LPYA 4BELD 3UJTH 5D2LB 1CDYA 1LQSR 5ITBH 3DGGB 4PUBL 4P9HH 4C83A 2AK1H 3PF2A 4HH8A 5JW4N 1AR2A 2ADFL 3TT1L 1P2CA 5I1GL 4IOIB 4PLKC 2R2EA 4AL8H 2YA1A 5EUOB 4XVSL 1MCOL 2D7NA 2HKFL 1IEBB 2R2HA 43CAA 4Q9BA 4FXKA 3Q3GA 3L5JA 4MHHG 4YBQD 4PGCA 1J1PL 3BH8B 4RAUA 2ID5A 3ILQD 4HIIA 3EYUL 4X7CC 1ZS8A 2R1WB 4PGDA 3FONB 3MV8D 4P2RE 1TJHL 4JKPH 1NBVH 3OMZA 4O5LL 2RQ8A 1KELH 1BIIB 4HK3J 3CFDB 1G0YR 1QR4A 2YPLA 3HE7B 1BAFH 4Y2DB 2UUDH 3QQ9C 3P4MB 4OI9A 1DCLA 5ITFA 2R4RL 1TQBB 3GHEH 4PJHE 4PJ8A 2CDFA 2BY0A 4MNGA 4R26L 4GQ9H 2GKIA 3MMEA 4PRNB 4YO0B 2BNUB 4GXUN 4LVOB 1MJUH 3LMJL 5K93A 5HPMB 2AABH 1M6OA 1KOAA 2FYYB 5GHWH 2WBWB 3TBYB 4K71B 1WBZB 3HB3C 4Z7WF 4QXGL 5KN5A 1CXFA 3JV6B 3JVGC 3VI4E 4WHCA 3QPQD 3TV3L 1R5IA 4C54A 4GKNB 2QQKH 4XX1E 2WANA 2H6PA 3WFDL 2H9GB 1WF5A 4JHAH 5I1DB 2CKBA 5K9OB 3G5YB 4NWTL 3KS0H 4KQ4L 1NCWL 3O6KL 2OP4L 4TVPE 4WO4B 4WHDA 3OKNB 3EDFA 2X5PA 5C0BA 3MBEA 5C0EA 1WC7B 5LGJA 4JPIA 3RBGA 2NX5A 3CH8A 2F53D 1U3YA 5IVOA 5L8JB 1AXTL 2DJSA 4FA8A 4X5WA 5EC1B 1A47A 4TULL 2M2DA 3L1OL 5E7BA 4R8WL 3V6OE 1ORQB 2ZJSH 1OAQL 3F7YA 4UMGA 3VWKD 2IG2H 2ZWLT 2IJ0C 4L5FH 4LSVL 5A2FA 5DUML 3ZT7A 2OSLB 4U1MB 1I7TB 4MD5A 5SWZD 3D18A 1J9CT 2JELH 1S9VA 4KK5C 4HEPG 3QUZB 1HI6B 3RX7A 3LKSA 4HKJB 2ZPKL 1BQSA 1DVFC 1HHIA 5F88B 4NSKA 4APQD 1NMAH 2J88L 3LB6D 4XXDA 4N0RA 4NZJA 4OGYH 2BVUA 4EBQH 5CZVL 1F42A 5C07B 2CIKB 1KPVB 3MYZA 3TBWB 1IAII 1OGTA 3OAZK 3BP4B 1AQKH 3EJZD 5CHNA 4ALAH 4QXUH 4BZYA 5F7FA 4AG4L 4Q0XL 1DEEA 1RUAH 1KIPA 3B5TA 3EDEA 3GKZA 4UINH 1I1AC 1L0QA 4PJIB 3FN9A 5FUOH 3KR3L 4PP2A 2IC2A 3MJ8B 1S7UB 3LN9A 3SDCB 3U0TA 5GZNC 2Y72A 4U1SA 1G7HB 1VFBB 2VZUA 4JG1H 4UDUA 1CD1B 4M9OA 3QHTC 1A5FL 2VDOL 3I50L 5ESQA 1HHHA 3L7EB 1NC4D 2CK0H 4HDIB 3BKJH 5L2KD 1AI1H 2APFA 4NQDE 4ORZC 5BVPH 3H3KA 4HIEA 1CDHA 3TN0A 3HZVB 5CSBA 1VFOA 3RKDD 1CDUA 4P2OC 4KJWC 2EH7L 5DQJA 3IDMA 2JJTC 4Q6IC 2G2RB 5BS0D 2IF7A 4OZ4A 1LE9A 1F4XL 3PV7A 4MJIB 4XBPB 5EB9A 4KROC 4Q9QL 4Y89A 1LEGA 3CFEA 4FZEL 4OCNC 2A9ML 4KXZH 1NBZA 5DVOA 3BGFB 3GMMB 5LXGL 1V7MH 4WEMB 2XPGB 3SKNB 4G8EB 4XPTL 5D6DC 3RUGF 2X4PB 2ZCHH 4DOHE 3MGOA 5EU5A 5I74B 4HWZA 2Z0BA 3O4OC 1HSAB 4KI5D 2Y25A 2VXQL 3H9SA 4LCCC 4PBXA 3QAZB 1QLFB 3X11B 5I8EA 4P23C 3WXVH 4LGPB 4PJ7B 3PQYB 1Q9LA 2Q8AL 1TVBB 2CKBH 3QYCA 4YE4H 5CJXC 2XA8L 4TOYH 2AV1A 1MFDH 3REWB 3MGAA 1FFOB 4RISL 4XC3H 3RJDA 1FYTB 1Q9WA 4FXLA 1JGVH 4KVCL 1KPUB 5DGQA 1RJYA 3PDGA 2NY3D 4I4WB 1MVFA 2VDKH 5FO7A 1R0AL 1DR9A 4FG6C 1AKJA 4RAVB 1S7XA 3BXNA 5F1KC 3L3DB 4JY6A 4I0CC 3G6DL 4LIQH 2FD6H 4RDQF 5KVEL 2OL3B 4I8DA 3TZVB 4FQHB 4P2CG 5JQHC 4X6BA 5K9QI 3EO1B 3TO4C 3D2UB 4NJAL 5ESVB 1TPXC 1UM5L 3MBED 4JQXA 2OTWB 2QQNL 2XKNA 2NX5D 5ABDE 4CU7A 4KI5F 2A83A 3S6CA 5IR1B 5CJ8A 1RVFH 1LEKA 5T1KD 1ZTXH 4NUJA 5EU3A 1OSZA 1UB6A 1U92A 1Z0MA 2MCG1 4O2EB 5T3ZH 1H5BA 2HLAA 5JXEC 2AW2A 1EZVX 1IGIL 3ZHLA 3U7WL 1GCFA 3AY4A 1BZ7A 3VXRB 1UM6L 1I7RA 2GQHA 4GAGL 1BFTA 3L3OA 3Q1SL 4AJ0A 3SDYL 1CVRA 5IBLD 4MA8L 4FFWD 4N0UE 2C4FU 1X4XA 1OP3H 5J11C 2H32B 2ZG3A 1QLEL 2DKMA 4U1GC 5IT2H 3IFOB 1JWSA 3VFMA 1VGKA 1HHJB 2IMNA 2X7LB 2Y06H 3ARDB 4L4VB 4PP1D 3KVQA 3NIGE 3X12A 1O7VA 2AJUL 2ZCKH 5T3ZD 4HS8H 3PJSB 4K3GA 4LCWE 3NAAH 5MEOA 3IXAA 4YWGH 3G6JB 3E6HA 1GZQB 3JXAA 4LPUA 5DLML 3AAZB 2AVGA 1KCUH 3GI8H 5L2JB 4FNLH 4N9GA 3KXFB 5EU6E 4X7SL 5GISH 3GJFK 3UJTL 1WBXA 2XWTB 1AO7D 2DQHH 2P5EB 5ITBL 1H8OA 1VPOH 1WAAA 3E2HC 1YYMH 5JHDB 4P9HL 3U46B 1ES0A 2IALA 3GSWA 5IFHL 5SWSE 3HUJE 2JKXA 1KEGH 3KPMA 5FYKH 1RUMH 3LY6A 1XZ0B 2DTSA 1QHPA 2Y36H 4AL8L 5ADOH 2WINA 2E9BA 2HVKB 3PWPE 4CNIB 4RSVA 3IGAA 3MRGB 1NGXA 1YPZE 3CFBA 1N59B 2HLFC 4L9LC 3TN0D 5JPNA 4D94A 1A4JB 4LF3A 4JRYA 3MLRH 3S96B 2DYPD 4JKPL 1NBVL 5CMAB 1MY5A 1UCBL 1KELL 4OF8A 4X8XA 5ESAB 1XEDA 1QSEE 1WTLA 2CUHA 1X4YA 1PYWA 1BAFL 2MSPA 4MD0B 3T2PA 1PX3A 1BLNB 5BJTB 5JW4R 3GHEL 1BJ8A 5GSRB 3TT3H 1ZHNA 4PJHF 4GQ9L 2HFFB 2P8LB 4LVNC 3TA3D 1VDGA 5I8CB 4U49A 5GHWL 5SX4H 2IBZY 3O8XC 1LP9B 5D1XA 1T80A 3JV4A 4XCEB 4KHXH 3WDHA 2VQ1A 4MDJA 2RIKA 5TGBA 2QQKL 4WI6A 5IROA 1A6WH 4JHAL 5B8CC 2OR7A 3BD3A 3O3BA 4LSTH 3ULVD 4OGAC 2B39A 3O4LA 1CL7I 4ISVB 4WTWA 3GSUA 2Y5TB 1I7UB 2JCCE 3GMRB 4OFVA 1C16A 1EBPA 2ED9A 4NM4H 3B9KB 5EBLB 2FJFB 1YEIL 5GRJH 3CZJA 5IOPA 5DEFB 5E8NA 1XIWB 2BY1A 3V5DA 2ED7A 5TDPA 3MTRA 2ZJSL 3B9EA 1NCDH 2IG2L 5HI5C 1T1XB 4L5FL 2K1MA 4QHLA 3VXMD 3T09A 5KJRH 1KG0A 1T0NB 3FQWB 3KDMB 3VXUB 3MNVB 3SQOH 4X80H 1QKZL 3QG6B 3L5WB 3OAYK 2JELL 3MRIB 5FGBA 4NO5B 4PJ8C 2R56H 3AUVA 3PWJB 1KCKA 3EKCA 4JZNA 4R3SB 4GKZB 3O3UN 4LLUB 2QHLA 1NMAL 5GPRA 6FABH 2RCSH 4OGYL 2X4RB 5IF0B 5AG9A 4EBQL 3FL7A 4N8VB 2DIBA 2FL5A 3O2DA 1P7QA 3S4SB 1AQKL 4ALAL 4QXUL 3TPUB 3RNQB 4WUUA 1RUAL 3CVHH 1YEFL 4L3EA 4UINL 4PY7A 4R7DA 3ULVF 4P9ML 4V1DA 3MODH 3G5XB 4UIKH 5EZLA 5FUOL 1QFWH 3CSPA 5D7IB 3NCFB 3RVTD 5F6IC 2Q6WA 3T1FB 1T83A 4JG1L 2DKSA 5CZXD 3VD7A 3DX6A 3NZ8A 4O02L 1ZA3B 4ENEC 5CP3A 2CK0L 4XB7A 1MCFA 1JV5A 2W0KA 1KGCD 1CGYA 2CGRH 5T5NF 2ADIA 3CFJA 4YHZH 5BVPL 1ROWA 4HJJH 3BQUA 3DTXA 2BNQD 4UQ2A 1TNNA 2Q1EA 2CXGA 4OZGA 4XNZB 3QNXA 1MRFH 3QUYB 4M4RA 2NW3B 4U4BA 2R69L 4LSSH 3GM8A 4U7KA 4NNYB 1QFPA 5ILTH 4LNRB 3ZKND 3IAGC 3LRGA 5J6HA 3LKRA 3GKWL 3ZKQD 4PJGB 4QRTB 3FO9B 5F7HA 3HC4H 4AIZA 4HFWA 4N90E 3LKNB 1V7ML 4K3EH 4Y4HA 1PG7L 3AREB 3C6LB 5E6IB 4L8SC 1DLFL 1XGUA 2FNBA 4KVNH 4OB5H 3M45A 2QV2A 2Q76A 4GKSB 3VFGH 3KPTA 3UDWA 3RY4A 3R4DA 3KHOA 3OGCA 5C9JB 5IB4B 1BVLA 4NPYB 4PLOB 4JRYD 4HEME 5GRUH 1AR1D 3MV7B 2K7PA 5EA0H 2CKBL 4ZUSB 4YE4L 3NCBB 4TOYL 1MFDL 1UWEH 3LVEA 1MCJA 3ZTJH 4X4XB 2MJWA 4ODXA 1JIBA 1I3VA 4XC3L 1JGVL 5FYLH 4P4KA 3DX9B 3WO4C 4ZXBA 4YFEA 4K55A 1ZT7B 4WWKA 1I8KA 5EBWA 5BZWB 2VDKL 1ZKAA 1VEPA 1RZKC 1R5WA 3WIHA 3CDGA 3BHBB 5ETUA 2W59A 2ATPA 4LIQL 2V2WB 2FD6L 3V4PH 2V7NB 1V7NH 3J8F7 5J1AB 3KAAA 3HNSH 5I30H 4AMKL 1D5IH 4NT6B 5HBBA 4KMTH 1SEBA 5DJYB 1W72B 4CUCA 5DJZA 3KYKL 4U7MA 1MH5B 3D9AH 1ZHLB 1BWWA 3QIUB 2IPUG 5HGHA 1WBYA 4WU7A 5EU6D 2X4OA 3QDHA 1IQDB 4OBRA 5BZDA 4R96A 5FDWA 3QIWC 1AGDB 1ZTXL 1C5DA 5DJXB 3VXPA 1MJ8H 4IDJH 3IFPA 3O2DH 5E1HB 3OXRA 2RFXB 1S7WA 3RWJB 1G6VK 3QIBD 1EAJA 4HJ0C 4DKAA 5HHOA 1RJZB 1QEWB 2J2ZA 3PWPD 1UA6H 3RWIA 5T3XD 1ED3B 4FFYH 1VFUA 4IOSD 5C3TA 4RCAA 3BZFA 3LH2H 2O26U 1D5MA 3B6SA 4ZYKB 2QLVB 3OKKA 3GO1H 3VDBA 4TTGA 5IT2L 1MCBA 3MRHB 2E7LA 2ESVB 5CP3H 1F8TH 2Y06L 3QDGB 2XYCA 4PJAE 1MQKH 2OBGA 4V2CB 1AXSA 2V2XA 1FSKB 1U8HB 3K2MC 1FL5A 2ZCKL 1NANI 4FTVA 3DETC 2FR4B 4HS8L 1J10A 3U9UB 2HA1A 4O4YH 4V1DD 4YWGL 3RWEB 3EYQC 5ACZA 2CIIB 1R24A 1AY1H 1KCUL 3GI8L 4H25B 1X5KA 1ZV5A 4FNLL 4K3DH 6CGTA 4N0CD 5GISL 2BY2A 2Q7NA 1JP5A 4NO2B 2WBKA 3BPNC 4RMRA 2DQHL 3JWOC 3QFJA 3QHFL 1YYML 5I19L 4HZLA 1KC5H 3WFEH 5J4MA 4XNMB 5JO5B 3SE9H 4UU9A 3T0VA 1KEGL 3HUJF 5FYKL 5E00B 4OGXH 4LASH 2Y36L 3TVMA 5ADOL 3ARGD 4ZUVB 3T0AA 3GGWA 3IXTA 3G08B 1JPFA 4PJDE 4YHNB 1GAFH 1U58A 3MLYH 4ZAKA 1EAPB 3ARFB 2P5WA 4GRWF 3MLRL 4NWUH 2VLLB 3K74B 3OR7B 3GM0A 1FORH 3LOWA 5CCKH 4QRPE 1VESA 3VWJA 3U0PA 4OIIL 5AYUH 1T66D 5H8DA 1HH6B 2VQUA 3RTQB 3VFRB 1CGTA 4NQSB 1XGPA 3D87B 5D1ZC 2PYED 1FLTX 2NY5H 2NW2B 5B38A 5HHQA 5K9JL 3WLBB 1BFSA 5HDBF 3TT3L 5L6YH 4QHMA 4OFYD 3M17B 2XNAB 1H0DB 3HNTH 3WNOA 2V2TA 3BMVA 3BGMA 4KK6D 4KHXL 2HKHH 3DIFB 3MRLA 1EK3A 5F7NC 1BFOB 3FQNA 2VLRA 5HTSA 4A2LA 1RV6X 1S7SA 5I9QB 3P4OA 4OBSA 3WIHH 3OF6A 3TH3T 4RWYH 1T1YA 2P47B 1A6WL 4D0CB 1YJDH 5F6HJ 1OF2A 3SBWA 5B38G 4JREB 2BRQA 4LAQH 4Q2ZB 2FSEA 1MAMH 3VRIB 2GI7A 4Y4KA 2R2BA 4YXLH 4S10A 1GHFL 3SKJH 2XTJD 4Y5XC 5IB1A 3C5SB 3MJGX 1J86A 4E42A 1T6WA 4GG6F 4NM4L 2DQJH 5GRJL 3WN5B 3L3IA 4H26B 2DJ4A 3NA4A 4QF1B 5DJ8A 1CQYA 3JWOL 1C1EH 2X4NA 5KW9L 1NCDL 2E5EA 5FHBH 3FT3B 3HRPA 4K23H 4R4NC 5KJRL 4MA1B 2R29H 5DD6B 3SQOL 3QI9B 2XV6B 4P5TA 4KJPD 5IEHA 4JFDB 4QTIH 3MOAH 4JKLA 4UUJA 3QPXH 2ADJA 4XAKD 2R56L 4PJ9B 2O61A 3QDMD 2PXYA 3EIFA 2BFVL 1EPFA 2X10A 2GIYA 4EI6B 1LD9A 2DS4A 6FABL 2VO5A 4KRPB 2RCSL 3V6ZA 4RGOH 2W1NA 1WWCA 3ZHDA 2XG4A 4S1RH 32C2B 2XFXB 2VAJA 3OXSB 4UIKL 5HHOD 5D93B 3QEQA 2EDXA 1NGWA 5DF0A 1KF9B 2AV7A 1QFWL 4RMUA 1B0RA 4LRNH 3U30C 3G6AB 5HDLA 3ARZA 5DEZA 2QKIB 4Z77A 5FUCC 1NUGA 5HYJA 1TTFA 5E9DA 3BWAB 3FHQA 2NY2D 1U8LA 1RURH 2R9HC 3CC5B 4L8DB 1GC1C 3RWDB 1FVCA 2FJGB 2CGRL 5MENB 3FQRA 3TLRA 2BVPA 4YHZL 3HI6H 4G6ML 3ZYIA 2P43B 2BVOA 4HJJL 1INQB 1BD2D 1CD9B 1MRFL 2HTLC 3WV0A 3QNZB 1LK2B 1NDMA 3MGTA 5DMIL 4YBHA 4BFIA 5HJ3B 1X6LA 2ZSWA 2PO6B 4K3JH 5ILTL 1KLGA 3KYOA 3QWQB 5C09A 4FP8H 4G6FB 4OI7A 2UVFA 3HC4L 1ZGLA 5JTWA 4DCQA 5E99H 4JN2A 3QQ9D 2WK2A 5CP7A 2E6PA 1PLGL 4ORGA 1BREA 4PJCB 5IEKB 1HXMA 3RPKA 1JGEA 4KVNL 4OB5L 3VFGL 5ID1B 2DL2A 4EI5B 3HB3D 2F5AL 7FABH 5GGQL 3D3VB 2A6JB 1J0YA 1N4XH 5GRUL 3WUWA 4CL7A 5IVXA 5BOPA 1XF5B 3RX8A 1FZMA 5E1AA 4KHTH 5IB5A 2DMKA 5EA0L 5LVEA 2COQA 3LRHA 1UWEL 1AGCB 3WE6A 1T7XA 3QUMB 2VSCA 5F21B 2RBLA 5FYLL 2I26N 1H3TA 1JNNH 2BMKB 3NFPA 3JTSB 1UKQA 3BQUC 4JN1H 3JTTB 3U7YH 1MNUL 2N1KA 3H0TA 3S98A 3WUWG 3VGEA 2YA2A 1ZVHA 3V4PL 4JKKA 1JVKA 3V8CA 2OCFD 3HNSL 4QYOA 5I30L 1IRAY 4UTBH 1KCSH 1D5IL 3HS0B 1PKQB 3GJEA 4KMTL 4JFEA 3LN4A 5C08B 5DHVA 4JFPA 1RHHA 4C59B 3D9AL 1F97A 4KK5D 4O2FB 3GZKA 4P2YA 3OKOB 4J3UA 3MR9B 1YN7B 3MQIA 4JFZH 1S5IH 3OHXA 3A6CH 1DVFD 4AQOA 1MIEH 1EVTC 4MSWB 4TNWK 1WZKA 4B5EA 2DWEA 4DJMA 1GZPB 4MNHB 4IDJL 3RFZC 3HE6B 1FGNH 3SJVD 1IGYA 2Z31C 5EC2A 3O2DL 5C1MB 5DRWA 3L5XH 5KSUA 4WFFE 2HT4C 2FGZA 4M7LH 4AEHH 5CJQH 3NVQA 4LDEB 3W9EA 3WL9B 4XNXH 5FYKU 5DDHB 5GGRY 3ZE2E 3P4NB 2ZUTA 3D85A 1Z5LB 2EC9T 4FFYL 3ZKSD 1IAIM 1EERB 4I0KA 3B43A 3PABA 4P4KC 3C09C 3P9LA 1CE6A 4WWKC 4PRDA 3M1BA 2C1OA 3GO1L 1JN6A 2D7OA 2IQAB 1JI2A 4LPTA 2EDQA 4I9WD 1U8NB 3LQAH 2WWKT 4J8RA 1F8TL 4IMLB 5IMMB 4YLQT 4NBZB 4PJAF 1MQKL 5I1AA 3W11D 3MRPA 4LVHB 1DBKH 1YEKH 3RDTC 2YPLE 1JZ3A 4O4YL 2FEDC 5D1QA 4UILH 3DX7B 4NFDA 4KK9D 4MLIA 5L0QB 1AY1L 4MNGE 4RMSA 5T1MA 4K3DL 3QZWA 5J6GA 2NTFA 1Z9MA 4HUVB 4Z7WB 1F6LL 2GFBA 4KJWD 1SYSA 1J1XH 5IMOA 4YHML 3QXDB 3PP3K 2KQNA 1ZVSA 5HDQH 1DDHB 1XT5A 2BSTA 3NCCB 5E9DD 1KC5L 4XPBL 3WFEL 4OD2A 5T5FH 1XAUA 3SE9L 3T0DA 4JFOB 2BC4B 2M26A 4IRJC 4ZPVB 1D9KC 3S88L 4OGXL 4X83A 3UPRB 4LASL 2ERJC 1CS6A 3WJLA 1MELA 1S9XA 3ZDZF 1H3GA 4Z7VE 2EDBA 4RMTA 4JGJA 4PJDF 1GAFL 3MLYL 4IEFB 1SJEA 3LKPA 3QZWG 1NGZA 5DJ0A 3FOLB 5C0BE 2SEBB 4NYLA 1FORL 1MY7A 1RK1A 3VD3A 5J06A 5F44A 3PUCA 3BPLB 5DT1L 4L29B 4P23D 3BESR 4DGVH 3UAJC 2XZQH 1UJ3B 3MV8B 2NY5L 1AHWA 2AERT 4BKLB 4LIQE 3NPSB 3MO1A 3HKFA 1A3RH 4F9LA 4NN5C 5L6YL 4FQJH 5DZOA 4PJEF 3DSFH 4YIQA 1IAKA 3EFFB 4QRQA 4M5YL 3T65B 5CILH 4DZ8B 1XFPA 4RNRB 3BISA 1JTTA 2JIXD 3H3BC 1FL6B 1U8JA 1UT9A 4G80B 3WIHL 4AIXA 2AGJH 4I5BA 4PTUB 4X6DE 5CUSH 1A9EB 4RWYL 1X7QA 4CJ0A 4YZFE 1YJDL 1X5IA 2R15A 4LAQL 1F3JB 4NKOB 4RFOH 4U0RC 1MAML 1LNUA 3PP4H 4ZMAT 4P99A 4UAOB 2YS4A 2YBRA 3MA9H 3SKJL 5DHVH 3HCVA 3NCEB 3F7VA 3TO4D 3UTSA 1B6UA 1I85A 3TVMC 4UOW0 3O9WA 2VISA 5F9JB 1WZLA 2DQJL 3GSNA 4PRIB 4HC1A 2FCBA 3IDIA 1T22A 2F53B 4RZCA 4R7NB 2RAMA 5FHBL 5JOEA 1ZT4A 5DJ2B 1P4IL 4K23L 1FV1A 4UV4L 4L4TB 1I75A 3FQXA 1VKXA 1U8KA 4DW2H 1P1ZA 4R97B 3AVEA 4JFED 3MOAL 3UMTA 1N0LA 5JXED 4MWFA 5SWZB 2BOBB 3WLWC 5CKAA 3EYVA 3RAJH 4RGOL 1YNTA 3MJ7A 1T7WA 1BVKA 4OZHA 4S1RL 2IANA 3W9DB 4APQB 2IGFH 1T20B 3BYTA 4F2MA 5HGGS 5EZJB 3S35X 4ELKB 5GSVB 1IAMA 3CLEH 4R9HA 1ZSDA 5CJBA 3STZB 5ANMA 5FYKE 1MCHA 5DUPH 5F89B 2YPKA 1T4KA 2E6JA 2A6DB 4LRNL 4OLUH 4PLNC 3G5VA 3TYFA 3RUGB 5I75B 5A3ID 4B0MM 4M02A 3PHOA 2ITDB 2VKXA 5D7JA 3QJFB 2G5BB 1RZIA 4Y19E 1IILE 1RURL 1JPGA 3H9SE 4M8QB 4ZO8A 2YUXA 5JORB 4E0RA 3BZEA 1JRHH 3MLVH 3HI6L 4NRYB 4F9PC 2NY4D 3ILPB 5E4EB 4P2QE 3HZMB 5L2KB 1MEXH 2Q3AA 2CLVB 3GIVA 2K7QA 4P5TC 3KPOA 1OTUD 5DYOB 4EKXA 3EO0B 1RIUL 5GGVY 1NBYB 2PXYC 4I2XA 3VFTA 1HOCB 2DRUA 1A1OA 2UZIH 4K9EC 4C4KO 3D39A 4K3JL 1JNLH 2FEEL 5H2BB 4H20H 3S37H 4FP8L 4Q58C 3VD9A 5FHAL 3SE4A 1JTOA 1KIUA 1PGRB 5DMKA 4FMFA 4FQLH 1B9ZA 4NOBA 3DWTA 5E99L 1TTGA 3EOAA 4MD4B 4UIMA 1WITA 3OPZH 3V52H 3U6RB 1EBAA 1M05B 4S2SA 1BM3H 4JCLA 4LHUG 4OUOA 2EEDA 1M1SA 3BEWB 4RGNE 15C8H 3WIIH 4ZO9A 3QCUH 5HHNB 3V5HA 5BRZB 5BV7C 2X1OA 3DLQR 1ZLVK 1A6AA 1JZ8A 3P11L 2UWEA 5F9WB 4JPWH 1TJIH 5TH2B 4KHTL 5F7EH 3MRRB 3HLAA 4GAYA 3WUZA 5D2NA 4TRPH 1S9WA 1QR1B 5HYIA 1H3WM 4F33A 2IH3A 5CD3A 4FXGB 4XZUB 4Y2OA 1JNNL 5MI0C 3SQBA 5KS9F 4R2GD 1GGUA 4NOFA 4G8FA 3GSNH 2XACC 4PRHA 4HC1H 2Q7YA 5F3BA 1FIEA 4HT1H 3C5JB 4Y8DC 4ZD3H 1SYVB 1G7LA 4OFKA 4OUUB 5C0JA 3ARXA 2GCYA 1S7VA 3I6KA 1OD9A 4LLAA 3MOBH 2HVJA 4HIXH 1J0IA 4WIQA 3VGHA 1DLHB 1KCSL 4ODSH 1JTPA 5K9KA 5DA4A 1VACA 3DMMB 3V7AG 2B1AH 2RB8A 1PZ5B 1QLRA 2A2QT 4ZUWA 3HR5B 3UTSD 3HFML 4HIHB 4IRSA 5EO1A 4JFZL 4FQCH 4D9LH 3O9WD 1S5IL 1KT2A 3A6CL 4TSAH 3RL2B 2GUOB 4D9QE 2QADB 1FN4B 1MIEL 4WDIB 5D9SB 4QRRE 1RAMA 3VXQA 1CF8H 5J89A 3EGSA 4Y4FC 3ARQA 3VGFA 4ZS6D 4P3DB 5CEYA 1E4WH 1FGNL 3PL6C 5DQDL 3WIFA 1FGVH 3C60A 3NIFE 3TBVB 1I9IH 1LK3H 1WICA 1EO5A 4M7LL 5CJQL 5T1KB 4AEHL 2FECL 1SVZA 3BIAX 1WAAE 2PTTB 4PG2C 3BRDA 3FT4A 2CJUH 1KB5B 3ZE2F 3TBTA 2YSSA 3C5ZC 3QULB 3THMH 1YQVH 5DS8B 3OB0K 3BYYA 2R0KH 4P48A 1DSFH 3GSVA 1NFIA 1KTLB 5TDOB 4JJ5A 1YEDA 2LVEA 4U1NA 4GW5B 3LQAL 4ZFOB 3X3FL 1WZMA 4C55A 5DSCB 3MXVH 4ENED 1CGVA 4P2RB 1K85A 2IAND 4HGWA 5GIRA 3K4DA 4DVRH 1L6ZA 2CDGB 5DJ6B 4LCUB 3K80A 3O3AB 4AM0B 1DBKL 3S5LB 3S35H 1KV3A 4WI8A 4UILL 4PJHB 3T04D 3QQ3A 4MQ7B 4KJYA 5JW3H 4JDZB 1XR9B 2EDRA 3DROB 5D71L 4X0KA 3SKOA 5IBTH 1FPTH 2AXFA 1J1XL 1W0WB 3RI5K 5IM7A 2N4IA 2R39A 5EN2B 1FZOA 1B4JH 1XR8B 4PTTB 4CVZA 5T5FL 3CFCH 4OM1H 1FL3B 2XRAL 3MUGB 4Y16A 3GK8H 5CINH 5FK9B 1AO7B 1JPST 4W81A 2K3TA 5AWNH 3HG1A 5FM8A 2FH8A 1UZ6E 4YAQA 2GSGA 4TPRH 1CG9A 1NEUA 4CN6A 4Z7VF 2VUYA 2F54A 1T5XB 5SX5H 3O4LE 5I1EL 4NM8H 5FYLE 3WEXA 4Q9CA 5J12B 3AB0B 4LHJB 2J5LC 2ILLA 2IADA 3RL1B 3SGEH 4F7EA 2X1XR 1NFKA 5FUCE 3ULSA 4X6FB 3GJFB 1MFNA 2XZQL 2DYPB 1UWGH 2HH0H 3I85A 4MCYB 3BVNA 1A3RL 5CWSB 4FQJL 4AEFA 1J8KA 3S7GA 2LQRA 1G7PA 5CGYC 3MRJB 4OCXH 1J5OH 3VXSD 4JO2H 3TBSA 1XF4A 5CILL 2WLZA 5EIIA 3U0WH 3TM6A 3TA3B 4XCCH 4DGYH 4JAMB 2AGJL 2VNCA 4X6DF 4YK4C 5IBUG 5CUSL 4Y7MA 1P6FA 5I2IB 1IM9B 5I1JH 1G6RB 3IJHB 2IBZX 1KJ2A 3QH3A 4RFOL 5T1LD 3PP4L 3RWFA 1Y18B 3MA9L 1DEDA 2OI9B 2VIRA 4U1JA 4NN7C 3KLAB 2EDKA 5JNYA 3WJLC 3CUPA 2H2PC 4WUUE 3VU2A 1E4XH 1N5AB 4L3EE 4PGJA 4GBXA 3VXNB 4Y19D 1JGDB 3G04A 3MNWB 3KWWB 1KXQE 1A2YA 3RI5F 4U33A 5D2LA 1FLRH 4LLVB 3DGGA 2WBJB 3F7QA 2VZSA 4DW2L 2F5BH 1T89C 3P0YH 4HJ0D 1A22B 3ZDXE 4NQDB 3VXMB 5IJVB 4IOIA 3TYGH 2IPKB 1OY3B 4OCLC 1IEBA 3RWCB 3I84A 2GT9B 5ISZE 2GW5A 4IRSD 3B9DA 3D0LB 3BH8A 4X4YB 2R1WA 4WEBH 3FONA 1T3FB 3ALPA 1WJ3A 2IGFL 3QRGH 4URTB 1RZGB 1BIIA 2R2CA 5CAYB 2AK4D 3QCVH 4Y2DA 3HE7A 5C6TL 5EIQA 3P4MA 3C60D 3CLEL 4AYFA 1EV2E 3DETD 3SO3B 4M7ZC 5DUPL 1ZAGA 4PRNA 3BWUC 4XCYB 2BNUA 3AU1B 4YO0A 1G84A 5HPMA 4DOHB 3EYQD 1FNGA 2FYYA 3L3KB 4NO0D 3TBYA 3IFNH 3VGBA 2AXJA 1WBZA 3NFSL 5ENWB 4FZ8L 1XF3B 1MCLA 1MFBL 3JV6A 1SEQH 4MNQD 1T1ZB 4GKNA 1H15B 3BEVB 2H9GA 1JRHL 5I1DA 4W4NA 3MLVL 5K9OA 2WWMD 1GPOL 1U3HA 4G8GD 4F3FB 4YHYC 1MEXL 4WO4A 2MCPH 3MLWL 3OKNA 5ICXB 1WUNT 1IEAB 1WC7A 2DICA 3IVKB 3INUL 2E3VA 5DK2B 1JNLL 1CDCA 4H20L 5EC1A 4OLWH 3S37L 1G9NC 3FKUS 3QDJE 4YDJB 1ORQA 4Q74A 2OR9L 4LEXL 3QEHB 1T2QH 3MFFB 3OPZL 1YC7A 5D1ZD 5GGSB 5HSFA 1MLCA 5IG7A 1P9MA 2OSLA 5ACLA 1BM3L 3HG1D 4F7CB 1QSFA 4WRLA 3NCMA 3QUZA 4DGIL 1HI6A 3DUUB 4HKJA 1UCTA 2F54D 15C8L 4FQ1L 3WIIL 3QWOA 3SE3A 3QCUL 4N9OB 5LG1A 4I3GA 3UYPA 4KAQH 1KIRB 4JVUA 2Y7QB 5GS2D 3MJ9H 1CR9H 2YXMA 4JPWL 1T1WB 1U41A 5F7EL 3TH4T 5C07A 2CIKA 1KPVA 4TRPL 3TBWA 3GHBH 3BKMH 1KJ2H 1G9MH 3UTZB 2NXYC 1YUHB 4W4OA 1CFTB 2BNRE 3T0EC 5LKNA 4X99B 4MHHI 4GJTB 4KMQA 4G6KH 1OTSC 1YEGH 5F7YC 4PJIA 2APWA 3GSNL 3ZYZA 5J8OA 3MJ8A 1S7UA 4HC1L 3O6LH 1G7HA 4KKAC 1VFBA 4HT1L 3IF1B 4ZD3L 4PRAB 1CD1A 2ADGB 1LDPL 2ZUYA 1DANU 4OQTA 3MRCB 3MOBL 1YMHB 3ESUF 1DUYA 1XGYH 4YH6A 4ODSL 3WHE0 4R4ND 4I0PC 3QXTA 1DN0B 4AENA 2B1AL 5F93C 1D6VH 4XPGH 3WKNA 1NDGB 3FAXA 2AI0H 3I02B 3RPIB 4FTVE 4D9LL 4LCWB 3HZVA 4TSAL 1RJLB 1UB5B 1DE4A 1CF8L 4GBXD 5CGTA 2G60H 1QYGL 3T0XA 4KXZI 1E4WL 5EU6B 3VE0B 3K2UH 4HWUA 2G2RA 2NY1B 3O6FA 5EORH 1FGVL 3FT2B 1CL7H 3VG9C 1I9IL 1LK3L 3NIFF 1K2DB 4NKMB 4XHJC 5ADPH 3K8MA 4MJIA 4XBPA 5C0AE 3ISWA 3QFJE 1A7BA 3OR6B 4NN6B 5SWSB 2B7DT 2CJUL 3HUJB 4KDTC 3GMMA 3U36B 2XPGA 2Z93B 1BQHB 3QIBB 3SKNA 2Z92B 4G8EA 1U0QA 1YQVL 3NCYP 3PWPB 2X4PA 1B0GA 2R0KL 1DSFL 1HSAA 1J0JA 4UOJA 5EO0B 4GRWB 2X70B 1QLFA 5FM5O 1T0MB 3MXVL 2P5WE 3LPWA 3X11A 2R9HD 4PJ7A 1QSEB 4OLXH 4DVRL 2M8XA 2UY6A 4EUPB 2CUMA 2R1YA 3REWA 1FFOA 3S35L 5LAXB 3DYPA 1FYTA 2OYPA 1KPUA 3H3PH 5JW3L 3KLHC 4YQXL 3LRSB 1BF2A 1HHKB 5IBTL 1PVHA 3LSOB 3D48R 5TQ2H 3MPCA 4RAVA 1B4JL 2AXHA 1QPXA 3CFCL 3L3DA 4OM1L 2VLRE 3GK8L 5CINL 2OL3A 4UOW1 3TZVA 4F15B 4FQHA 3EHBC 2H1PH 1UZ6F 4YHKH 3EO1A 3RWHB 1RULH 5ESVA 4HUUB 2R8SH 2OK0H 1MCEA 2VL4A 1FG2B 3E8UH 2P44B 3G5ZB 3S3PA 3ARGB 4BZ1H 4NM8L 4GG6B 1DL7H 2OTWA 3MZTA 3O6ML 5EOQH 4JDVB 5IR1A 4K7PY 1TQCC 3RGVC 4UDTB 4PB0H 2XWBB 1W8NA 1S9KC 2HH0L 1UWGL 5CBAB 5C0DA 3GIZH 4O2EA 1QUNA 2HN7B 2VZ1A 1MRCH 2NZ9C 2CSPA 4OCXL 5HGAB 1J5OL 4JO2L 1HYSC 3OG6B 5B22A 2C3GA 3PXJA 4YNYB 5DK0B 3VXRA 4XCCL 5EPMB 2E7BA 5DUBB 4CDGC 4DGYL 1FVEB 1VADA 3QUKB 3RA7H 5I71B 5IWLC 4UNTA 2PNDA 2H32A 4TUJA 4OQTH 5I1JL 4W6XB 3IFOA 1WLHA 1HHJA 2X7LA 4Z0XB 4ODTH 2AJSL 3ARDA 4L4VA 2HFEB 4QT5A 4FQXB 3ARBB 4DTGH 4OV5B 1CWVA 3LCYA 5BQ7A 1F6FB 2FO4B 5ERWB 3C8DA 5EOCH 3SE8H 1GOGA 4S0SD 4XNYH 2CR6A 1E4XL 4JO1L 4WV1A 3PJSA 2UY7A 2WIIB 2DLEA 3G6JA 4WI9A 5DTFB 5EOTB 3QEQE 3SOBH 4JFYA 4JQVA 5AG8A 3SDCD 3T08A 4BH8B 1CICC 1Q1JH