4RGOL

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
DIVMTQSPATLSVTPGDRVSLSCRASQSIGDYLHWYQQKSHESPRLLINYASQSISGIPSRFSGSGSGSDFTLIINSVEPEDVGVYYCQNGHSFPYTFGGGTKLEIRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoL01
3EJYD 5D1QC 1J0YA 1WK0A 3WHE0 5CD5D 1KULA 5EIQA 5I9QB 4NP4L 4PJCA 3OG6B 4JZJA 4OZHF 4R3SA 5FCUH 2ATPB 1EZVX 1D9KD 4ELKB 1QNZH 1RJYB 5CJ8A 4BFBD 4UV7H 4OCMC 3QUZA 1LE5A 4YWGL 1QNZL 3BPLC 3SQBA 4XMKL 3VJ6A 3QXVA 4XP6H 2AEPL 3WDJA 1D6VL 4GXUM 4O5LL 1MCKA 2ZUTA 3ARYA 4XP6L 1U8HA 4WHYH 1VFBA 3CIQA 5CEZD 4Y19D 1NGZA 4MJ6B 5IB5B 2PF6A 3GK8H 1S9KC 4ONGL 4U1KA 2P8MB 3KYMB 3DXAE 3TLRA 4EI5A 2VR9A 1MI5D 1RIUH 4I0PB 2ZCKL 4UDTB 4N68A 1RIUL 2HJKA 3BZFB 4HUUA 5TPWH 1A6WH 2H32H 3NABH 1OM3H 2CUMA 2D7MA 4C58B 1TTUA 1MLCB 3F7VA 4X6DF 5TPWL 3VXRA 5DJ2B 3SDAA 4EBQH 1N7MH 3LKSA 1S9VB 1IGIH 1XH3B 1YMHB 2KPNA 4PLNC 4LHUG 1N7ML 2EIZA 2DQGH 4WV1A 4HX1A 5DJZB 3BIKB 1IGIL 3UTTE 5I0ZA 3CFBA 4E41E 1P53A 2DQGL 4N8VB 2IBBA 4PLJC 1S7SA 5J6HA 2XXMB 1XF3A 3MZGB 5DA4A 1YY8A 3KXFA 1B6UA 5SWSB 4JFYA 4OZHB 4D0DA 1ZVHA 3GSVA 5EU4A 5E56A 5I73B 4ZO6A 4ODWB 4UINH 4J4PC 5DMKB 5FAAA 4UINL 4XPHL 3H9SD 3AM8C 3B9DA 5DD0L 5D1QD 3G6JF 4KVCL 4PJHA 1CE1L 1I1YA 2V7HB 5EN2B 3U7WL 1K4CA 5LCVL 3QEGH 4NCDA 2UZIH 2Y25A 2ZPKL 5JIPA 1RUQH 2X2YA 3BKJL 2P47B 3QEGL 4KQ3H 3V2AR 4I5BA 3SDXE 2R69H 4OZFG 2KUTA 5F6HJ 2FL5A 3GB7B 4KQ3L 4OKVA 3TP4A 3AY4C 3ILPB 4IRJB 3UJIH 3V9FA 2C5DC 5LJYH 2HT4D 2CDEB 3RL1A 4YHYC 3QFDB 1CGYA 1CXEA 3MMEA 3TPUB 3AREC 3RWDB 3O0RL 4Z0BL 4LVHC 2PYEE 2ZKHL 3RDTB 4D8PB 2IH1B 2Z4QB 3AUVA 3DROB 4Y89A 4MXVE 1MJJB 2FWOB 1RK1B 1UXWA 3HPJA 3KAAA 1P4BH 5C0BA 4AQOA 3PNWA 4DKAA 3MLYH 4EXKA 4LPYA 4D9RE 2E6QA 4M6OH 3PWUA 5HHMD 4ZFFA 3GJFB 2X4RB 3MLYL 1H3PL 3D25A 2J3SA 2QJDA 4JRXD 1FYTB 1HINH 5GISH 4G8GD 4ODHH 5T3XD 4JZOA 1MIMH 5GISL 4ODHL 5KN5A 4AEIL 3P0YL 1RHHA 1ZVSB 4ZFGH 4JR9H 1DE4B 1QBMH 3T8XA 2O61B 4ZFGL 1EAJA 2KDGA 4LLDB 4JFDA 4QRQA 5TDNB 5FB8B 3G6JB 4C56A 5FYLH 2GQHA 5J9PB 3WDHA 3QUXA 3LKOA 1NFIB 5KSUA 2VC2H 2XWBA 4URTB 4WWKB 1XCTA 4ZFZB 3ZL4H 3RY4A 3O4LD 4J4PD 1A6AB 5KVFH 3BI9X 2EEBA 4NBXB 5D7JC 4OJFH 1FL3A 2Z9TA 1OGTB 5HHOB 3QH3A 3ARDA 3C5ZD 2Y4SA 2XACC 3T0EB 3FB5A 4GMTH 4HV8A 4CDGC 3CFDB 3JVGC 3O9WD 2IALB 2VDOH 3UDWA 4L8SC 4JQVA 3TO4B 5GS0L 4GMTL 4PRPB 3LV3B 2ITCA 3I50L 3ZE0F 4MD5A 4BZ1H 5F7YC 1ZA3B 4BZ1L 3TV3H 3VXUD 2R1XA 5HYIA 1TPXC 3TV3L 3OKYA 4M7JH 1EEYB 3MV9E 2EDOA 5C09B 4LCCC 4HT1L 3RP1A 2OR9H 4M7JL 4LFHD 4NJ9L 3D0VB 3T3MF 5HJ3A 4KK5C 4PJBB 2Q7YB 3HE6A 1NMBH 4KY1L 1HEZB 4IMLA 5B38A 3WFDH 2BNUB 3DX6A 3DV6A 5I75C 1ZVYA 5JXED 2AK4D 3JV5A 3QJFA 3QPXL 2AXGA 3X11B 4UNUA 1OTUC 4LRIC 4ZPVB 3V6ZB 3OXRB 4HFUH 3FFCA 8FABA 1OP5K 1BQHG 4X8XA 4P5TA 4WI9A 3D0LB 5EULV 4HFUL 4L4VB 3DPBA 5LGHH 4YHZH 5JPMB 2BNRA 1T1WA 3HTLX 2K7PA 1FP5A 1MCQA 4M00A 4MQ7A 1UM6H 4UU9A 3O3AB 1V7MH 4MA3A 1NDGA 1UM6L 4W4OC 3S9DB 3E3QC 3PF2A 4WW1A 5F9OH 5JDSB 4EDXB 5H35A 1DUZA 5DEFA 4DKEL 4G6KH 5F9OL 2OQJB 4N0CC 1OAYL 3JUYA 5C08E 4G6KL 3CX5J 4DN3H 5GS3A 3OKEA 2ZOKA 2KQNA 1N6QH 1KPVB 5A2KH 4DN3L 1UZ6E 4OV5B 1EHAA 1T03H 1OVZA 1HI6A 1ERNA 2X4QB 5GGUB 2RIKA 4TULH 43C9B 4OLWH 3VA6A 2DIAA 4QHLA 5KVMC 5SX4I 3BE1H 2HLAB 2OR7A 3IJYA 3LH2L 1H0DB 5HYSA 4JG1H 4KKLC 2VE6B 3BE1L 5D6DC 3BPNB 3O8XB 4XNUH 1FG9C 5DQDL 3BT2H 5E9DA 4XMPH 4WNQA 3TYGH 4XNUL 1QFWM 4YDIL 5HPMB 2GK0B 3C60A 3GNML 1XF1A 5EDXA 4QF1A 1JUFA 2BOCA 2QHLA 3GI9H 5TE6H 2CQVA 4MQXD 3NPSB 4FQQB 5C0EA 3SQOH 3IXTB 5DVKA 5I8KH 3GI9L 1JHLH 5INDB 3MJ7B 3SQOL 1JN6B 2RCSL 1NL0H 5I8KL 1JP5A 1FO0B 3BSZH 1JHLL 4BM7A 3HC3H 1LO3H 1DL7L 1AY1H 5LGJB 1I1RA 1NUGA 1YJDC 1KTLA 4ODXB 1I9JH 1G7QB 1AY1L 3OKLB 1I9JL 3K7UA 3QCVL 3QHFL 1Q0XH 1I85C 1Q9WA 5BS0B 1EJOH 3MRGA 4HUKB 3MV7D 5BQ7A 2ARJB 4OD2B 1EJOL 2KQMA 4QOKA 3F58L 3R0NA 1RMFH 1OTUD 1CL7H 3LSOA 3O3UN 1RMFL 3KLAA 1KOAA 1CL7L 4NKIH 3MBED 4HFWA 1FNEB 4NKIL 1AXSA 4PB0L 4WTWA 2WAHA 3AROA 1WIOA 5DZLA 3H3BC 3MYJA 1EMTH 3W9EB 1SYVA 5I16B 1P5UA 1QA9A 1U93A 5B39G 1EMTL 1D5IL 1QR4A 1BIIB 3CXHK 3GSNL 3RPKA 2DWDB 5KG9A 3NCBB 4RWHA 4XGZA 5D1XD 2X4UB 1AGDA 2OI9C 3WHXA 4MS8C 4ETQA 5JW3H 2WWMD 2KKQA 2F19H 4AEHL 1IC5H 2VDML 5JW3L 4GS7B 2F19L 4ERSH 1BJMA 1F3JA 4HKJA 1IC5L 4OTXL 4QHMB 1C7SA 3LN4A 3DX8A 1EEUA 3Q6GH 4M6NH 1WFTA 4TN9A 4RFOL 3LKPB 4NHUB 3DXAA 4PJ9B 4M6NL 2EDBA 1CBVH 3GUTB 1MWAB 1NC2D 1CBVL 1MI5E 1WT5A 2XFXB 3HKFA 1CFBA 4IOIA 3UJTL 5E99L 4S11A 3LQAL 4X99A 1F6LL 1L0QA 1QSZA 1K6QH 3IDJB 4PRHD 1C12B 5D9SA 5T3ZH 1GVIA 4QHKJ 3U46A 4XXCC 1P7QA 1SEBB 3OXSB 4DGIH 1K6QL 3PQYE 1AGCA 1N2RB 5F7DA 4FZEH 5D2NC 4DGIL 3HMXL 4WFEE 2PTVA 3V95A 1DFBL 3UTTA 4ZOBA 1FIGH 1F02I 3QWRA 2ADGA 4B50A 1IJ9A 2VAJA 5JA8B 1C16B 3CH8A 4U6VH 3G08A 3BOVA 4OIIH 1ULVA 3ZE1E 1CFNB 3QHTC 4YBLB 3RIAK 5DHXB 3MBXH 4M9PA 4OIIL 5CINH 4TOYL 4HH8A 2XWTA 4G6JH 3D18B 3KYKH 5C07D 4HIJA 1KELH 3MBXL 4AK1A 4UUJA 3UPCA 4IOFC 4Y4KA 2ESVA 1A6UH 4G6JL 4OCXL 3KYKL 5B4MC 4UAOC 2OL3H 1Z9OA 4PJCB 3H9SE 5IEKA 4JZJB 4FS0A 3G5XA 4R3SB 1MY5A 5CLWA 2C7UA 1H5BA 1LNUA 3QUZB 3BQUD 1LE5B 2DDQH 1KXVC 2DQTH 4S1QH 3VJ6B 1UKSA 4L4TE 2VABA 5GQBA 4S1QL 1U2HA 5IJVA 4M7ZB 4NKQB 4UZGA 1U8HB 4FQ1H 5LVEA 4PJHF 2VQTA 1NGZB 3P4LA 4FQ1L 1KCRH 5J6GA 1J0ZA 2CGRH 4BUGA 1I7UA 1BGXL 1KCRL 4DUWA 1X5GA 4TNWK 2CGRL 2PYEA 3G04B 1JGVL 4EI5B 3Q6FA 1DVFC 5CBAB 3LDBB 2JK5B 4CAGA 1MHPH 1MCEA 2HJKB 2AI0L 5E5RB 1SQ2N 1BD2D 1NCTA 2VZOA 5HHME 3F7VB 3B9EA 3ARFC 5H94A 3VXRB 2OK0L 2IPTH 3LKSB 4JN1H 4X98A 4G8GE 1DLFL 5T3XE 2EIZB 2OTWB 4WV1B 2IPTL 4HX1B 4JN1L 4MLIA 2HFEA 3WIHH 3G9VA 1J1XH 3CFBB 2VLKD 5J6HB 4M1DL 1S7SB 3ALWA 1M6OA 4KMLB 5ITFA 1TMCB 1XF3B 3WIHL 3KPMA 1J1XL 1YY8B 3KXFB 4M62L 1SBBA 5ABDE 4JFYB 2DYPD 4D0DB 1EERB 4F3FA 4TVSa 2MPAH 1JTPA 5EU4B 4JB9H 2I9TA 2UZYB 4MAUL 2MPAL 3STLB 2WK2A 4JM2D 2HA1A 3R8BB 3PE9A 1QLFB 1QBLL 1UG9A 1CXHA 1P9MC 3QUMA 5DVLA 5E2WH 1AQDA 5B4MD 4PJHB 1LVEA 1I1YB 1EIBA 1UVQB 1H8NA 1VPOH 4KDVA 1IKFH 1K4CB 3PG2A 1CN4A 1TCMA 4P9HH 1IKFL 4I5BB 2P1YA 1O7VA 2EH7L 4Y4HC 2DLEA 2FL5B 3EKCA 4GRLD 3QO1A 2DMCA 1M4KA 4V1DA 3JZ7A 4OKVB 3HI1A 1JHTA 1BJ1J 3BW9A 5FECA 3RL1B 3VXUE 3MMEB 3MV9A 1NFDE 1YNLH 1E6JH 3ARZA 1MCJA 2ZJSH 3TWCH 1YNLL 2BSSA 5E8OA 2ZJSL 5TDPA 3O6FD 3EDKA 3TWCL 3QEHA 1S78C 1UXWB 5DJ6A 3HPJB 4HXBH 5D6CA 5C0BB 1T1ZB 4R90L 3PNWB 2A9MH 3ARBA 3PWUB 2A9ML 4ZFFB 2X1WL 1UWXK 4XPBL 1ZKAA 3HMWH 3WUWG 1HQ4A 4XB8A 4LL9A 4N5EC 3EDFA 4JZOB 4HZAA 3U0PA 4MLSA 3UTSE 1BFOA 5KN5B 3V0AC 3MODH 3AS3A 1RHHB 2HRPH 2VOTA 5KTEH 4RBPH 2CLVA 3MODL 3ELAT 3T8XB 1KYOJ 4U3CA 2UY7A 5KTEL 4LSRH 3TBTA 5CIPH 3DUUA 5F9WB 4QRQB 1U8QA 4XNMA 4LSRL 4C56B 2R4SL 1WFUA 3FFDA 4XBPA 3MLZH 3LKOB 5KSUB 3MLZL 2XWBB 5C08A 1XCTB 4K71C 1GSMA 5F96L 3JXAA 5HPOA 4M5ZH 3HAEG 3WBDA 3TF7C 1FL3B 1NAML 4LQFH 5CKGA 4GAYA 5DURB 3ARDB 3QIWC 4FNLL 5FYKH 2VLLA 5EIIA 4U6XA 3DWTA 4N90D 1QBBA 2ADFL 3MUZ1 4RA0C 4HV8B 5FYKL 2KL6A 2ITCB 2V2WB 4X7FC 2PR4H 3QXTA 1LK2A 4Y4HD 3ULVF 2R1XB 2HG5A 4P2RA 2AERT 5ACMA 3BKMH 3CVHL 4TUJB 2AV1B 1K9TA 4ONOA 3X13B 3P4OA 4Z0XA 2DQEL 1BF2A 3WEXA 4MAYC 3L3GB 2YC1A 1SJEA 2GKIA 1IEAA 1T89A 5F3BA 5MHSD 1N4XL 5HJ3B 4OCNC 3HE6B 1NCBL 5I0DA 1QO3A 3I9GH 4IMLB 3HPLA 5B38B 3DX6B 3ZDYF 5CP3A 4LP4A 5FM4A 1S78D 3V4PL 1S5IL 2MCG1 2ZG1A 3VH8G 5CS7A 4YDLB 3QJFB 5MI0B 1QFPA 2AXGB 1IFHH 3UCRA 5K9QI 3L5XL 2BVTA 4PJAF 5SX5H 1J0JA 8FABB 1IFHL 4P5TB 5ILTH 1MRCL 5I1JL 3IDUA 5ILTL 3WN5C 1QHOA 1T1WB 3MNWA 5F88A 2J8UF 3MRRA 5I8CA 4MQ7B 2QQLL 4OFIA 4XNQA 4UU9B 3C8KB 2XY2A 4IRZH 4MA3B 1NDGB 3TGXA 1VFUA 4U1NA 1WFNA 2P8LB 1BVKA 4YBQD 3V7AG 4WW1B 1YC8A 2DM3A 5H35B 3MCLL 5DEFB 1ZANL 3KHQA 1D9KA 2XNAA 3QR2A 1RSFA 3OKEB 4TVPL 5HHXL 1X6LA 3RWFA 1PSKL 4UBDC 4WI4A 1HI6B 1RUKH 4JREC 5HYQA 4FTVD 4WVRA 2E7MA 3ABZA 1JNLH 4Y19A 2E7LC 4G42B 4Z95H 2DB8A 4XT1C 4P5KA 4OUOA 1RUPL 1U2CA 5ICZA 3B8SA 3IJYB 1AO7D 4MMXC 5HYSB 2XXCB 1J87A 5GHWL 4L3CA 4RMTA 3CMGA 5E9DB 4B7IA 3Q5TA 1MI5A 4DWHA 5HGDA 3C60B 1O0VA 2G5BA 3U0WL 2IWGA 1JUFB 2XZCL 4QXUH 2BOCB 1JV5A 2R2CA 5C0EB 3K1KC 4LSUH 4F8TA 3B2UD 4LKCA 4PJAB 4M9OA 4PRHE 3VW3H 4LSUL 2I25N 3VW3L 4CVXA 1QD0A 4DKFH 1OW0A 3JV0A 3RVXC 2QL1A 1J11A 2IBZY 3QXDA 3LMJH 3SPVA 3PWPD 3TC9A 1Q9WB 5DD1H 3UBXG 3MRGB 1T21A 4QXWA 1E4XL 4YFLF 4Q9RL 3LMJL 4QRRD 4Z7NE 5BQ7B 4QOKB 5DD1L 3LSOB 4JQIH 3SO5A 1IARB 2LTQC 3KLAB 1J88A 4JVUA 3RGVD 1IZKA 1T04A 2YPVL 1J8HD 1CT8A 4JHZA 1AXSB 4IRSB 2NY6C 4M8VA 1IE5A 5I66A 2Y23A 3H9SA 4NC2B 3MYJB 4BYHA 1SYVB 1WIPA 2XQYK 5D1QA 5SX4H 1N0XL 1QA9B 1U93B 4Y1AD 5E1AA 4L9LA 5I6XB 5JHDD 4R97B 2ID5A 5KG9B 1R3LA 3N06B 4XGZB 3VFPA 3BD5A 3M17A 4F7TA 2XWJA 1AGDB 4Z7UE 5FGRA 1OP5H 3WHXB 5E8EA 4XHJD 5IB4A 4ETQB 2C1OB 3ULUF 5C0DA 4U31A 4AENA 3GKZA 1MY7A 1G9EA 1F3JB 3RUGE 1OCWH 2VB5A 2EXWC 1NLDH 1UWGH 3LN4B 3DX8B 3INUH 2ILLA 3VFTA 3BP4A 3WLWC 5B8CC 5ALBL 1LO2L 1W72L 2VWEC 3DXAB 4TSBH 5AZEL 5DD5L 1KXQE 5IBTH 1AQKH 2HFFA 4PRDB 1RULH 4TSBL 1ZWIA 3QDJD 4IOIB 3QQ3A 4ZAKC 5IBTL 1ADQA 3FQUA 1RULL 3MUGB 5IESH 5GS0C 1KCVH 3OX8A 4JRYD 5IESL 4LLQA 4PJDF 1KCVL 2PNDA 2CRMA 3QUYD 3U46B 5JLZB 5IROC 1P7QB 1AGCB 1A7OH 1Q9LB 3MLUH 4G8GA 5F7DB 3WIIH 1OQXA 2NTSP 2R39A 1A7OL 1IAKA 4R2GD 5CILH 5TF0A 3UTTB 3WIIL 1DJSA 4C54A 2ADGB 2JB6B 1QSFD 2D9QB 2CKBA 5JXAL 2VLJB 1C08A 4WENB 3G08B 3K8KA 1DEDA 5B22A 2AKRA 5ANMA 2COQA 3OB0K 3LEYH 4HIIB 3BPOC 4HUVA 2PW2A 1WIUA 3AGVA 5I1DA 5IBLC 3L7EB 2XWTB 4JGJA 4HIJB 2VLME 3QNYB 4UUJB 3BMVA 4Y4KB 1A7QH 2ESVB 3UTZA 1Q72L 3O4LA 4J4PA 2AJUL 4ZG1A 1A7QL 1U8JA 1BFSA 2YK1H 5T1LD 1MAKA 5IEKB 3TYFA 4KDTC 4AM0A 3C5ZA 3AM8A 2NY4B 3RJDA 4ONFH 3C5JA 4QRPD 2C7UB 1H5BB 1AGEA 5T1MA 3DSNA 3RVVC 4ONFL 1XGUA 2NY1D 1LP9E 2VZUA 3O9WA 4UQ3B 2QEJA 2Q20A 3SKJH 4YHKH 4NC0B 1H3XA 2VABB 5IJVB 2EIEA 4YHKL 2HP4A 4Y16C 1VSCA 4GKSA 1CR9H 2I5YL 3TN0C 3VXUA 3W82A 1XZ0A 4GO6B 1NFDA 1WTGT 4RGMB 1HE7A 1A7RL 1I7UB 3AY4A 5FYLD 1RZFH 4CJ0A 2EXWD 4JKPH 2JF1A 2PYEB 1KNOB 3B3IA 1RZFL 2C3VA 4HZLA 5F7FA 4WU5A 3RWEA 4FG6C 3MRQA 3C08H 1WWAX 3T1FA 3C08L 1MCPL 2CJUL 5JXEA 4HC1H 4U0RC 4LVNB 1YEFL 2AK4A 4HWBH 3UYRL 5HXMA 2PO6D 5H94B 1FVDA 5A2IH 1WVZA 1MNUL 5DUBA 2QSTA 1FVCA 2ICWJ 2HN7A 1FAIL 3G5YA 5D7LD 4GH7B 4OQTH 4U1MA 1HSBA 1DCLA 4X7SH 4KAQH 4OQTL 5MEND 1M6OB 5ITFB 1CXKA 1Q94A 4KAQL 4G6FD 4NUJA 1AGFA 4LF3A 4JHAL 2WWKO 5CEXA 4F3FB 2I9TB 3IYLW 1S3KL 2VITA 4O02L 2NXYD 1NBYA 5FGSA 5FA4B 3I6GA 3DVGA 3GZKA 1TJIH 3T08A 3S96A 3B2VH 2EO1A 4X6CE 3QUMB 2WM0A 3ARVA 1AQDB 5DF0A 2H2PD 1S7RA 2IPUK 2XRAL 3QA3A 1A3RH 1S9YA 1EZVY 1G0XA 4LAQL 1FL6A 5F6HI 4HQQH 4I8DA 1E27A 4TUOA 1L6ZA 5FK9B 3S3JA 4TYUA 1HOCB 4JLRA 3OJVC 4ODSH 4HQQL 3RVVD 3SE9H 5LXGL 1EEZB 3W5MA 2GSGA 3QO1B 4V1DB 5JA9A 1VESA 3HI1B 1JHTB 1NCWL 3SE9L 3IKCA 3BW9B 3SGJA 4J3UA 5K33A 5FECB 2J1KA 1EUTA 2MHAA 4NO2A 5TQ0H 3N85H 3ZYOA 35C8L 3ESVF 3MV9B 1JYVA 3WCYA 3FAWA 3PGDA 5TQ0L 3N85L 5AAMA 1PKQA 2QTEA 2BSSB 5E8OB 5EU6D 5JOFB 3RZWA 3QEHB 1GGCL 2DF3A 5DJ6B 3NH7H 1K8IA 5D6CB 3ARBB 1ORSA 5E08L 4JO2L 3ALXA 4QNPF 3O2DH 3LKNA 5B21A 1WTLA 5FOBA 1CDHA 1HQ4B 2DQHL 4K55A 5LWYL 4HWUA 2X44D 3LPWA 4JDTL 3AC0A 3T4AA 3U0PB 3OV6A 3MV7A 5KOVC 5DRXA 1BFOB 3LQAC 4LRIA 1MWAH 5GGVY 5I76B 1BM3H 3TCLA 2CLVB 4J3VA 2PTUA 3FN9A 3MBEA 3TBTB 2EDJA 3DUUB 4J1UA 4WFHD 5FHBH 4PJ8C 1ZAGA 5DEZA 4DVBA 3FFDB 2VRAA 4XBPB 5IT2H 2FIKA 1Y0LA 1ZLWH 3MJ9H 4EUPA 2QSCH 3H9ZA 1DQML 4C57C 2LAGB 3MJ9L 1UGNA 5E1HB 5D1XA 3AU1A 3O41A 3SOBH 3S35H 2FGWH 3TNMA 2H8PA 2J4WH 2VUOA 3JTSB 5DJAA 1CCZA 2VLLB 5EIIB 4U6XB 3S35L 3SOBL 3DURA 4BUHA 2Z91A 4FTVE 3D3VE 2XA3A 3LCYA 3GKWH 1X5FA 2H6PA 3D2UB 3AB0B 3U36A 3BIBX 4BK5A 4I3SL 3VWJD 3LEVH 5IHBA 1T3FA 3FB8A 4UB0H 4PGJA 4YXHH 1OAUH 1LK2B 2HG5B 4P2RB 4FRWA 5L9DL 2RAMA 1NC2A 3JWDH 4X9GA 3GSWA 4LCYA 3P4OB 4LLAA 4Z0XB 3C09C 3WEXB 4R7DA 4LGRB 1RJLB 1JZ2A 4NOBA 5IJKA 2YC1B 4Y2DC 1SJEB 4PRHA 1IEAB 3L3JA 1HHGA 3VWKD 1QO3B 3MJGX 5D7IE 3G9AB 1KFAH 3HPLB 1NMCB 2HTLD 5D7KD 5I1AA 4L3EE 4L29A 2D7NA 1UZ8A 3LRSA 2XQYG 1DBMH 1GAFH 5CHNB 1EO5A 3PWPE 3FO9A 3GFUA 2CO6B 3MLPA 1DBML 3B5GA 3C2SA 2C26A 1I85A 2AJVH 4UT9L 1KUMA 4LRNL 2VDQH 4IIQA 3MNWB 4H1LG 4LLUB 4YAQA 3MRRB 3NZHH 5GRXG 2AJVL 1P1ZA 3RTQC 1CDBA 1E4WH 1MJUH 4PJFE 4XNQB 1RZKH 4HIEA 4YQXL 1B9ZA 1J8HE 4U1NB 5KSBF 3VFRA 1RZKL 3S4SG 1IKNC 1MCRA 1BVKB 3BUTA 5ID1A 5KSAC 2EECA 3VFVA 1RIHL 5T3ZD 1KJ3L 1D9KB 2R0LL 2XNAB 1J0KA 2ZNXA 2QBWA 4K9EH 5ERWA 5T5NF 3BQUA 4Q6IA 4G9FE 5D7SH 4Z7UA 1KV3A 3P73A 4FQCH 3RWFB 5D7SL 5CSZA 3VFWB 2HH0L 5HYQB 3RUGA 3RA7H 3O2VH 5JW4Q 1F3DH 4Y19B 1OP3H 3MJ8A 2Z8RA 1N26A 2EE3A 3O2VL 3KLSA 3RA7L 4P5KB 5J11C 5ICZB 3HI5L 4L3CB 3RPIA 1KIPA 4LCIH 1KB5A 1FFRA 1U9KA 1MI5B 1FLRH 5HGDB 1CGUA 2G5BB 1NGQH 3NCJH 1FLRL 3HN3A 2GYSA 5I30H 3QISA 3TT3H 1NGQL 1F13A 4JRYE 5E8DH 2GUOA 4LKCB 2AV7B 1IGFH 3TT3L 5E8DL 4EIGB 4Y2DD 1IGFL 2G2RA 2EC9T 1FJ1A 2VDPH 5C0RH 1HHHA 4CVXB 4XXCA 3EYSH 4KI5C 3MRIA 1EH9A 4KQ4H 3HNVH 1OLZA 3QXDB 2VLKA 3SPVB 3C2AH 1TJHL 1A1NA 4TSCH 2DL9A 5L0QC 3L6FA 1QSFE 1H3UA 1T21B 3HNVL 4ZXBD 1F4WL 1ITBB 4WFGD 3C2AL 3DX9A 3IFPA 1AXTL 3P9LA 4MXWH 3T4YA 1HCVA 2YSSA 1UKQA 1F90H 4L8BA 1EK3A 2DYPA 3GJFK 1EXUA 2EDYA 4MXWL 1T04B 1BZ7A 1CT8B 1GC1L 5F93C 5CUSH 3ILQC 4JM2A 2XZZA 3L5WA 5IFJA 2V17L 2YXFA 1KENL 3S37L 5CUSL 5I66B 1KBGH 3H9SB 1D6EA 3DX7A 4QTHA 5D1QB 4KV5E 3QI9C 1KBGL 4M7LH 1CS6A 1UH3A 4OI9A 1JF1A 1WWBX 1WC7A 2XI9A 4L9LB 5E1AB 5C71A 2R1WA 1JWMA 4R4BB 1R3LB 3EYFA 1LP9A 4QRPE 4ZUTB 4XP9H 4W81A 3VFPB 4F7TB 3M17B 1SJHA 2XWJB 3BAEL 5E8EB 4XP9L 4X4ZA 5FUCC 4AENB 1OWRM 2BY1A 4GRLA 4K2UL 4YGVA 3ZYZA 4NFDA 2BNQD 2C4FT 4TRPH 4XMLH 3F7RA 1UQSA 4KPHH 3VFTB 5FYLE 5EC2A 3WE6A 1OAKL 2B8OT 4LEOA 3WYRA 3O6LL 2VZSA 2H2SD 2HFFB 3O6FA 5FKPB 1GZQA 1S7WA 5K59E 4K7PY 3QQ3B 1JHKL 1CFVL 4QHKI 3OX8B 1FFOA 4YIQB 1JNNH 4LDOB 4LLQB 3BN3B 1MEXH 4HGWA 5HHMB 1OTTD 1KPUA 3P9WB 5I1LA 3A67L 1JNNL 4KK8D 1MEXL 4JRXB 3FB6A 3L3DA 2EDNA 4G8GB 1YEGL 2BVPB 1IAKB 5T5FH 5I15H 3KPRD 1CFTA 4NWTL 1JYNA 1HSAA 3MRBB 1B0WA 4CNIA 5BW7C 1TVHA 4KI5D 2IPUG 1C08B 3IDGA 2NY5L 1TETL 2HMIC 2RB8A 2AKRB 5ANMB 4OFPA 1EFXD 4GKNA 4FXGA 2UYLA 4A6YH 4HWEH 4HUVB 2PW2B 1CICC 5FDWA 4NQSA 4XNXL 5I1DB 1P4LA 2R0KH 2XIDA 4DOHE 1U91A 2VLRE 4HWEL 3FOMB 2KH2B 4A6YL 1JYWA 3VXMD 2R0KL 5IGXL 3UTZB 4CADA 1XT5A 2C1PB 4I4WA 4PRID 3UZQA 2E27H 2ZUUA 3O4LB 1U3HC 1U8JB 2FLRT 1CYGA 1KCUL 3TYFB 5D8JH 4AM0B 2CDFA 2A73A 3C5ZB 4NWUH 3C5JB 1F45A 4K94H 3EFDL 3E8UL 1E4KA 1AGEB 5T1MB 3KJ4C 1XGUB 3O9WB 4KRPD 2BMKA 1EX0A 4N1EA 1QFWI 4XX1G 5E0QA 2A38A 2W92A 4GKSB 4NN6C 4Y4HA 3RVWC 3VXUB 5TQ2H 1XZ0B 4NBZB 1IC7H 1NFDB 5E70A 1KTDA 4NQCD 5C70A 5ICYA 1JPTL 4X0KA 5GRUL 2FATH 2C3VB 4I13B 4HZLB 5KZCD 3NA9L 2GTZA 5D2LE 3TPKA 4ZFOA 1QHPA 5EU6E 3VXNA 4WU5B 1ODAA 3RWEB 2SEBA 3MRQB 1TDQA 4LVHB 3CDYA 2MQCA 3T1FB 5EOQH 3IDIA 3EZ8A 5FYKD 4CMMA 4MXQC 3OGCA 2AK4B 5EOQL 3K74B 4NZUL 4LBEA 1FVDB 5LQBH 5DUBB 4P5MB 2MKWA 4IDLA 1FVCB 1WZMA 2HN7B 4P2OC 3D9AL 3G5YB 5FXCH 5BVPH 4U1MB 1HSBB 1MQKL 4YPGA 1RURH 1J5OH 3SE3C 3QWOB 1RURL 3GMMA 1Q94B 1QLRA 4NUJB 4WI3A 1AGFB 4J6RL 4LF3B 3F65A 1Z9LA 2D4DA 1DBAH 3BGAA 3PV6A 1KG0A 2HMID 2VITB 3I6KA 2V2TA 3K81A 5JZ7C 1NBYB 3WS6C 5GGRY 2UUDK 3I6GB 4RGND 3DVGB 1CICD 1UEMA 5F1IA 3S96B 2F8XC 2X4NA 5DD6B 3LN5A 5ISZD 3STBA 4ZYKA 1S7RB 1F3RB 1VGEH 3QA3B 4JFZH 3HA0A 4K8RH 1S9YB 4FTVA 1DUYB 2FHFA 4M7KL 4EDWL 4JFZL 2BRRL 2EE2A 4K8RL 4OGAC 1E27B 4TUOB 2AVGA 5F70A 1B0GB 4FMFA 4JLRB 1MCBA 4PB9H 2OM5A 4JKMA 1AO7A 2RJMA 1UB5A 2BSTA 3MQIA 3PDGA 3OB0H 3QULA 4PB9L 3QIBC 5GZND 4AZ8A 2MHAB 1W0YT 3MLXH 4NO2B 1C5CH 3JWOC 2APXA 2YPLD 3C6SB 3PGDB 4NT6A 2JJUA 5DFTA 5F71A 4PJGE 3PGFH 1PKQB 4HDIA 4H8WH 2BXYA 5IR1B 4OLUH 2YD8A 3PGFL 5I1HH 1UC6A 1CTNA 4OLUL 3L1OH 1IBGL 2Y5EA 5KVDL 1K8IB 5DD3H 5C1MB 4I18A 5I1HL 1ORSB 5DD3L 5FEBA 5IK3B 3FB7B 5D7KE 3LKNB 3GIVA 1IEHA 1XF5B 4N8VG 5FOBB 1SHMA 3VRLF 3PWPA 4MXQD 2A77L 4YHLL 5BJTA 1JGLH 3T4AB 4QRRA 3MV7B 1TZGH 5DRXB 4Z7OE 4OF7A 2FX8H 3TCLB 5IMLA 3BZ4A 4CU7A 3DIFA 1DEEA 1D3CA 3RGVA 2FX8L 4PJFA 1V5JA 1J8HA 1KC5H 3MBEB 4J1UB 1MRFL 4Z7NF 1BMGA 3NTCH 1CGSH 1K8DA 2PYFA 4DVBB 1OL0A 4ZMAT 5DK0A 2H32A 4U1LA 1NCDH 3NCCB 1CGSL 5FO7A 2FIKB 1Y0LB 1T5WA 4EUPB 3PV7A 4JO1H 3IF1A 4Y1AA 5T3ZE 4KRLB 3T0VA 1NCDL 5JHDA 1FDLH 4DN4H 5D1XB 3AU1B 1FDLL 4DN4L 3MOBH 4H0IA 2H8PB 3SDCC 3UTOA 5DJAB 3DURB 5I8OL 2Z91B 1JMXA 3OAYH 5CP7A 3X3GH 4CN1A 1OT2A 3CMOH 3N9GH 3UYOD 3SBWA 2N7AA 2H6PB 3U36B 5INCA 1PDKA 1T3FB 3FB8B 1OF2A 1FGVL 3ULUH 4LK4A 1NC2B 3QDJA 3GSWB 4LCYB 5KANG 1BWMA 3IRZA 4R7DB 5JO5A 4JRYA 5HDBF 2JTDA 5ESAB 4D9LH 1NLBH 3PWVA 1AR2A 2ICEA 3L3JB 3QUYA 4Q9CA 1TJGH 4D9LL 1AC6A 1DBKH 5HI3D 1TJGL 3KPSE 3B6SB 2ZNWA 3DVNA 4NRZB 2E8ZA 1WSST 4L29B 3NAAH 3LRSB 1UZ8B 1YNKH 3ARUA 1VERA 2XG4A 2ZOLA 4TTGA 1QSFA 1KJ2H 2IQAA 3NAAL 2Z35A 1E6OH 3FO9B 1KJ2L 1ZTXH 5GRYA 5KBNC 1AFVL 4WFGE 2A9NL 4WWKD 4P23D 2EC8A 5FYJE 4N0UA 5D96B 4KDWA 1ZTXL 4G80B 2PXYD 4YAQB 1M7IA 1P1ZB 2Z93A 2Z31D 2APFA 4HIEB 5C07B 4MNQB 1GZPA 4KMQA 2FECI 4NQDE 1S7QA 3VFRB 4NC1E 5DHYA 3GHBH 2ICCA 2F5BL 3VFVB 3HFML 4Y5XA 5T1LA 4WUKL 3GHBL 3N1PC 3V6OE 2J2ZA 2FJHB 2WIIA 1HILA 5D7LE 2BX5A 4RSVA 2VXQH 4QRPA 5ERWB 2C3GA 3BQUB 4Q6IB 1RZGA 2EKSA 4WTZG 4K3DL 4Z7UB 2YD5A 1N5YH 2JJSC 5JQ6H 3IFOA 4S10A 3RUGB 2OI9B 2JJTA 3U0TA 2V6HA 4RFEB 5JQ6L 2IFGA 3MJ8B 2BNQE 1RZJH 5IQ7H 4NQED 4OD3H 5IHLB 3QP3A 2YKLH 1JK8A 1RZJL 5IQ7L 2EH8L 2X9WA 3RPIB 1KIPB 3PXHA 5C9KA 1KB5B 1FFPA 4OCSH 3SCMC 3H0TA 3H2WA 5A2JH 1QP1A 5D72L 2PETA 1X4XA 1ZGLM 2GY5A 1MFBH 1VA9A 4NQUA 1OPGL 5ELIA 4U49A 2XA8L 2X10A 1BD2B 3CLFH 2GUOB 1EFQA 1X3DA 4GXVH 4R8WH 5HHPA 4U0QB 2PO6A 3OAZK 3RVUC 3V52H 5HI5C 5EORL 4R9HA 4Z7VE 4D2NA 1FJ1B 4GXVL 4R8WL 1TQCB 2XG5A 4D0BA 3T0BA 1HHHB 2IAMC 3MRIB 2YBRA 5FGBA 4KHTH 3QQ9D 3KPRE 3OJMB 5F7EH 2LV4A 2VLKB 3QPQC 5FKAA 1A1NB 4KHTL 3S35X 5AZ2H 5MENA 3L6FB 5F7EL 3RVTC 3UO1H 2X89D 2UWEE 4Z7QF 5AZ2L 2EIDA 3DX9B 3IFPB 5F1KC 3P9LB 3T4YB 3UO1L 4L8BB 2DYPB 2P24B 3ARGD 1EXUB 4G9DA 1BZ7B 2X9YA 1X4YA 5GS1C 4NZTL 3L5WB 3OKNA 5F1NA 1NCAL 3N1GC 1D6EB 3DX7B 3DUHA 4PRIE 4YHIA 5DVNA 4QTHB 1IGYA 4I48A 1JF1B 1RZ8A 1WC7B 3JBG7 2BOBB 2XZAH 2R1WB 1JWMB 1AI1H 4DQOH 1A5FH 1ZLVH 4OF8A 1LP9B 1U8OA 2E6PA 4XX1E 1OTSD 1SJHB 4GUPA 1F58H 4DQOL 1A5FL 2QQNL 4OZGE 3MRNA 4LPCA 1CQYA 4GRLB 4YXLH 1DSFL 1P84J 1MAMH 5I2IA 1K4DA 5GGQH 1KLUB 1UQSB 5ADPL 3ZDZF 1VGKA 4F37K 4GLRI 1CLYH 4XCEA 5GGQL 3VD4A 1F11A 2ZSWA 4ODVH 2YUZA 3WE6B 3G5VA 4U33A 3MLVL 1CLYL 2AEIT 4LEOB 5D2LA 4WW2C 5EU6A 4HXAL 3O6FB 4LCWD 5GSVA 1LO4L 4KUZL 1J8KA 1AXIB 2IG2L 4HS8L 3WJLA 1S7WB 1PY4A 3VG9B 3DGCR 1DVFB 1FFOB 2XTJC 4D3CH 3ZDXE 2H41A 4PLOB 4AMKL 1KPUB 4P2QE 5I1LB 4D3CL 1G7LA 1I7TB 2ZG3A 3FB6B 3L3DB 3T0AA 4G6AC 4LPTA 2GW5A 4JFXA 1KSRA 4U6HA 3RVUD 1BBJB 5SWQA 2YR3A 1HSAB 4KJWC 3QZWB 4RAUA 2IAMD 1TVHB 4F57L 4FQXD 4YR6A 2HTKC 3RZCC 3HC0A 4P4KD 1FQ9C 2JJVA 4WU7A 2EDWA 3RVTD 5A43C 1F4YH 3P11H 1BAFL 4GKNB 1H3GA 4FXGB 2UYLB 2YD7A 1T4KA 4NQSB 5FDWB 1O5DT 1P4LB 2CK0L 1G6RB 4NO3B 5ESVA 3PHQA 1U91B 4PRBA 4U1GC 3TNNA 1JMZA 4KJQC 3UC0L 5H37G 4R4NC 4CADB 2BCKA 4I4WB 4RGNE 4NHCH 4QCIA 5F7LB 5A2LH 1WZKA 2CDFB 2A73B 4XWOD 3OZ9L 1RJCA 1AHWA 1WAAE 2AQ1A 1IGMH 1WJ3A 2FO4A 5DR5H 1A9BA 2DM4A 2P8PA 4JRWA 1IILE 3VWJA 5I71C 4YH6A 3DSFH 1NKOA 2ERJB 4H26A 5DZNA 4Y4HB 3RWIA 2FRGP 4LASH 3GJEA 4K07A 4XP4H 4IMKA 4WO4C 3FQXA 3O2WH 1KTDB 3LY6A 4LASL 4RMUA 1Q9KA 1N5AB 2N1KA 2NY2D 2YPLE 3P0GB 2N4IA 4WHTA 5ICYB 4X0KB 1MREH 1MHHA 4LNRA 3IKKA 2MCPH 4P3CL 3WNMA 4ZFOB 2GTZB 2SEBB 2MCPL 3VWKA 3HG1B 4PG2C 3S37X 2DI9A 3IDIB 4CMMB 3OGCB 5EZOL 2ICWI 5SWSE 4LBEB 3HZVA 2XTJD 4OZHE 5ITBH 3NCEB 3PL6C 4G7YL 1TTGA 1FNLA 3CLEL 1CLCA 5ITBL 1XR8B 1JJUA 1IQDA 4YPGB 3TVMD 5DC9B 4PTTA 2A1WL 5L6YH 5KAQF 2IGFH 3TBVA 3GMMB 4JPIA 2VERN 1GOGA 1QLRB 3F7PC 4MJ4A 3LS4H 5L6YL 1FNGA 4F15B 1Q8MA 4X9BA 5B3JF 2BJML 1U6AL 4ZTPH 3LS4L 2P4AB 3T1WA 1UWEL 3MACL 3PV6B 1KG0B 3OR7A 3I6KB 4XRCA 4ZTPL 2V2TB 5DJ0A 4PJFF 1QFWH 1ROWA 5F1IB 2X4NB 1QFWL 2FCBA 4KJQD 2QQQA 3QQNA 1YNTB 4ZTOH 4ZYKB 4K71B 1MF2L 2FR4A 2EKJA 4KKBD 5GPRA 5BOZG 5DRNA 4FTVB 1GC1C 4HJ0C 3U4EB 2QADD 1OGAD 5DO2C 4X6DE 4RCAA 1AO7B 1UB5B 3MOAL 4PLKC 5F89A 2BSTB 1ZLUH 7FABH 4H20L 4I0CC 5BMFL 4I9WD 2FH6A 4CMHC 4M93C 4X4YB 7FABL 2VDNH 1NC4A 2DQJH 1H3TA 4CGTA 1JRHH 3VGEA 4NT6B 2HJLA 3BGMB 4HDIB 2E5EA 1S9WA 43CAB 5HHQA 3H6JA 4F9LC 2NZ9C 3E6FA 1R0AH 5DZOA 4Y2DA 3ZHKA 2EEAA 5C6TL 5JIIA 1R0AL 4GBXC 1ZT1A 2OBGA 5HYEA 5AG9A 3PWPB 3AS0A 3G6JE 4HK3J 5CKAA 2O93L 2F5AL 3VXTA 4ZXBA 1BFTA 5BJTB 3RY6C 2VDLL 4QRRB 2DQDL 3BGFC 1MCSA 2CMRL 5D70L 1GH7A 5IMLB 3BZ4B 1GIGL 1DEEB 3DIFB 4MD0A 2B5IC 3RGVB 4PJFB 2Y7QA 1J8HB 3P9MA 3OHXA 1KTRL 1RUML 4JCMA 1EO8L 1T7VA 5HHOE 1T0NA 3K4DA 4TNVF 4NJAH 4UIKL 1K8DB 2PYFB 3T0EE 3HE7C 5DK0B 1F6AA 2H32B 4U1LB 5FO7B 4O4YH 2QKIB 5FO8A 3KR3H 5D7LA 1T5WB 1BZQK 1YY9D 2JCCA 4Y1AB 3RNQB 4LGSB 4PIRF 5JHDB 4XI5D 1TTFA 1IM9D 1CXLA 3T77A 2YOCA 3UPAA 2NY5C 1YYMH 4MA1B 1YEHH 5M95B 3FL7A 3MLSH 3WIHA 4BQBA 4DUVA 4HGKC 3FTGA 4KV5F 2V7NA 1FRGH 1TZHB 3CNKA 4XVTH 5FM5O 1N6VA 2BNQA 5CP7B 5JW4N 4JREB 5I17A 4G6MH 4HJ0D 4XVTL 5JDJA 1FO0L 3KYOA 2BK8A 4NQEE 5J12B 4G6ML 1OF2B 2VKWA 3BKCH 4GQ9H 3VFGL 4PLKD 3BISA 3CZJA 2R29H 3QDJB 4FQIH 4JQXC 1I9IH 1HXMA 2R29L 5JMRA 5JO5B 4JRYB 1N64L 1I8IA 1QEWB 3PWVB 4PYGA 2ICEB 3QUYB 2A2QT 4M1GH 4CUCA 3LKRA 4JPKH 4Z7VA 5C6WH 3QXUA 1ZHKA 2OJZH 1LDPL 4FABL 4HKZA 3DVNB 4JPKL 4ZS6D 5IUSA 1ACYL 4OGXL 3MRPA 1KGCE 2FBJH 4R2GB 3KPRA 4LDEB 4X7DC 1EHNA 2OJZL 1JF5A 2FBJL 2YUWA 1CLOH 1QSFB 5FYKU 2IQAB 4GBXD 4N0RA 1HZHH 4HMDA 4BSVA 2HFGH 4PBVC 5GGVH 1DR9A 2YN3A 1RJZA 4N0UB 4BQ6A 1URLA 1EFXA 2CK2A 1M7IB 1IC4H 1NMAL 2Z93B 4KFZC 3OKDB 5K93A 3P4MA 1GZPB 2LTQB 3MGOB 1IC4L 5TE7L 2Q76A 1S7QB 4PRIA 4NUGH 3C6LA 4S1RH 4Y5XB 3KGRA 1R24A 5EZLA 1CLZL 3TJHD 1HILB 3HE7D 1L7TH 4QRPB 1MFDH 1RZGB 3FN0H 5DQ9A 4XVJL 5DJXA 2WBJC 3T3ME 4OZGA 5EA0H 1L7TL 2NY1B 3U7YH 4Q97A 3O4OB 1MFDL 3FN0L 3RI5K 2CUHA 3P77A 4U1JA 4Y5YC 3U7YL 1SY6H 1B2WH 1CGVA 3HC4H 3U0TB 2DLFL 5CIPA 1E28A 4R7NA 1B2WL 1S7XA 4FQHA 1NANH 3U82B 5HGBA 4EOWH 1JK8B 4OLVL 5L7XL 4NQCA 5EWIL 1R6VA 5DT1H 2EDTA 3ORJA 1AJ7H 1QACA 2ARWA 3K3QA 2A6IB 2Y6SC 1BQLH 1FFPB 5B8CB 2YMXL 2PN5A 1NAMA 3H0TB 4RFNB 1BQLL 4YHMH 5I74C 4LCWE 1JBJA 5B38G 4K8RC 1U3YA 2WINA 1SM3L 4UT7L 5GGTL 3RWGA 5BS0E 4YHML 4LSTL 4P2QA 3BMWA 5HHPB 2PO6B 4Z5RA 1T7YA 4MDIA 4D0BB 1F4XL 5CGTA 3GMLA 1JPSH 2YBRB 3QAZB 3FZUD 1JPSL 5FKAB 1F2QA 3QRGH 4ACPA 2V9TA 2FECL 5MENB 5GRZA 2AJZA 4U6TA 4JFOA 2YZ8A 4G6FB 4AG4L 3BRDA 1JPGA 1XGPA 1LILA 1RJYA 2R23A 3G6DL 4GFTB 4G9DB 3VFNA 4H88H 4RWYL 4DOHB 2OS7A 1G7IA 5LG1A 5C8JA 4DK6A 2NXYB 2LABA 1CICA 3OKNB 5F1NB 3KPPB 3QNZA 5F7KC 4YHIB 3Q1SL 1IGYB 5ISZA 2VQUA 4I48B 1RZ8B 4FQLL 4PREA 3SKNA 5IB5A 1SBSH 1WAAA 4X4XA 3QG6B 4OKDA 1U8OB 2P8MA 1SBSL 4GUPB 1U0QA 4JPVH 3MRNB 4CW1A 2F53D 5HYSG 1A7PH 2WBJD 4OQ1A 4JPVL 3BP5A 2MOVA 4XPGH 4S0SD 5EIVA 1XGYH 2V9QA 3BD3A 1K4DB 4M43H 5I2IB 5IV2A 5AYUH 1JWSB 1VGKB 5TDOA 2YPLA 1XGYL 5KS9F 2WMPA 3G5ZA 4XCEB 4Y16B 2AK1L 3TM6A 3EIFA 1F11B 2ZSWB 3WO4C 3G5VB 2Z8VC 1XH3A 1CVSC 1ND0A 1YMHA 5D2LB 5EU6B 1FNHA 4G7VH 5GSVB 2IPKA 4HIXH 4G7VL 1QLEH 2FJGA 3VXSD 4F9PC 4PJ7F 2Q87A 4KTDH 4HIXL 3CC5B 1QLEL 4K8RD 2HT2D 3K2UH 2ZP0T 3B9KC 4OZHA 1G7LB 4G5ZH 5GGSA 3SDDC 4JFXB 3UTQA 4XCNA 1M71A 4U6HB 5JUEH 5HVFB 5SWQB 4IRSD 2DBLH 4XB7A 4RAUB 1S7TA 5CGMA 4NQXA 1LK3H 4YR6B 1S9XA 3HC0B 4N1HB 5MP6L 1LK3L 1CFQB 2V7HA 5EN2A 5IB3A 1CD9B 4WU7B 5E8PA 3AMLA 1JZ7A 4DZBA 4Y5VC 1LQSR 5ESVB 3PHQB 4PRBB 3TNNB 4W6WB 2O5XH 5F6IB 2WUBH 1A6PA 4ELMF 3ES6A 1ITCA 4LARH 3EJZC 1TZIA 2BCKB 1LEKA 1YJDH 3WS6A 4R4FL 3ZYJA 1MCOH 5EB9A 4GLRH 3WNLA 1MCOL 3X17A 1A8JH 4PGZA 1A9BB 4D8PA 4X6DA 5KS9B 1OGAE 3ZKXB 3ZO0A 2P8PB 1UM5L 4UTAH 3VWJB 3W2DH 4DEPB 5EUKB 5A3IC 5ADOH 4OT1H 4H26B 1X7QA 3RWIB 4YHOH 3GJEB 4NNYA 3W0WD 4I9WE 1L9MA 5ADOL 5BZWA 3FQXB 3QRFM 3T09A 4PJ7B 1AGBA 2VXSH 4TUKL 2PCPA 3GHEH 4QWWC 5DMIL 4WHTB 5GIRB 1MHHB 1UH4A 4LNRB 1ETZA 3GHEL 4M1CD 4HK0A 3TZVC 4O58H 1CF8L 1HHJB 3VWKB 1QSVA 1OAXL 3D1MC 3NACH 1D5ZA 3KXFE 1RZ7H 5FB8A 5I18H 1RZJC 3NACL 5I19H 4LPXA 3HZVB 5GJSL 1RZ7L 3W39B 4HCRH 5I19L 4POUB 2CUIA 5GRJH 3MX0A 1OARH 3IFNH 4WWKA 4P23A 1IQDB 5D71H 3QO0A 5GRJL 5IMOA 4PTTB 2JB5H 1OARL 1A6AA 2OJEA 3O6KH 2PXYA 1NH6A 1NUFA 2VZVA 2FEEI 5D71L 3VXQA 2Z31A 3TBVB 4JPIB 5HHOA 3KJ6H 3D69A 4PJHE 1FNGB 2K7QA 2WP3T 3QIUC 3WL9A 4DGYH 3T0EA 4GKZB 1E4JA 2IALA 4DGYL 1TVBA 4KU1A 3TO4A 3OR7B 4XRCB 5GGSY 3RNKA 5DJ0B 5AEAA 3BX7C 4QXTA 5I9QC 4HUNB 2DM2A 4JKKA 4J3SA 1ACZA 4OLZH 4DVRH 3DGGA 4S1DC 2L0DA 2MWCA 4KJPC 1XGQA 4DK3A 2XT1B 1H9VA 3VE0A 4QYOA 4OZ4A 4HBQA 1FPTL 3ZTNH 2JCCF 3T3PF 3OMZA 4LLWB 4NQEA 1G7MA 1UJ3C 4MVBC 5F89B 2AABH 3KYNA 4OF5A 5D5MA 2EZ0D 4PTUB 3U30C 3CU7A 4R26H 4X6BA 4OUUA 3CD4A 4R26L 3L3OA 3X11A 3V6ZA 2HJLB 3OXRA 2DJ4A 2ED9A 3H42H 4I0PC 1S9WB 4GSDL 5HHQB 4KZEH 3OR6A 1U8LA 1WBYA 4UQ2A 3H42L 4QWWD 3PJSA 4EZMA 4KZEL 3E6FB 3E2HB 5J06A 4Y2DB 3TZVD 2NY3D 4TQEH 2FBOJ 3GRWH 1I1AD 2AJ3A 4LDLB 3O3AA 4ZNCD 2VYRE 1ZT1B 2B1AH 3GRWL 3BRFA 1YC7A 4PV9A 4Z8FH 2B1AL 3ARPA 1MPAL 3TBSA 4ZXBB 1BZ9A 3ZKMC 4Z8FL 4R0LC 3LHPH 3REWB 3MCKA 3K80A 3ARGA 5C0AD 3AAZA 4MD0B 5GZOD 2Y7QB 3P9MB 3OHXB 1A6TA 1XMWA 4KI5F 3T0WA 2A0LC 2ZWLT 43C9A 1F6AB 1QQDB 4HC1A 3JSSA 5FO8B 4HWBA 1I1CA 2AW2A 5D7LB 3GO1H 2JCCB 2HLAA 1H0DA 2QV2A 4HMCA 1X5XA 3T77B 2VXTH 1KIQA 2DQCL 4S1SH 3MV8D 4OQTA 2AJSH 4FQ2L 1NPUA 5HPMA 4S1DD 3FTGB 4X9IA 1FORL 2Q7NA 1G7JA 2V7NB 4PJEA 3S7GA 4MNHA 4EQ3A 1QYGH 2PUQT 2BNQB 2H1PL 3IXTA 5I17B 1MJ8L 3MJ7A 1G6RH 32C2A 4IRJC 4M48L 4M61A 4MA7H 3KYOB 2OMBA 1PLGH 2GSIA 1UACL 4G3YL 4MA7L 4UV4L 4KVNL 5HY9A 3V4VH 2X1QA 3BVNA 2FJFA 4MVBD 4XPAH 4LCWA 1XGRB 3HB3C 1HXMB 5GRWA 5BS0A 4KK9C 1I8IB 1ZT7A 3CDCA 3BUYA 4LLVA 1WBZA 3LKRB 4Z7VB 5ACLA 4PBXA 1LEIA 1ZHKB 12E8H 1FFQA 2R56H 4HKZB 4OFDA 1B0RA 2LU4A 3KPRB 1NBVH 12E8L 3ZDXF 2Z0BA 2NW2A 5F97E 3ZMRA 2APTA 2IAMA 2DI7A 4FQXA 1X4ZA 3V4UH 3L7FB 2J88H 4O2FA 4P4KA 5EU7E 4BSVB 3V4UL 2G60L 1RJZB 5MERB 4OLYH 1EFXB 2DLIA 2X05A 5DMGC 1FAKT 4KK6C 3P4MB 3PABB 4OLYL 1A3QA 3MRLA 2FNBA 4IJ3B 4AIXA 3VXMB 2Q76B 3M45A 1R5VA 3QFJD 3VFSA 4PRIB 3ULVE 4YC2B 1QVOA 2CIKA 5BV7L 1LWRA 3O2DA 2A0LD 1R24B 5EZLB 1UKTA 2NYYD 3U9UB 5DQ9B 5E00B 5DJXB 4OZGB 3HR5A 4P46C 4KRPB 5E9DE 4ZODA 1MWAA 2VZ3A 3CPLA 4U1JB 1HYSC 1F4AA 3ZDYE 1QR1A 2F53E 3SE4C 1FIEA 3KPNA 4XTRD 3MC0A 3FONA 4LPUA 1E28B 2XQBH 3IAPA 4G8IA 2V5SA 4R7NB 1S7XB 4FQHB 3FHQA 4Q6YA 5HGBB 3WFEL 3DETC 4PJAE 4NQCB 1NGXB 3WFCL 9CGTA 3MJ9A 5DQJA 4ZSOE 1QFUH 4NRXA 5KZCB 1NAMB 1HWGB 2J8UE 3PP3K 4XC3L 1Z0MA 1QFUL 3OB8A 4NZDA 2WINB 4WW2A 2MMXA 3RWGB 1XIWD 2FIRT 1UENA 1JTOA 1C5BH 3HB3D 3VXSE 2BHZA 4UDUA 4Z5RB 4JFHE 4MDIB 5IF0A 3ISWA 2P46B 3GMLB 5HI4C 3THMH 5ACZA 4NP4H 4O9HH 3LIZH 3PWNA 4YO0A 3TVMA 3THML 1LE9A 1ZGLB 1RY7B 4O9HL 3LIZL 1FFNB 2AJZB 3I3EA 2GY7B 2J8HA 4JFOB 2DMBA 3N1QC 5FHAL 4YWGH 1JPGB 1HHKA 5E2TH 1XGPB 2R23B 4XMKH 3LD8B 5I1CH 4N9OB 2AEPH 1D6VH 2MKLC 3VFNB 4O5LH 5CCKL 5E2TL 3EO0A 5I1CL 2BY3A 4OD1L 1G7IB 1D5BA 1UCBH 1X6NA 5C8JB 5FV1L 5DVMA 2ED8A 4RGNB 1CICB 1UCBL 2R4RH 3NCYS 4KK6D 3QNZB 2R0WL 3VMPA 2AS5M 4WUUD 1YEKH 2R4RL 2ZUVA 5T33H 5ISZB 4ONGH 2X42A 4PREB 3SKNB 1MH5A 1YEKL 4GAJH 4MZ3A 5T33L 1AC0A 1T83A 4X4XB 3G04A 4GAJL 4IHOA 1LD9A 1OGAA 4DJMA 4DAGL 1PG7L 3K4AA 2ZCKH 5CBAA 4CW1B 5FM5M 1ZMYA 3BP5B 2JK5A 4P46D 2Q86A 4RRPA 4ALAL 4KWUA 5E4EC 3H7BA 5IV2B 2QHRL 3O8XC 2Q6WA 2GEEA 5TDOB 2YPLB 3G5ZB 4OFYD 1KTKE 3VXOB 4QT5A 2EDEA 4P99A 1F42A 1ND0B 3QUKB 2OTWA 2IPKB 1TENA 1F97A 1RV6X 4QO1A 3C5SA 1RU9H 2FJGB 2VLJE 5CSBA 5D1ZD 5D4QA 1FV1A 1RU9L 2DLTA 3TA3D 4LMQI 5E2JA 4LEXH 1GYAA 3RIFK 2H45A 5GGSB 1DN2A 3SGDI 5EUOA 1B4RA 4LEXL 3SN6N 3UTQB 3STLA 4XCNB 1M71B 4XPHH 1X5IA 1T6WA 1QLFA 2F54D 2X1XR 5DD0H 1S7TB 2ESVE 4KVCH 4NQXB 1CE1H 3QUML 5DJCA 2DN7A 1S9XB 4HUMB 2RFXA 5T5NG 3U7WH 3ULUE 2ZG2A 2F15A 5LCVH 5IB3B 1UVQA 2ZPKH 4XVUC 3SKMA 5E8PB 5JW4M 3BKJH 4DZBB 1J12A 5IQ9A 5HVHB 3NIDF 1OSZA 3KNBA 1DLHB 4K3JL 4PS4L 2P5ED 1H15A 4E5XA 3ES6B 1X5KA 1TZIB 1IM9A 1KEGH 1LEKB 3HNTH 2WNGA 4FQJL 1TQBB 1KEGL 2IAND 3O0RH 1GOFA 3HNTL 4Z0BH 5IOPA 3ZTJG 2ZKHH 4LOUC 2WLZA 4PJDE 4X6DB 1MJ7H 2XV6B 3HCVA 2QLVB 2IQ9H 3IGAB 5EU5B 1MJ7L 1T1ZA 3S36L 5K9OB 1H3PH 1X7QB 2IQ9L 1BQUA 2BVEA 4NNYB 4MJID 5TF1H 5BZWB 5IG7A 4PJ9C 1AGBB 4ESKA 2PCPB 4A2MA 5C0CD 5TF1L 1I7ZB 3NFSH 4AEIH 2JIXB 3P0YH 1KT2A 1IM3A 3UZEA 1ETZB 2EYRB 3NFSL 4HK0B 5D5MF 5CGYC 5A16B 4NKOA 5E6IC 5BRZB 1D5ZB 2R2EA 4F9LA 4PLJD 4YJZL 1XFPA 4UT6L 4BSJA 3AS1A 1DQTA 4KGLA 4YUEL 4P9ML 1V3LA 2E9JA 1NGPH 2XZQL 4GBXA 4TPRL 1W72B 2NLJA 3BO8B 4H25A 1NGPL 1BJ8A 1A0QH 2L7JA 4P23B 3QO0B 5IMOB 2OJEB 1A2YA 1A0QL 2PXYB 5J1SC 3VXQB 2Z31B 4IM8A 4YBLC 3D69B 4DFIA 1MVUB 2EICA 4EUPG 1WCBA 3WL9B 4N9GA 4JFED 3UX9B 1L7IL 4HULB 5GS0H 3I50H 5IP4A 1TVBB 4C4KO 3RNKB 2V2WA 4QXTB 4K23L 3HE7A 4QLRA 3V79C 4KKNA 1EGJH 1MCWW 3DGGB 4V1DE 4RX4D 1XGQB 1EGJL 1J10A 3QUZC 3VE0B 4QYOB 4TUJA 3V7MA 2AV1A 4HT1H 4OZ4B 5L8LB 3X13A 3RKDC 3NIGF 1PKOA 4NJ9H 4XNZB 1BOGA 3L3GA 4GRWF 4LOUD 3ARED 4KY1H 4MJ2A 2GJ6D 4NQEB 1G7MB 5FGCE 1PYWA 4A6YA 4Y2OA 3KYNB 4X83A 4LFHG 5D5MB 3KLHC 2ZUSA 4YGAB 3QHZL 3QPXH 2W0LA 4PJEF 4X6BB 4OUUB 1DZBA 1NSNL 3B4NA 3L3OB 4EI5C 2Y5TA 4LU5L 2DAVA 1U8KA 2KBGA 2FLBT 2J5LC 1TLKA 3OR6B 2CPCA 1U8LB 1WBYB 4UQ2B 5CLTA 4C55A 4LSQH 4EEEA 3PJSB 5EBGA 4KKAC 4YDJA 1I3VA 1FBIH 4X7EC 3DJ9A 2E8YA 4LSQL 4NIKB 2IFFL 2AJ3B 1FBIL 3C8KA 3SDAC 1NAKH 2FEEL 5ALCH 4W70A 1FZMA 4I77L 4PG9A 1E4XI 5E6ID 3VDAA 2P8LA 4PV9B 1NAKL 4DKEH 5ALCL 2W65A 2BY2A 2A6KA 3TBSB 5GRVK 3BN9C 1OAYH 1BZ9B 3OPZH 2V5TA 4X4ME 3MCKB 3MRCA 4OM0L 3ARGB 3OPZL 3AAZB 1H8SA 1UFUA 4M6ML 1A6TB 3P4NA 1AIFA 5C92A 5B3NA 5D7JD 3SJVD 4G42A 1ZT4A 3LH2H 4RNRA 1DANT 3CK0H 5DQDH 3SGKA 4UILL 2XICA 15C8L 3HUJF 1G9MC 2H9GA 3RWCA 3CK0L 2AXHA 4H5SA 1FCGA 1KIQB 4YDIH 3EZJB 3GNMH 4Q0XL 5DK2B 3SGEI 4P2RE 2F53A 2X6MA 2WBJA 1G7JB 2BXZA 4PJEB 4NN5B 5EU3A 4MNHB 1UA6L 3FRPA 4LSPL 2RCSH 4QNPE 1SVZA 1H8OA 1DL7H 32C2B 4M61B 4PJAA 2GSIB 3KPOA 2CD0A 3PWLA 3GM0A 5LGKA 4JANA 3CFKA 4ZSOA 4M4RA 5HY9B 4KK5D 3QCVH 3QHFH 3BVNB 2FJFB 2J8UA 4HS3A 3MLRL 4LCWB 3O6MH 2J6EH 3F58H 3VXSA 3O6ML 3Q0HA 1IGTA 2J6EL 1ZT7B 1TVDA 4PD4K 4I3RL 2BFVL 2XN9D 3BUYB 4LLVB 2HT3C 1WBZB 5DFVC 1LEIB 4PB0H 1I75A 1EV2E 3U1SH 3E1F1 1B0RB 5JOPD 1L0YA 4HIHB 4WW2F 4IRSA 4NSKB 1YECL 3U1SL 2NW2B 3CFEB 3HZKA 2IAMB 3SDAD 1D5IH 2FX9H 4FQXB 4OZFH 3GSNH 3IJHB 3QXWA 3OKKA 2FGZA 1RVFH 4O2FB 2FX9L 4P4KB 5EO9A 2NX5D 1RVFL 3BN9D 4AEHH 1Y18A 4NQVA 1V3JA 4N0CD 2XYCA 2VDMH 3AS2A 3MRLB 2C1OA 4OTXH 1R5VB 3VFSB 3QUXC 4N5UA 1QVOB 1M05B 3R8QA 3WXVL 2CIKB 1T5XA 4NM4H 4Y19E 5CEZE 4RFOH 1HDMA 4NM4L 4WI5A 2B2XL 4N1CA 3ARDC 1GPOH 1R5WA 3V0WH 3HR5B 3KPLA 2B1HH 4KKLD 4JAMA 3UJTH 5E99H 1GPOL 3CPLB 3LQAH 4PRDA 3V0WL 3ALPA 2B1HL 1ADQL 1SEQH 5DJYA 3UDWC 1QR1B 4KTEL 3MUGA 3KPNB 3FONB 3F5WA 1SEQL 4G8IB 1X5JA 2V5RA 2J12B 4OF0A 3W0WA 2W9DL 5CEYA 3HMXH 4PJIF 2ZUYA 1Q9LA 4JO3H 2NY2B 1HIML 1DFBH 5DQJB 4JO3L 1JPFA 4NRXB 5J1AA 1BVLA 4KUCF 4H0HB 2CKBL 2JB6A 1QPPA 1CDYA 4WW2B 2VLJA 1AH1A 5JNYA 1CDUA 3QDGD 3QCUH 3HE6C 5DRZB 5KSBE 4JFQA 4TOYH 3QCUL 2W38A 4OLEA 2AXFB 4UDUB 4D9QD 1EPFA 2XTJB 3P40A 4HIIA 4PY7A 5IF0B 3L7EA 4YDLC 4OCXH 5MI0C 4MNQD 3QNYA 1A22B 5ACZB 2ITDA 5J89A 1RQ5A 1U8MA 2DI8A 3PWNB 3NMEA 4YO0B 3TVMB 4DZ8A 4P5TC 1LE9B 2F54E 3D39D 1IAOB 1YYLL 2VXVH 1JFQL 4OI8A 2ENYA 5EUOF 1HHKB 3UXFA 2VXVL 3ARRA 1MUJA 1X5HA 3EO0B 1U58B 3FCTA 1A1MB 4QHUA 4UQ3A 1Q9OA 1D5BB 3NCFB 1J0IA 4JFDD 2FD6H 2B4CL 5JLZA 5TFSH 3S88L 4MS8D 2FD6L 1VCAA 1BGXH 5TFSL 4WFFD 5IFHH 3DVIA 1MH5B 3EYOA 1KJ2A 5IFHL 1M7XA 3VDCA 1JGVH 4PJDA 3FQRA 4XZUA 2QADB 1KNOA 4IHOB 1LD9B 1OGAB 4WHCA 1BPVA 3RBGA 1DDHA 3UAJC 2AI0H 3MV01 2Q86B 1QZ1A 4RISH 1HQRA 3H7BB 2NR6C 5CBEA 2OK0H 3GSXB 5DC4B 5KW9L 4RISL 2Q6WB 4D0CA 2O5ZL 3R0MA 4GW1A 4MJIE 4IOSD 3NN8B 3JWNC 1DLFH 4AH2A 2EDDA 1NBZA 2Z8WC 4OF3A 3N1FC 4QT5B 1XR9A 3NGBB 4JRXE 4WO4B 5C0CE 5AAWA 3C60C 5E6YA 2NY0C 1XGTA 3IVKA 1VFAB 4M1DH 4YEFA 3UBXI 3MFFA 1IAIL 1KCLA 4M62H 3MREB 4YK4B 4ZNEE 3C5SB 1BLNA 3TZVA 3EYUL 1I1AA 4X7TA 3WLBA 5HDQL 1TNMA 1FV1B 2AJXL 5F9JA 3ZZ1A 4MAUH 1G9NC 1T66C 5ANME 4BKLA 5EUOB 1NFKA 3V0VA 1QBLH 5T1KD 5FA4A 2OLDA 2YN5A 2C4XA 3E0GA 1EEQA 3O4LE 5DJCB 3EYQC 4IOFD 3FFCD 4K7FA 2RFXB 1YMMB 2R15A 5J3HC 2A74A 4HWNA 3SKMB 4XAWL 1FC2D 2VMFA 2BNRD 5J0BA 4LIQH 2EH7H 2XY1A 5SWZD 5IQ9B 1OSZB 3KNBB 3Q2CA 5FK9A 4ZQKA 4LIQL 1HOCA 3RU8L 4QRTA 4B41A 1EEZA 1H15B 4E5XB 1G7PA 5CZXC 1IM9B 2A6DA 2ZUQC 4FN0A 1Z5LB 2Q8AL 4R97C 1O7SA 3MV8A 5IOPB 4XPTL 2W0KA 1I8LC 5JOFA 4Q9BA 1R5IA 4R90H 4EI6A 3HCVB 2GJ6E 4XVSL 3DO3A 3VGFA 2VN4A 2VZTA 5BV7C 1HH9B 1DVFD 1C8PA 3WSQH 4XPBH 1ZLSL 3UAJD 1UJ3A 4PBWD 3BESR 3WSQL 5IG7B 3OJDA 2AK4E 3KLDA 1TITA 4M93B 1KT2B 1WT5C 1IM3B 2MTPA 3ARFD 3CDGA 3NVQA 3I85A 2DICA 5I76A 2NY0D 3L9RB 4NKOB 1WICA 2R2EB 2RGSA 3EOAA 3LRGA 1JYXA 3BEWA 2R4SH 4M5YH 4ORGA 2N7BA 4YXKH 1JGDB 4M5YL 3MJ6A 1ES0A 4GBXB 1LHZA 5F96H 3LS5H 2NLJB 3VI3F 5J13B 2D0FA 4H25B 4YXKL 4X4MA 1PG7X 3LS5L 3V6FA 1NAMH 4YX2H 1A2YB 3BGFB 4J7RA 4FNLH 4GQPH 5DS8A 4QXGL 2ADFH 4YX2L 4WGVB 3JTSA 2B5IB 1MLBA 1WCBB 2VDRL 3EYQD 4QEGA 4N9GB 5DDHA 4F33A 3QFJA 3STZA 1MFAH 3SJVE 1RIVL 1EUUA 3D2UA 1MFAL 3DRQA 5HD8C 3C9NA 3HE7B 3MNVB 3CVHH 2NY4C 3MGAA 2DQEH 1LO5A 5CZXD 1EAPA 3GEWB 4HBCL 3F7YA 3BWAA 4YDKL 1RJLA 1BOGB 1PKQE 2OR8A 1N4XH 1NCBH 4GG6F 3UJJL 3FOLA 4WGWB 3V4PH 3HG1D 1PYWB 1S5IH 4A6YB 4ODBD 5MEOA 2WANA 4RGMC 3MA7A 1EBPA 4B53A 2CR3A 3JTTA 2AP2A 3EHBC 3L5XH 5DJDA 2BVYA 2Y5TB 5CHNA 3MZTA 1U8KB 1XIWA 1MRCH 4WIQA 1OY3B 2R0ZH 5I1JH 2Y06H 2HAZA 3MV7E 4N5ED 4GG8A 3VDBA 2QQLH 2XN9E 2R0ZL 4YDJB 2Y06L 4LLUA 2Y36L 4PGBA 4O00A 4LVNC 4LSSL 1FZMB 4PG9B 3MCLH 3A6OA 4L8DA 1ZANH 3RX5A 2W65B 2A6KB 1CTOA 4TVPH 5HHXH 4E41D 4JFPA 3E3QE 3MRCB 4G8FA 4QGYA 1MVFA 4B5EA 1PSKH 1RUAH 2HVKA 3S36X 5IW3A 1P2CA 1NGWA 4U7SA 2Y07H 3P4NB 1AIFB 3FO0L 5CJXA 1RUAL 2IMNA 3IRPX 3VFWA 1QSED 2Y07L 1KLGA 4J3OC 1NDMB 1RUPH 3QIWD 1T0MA 1ZT4B 4WUUA 4RNRB 2K3TA 4KTYA 1CXIA 2DJSA 5GHWH 3CSGA 3QYCA 4YFDB 4RAVA 2H9GB 3RWCB 3K4ZA 4H5SB 4XCCL 2LU7A 3U0WH 2XZCH 3D85D 1MFEL 2F53B 1JNHB 2WBJB 3V5DA 4P46A 5EU3B 1YEDB 4YHNB 1IQWL 1Z9MA 1X5AA 4HGMA 5CFHA 1UYWL 2NZIA 2AV7A 2BSRA 4YFEA 3VRLE 4MAYD 5IVNA 4JO4L 3WIFA 2IC2A 4LGPB 3KPOB 3PWLB 5F1OB 4JANB 3CFKB 4ZSOB 2DD8H 1F8TH 3D5OF 2J8UB 4HS3B 2DD8L 1E4XH 4Q9RH 4FOMA 1F8TL 4MWFA 3MLWL 2XTLA 5C0GA 3VXSB 3QWQB 5KSBA 2YD9A 2Z92A 2IBGA 1IGTB 3KHOA 5I74B 5D1ZA 4WHYG 1HHIA 5DK3A 1OD7A 2YPVH 6CGTA 5GXBB 3TA3A 3ARBC 1MQ8A 1JZ8A 1F3DJ 3NBNA 1LO0H 1OQOA 5EOCJ 2AQ2A 4D9QE 5HSFA 2ZUXA 4ZUVB 4PJXA 1LO0L 3QDMD 5C07E 4MNQE 2W9EL 1NUNB 1Y6NR 2F54A 5CMAA 5IVXF 4LNVA 1N0XH 3HZKB 5TGBA 3RX7A 3OKKB 1FH5H 3ZKNC 1QUNA 3JWOH 43CAA 3OGOE 5EO9B 1FH5L 1BVZA 2LQRA 4R4BA 3JWOL 4Q9QL 3BPCA 2HWZL 4ZUTA 1Y18B 3CSBA 4JCLA 4NQVB 3LRHA 3SKOA 3GM8A 1AD0A 3SGEH 5TE4L 2P5EA 4JDVA 1R3JA 5FDYA 3GMNB 1ZSDA 1L6XA 4UBDD 5L2KD 1T5XB 4FFVC 1LO2H 5CJBA 5ALBH 1W72H 1IT9L 2APBA 1HDMB 5JW4R 5AZEH 5IW6A 5DD5H 4HJGA 3QJHA 5HDBE 3DUSB 1R5WB 3WO3B 3KPLB 4JAMB 2FO1A 4IDJH 5FKPA 5I1EH 2FX7H 5GRVL 5DJYB 3KG5A 4IDJL 5I1EL 3EDJA 3QQ4A 3AB0C 2FX7L 3F5WB 3JUZA 4YIQA 4CL7A 3C8HA 4AIZA 3W0WB 4MJIA 1BD2E 5CEYB 4F8QA 4JRXA 5C0CA 4NKDA 2BVPA 1A6VL 3QEQB 1JPFB 5HHNA 3U83A 1YEEH 5J1AB 5JXAH 3MRBA 1BVLB 5DEGA 4ZS7H 3P2TA 4QTIH 4ZNEA 3BJ91 2NY7H 3MA9L 1YEEL 5D2NE 5DLML 4ZS7L 2VLKE 3RVXD 1T89C 5JNYB 4QTIL 2W59A 2NY7L 2RBLA 5IVXB 4XBEH 3QEUA 3LEXA 3HAEH 5C0NC 1PX4A 2BERA 4UMGA 1NMCC 4JFQB 1L9NA 4L8CB 4XBEL 3TFKC 2B7DT 1AR1C 4PY7B 4ZUSA 5EBWA 1CG9A 4I2XE 3H9YA 2IJ0C 3FOMA 1Q72H 2AJUH 3QB7C 3T2NH 2ITDB 1U8MB 2C1PA 3ZYIA 4DZ8B 2J8OA 3T2NL 2NY6D 2EE9A 2CRYA 3FO2A 3K46A 4BZ2L 4JFEA 1MUJB 3ESUF 3T0XA 3CFCL 1TIUA 3FCTB 3EJYC 4QHUB 4OV6F 1Q9OB 5SWZE 5CD5C 3PIQA 5JQHC 2I5YH 1G7HA 3NCYP 1D9KC 1R3KB 4RX4A 1A7RH 1HH6A 5AYQA 1V3KA 5T1DL 2M2DA 4CVUA 3EYOB 4NFBA 1KJ2B 3TCXA 1AE6L 4OLXL 5KSVA 1A4JA 4GMSH 4PJDB 5C3LD 3FQRB 4XZUB 4MNGE 4GMSL 4Q7DA 3WLWD 3AREA 2ZCLL 2H26A 2GJ6A 2MQ3A 1DDHB 1MCPH 4F58H 4AQ1B 5IVOA 1NJ9B 3VRIA 3NOIA 3BKYH 2CJUH 4XPFL 1YEFH 2C3XA 1HQRB 3MR9A 3UYRH 4LCUA 4F58L 5CBEB 5JHLH 4ZAKD 3BKYL 2LE9A 3FAXA 3H3PL 2APVA 4D0CB 5GS0D 1MNUH 4GW1B 5JHLL 2R1YB 4AH2B 1NBZB 2Z8SA 1FAIH 4GRWH 4AYFA 1XR9B 3MRHA 4JM4L 4P5MA 4Z7QE 3MUHL 4KMTL 1XGTB 3IVKB 5IB1A 1QRNB 3MFFB 1BLNB 1Y6MR 1U8IB 3TZVB 2NY3B 3QWOA 4JHAH 1I1AB 2YHGA 4X7TB 3WLBB 3CSPA 3SO3B 3U6RA 1SY6A 3IETA 5F9JB 3HI6L 4AEFA 5E6IA 1S3KH 3ARSA 4O02H 3ULSA 4BKLB 3BDYL 4E0RA 3V0VB 3RFZC 1JGEA 3RHWK 1A47A 5IBLD 5FM8A 1YPZF 1MRDH 5C0AB 5DD6A 2X1PA 3VD5A 2XRAH 4X5XB 5HVWA 4K7FB 4OGZA 1BF8A 1MRDL 4LAQH 4HG4K 3F6IA 2A74B 5FA3A 5D7JA 4QRSA 5DVOA 3GMRA 2X4PA 3HRZA 5FV2A 1DUYA 4OZIA 4N90E 3SJVA 2K9UA 3OBAA 5LXGH 3ZDZE 1B0GA 4ZQKB 1NCWH 4QRTB 1PX3A 1BECA 3BZEA 1G7PB 3JVGA 4V2CB 2VNCA 2VXUL 5F7NC 2BVOA 4L8SA 5JIKA 2A6DB 4L9LC 35C8H 1FHGA 4JGMA 1SMOA 3MV8B 4X7CC 2YRLA 4Y16D 3C6SA 1JZ3A 3TN0D 1DQLH 5ESQA 7CGTA 3DNKA 5FCUL 5IR1A 3VGDA 3IS0X 1DQLL 1GGCH 5IFAH 1R5IB 4UV7L 4EI6B 5FGCB 4LCCA 5IFAL 2HT4C 5E08H 4JO2H 5MHSE 4H0GA 3HG1E 5C3TA 4FG6D 4OF6A 5IK3A 3FB7A 2DQHH 1UJ3B 5LWYH 3OJDB 1XF5A 1MAJA 4JDTH 3FT3A 3U30B 1TXKA 3VMOA 4RBPK 4GT7A 2LFGA 1Q38A 1QRKA 1T7ZA 3X3FH 3GK8L 3CDGB 2NTFA 4HHAB 2LVEA 2XN9A 3X3FL 1DP0A 4HPOH 4RMVA 5J4MA 4GRMB 4HPOL 3EOAB 1YPZB 3BEWB 1I8MA 4LHUD 1S5HA 1IEBA 3PQYD 5DGRA 1N59B 2IADB 4ORGB 1A6WL 3NABL 1OM3L 1ES0B 4WFED 1DQMH 4W4OA 4EBQL 3TESA 3RJQB 2NX5A 3V6FB 1U92A 2VZ1A 2DJUA 4R0LB 1LDSA 5DS8B 1EHXA 1JTTA 5BVJB 4HK3N 5K9KB 1MLBB 3QNXA 5DDHB 4F33B 4OCLC 3QFJB 3Q5YA 1JE6A 5FF6A 1CU4H 1QSEE 3MFGB 3STZB 4JY6A 4I3SH 3WD5H 2EDRA 1CU4L 3GSOA 4RDQG 3DRQB 3T2OA 3WD5L 2F8VA 3C9NB 4NPYB 1GGTA 1AO7E 5L9DH 3C5ZC 2B39A 2YXMA 4O51A 3SEPA 4LHJB 1LO5B 5D6DA 1EAPB 3O9WC 3F7YB 3MRDA 3D6GA 3IB4A 3BWAB 5ESAA 5F3HB 1OP9A 5IMKA 2B4CC 1RK0A 4L4TD 4G43A 4FXLA 3FOLB 2UZIL 5CWSA 1RUQL 3BIAX 2P43B 5MEOB 1WV7T 3ME0A 3B6SA 2R69L 3MA7B 5SX5K 4NO5A 4Z78A 4NRZA 5F7HA 5DSCA 2GCYA 3JTTB 5EOTA 3UJIL 5DJDB 1PW3A 2G5RA 3MSPA 3TH4T 4GAFB 1XIWB 5J1TC 3X14A 1NEUA 1UADC 2EYSA 3QDGA 4LRNH 4UT9H 2HFTA 5B3JE 4QRRE 3DBXA 4GG8B 3W11C 1J9CT 3DHMA 4YQXH 4G80A 4PGBB 5JXEC 5DUPH 3FMGH 1MHCA 1P4BL 5C07A 4MNQA 5DUPL 4O2CA 2BC4A 4L3AA 3FMGL 3EFFA 1RIHH 3QDME 1W8OA 1KJ3H 4M6OL 4L8DB 2R0LH 3D39A 4PJ8D 3ZKSD 4PJBF 2FJHA 1HINL 3LZFH 4Y1AE 1UWXH 1MIML 4JFPB 4G8FB 1AD9A 5JHDE 4PJXF 2WWKT 1BHGA 4AT6A 3LZFL 3ECBA 2HVKB 3OSKA 1P2CB 4NBYB 3TH2T 1NGWB 2HH0H 2VSCA 25C8H 2CLRA 4JR9L 1CDIA 1QBML 2NCMA 1X5YA 25C8L 3AXLA 4NO0D 1KLGB 2L7UA 4RFEA 3HI5H 1T0MB 2UVEA 1OSPH 4NNXA 4WUUB 5FYLL 5L2KE 1T22B 1JVKA 1OSPL 1PQZA 2BRQA 4HCRA 4HUWA 4RAVB 2X09A 2VC2L 4CKVX 3ZL4L 5FFLA 5KVFL 4EKXA 5HBBA 2NNAA 3QDJE 4OJFL 1MCFA 1X44A 3V5DB 3VGAC 4P46B 2HVJA 4E9LA 5M7QA 2CRIA 4XC1H 1BD2A 3EOTH 2BSRB 4Y8AA 5L8JB 3TIEA 3SGJC 2VDOL 3WIFB 4XC1L 3EOTL 4RAHA 2EO9A 3FQWA 1WISA 2YD1A 1NCUA 1P5VA 1GJIA 4MDJB 1TJHH 2P7TA 4MQXC 5D2NA 1F4WH 2JLLA 1CXFA 2YD6A 4NCC1 1WWCA 5DMYA 4MWFB 1AXTH 5C0GB 5KSBB 4Q2ZA 1F4HA 2Z92B 3IU4H 5E7BA 5D1ZB 4OGYH 1HHIB 2OR9L 3TA3B 3IU4L 1WFOA 1GC1H 2P24A 4OGYL 4N0UE 1PFCA 3QG7H 4I2XA 5C0IA 2V17H 1OAZH 3W11D 1KENH 3QG7L 4Y4FC 3S37H 1NMBL 4PJXB 3BZDA 5T1KA 4U1HA 1KB9K 1OAZL 3DRTA 5H8DA 3WFDL 3RTQD 2F54B 2GK2A 3LB6C 5CMAB 5TGBB 1RAMA 2ICWA 3CAFA 3UTSD 4JN2A 3ZT7A 2BOBA 5KSAD 3WMSA 3BAEH 3MBEC 3BPCB 1C5DA 3IAGC 2I07A 5SWZA 4L1HA 3SKOB 2HKHH 1UEYA 4YHZL 1W8NA 4K2UH 3RY5A 5LGHL 1AD0B 2X4SA 3MRMA 4LVOC 2P5EB 4JDVB 1R3JB 2HKHL 2V2XA 3BPLB 2KZ1B 3GRWA 3U4BH 4WWID 4F7PB 1ZSDB 1V7ML 5DHVH 3U4BL 1KLUA 2IANB 1OAKH 4HEME 5D1XC 5IW6B 1JWUA 4HJGB 3QJHB 3O6LH 3T04D 4MNGA 2WWMC 3T65B 1WZLA 3I02B 5KANI 1NEZA 5J8OA 1JHKH 1CFVH 4Y0GA 1PBYA 1N6QL 5EO1A 2VWEE 3AVEA 4LAJH 4WDIA 4W68A 4HPYH 3QQ4B 1DVFA 1T03L 3A67H 2VR4A 3DTXA 2NQCA 4HPYL 4AIZB 4MJIB 3IJSA 4O2EA 3ZHLA 3K8LA 4TULL 1YEGH 1I7TA 4OLWL 1GGYA 4QHNA 5E4EB 5C0CB 3L3HB 4NKDB 4F2MA 4NWTH 3GMOA 5GGRA 4DCQA 5HHNB 4JG1L 3ARFA 1BBJA 4K7PX 5DEGB 5ETUA 3BT2L 3QZWA 4XMPL 3P30H 2F9BT 5IJKC 3RL2A 3OQ3B 3TYGL 1SVCP 3GIZH 2NY5H 1TETH 2W0FA 3P30L 5MENE 1CFSA 2V9RA 3GIZL 3QEUB 3LEXB 5TE6L 1FZOA 4XNXH 2E7CA 2YRPA 3IT8D 4ZUSB 3KS0H 5EBWB 1CG9B 5IGXH 1NL0L 1G6RA 1N0LA 3H7LA 4NO3A 3BSZL 4XAKD 3HC3L 1LO3L 3RX8A 3S5LA 1KCUH 1UXSA 5DWUH 4YBHA 4Y4FD 3ILQD 3MNZA 5D96C 5DWUL 2YEZA 3EFDH 3E8UH 3LB6D 4IIQC 2DQIH 1Q0XL 4JJ5A 1P9MA 3FO2B 5F9DC 4JFEB 2DQIL 3NFNA 1BFVH 3QI9D 3REVA 4B0MM 1BFVL 1FNAA 1PVHA 3PIQB 1G7HB 5FIEA 2WBKA 2DRUA 1HH6B 4OI7A 4P3WA 3BQUC 4Q6IC 4OZIF 1QKZH 1JPTH 5GRUH 2APWA 1N5AA 4YHYB 5KSVB 1A4JB 1YEIH 3NA9H 1IL1A 1QKZL 1YEIL 3AREB 2H26B 3FRUA 4RZCA 2GJ6B 5JPNA 1I8LA 4PJCF 3CH1A 3HG1A 4Q58C 3VRIB 4U4BA 3MR9B 4HWZA 1FLTX 4NZUH 4LCUB 5GS2H 4H1LH 3P0VH 4ERSL 4PJ5D 2ORBH 1T80A 3D9AH 3P0VL 3OKOB 3MRHB 3Q6GL 2ORBL 1MQKH 5L8KB 5HDLA 1G6VK 1CGXA 3L95A 4WI8A 1XR8A 5IB1B 2YA0A 3EDEA 3BHBA 4J6RH 2MSPA 2OTUA 4BSWA 2OX5A 5FO9A