4RGOL

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
DIVMTQSPATLSVTPGDRVSLSCRASQSIGDYLHWYQQKSHESPRLLINYASQSISGIPSRFSGSGSGSDFTLIINSVEPEDVGVYYCQNGHSFPYTFGGGTKLEIRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoL01
3BQUD 2YD8A 1T7YA 1A14L 1D6EB 2FGZA 1B88A 2DL2A 4DZBA 1RK1A 5KN5B 1XCTA 3GI9H 1CXKA 1BM3H 1EEUA 1BQLL 5INCA 1BZ7A 5ID0B 1K5NB 1BD2D 3BPCA 3P0VL 5JMOC 1JRHL 4OCSH 1DUZB 1HDMA 4DVRH 2VDMH 2X10A 4JR9H 4OLXL 1CGSL 2I9TA 4WWKA 4CNIB 3FT2B 3MRDB 4YBHA 2H2PC 4QRSA 2YUXA 3TCXA 1AQDA 3WNKA 5ETUB 3ZTNL 1IQWL 5GGQL 1A4KB 1D5ZB 1WLHA 5JLZA 1X4YA 5BRZB 2BVYA 2BHZA 2XXCB 1FNHA 3PNWB 4WFGE 4HS3A 1H8NA 5DRNB 4PRHA 5GGTA 1OAZH 3KXFB 3NCFB 4JN1L 1S7UA 3QIWD 1LDPH 1VENA 1XZ0A 3LS5H 1RUKH 1WBXA 3WL9A 3TO4A 3ARYA 3N1QC 4CW1B 2ZPKL 1IRAY 2DQGL 4JO3H 5SX4H 5IFAL 1X3DA 2A0LD 2DQHH 4FQXA 3ARDA 3W5NA 4U1JB 3RZCC 1INQA 1UCTA 3CFJB 1T4KB 4EOWH 1H5BA 2G75B 3QPQD 3UO1H 3L5HA 4LF3A 4OF3A 4XP1H 1W0WA 4MD4A 3O4LE 2XQBH 2HFGH 3ARFC 2FATH 3V4VH 4D8PA 5D4QA 1OTSC 3HI1B 3TFKC 1RJZA 2NW2A 2UV3A 4X4YA 5BXFB 2AP2A 5IK3A 2P5EE 2MFNA 4M93B 1KB9J 5EG6C 3K4AA 3VDAA 1RUQH 4Y2DC 3EGSA 4MA1B 4RBPH 4WEUD 1SVZA 1QQDB 3P30L 1PKQE 5FECB 5EUOB 3BWAB 4XPFL 3QNXA 4U6XB 1I3VA 5KVFL 1AH1A 4Z7VA 4BUHA 4HXBL 5FYJD 2B2XH 2ESVA 3UJIL 3ZDYE 3VFNB 1GIGH 2NY3B 1HCFX 3H9YA 3ZDXE 1JF1A 5SWSE 4AM0A 4AEFA 2C3HA 3IFPB 4RFOL 3EHBC 3HPJB 3U0TB 4X5XA 1SY6L 4D9QE 3SO5A 1ZOXA 5D7IF 1ORQA 1BBDH 1QFHA 3QCTL 5IP4A 1GRWA 3O4LA 2RFXB 3OKDB 4HK0A 4ZOAA 5E2VH 5C8JA 5KW9L 1U3ZA 3RIFK 1LP9E 1NLBL 5FYKD 3MNWB 4WU7A 3D18A 5ADPH 3MA9L 1HHHB 4XNQA 1H3WM 1YNKL 5DLMH 3RZCA 3REVA 3SE9H 2OQJB 3UC0H 3O2VH 1L7IL 4K71B 3RWEA 3I9GL 3QDMB 3NCYS 5KOVC 3TYFA 2RBLA 1HSAA 3K2MC 4UINH 2KH2B 2VR5A 3EYQD 1PKQA 4K94H 5H8DA 3BMVA 3SDCB 3R1GL 5GSRA 5ANMB 2GK0A 3RNQB 5LCVL 1ES0A 3B5GA 3ARFA 1QR1A 4LSPH 1MHHB 3S36X 4CGTA 3HG1D 5SWSA 3TNNA 3MLZH 2CXGA 4OV6F 1PY9A 1QSEA 1UZ6F 3VXTA 1FVCA 3TBVA 3ARSA 1WTGT 1GGCL 3WDHA 4Y2DA 2BY0A 5HHNB 4AT6B 1ITCA 4AEIL 1BOGA 4FP8H 2R15A 4X5WA 3RJQB 2I25N 5EBLB 4WI5A 1NMBH 2VUOA 1MRFL 5JXEC 5L88H 5ILTH 2A9MH 3D85A 3IF1A 4XPGL 1P6AB 4PJAF 3GSNA 1PG7W 2GI7A 3BPOB 2KZ1B 4WGWB 1RY7B 2HJKB 1YN6A 2QQLL 1QSFE 3P4MA 1Z6JT 4PJ5E 1Z9LA 4Y7MA 1N26A 5EWIL 4RX4D 1MCLA 1OCWH 4R2GC 1KELH 2YPVL 4OLUL 3IDXH 4I2XB 4XNZB 4ORGA 1UJ3A 3KYMB 5I8CA 2DQCL 1AGFA 3VH8G 5CP3A 5TE7H 1TZGH 5EZLB 4PV9A 1NLDH 3LEYL 2XZZA 2AV7B 1J10A 3TH2T 3QRGL 2ZJSH 1RZKL 4P2QE 3PF2A 2CRZA 1ADQA 1YMHA 1PYWB 2VABA 2OTWB 1UKSA 1A6ZA 4GG8A 3O6KL 1A6AA 1QRNE 5I15L 5DRXA 5GGVY 3MLPA 5B39B 5C08D 3OKYA 4O02H 1N8ZA 3CLEH 4BM7A 1QSFA 5BZWA 4KZEL 4G5ZH 2CQVA 3B2UD 3WEXA 1XGQA 2P8MA 4MNHA 5EOTB 1ZT1A 4EIZC 5JXEA 3ULUL 3MV9E 3U7YL 4U1LA 4KFZC 3MQIA 4KK8D 3WFCL 5IHZA 4NQCA 3GMNA 3MV8D 4ORZC 3MLXH 1BIIA 3D5OF 4G8FA 3QUXD 2V6HA 1R0AL 1X5ZA 4WWID 2HKFL 2V2TA 4JO2L 5HY9A 5CGTA 1JTOA 4K9EH 5KTEH 1YY9C 5C3TA 3KS0J 5DUBA 4B0MM 3B5TA 4LSVH 1MELA 4LCUA 5CD3B 1V3MA 3MLUL 4AZ8A 5AAWA 1T21B 4KDWA 2GK2A 3WKMH 3IRPX 1QRNA 3O6MH 5CEZE 2IBBA 2NY2B 2X2YA 2VDKH 2NY7H 5MI0C 4NYLB 2P4AB 4B7LA 2F5AL 2HT3D 4LAQH 3LQZA 4JPVH 5E6IA 4YHML 3KJ4B 5TDOB 2YRLA 3DMMB 3MV9A 3EYSL 4X99B 5IB5B 4U7MA 1N59A 3GUTB 3EDFA 5JIIA 5L6YH 5BRZD 4XMLH 1BFOB 1A9BB 3KXFD 5L2JA 2R9HC 4XCNB 4H1LA 3WFHA 1SEQH 3SDDC 4PTTA 4ZAKA 1T1WA 4DUWA 1C1EL 3A6BH 4YFLI 3ES6B 1IQDB 5DF0A 1WSST 1U8HB 3ARGC 2IQAA 4M6NH 3V6BR 3FQUA 4PGZA 2P46B 3QEUA 5DJ6B 5HBBA 2X4QA 3DX9B 1B2WL 5EU7C 2YKLH 3MNVA 1GZQA 4WFFD 4V1DE 3P9LB 2FDBP 1FL3A 4YBLB 3RU8H 1QR4A 4HIHB 4MD0A 4JFFE 2ZUSA 4MQTB 4UDTA 5C3LD 5EH1A 1DSFH 3GKZA 4LSTL 3MV7E 2EO1A 3AXLA 2GT9B 5IUSA 3S96A 4PGBA 5D7IE 3A67H 2YRPA 3PWNA 3D6GA 2R2BA 5T5FH 4YX2L 1NEZA 3N1FC 1FORL 3MODL 5DZNA 3BKJL 4IJ3C 3MRQB 2KQMA 5T5NG 4AYFA 5GRYA 1I85C 1LGVA 2CGRH 1OARL 43CAA 5IB4B 2BSED 3WIHA 3RWFA 1RVFH 3QEGL 2OZ4A 5DJ0B 4ZPTA 4M6MH 2A1WH 2AABH 5E2JA 2NY3D 1ZTXH 4RA0C 3L7FB 1FPTL 3QG7L 4JG1L 5I1JH 2AK4E 3B9AA 3LPWA 2B7DT 3FFCA 3NFNB 3DV6A 2CRMA 4U1HB 1AR1D 3DX8A 4JFFA 4QF1B 4MA8L 5H94B 3WFEL 2DF3A 3BP4B 3MJ9A 1UZ6E 5KVDH 3ARGA 4OCWH 5C07B 2H2SD 3MV7A 2QKIB 1KNOA 4KK5D 3UPCA 3EJYC 3FTGB 5D7IA 1G7MB 2IBZY 2YXFA 4L3AA 5FAAA 1IC5L 2NY5L 4P5MB 1XGRB 4HG4K 3QDMD 1KXVC 1W2KT 3HC4H 4L4VA 3C9NA 4M8VA 3DROB 3BJLA 2ED8A 4NC1E 3WFBL 3SDCD 3QDJE 1QBLL 5DJZB 4JANB 4O00A 5TJWK 3RX7A 1U8IA 4PJAE 5IW3A 3KWWA 3SCMA 5C0JA 5I19L 2ZCHL 3GHEL 1WFNA 1AGBB 1RZJH 5D2LE 3D2UA 4MSWA 4B7IA 2XKNB 1H3TA 2AK4A 4KY1H 2CIKB 3GGWB 4HKXA 4JFEB 2H26A 1KV3A 3GHBL 4GS7C 4RMUA 4RAUA 1I85A 4CVXB 1DN0B 1G7QB 4L8SC 2EE9A 2GITA 4KRPC 3WS3B 3VW3H 3EFDL 4UQ3B 4IM8A 2VZSA 5IB2B 1HQRA 3G5ZA 1FLRH 2P43B 5AZEH 3MCG1 4KXZI 2X05A 5LGHH 5HDLA 1MY7A 1U42A 1N4XL 4OQ1A 3ZKXC 4C57C 2L7JA 5BV7L 4L3ED 1JI1A 4OLVH 2VQ1B 1DQLH 3TNMA 2FX8H 3FOMA 4YDVB 4CADB 2ADFH 4U3CA 3VFGL 1OW0C 1IC7L 3RX5A 4YXLL 4F7TA 4O9HL 1JWUB 3MO1A 5T3ZH 3CFEA 1XFPA 3H7BB 4PJAA 1X5XA 1RURH 2AS5M 1WIUA 1Y18A 1PG7X 2EO9A 1TQCB 3TH4T 1P6FA 2UYLA 4GKZB 3OAYK 3S37X 3P3YA 2PW2A 4JHBA 1EBAA 2E6PA 4NZRH 1LWRA 5MP6H 3OG4B 5JIHA 2BVOB 2A6JB 3W9DB 2W9EL 4JCLA 3TZVA 2XPGB 4ZFFB 5J1AB 5A1AA 1HSBB 3SDXB 4MB4A 5EA0L 1Q9OB 4HPOH 2X4PB 2ZOLA 3ILQC 4PGCA 1H8OA 4HJJH 3HB3D 5SWZE 2EDHA 1JGUH 4O2CB 4PIRF 4KVNH 3RA7L 2EE3A 4JO4H 5EO1A 2VLME 2PCPA 1M71A 1A14H 3ARQA 3T4YB 3MXWL 1A6PA 3WXWL 3OXRA 4L8SA 2W1NA 4LVHB 3QJFA 2JCCF 1BQLH 5IW6A 5SX5K 1MQ8A 3P0VH 4ZUSA 1WFOA 1JRHH 3MREA 3UBXA 2BMKB 2X1QA 3PIQA 4PRDB 4OLXH 1CGSH 3QQ4A 3VGFA 3MA7B 1DR9A 4YK4B 5C9JA 1EEZB 2GTWB 4LCYA 3ZTNH 3U30B 1U3HC 3V52L 3RWCA 2VZTA 1IQWH 1OW0A 4JN2B 5GGQH 4H25A 3GMMB 2A6DA 4PS4L 4XP4L 3NOIA 1MLCA 1QZ1A 1QRKA 3IKCB 3CSBA 4L8CB 5SWZA 4JN1H 2QADC 2EKJA 4RA3A 2B20A 3BHBA 3ZHLA 4NQSB 3CH1A 2Z31C 4PP1C 3GMQB 2RQ8A 3F7VB 4HWUA 4X7TB 5HD8C 3L6FB 5GJSL 3RZWA 2ZPKH 2DQGH 5IFAH 2BK8A 3OPZL 1AO7B 3FZUC 3DMMD 2CDEB 4GW1A 5ITFA 3IFOB 5EO9B 1A9EA 1MIML 4ZUUB 4WHYH 4DZBB 3CFDA 1HH9A 5IB1B 5IF0B 3IDGB 3MXVL 1R6VA 3LH2L 2NYYD 2PF6A 4OF7A 5C0BE 5CGYD 3SGEH 1CGTA 5ANME 2NX5E 4M7ZC 5J8OA 4PRPB 2I9TB 3VFPB 4C55A 1VSCA 2DMBA 5FCUL 5FUCC 4ZTOL 1HHGA 3WHXA 4A6YB 3GJEB 4PJGE 4BA8A 2DQIL 3QUMA 3QXWA 1MCEA 4HG4J 1FQ9C 1JNJA 1R3JB 3ZKSD 1FNEB 2ADIA 5KVFH 3HRZB 5B3JE 4IRSC 4PRHB 4HXBH 3M17A 3UJIH 4QXUL 5JDSB 4NN7B 4HIIB 1TFHA 4QRUA 5H35A 1DQQA 4RFEB 1T0NB 1OP9A 4RFOH 5FUCE 5LKNA 1EEYA 4WVRA 4DEPC 1JPFB 2ICEA 1NCDL 5E9DE 3O6FC 3QCTH 4FQXB 3GBNL 5F7UA 2Z31A 5KW9H 1X4XA 1I3RA 2CPCA 3K8KA 3L7EB 4JPIB 1GH7A 1NLBH 4TSCL 5C0BA 3UTSB 3V6FB 1EVUA 2NX5A 3BUYB 1W0WB 4I1NB 1YNKH 2X89D 3ARBB 1AD0A 2VDLH 2DMKA 5JPNB 1L7IH 4YE4L 4JZNA 4MCYA 5C0RL 5K9KB 5GGUA 5F9JA 5IK3B 5I1GL 3R1GH 1T5XB 3QEHB 4F37F 4JGMA 5JR1L 4G7VL 5LCVH 5I71C 3GM0A 2YC1B 5C07D 4Z7VB 2CDFB 3DLQR 1GGCH 3NZ8A 3L3HA 4M3JA 4DN4L 1YQVL 3TA3D 4AEIH 2KZWA 5E9DA 1H3PL 5DXWA 5F6IC 4AM0B 1TCRB 3LSOB 5F6HI 1MRFH 3DUSB 4OLEA 4X5XB 4IRSA 4O2FB 1MQKL 2X4TA 3H2WA 1ORQB 4GG6E 3OKLA 1ZKAA 3DECA 4XPGH 4FS0A 3FB7A 4QRQB 4DZ8B 1A6VL 1HYSD 4XVUD 3O6FA 2QQLH 1KJ2L 3HFML 3OJ2C 5EWIH 3LKRB 3I50L 3K81A 3N1PC 4PP2A 4NBYB 2R0LL 4W70A 2GFBA 5CLWA 4OLUH 2AI0L 2YPVH 1AE6L 3JUZA 4LDOB 3ROOB 2IJ0C 4TN9A 5D6CA 2D7MA 2D7OA 3RDTC 3PGCA 2DQCH 4M1DL 4YEEA 2GK0B 3LEYH 1DUYA 4S1QL 4YGVA 4CMHB 3EOAA 2DRUA 3QRGH 4DOHE 1QR1B 1I7TA 3RWIA 5HGDA 2FNBA 2WBJA 5FDWA 2NCMA 1RZKH 5D70L 3VXTB 2DIAA 3RAJL 1JN6B 4QY8B 2V5TA 2IPKA 2ZNWA 2GSIB 3O6KH 4ACPA 1EXUB 4J3OC 2DYPB 5I15H 2ZUTA 3LZFL 3V5KB 4QRRA 2APTA 3OAYH 4WNQB 1L6XA 1T1ZA 3DBXB 4KZEH 4X80L 2JCCE 4PRIE 3ULUH 3U7YH 1JF5A 1NGZA 5IW1A 4M7KL 3OHXA 3WFCH 5DK3A 4CAGA 3P4MB 4P9HL 1R0AH 2HKFH 1A1NA 4KJQC 4ETQB 4JO2H 3EYVA 3PWUB 4WUUE 4KRLB 4IHOB 2PTVA 1AGFB 2OXGA 2EEDA 3F58L 3GM8A 4MVBC 2PYFB 3MLUH 4A2MA 2Z92A 3JWDL 5I1DA 3RDTA 1HHKB 2V17L 5SX5H 1YEFL 3UMTA 2XA8L 2VDQL 5I18H 2BHUA 3L5IA 4P5KB 4QNPE 1SVCP 2J8HA 3LV3A 3QHTC 4N5EC 3RIAF 1JNLL 1U8LA 4IOIA 1X44A 2VABB 3LKQA 5DGRA 2C7UA 3QDGA 4R97C 3M07A 2JCCA 1KYOJ 4GRWH 4APQA 4PRIA 4K55A 5DRXB 2YK1L 4KVCL 4KPHL 4N5UA 3EYSH 4GSDL 4UU9A 3AUVA 3F7RA 3CFCL 2LVCA 1U36A 1LE5A 1GSMA 2A6IA 2KPNA 1A6TB 2JF1A 3BH9A 1MY5A 1ZT1B 2B1AL 3VRLF 2Y72A 5B38G 4L9DA 2FZ3A 3U0WL 5D1XB 1CK0L 4WUUA 5EBMA 3E2HC 3AVEA 3NN8B 2VN4A 1C1EH 2VXVL 4OUUB 5J6HB 3V0VB 3L3DB 4TUJA 4Q2ZA 5I2IA 4NO3A 5HY9B 5IJKC 1TLKA 4J6RL 1B2WH 5CSZA 3T8XA 5EO0B 4OQTH 3MRHA 1F3DJ 1KG0B 2MWCA 4LCUB 4XH2A 2VH5L 4WJ5B 1JIBA 1TITA 3HRPA 2H41A 3OGCA 3DVFA 3Q6FB 3BX7C 4G9DA 3TM6A 3MUGA 4WRLA 2X1WL 4U05A 4YIQA 5CJQL 2W0FB 4PY7B 4LSTH 4WCYL 5BS0B 3BDXA 5I30L 2FSEA 2E9WA 1AGEB 3JBG7 4PRPD 3MROA 4YX2H 1FORH 3MODH 3I85A 1TNMA 5F9WC 3BKJH 1G0XA 3GBML 4D0CA 2VLJB 1QA9A 1OARH 2ERJB 4L8BB 4JFEE 1P5UA 4OFDA 3QEGH 4YEFA 1RFDL 3QIBC 2ITCA 3L3GA 4PRHD 1YNTB 3QG7H 1NAMA 4JG1H 1DJSA 3CSYB 3T09A 2IQAB 1C8PA 3RP1A 5A3ID 3FQUB 1XCQB 2X4UB 2DQEL 2X4QB 4YNYA 4FQXD 3MNVB 4X98A 3WLWC 1B90A 4MA8H 3WFEH 5DUML 3VXMA 3ESVF 3QXDA 3UTSD 4G43A 1XR8A 4LLDA 3BXNB 1MFAL 1P4IL 5DC9B 3ARBD 1A3LL 2OMBA 3RHWF 4ELKB 1IC5H 2NY5H 4JHZA 4C83A 1IILE 1V3LA 3CDFA 5IJVA 2X70B 1BJ1J 1IAKA 1FGNL 4ZFGL 1F3DH 3WFBH 1QBLH 1MCJA 4M9OA 5EIIA 5I19H 1F5WA 2ZCHH 3WNNA 4YAQB 5MI0B 3WFZA 43CAB 2FEEL 3C08L 2DM3A 2KL6A 2BOBB 2H2PD 1PQZA 2APBA 2J6EA 3KVQA 3LN5A 3GHBH 4UOJA 3ARTA 1I1AC 2AKRA 4E5XA 3H42L 4FFYL 2H6PA 3EFDH 3BP7B 2A6KA 5DMIL 3SKMA 3GBLA 4LEOB 1UG9A 3FFCB 3QIBA 3CX2A 4UIMA 3D9AL 3DX8B 5HVWA 3SDDB 2EXWD 4P3CL 1CG9B 5BV7H 1I4FA 2J8UB 1ZWIA 1EJ6A 3A6CL 2IAMC 3VFGH 2A9NL 1IC7H 4YXLH 4P3DA 4O9HH 3S98A 1V5JA 1JZ5A 3RZCD 3I3EA 1OGAB 1ZGLP 1BFVL 4G6FB 1G0YR 1MEXL 1U8IB 4MJ6A 2W9EH 3ZTJG 2Y5TB 5DD0L 5GZNC 3K74B 2EDRA 1WBYA 4HHAA 1OTSD 3O45B 2WQRA 3FQNB 4XTRC 4ZSOE 3D2UB 2JK5B 4MSWB 3IU3B 5EA0H 1EV2E 4F3FA 1BJ1H 1ZT7B 4HKXB 4Y2DD 1V7ML 2XZCL 2D31B 5JNYB 1MHPL 5E8EB 1AO7E 2C1PB 2ZUUA 4UTBL 4ZXBB 1F11A 3BPNC 3IVKA 1YDPA 2W0LA 3HMWL 4KQ3L 3RA7H 2GITB 1AXSB 2DYPD 3MOBL 1K6QL 1FFNA 3WHE1 3QWOA 1MHCB 5D71L 4RFNB 1DBML 1I1AA 3U1SL 3WXWH 4ONOA 2LU3A 3GSQB 4X9HA 5CEYA 4DCQA 1ZLWH 3EHBD 5HYSA 5C0AE 4Z7NF 4YHOL 3LCYA 3FOLA 5DJ8B 3OZ9L 3WLBA 1U3YA 5I8KL 1OSZB 3GSOA 4YHLL 2Q7YA 3OQ3B 5FO7A 3PE9A 3CFEB 5MEOA 1F6LL 4MA7L 4P57B 2IAMA 3RWGA 1NUNB 1Y18B 3V52H 4F9LC 5GS3A 4ZSOA 1IAOB 2UYLB 1FE8L 1IFHL 4PS4H 4XP4H 2NZIA 2CUHA 3VRLE 4FNLL 3ZDZF 4F8TA 1HXMA 3S35X 1DQDL 4HH8A 5KSBF 3R8BB 3TBSA 3IDYB 2ICWA 1KULA 3HZVA 1CZ8L 5J3HC 5GJSH 1J86A 4FG6C 4RAVB 5FYJL 2D7NA 3UTSE 5C0AA 2PCPB 3FQTB 3OSKA 1GGIL 4RMTA 1MIMH 4I0KA 1DQTA 3HI5L 3JWOL 5JXED 3MXVH 1OM3L 4OT1L 3LH2H 5DMJB 1UJTA 2AQ3A 3INUH 4DFIA 3OXSA 2E6JA 3KDMB 3TJHC 3DO7A 2F58L 3ZKXB 2Z4QA 1IEAA 3EO1A 3FN0L 4ZTOH 5FYKL 4KK9C 3FT4A 4UT7L 2DQIH 1IMHC 1XF3A 2FIKB 4KK6C 3BPLB 3RKDC 1NGXB 5JW5A 4HUNB 5D9SB 1A0QL 3SO3B 2F53B 1FZKA 3HN3A 1CXHA 4Q7DA 4K3GA 4BQ9A 2G2RB 4QXUH 5D93C 5DHYB 3FQWA 3ZYZA 2HVJB 3PWPB 1AC0A 4NM4L 2XG4A 3P11H 4KGLA 4E41E 1HOCB 3EFFB 3UROR 2V7NB 5BS0D 4R8WL 3WDJA 3H3BC 1NCDH 1AXIB 4PR5A 5CINL 3IAPA 2W38A 2H8PB 3GBNH 2VLJD 4LHUG 1N2RA 4TSCH 3AS3A 1HH9B 4U1MA 1X5JA 3QIUC 5FKAB 3IRZA 4N68A 5E2UH 4J23A 2QEJA 3LAFA 4JM2C 3D3VB 4I48B 5C0RH 4XXCC 5D7LA 4N90E 4MCZB 1RZFL 1MOEA 1KB5A 5I1GH 2R4SL 1HHGB 2PUQT 3O0RL 4XZUA 5JR1H 3WNMA 4G7VH 3QUMB 2CDGB 1F4AA 4FXKB 4G3YL 4JHAL 3C2SA 4E41A 3U46B 2VOTA 5DT1L 5LAXB 2BNQB 4DN4H 1YQVH 2WSKA 3AM8C 3M17B 2WAHA 4XBPB 1U3HB 2F5BL 3TN0A 2HFFA 1H3PH 1XEDA 4G80A 4CBPA 4HCRA 5E94B 1PZ5B 4XGZB 1KJMB 1EEYB 2Z8RA 3OR6B 2W9DL 1MQKH 3IDMB 2QADB 5E8PA 4BQ6A 5IOPB 2R0WL 3DRQA 1CT8A 4LARL 4S1RL 2B1HL 1WISA 3SGKC 3F7YB 3B83A 1I3RB 1MWAL 4ZO7A 1A6VH 5J9PA 4EJ1C 1KJ2H 2CXKA 3HFMH 4BQBA 3MRNB 1OT1A 3DGGB 3I50H 1P1ZB 2GIYA 2R0LH 1ZHKA 3ROLA 4DVBA 2BNUB 4X7FC 2AI0H 3HZMA 1AE6H 4LCCC 2HP4A 4MCYB 1QYGL 5GGUB 5I1IL 4QHKJ 3QIUA 3FFCD 5IKCA 4M1DH 4QHUB 4S1QH 3SDDD 3KPNA 4XXCA 1BQHB 2OTUB 5I74B 4FABL 5J13C 5D70H 1T0PB 1Q72L 1FZOA 3C5SA 3JV5A 3RAJH 5CEXA 3SE8L 5JXAL 3NZ8B 1KT2B 2NY6C 3QAZC 1U3JA 4QCIA 2X44D 4NBXB 4QGYA 4F58L 1OGAD 4G8GE 4G6FD 1J88A 1ETZB 1T80A 3MPCA 5TFSH 3ABZA 3LZFH 3AM8A 4NHUA 4NN5C 4PGDA 3TO2B 1YQ2A 32C2A 5E2WL 4LP5A 1F58L 4X80H 2RIKA 4Z7NE 5L8JB 1UWEL 4M7KH 4Y4KB 1S7RB 2GQHA 3D2UD 3CJJA 3MGTB 3VFUB 2YN3A 1AKJB 2DOCA 2YRZA 2GJ6B 2VWEE 5GRXG 3SGKA 1RULL 4ZXBD 4W4NA 3T0XA 5HYEA 4YFLF 3PHQB 5D6CB 4XPHH 2E7LC 3FO0L 1FO0A 4M6OL 4NNPL 1RZ8B 2WWMC 3SDYL 1U93A 4Q6YA 4O51B 3F58H 3ZDZE 3TBTA 4LCCA 2UZXB 3LEXA 4BYHA 3RWIB 1SJEB 3SQBA 5HGDB 1BBJA 4U7KA 1NDGB 3D39B 5JA8B 5KSBE 3JWDH 4KJYA 5IVOA 2HLFD 2V17H 5A2LH 1YEFH 4G8GA 2OCFD 2VDQH 4HS8L 1YPZE 1HEZB 5C6PB 1LK2A 2HH0L 1JNLH 5I71B 2QQKL 1LO0L 2VLJE 3SBWA 2AXJA 1RV6X 3L95A 2YK1H 5IMKA 4KVCH 4KPHH 3EJYD 4GSDH 1R3KB 1S9YA 3CFCH 3AREC 2XRAL 4PJDF 4Q6IB 1EDQA 2EIDA 1HIML 1B0GB 1SJHA 4LCWE 3FN9A 5E7BA 1IEBB 3U0WH 3QXVA 5L0QC 1Q38A 4I8DA 2FD6L 1CK0H 3OHXB 4JFDA 3Q0HA 4H8WC 2VXVH 3DJ9A 5D96C 4FN0A 3TPUB 1VFAB 4D0BB 4HH9A 3G08A 1S7XB 4MJIE 5EU5A 4J6RH 5JQ6L 2NY4B 3FAXA 4OCLC 5KSBA 3RNKB 2JJTC 3BESR 2GTZA 3EYOB 3E6FA 1UXWA 3MUZ1 5HPMA 5HVGB 2Q6WA 5JORA 2VH5H 4IIQC 1NCUA 2JE8A 1L9MA 3TEUA 3O3EB 2E7LA 2Q86B 4L4TE 5CJQH 4MB3A 2AQ2A 4QOKB 4WCYH 3DX6B 3LV3B 5I30H 1U8LB 5GISL 1U8PA 4GQ9L 4TVPD 4AY0A 3HZKB 4J3VA 4GRLC 2F74B 1NCCL 1BQUA 2FL5B 5CD5C 4ISVA 3GBMH 3N1MC 4UILL 3KPOA 4YDIL 1MF2H 1LE9B 2APVA 4OF8A 4ODHL 1VEOA 2VDNL 5EBWA 3LPFA 1RFDH 3EBAA 1X4ZA 5IBUG 4CVUA 4Z77B 3MRLB 2DLHA 3AREA 4ZS6C 1I75A 1MPAL 5K9OB 3RY4A 4KKLD 4OAWA 3KLHC 1YN7B 4M1GL 1PVHA 3VXUB 3WO4C 1EHXA 5LWYH 2DQEH 3F7QA 4PJEF 1HCVA 5BVJB 1F2QA 5DUMH 4L4TA 2X41A 3MRHB 3ILQD 2E27L 4ZTPL 5F96H 4XH2B 4U0RC 3OKEA 4OZGB 2V7HB 2CD0A 3BKCL 1HQ4A 1P4IH 1OGAE 2AJYL 3LPGA 3RVVC 1A3LH 4YIQB 3AGVA 2PYEE 5INDB 5F7WC 2DLFL 4Z78A 3D3VD 4IIQA 1FHGA 4G9FA 1FGNH 1JBJA 4ZFGH 3MROB 3QB7C 4AIOA 3RQ3A 3O8XC 3VCLA 3IGAB 1YA5A 1O0VA 1NANI 4GMTL 1QA9B 4NRYA 3C08H 5C0GB 5DHVH 4R97B 2BNQD 4GRLA 4OLZL 3GSXB 1BMGA 1U3HD 4UOW1 5E2TL 5GSVB 1FL6A 2E6QA 2APWA 1IM3B 4P5TA 3H42H 4FFYH 1KFAL 4N1CA 4DKAA 5GRVK 1T83C 5DMIH 3KLSA 1WCQA 4UAOC 5FO8A 4NQXA 4WW1A 2P24B 3D9AH 1JNHB 1CFQA 4KU1A 4LLVB 4OLWL 4PJFB 2QADD 4YNYB 5F89B 4K3HA 4G6AD 3E2HB 4P3CH 5FK9B 5J1SC 2R0ZL 1EX0A 4R7DB 4LSUL 2PYEA 2V2XA 4JDTL 4Y1AA 5DS8A 1ZHNB 5CUSL 3A6CH 2YPLA 1P7QB 2WP3T 3STZA 2A9NH 4NNYB 4JZOB 4QHNB 3RPKA 3FZUD 3U7WL 4U0QB 3QFJA 3EZJB 1Q0XH 2DI9A 1BFVH 3F65A 3EKCA 3T3PF 5FGCB 5I6XC 5IROC 5E08L 1CD1B 4HWNA 3VFOB 1Y6NR 4R90L 5F7KC 5IQ9A 5FKPA 2EH7L 5DD0H 5CP7A 2NY0B 1I8MA 3FQRA 5AAMA 3QEQE 4X0KB 3O8XA 4BJLA 4JAMB 1V7MH 1FAKT 2XZCH 4N9GA 1MHPH 4MNGB 2X9YA 3C5JB 2E8ZA 4UTBH 1Z9OA 2GSGB 4E5XB 3GSVA 2M26A 1VHPA 3HMWH 4KQ3H 5A2FA 2SEBB 3MOBH 1K6QH 5DJXA 1MIEL 4QKXB 4IRSD 2IALA 2C3VB 2NLJA 1DBMH 2FLBT 5M94B 1T22B 3U1SH 1F97A 4OGYL 3G6JF 1P9MC 3VE0A 3DARA 1Z5LA 2VLRE 4HUVB 1I4FB 1T83A 5FYLL 1KENL 1BZ9A 3P77A 4NO5A 5DMYA 4XMPL 5MENA 4XB7A 1G7LA 4YHOH 3O6FD 1T0MA 3FO9A 5FA4B 3MJ7A 3OZ9H 1AKJD 4OCRL 2EYRA 5I8KH 4YHLH 2GJ6D 5I17B 3VRIB 4OB5L 4PRAA 5E95B 4LPYA 1OQXA 2DWDB 4MA7H 5DI8A 3UJJL 3PXHA 3I6GB 4R3SA 3THML 4F57L 2F53E 1OB1A 1FE8H 1IFHH 3V5HB 4L3CB 2BP3A 3K0WA 3O41A 3ALPA 4FNLH 3PWPE 3S36L 3NPSC 3R06B 2NXZB 1IT9L 1DQDH 3D39D 2FX9L 2WINA 4P2YA 25C8L 2DMCA 5IROA 1DE4B 1FC2D 5CHNB 4Y19E 1T3FB 4RMVA 1CZ8H 3HR5A 3HC3L 2Z35A 1UZ8A 3IVKB 4XCEA 3JZ7A 1MHEA 4P4KC 5I75C 1T2JA 2J7LA 5CJOL 2VLRA 1B0WA 1UM6L 3ZKMC 5FYJH 3BH8A 3TVMB 1GGIH 1I1AB 3UTTA 4MGXA 1QSZA 1SYVA 1BWWA 4D0DA 3HI5H 1B9ZA 1QG3A 4DCQB 1R24A 5HYQB 1OM3H 4OT1H 1ONQA 2OR8A 5DJ2A 4U6VL 3BIKB 3QO1A 2E8YA 2B5IC 3FQXB 3MBEC 4ZO9A 3BGAA 2F58H 4PJDA 1NC4B 1VADB 3FN0H 5FYKH 3HE7C 1IZKA 4UT7H 4MJ5A 3C6SB 2IAMB 1KIPB 5E4EB 2NY4D 2J3SA 2OI9B 2BX5A 1IGML 1A47A 4ZPVA 3NPZB 1A0QH 5DEFB 1FVEA 4OI7A 4Y19A 5T1MB 4KKCC 1B4JL 2LU7A 4KAQL 4RDQG 1HXMB 1P84K 1NKRA 4U6YB 4QHLA 4E0RA 4RMQA 3MLVL 4OD2B 2H3NA 2KUTA 1I1YA 4OD1L 4QOKD 2ICWB 4R8WH 4ZUVA 1G6VK 4YHKL 2X4NB 4LFHG 4PJEE 5CINH 3HKFA 3CC5A 4J3WA 3QNYA 4JDZB 1N0LA 2V5RA 4FQQA 5DK2B 2VXUL 4OD3L 3OB0H 3BPNB 4NM8L 4NQTA 3K1KC 1P4LA 4WO4C 4HEME 1K4CA 2ZUXA 1I8KA 4JM4L 4Z7QF 5HI5C 1FGVL 1DVFB 1IEAB 3PL6A 1RZFH 3QG6A 3U4EA 2R4SH 5AZ2L 3O0RH 1AFVL 1DANU 3LN4A 1XF3B 4LCIL 5T3ZD 5DYOA 3BD3A 3KPSA 4JHAH 4YXHL 2JB5L 5JW5B 2C3WA 3C60C 1C16A 3UCRA 1SMAA 4KJQD 3X12B 2XZQL 5DT1H 3GRWL 3HE7A 1TZIB 5TE4L 2FHBA 1WITA 3FQWB 1YC8A 1R3IL 3ZTJH 3V2AR 1K8DA 5ALCH 3GMRA 2W9DH 3PWJA 1VCAA 1XF4A 2R0WH 4S1RH 4LARH 1RUML 5I1CL 1HXYA 1QVOA 2R1YB 4JVUA 4NKOB 4N5ED 1MWAH 1J8HB 5IEKA 2OP4L 4M3KB 2GJ6E 4HC1L 4WTWA 3DHMA 1A2YB 2AEWA 4AG4L 4WTXA 1UH3A 4Q0XL 2WWKO 3V7AG 1QYGH 4IOFC 3WYRA 5K9JL 3ME0A 1KB5B 4QTHB 4JRXA 3G6AA 3QNZA 3IXTA 1UVQA 4OFYD 5F1OB 3CMOL 1S9WA 4WO4A 1REIA 4TNVK 1D5MA 2XTJC 3VXMD 1EPFA 4GRWB 1JTTA 1H3VA 4FABH 1P7QD 1Q72H 3SE8H 5JXAH 1GGUA 4JQXC 1AGCB 2QHLA 2JJSC 1G9NH 1NBYB 2A83A 3X11A 2HFFB 3PGFL 3DV4A 4PREA 4F58H 4PUBL 3C60A 3DI2B 5KG9A 4FXGB 2GJZB 4PFEA 5IR1B 1BX2A 1OAYL 4H5SB 5E2WH 3DRQB 3VFVB 4DJMA 1F58H 5DRZB 1KJVB 1FNGA 1P4BL 4XRCA 2CLVB 3FO1A 1OVZA 1TXKA 5J9PB 2HG5B 4IMKC 1S7QA 1EO5A 2WNGA 5JTWA 3V5DA 5J12B 1ZHKB 4G8EB 4GBXC 3ROLB 4DVBB 4UTAH 1RULH 3F62A 3PV6B 4XNMB 4DUXA 5F8QC 3FO0H 4M6OH 5J11B 1JPSL 3MZTA 4NNPH 1LO2H 3SDYH 3NIDE 4HIEA 5T1KB 2G5BA 3BMWA 4X6CA 1SJXA 4JM2B 3RL1A 4NOBA 1YZZA 1DANT 4POUB 5IHLB 3C5SB 4HS8H 4E42B 3QQ9C 5D7SL 1P2CB 5DDHA 2MTPA 2HH0H 5CILL 4CUCA 4Z7WB 3TP4A 2H1PL 3WLWD 2X42A 3G6JA 2QQKH 1LO0H 1CFTA 4LL9A 1CVRA 1TPXC 4KRNA 2GEEA 3VGHA 3ZYOA 4GW5A 5HYFA 1VKXB 2ZSWA 1D5BB 3D69B 4JQXA 4Z95L 1QLRB 4ODXB 1Z0MA 2XRAH 3DUHA 1S5HA 3EIFA 3N9GL 1HIMH 3RTQC 5BJTA 4J3UA 3T04D 4X5LA 2FD6H 3DYOA 4JFHE 3CZJA 3G5YA 3V0AC 4LBEA 3VXUE 1X5LA 4CKVX 1Z2KA 5T3ZE 4XT1C 1F02I 3NGBC 4QXTB 3VH8B 1IGIH 5JQ6H 1FNAA 1VACA 1BZQK 5GGTL 4JCMA 4Y0GA 1FO0B 4IMKA 4OZGE 3TVMD 4TNWK 3ULVF 4OIIL 3ZKQD 2VSCA 2WUBH 4HX1A 1MREL 3D25B 1I1AD 4GBXA 4WGVB 2ATPA 1TDQA 4GT7A 4JY4A 4OZ4B 1HHJA 1VA9A 3STBA 2RAMA 4I3SL 1KTDA 3PQYE 4B41A 2DJ4A 1G7PB 5GISH 4GQ9H 1NC4D 5IMOB 2A74B 1YEKL 3GJFK 2DTSA 4XC3L 1NCCH 4XVTL 1PG7L 3MLWL 2IAMD 3M1BB 1JGEA 5IMKB 1JV5B 1LEKB 3S37L 1WBZB 2YEZA 4UILH 4JY6B 4OCXL 4YDIH 4NGHL 4NWUL 4ODHH 2VDNH 4LGPB 4IBLT 2GCYA 4Y4FC 1C5BL 4LVNC 4HWBA 1JZ2A 4UQ2B 4JFDB 3ULUF 1CBVL 4Z7QE 5T1DL 5E24E 5DJAB 5BW7C 1N5YH 1MPAH 3RTQA 4GQPH 1EFQA 1CIDA 5K9QG 4M1GH 1C12A 3SJVE 5F70A 5TGBA 4I4WB 2E27H 4ZTPH 2X1PA 1JUFA 3VI3E 3ZMRA 5F88B 4HUWA 3HUJF 3BKCH 1TCMA 5JUEL 3C8HA 3MYZA 4K8RC 1A64A 3TH3T 2AJYH 4ELMB 1FJ1B 1R5VB 2F54E 3EYUL 1T5WA 2FR4A 4KJWC 1QBAA 4G42A 2DLFH 4H1LG 1BLNA 3GMOB 1U8PB 1DVFD 3KR3L 4FZEL 1U8QB 4PLOB 1ZXQA 1BJ8A 2RR3A 2VLLA 4PJ8A 2ATKA 2X4OA 4MMXC 3QA3A 3RVXC 3WDIA 2W60B 2ZKHL 4BH7A 4BSVA 2FWOA 3ZHDA 2P44B 4GMTH 1U58B 5L2KA 2XT1B 5TDNB 3I84A 1CL7L 4OLZH 4ONFL 1NBVL 1AP2A 2AJVL 2DKMA 4HZLB 5B22A 5E2TH 1BWMA 4P2OA 3IAQA 3SJVA 4LKCB 2QV2A 1PD6A 4AIZA 4Y4FA 3ZE0E 4FQ1L 3V6OC 4OLWH 5DVKA 2YZ1A 5MERA 4Y88A 1F6AA 1NEZG 2BVQA 5BW7A 1PEWA 2R0ZH 5D96B 1KLGA 2F54A 4LSUH 4ERSL 1JHTA 2YPKA 4JDTH 1J8HD 5CUSH 1OGTA 1Q9WA 2PO6C 3BEVA 4LU5L 3WFDL 5J3HD 5DJCA 4FG6D 3RPIA 1FZMB 4JKWA 4LVOC 3F5WA 1D9KB 1FN4A 3U7WH 4HWEL 2Q7NA 4WU5B 4X8JA 4IIQB 3GB7A 4JRYA 4L1DA 5I1LA 5D7LD 3QR2A 4G9FB 1QTYT 1I7ZB 3O4OC 1UACL 5E08H 4J2XA 3GSNL 1D5XB 5CBEA 1QLFA 1QSVA 1E4WL 2EH7H 4BSWB 4NRYB 3TJHD 3MLRL 3HPLA 5C2UB 4OCYL 3LKPB 4NDMB 1EA9C 4GRLB 5F1KC 5JHDB 5ERWB 4KK6D 2GUOB 3VRJB 1ND0B 2JIXB 4M62L 5C7XL 4CL7A 4AENB 1GOFA 1OOAA 3NCEB 1MIEH 1M6OB 2W9LA 3I02A 2QJDA 4Y5VC 4OGYH 4D9LH 1ADQL 4JRWA 4JFYB 4KMLB 3B6SB 1S7VB 1CGXA 2JJWA 4X7SL 4IDJL 4J8RA 5FYLH 1KENH 3H9HA 3MTRA 2FECI 4XMPH 3CU7A 2YPLB 3MUHL 3QUKB 3FT3A 1NGYB 3BGMB 3W39A 3WO4B 5AEAA 5SWQA 4OCRH 4LLQA 5F7EL 5HGAA 4PJ7F 2PW1A 2IPTL 3QFJB 5D2NE 5CJ5A 4L9LC 4U0RB 3UJJH 1JZ6A 2PO6A 1VGKB 4X6DB 3THMH 3ET9F 4F57H 2NTFB 5EOCL 4OGZA 2Q87A 3ULVC 4Y16A 5D7JC 5T1KD 2JKXA 4JM2D 3BP5A 1MFEL 3SDAC 1IT9H 3FQRB 1OTTC 1A6WL 3GDBA 1XGPB 2CIIA 2FX9H 25C8H 1U92A 1ORSA 1E6JL 4FMKA 3U9UB 5GZOC 3BEWB 4D9RD 3HC3H 4YPGB 3IXAB 2PXYA 2VLKB 4WFEE 5CJOH 1KXTB 1WWBX 1UM6H 4KTDH 2P5WB 2IALB 4XPAL 3FCTB 4HGWB 1H15A 2DLGA 3RUGB 3CCHA 2C4XA 1NPUA 4XI5D 3SEPA 1WICA 5D2NA 2R56L 1BZ9B 4UAOB 4U6VH 3X17A 5MENB 2B4CL 1T0MB 2VZUA 3MUY1 5D1ZC 1DQJA 3VXNA 4RZCA 4FTVB 5DI8B 2NW3A 2UWEF 2BSSB 4GAYA 4GJTB 1IGMH 5HHMB 5EULV 3T2OA 4OV5B 1B4JH 4GW4B 4L9LA 5T33L 4KAQH 3KPPA 4JHWL 1CN4A 5IMMA 2D0HA 3LKNA 3MRCB 4QWWC 3ULUE 3OKNB 1XGTA 3MLVH 4FQPA 4F15C 4X6FA 1AXTL 1V3JA 5EPMA 4YHKH 3T4AB 3E6HA 5CEZL 3TIEB 1UZ8B 3VFWA 1DBJL 3FB5B 3MCKB 4XCEB 1MHEB 1KJ2B 3GJFH 5GGSA 5I76A 4HK3N 2BERA 3IDIA 4NRXA 3O3DA 1XIWB 4PJIF 5TQ2L 3V7MA 5DK0A 2VXUH 4OD3H 4GKOA 4ZOEA 2Z93A 3MJ8A 3TJEL 4D0DB 5FGBC 4NM8H 1NUFA 3MJGX 1R24B 3BW9B 2BSRA 5FO9A 3GMPA 4JFDD 1FV1A 1KLUA 4TTDD 2X09A 1ZHBA 4JM4H 1FGVH 4PJDB 3HR6A 3A0OA 4XB8A 1Y0LA 5AZ2H 3WIHL 2LTQC 1AFVH 2FH8A 4F7CB 1KPRA 4LCIH 5DJYB 2GY5A 4ZPVB 3MGOA 4YXHH 1G6RB 2JB5H 4KV5E 3FRUA 4L4JA 4LK4A 2XACC 3QULB 2HJLA 1C7SA 1T03H 4Y5YB 5FB8B 2XZQH 5C09E 3GRWH 4IS6B 3WUWA 2XYCA 1A3QA 5TE4H 4WI6A 4HD9A 1U6AL 4E0RB 2FHFA 1R3IH 1CFVL 2ZUQB 4F7PA 4Y4HC 2WWMD 3T2NL 3GKWH 1U91A 5I16B 3GSWB 4PJXF 3HUJA 4P2RA 5H2BB 4MQXC 35C8H 4YH6A 4GMSL 1YMMA 3VGAC 3B9VA 4PJCF 1N5AB 1RUMH 5IM7A 5I1CH 3P0GB 1VFBB 1AGDB 3QNYB 2VTFA 3UPRB 1LMKA 1U8KB 4FQQB 5LVEA 1NH6A 4PJHB 5ESAA 3MNZB 4HC1H 2P8LB 4P4KB 1PX4A 3CPLB 4IOSD 4W68A 3F8UB 4XAWL 2DL9A 1I1CA 4AG4H 2DKUA 4HKJA 1C5DA 1MNUL 4P4RB 1MJJA 4Q0XH 4HFWA 4XC1L 5TDPA 1R3LA 3HCVA 4WUKH 4DAGL 1KIRA 5FV1L 3U36B 5K9JH 4TULL 2FHCA 3QG6B 3U4EB 2ZOKA 5IEHA 5C09A 3TCLB 2X9XA 3CUPA 3CMOH 4QHMA 2HMIC 3MRBB 2JB6B 3MBEB 2Y7QA 4HUMB 4RGNB 2XWBA 5ECJE 1A4JB 3O81A 1IGTB 5K59F 4WHTB 1IAIL 3SY0B 1O5DT 2XQYK 1D9KD 3PGFH 5FHAH 1QFWI 4PUBH 3AAZB 2K7PA 3P73B 4XP5L 4OQTA 4NQDB 1ZA3B 4G9FD 4S1SH 1NFDF 1IGCL 4J3TA 4Z7UF 3MFGB 5BOPA 5EU3A 4Y4HA 1FCCA 1VB9A 2BRRL 1P4BH 1QPPA 2C3GA 5MHSD 1FBIH 1CXEA 4GRLD 5JZ7C 1KPUB 5JHDD 4AEHL 3JV4A 4Z9KB 4PTUB 1CLOL 2JIXD 3F12A 1U0QA 3ETBF 9CGTA 3VXPA 2QSVA 4KDVA 1AD9A 4J1UA 2ZSVA 1G84A 4R26L 4HKZA 5D72L 3SE3C 1U8OA 1JPSH 2H32A 4JREC 4Z0XB 1HILB 4N8VA 3BIAX 4JRXB 4OZHF 4NRZB 3SGDI 5B8CC 3MRRA 1S9WB 3CLFL 1SM3L 1T7XA 3D0LB 5ITBL 4LSRL 4WO4B 2ICCA 3IETB 4ZS6D 4W6YB 4HK3J 1AC6A 4J4PC 3KLHD 1MAJA 3PJSA 4Y1AD 3B9KB 1CLCA 1WF5A 2YPLD 1HK6A 1N6QL 3BZEA 5D7SH 4Q9CA 4AQ1B 2AJZB 3GIVA 3Q3GA 2GAZB 2F19L 5CILH 2H1PH 4BKLB 4RRPA 1EAPA 2V9TA 3QFJD 4RMSA 4YC2C 3ZT5A 2NNAB 3UAJD 1QEWB 5F9AC 5IVXE 4Z95H 2D3VA 3KYNB 5FOJA 2R2CA 1TIUA 3N9GH 1W8NA 4PJ7A 2PTTB 3IU4L 3T0EC 4TVPL 4HIXL 3T0AA 2EDOA 2MHAA 5FFLA 4TQEL 4A6YH 5DGQA 5DSCA 2Y4SA 5E00A 3T77B 3O8XD 1ZS8A 5EN2A 2D7QA 5HHQA 5DJDA 3KNBB 3UTPE 1YJDH 3FO2B 1F2XK 4HUXA 4K7FA 5IWLC 1L0XA 4GRMA 4HIJB 5GGTH 1BPVA 1WC7B 4PJBF 3WIFA 1LK3L 2P5WD 4OIIH 1W72A 1MREH 3VD9A 5FM5O 4K7PL 4X6CB 4R4BB 3V6ZA 1Q94B 2OX5A 3BE1L 5HI4D 4H0IA 3SE3A 4NWTL 3VD4A 1RUAL 1RJCA 4TYUA 3X3FL 3AS1A 4PY8J 5MEND 4I3SH 2HJFA 3W0WE 3FONB 3TIDB 4BH8A 5B8CA 4YR6B 1RJLA 1YEKH 2XTJB 4J4PA 5DD5L 4FFWC 4PBVC 4PJIE 2FO4A 4FTVD 2EYTA 1PG7H 2XNAB 3MLWH 4XVTH 2X4RB 3WN5C 1W8OA 5HXMA 2CLRA 4OCXH 3OKMB 4NGHH 1INDL 3H6JA 4NWUH 3OAUL 3DXAE 1TZHA 2BHYA 1C5BH 4OF0A 1HE7A 2DS4A 4HAFA 3MMEB 3QWRA 2UWEA 4WI9A 1CBVH 5T1DH 3QUML 3DVNA 4EUPA 1BGXL 2Y6SC 2Z9TA 4MDJB 3T0EA 3MUJA 5C1MB 3QH3B 4O2EB 3GK8H 3G04A 1QP1A 1I1FB 3MRMA 1XIWD 1CLYL 4EI5C 4MJ4A 2DN7A 3VXRB 2CLZA 3UTTD 3W0WA 5LGJA 5IWLA 2AXGB 3HNVL 3L3JB 5JUEH 4MDIB 4MXQC 1GYAA 4OZIF 3TBWB 4EXPX 4PJIA 3EYUH 2FBJL 1KTDB 1L9NA 4PJXE 2A77L 3CGTA 3QJHA 3KR3H 4FZEH 4RIRB 3DTXB 1IM9A 1MI5B 2ZKHH 4UIKL 3O2DA 4XNYL 1JGEB 4AH2B 3P4NB 2C9AA 3QXAB 3LIZL 5B38B 4ODSL 1CL7H 1TTFA 3BT2L 4NT6A 1U2CA 3J7HA 3GNML 1BEYL 1NBVH 5ICXB 1TPXB 2ED7A 3X13A 3WN5A 1T66C 2AJVH 2BNRE 5D1QC 2VITB 1KPVB 1OD7A 3DHJA 3GSRA 3FHQA 3RGVC 3S3SA 4R4ND 1JK8B 4OKVB 2L0DA 4FQ1H 3NTCL 5C70A 4NOFA 1C12B 4KC3B 5JO5A 1TQBB 1ZLSL 4PG2A 5EOCJ 4PJXA 1O7SA 3WFDH 4LU5H 3DWTA 4LEXL 1QBML 3NGBB 4I3RL 4PV8A 3JTSB 4P4KD 2HT4C 1NGQL 4PBXA 4PJCA 3ZKMD 5ENWA 1J05B 4HWEH 5MEPA 4LKXA 4EI5A 4LLYA 4X6DE 4G42B 3QQNA 2MKWA 3LVEA 5DFVD 4OFVA 1UACH 4Z7UE 3GSNH 3MLTB 2HLAB 2IADB 1E4WH 1J18A 3UTQA 4BSVB 3U79A 3JVGC 4LOUC 5A40E 3EJJX 3MGAA 4HJ0C 3MBED 2BNRA 4M02A 3MLRH 4NHCL 1CDIA 3MRJA 2WANA 5L2KB 4RGND 4OCYH 4K07A 3G5XA 1KIQA 2ARJA 3HE7D 5I9QB 2VLKE 1AP2B 5CP3H 2CRIA 2I24N 4M62H 4NPYB 5C7XH 5DQJB 1RZGA 2P5WE 3BZFB 2BVPB 4KKCD 1JNNL 4NQDD 4G8IB 3RUGE 1A02N 4YDJA 5I1AB 4OZHE 1J8KA 2FJFA 2XN9E 1N0XL 1JZ4A 2CKBA 1VESA 5D1QA 1QHOA 1ADQH 3RGVA 4Q9RL 1FH5L 4X7SH 4YO0B 4IDJH 3BIBX 3QDHA 3VXSB 1NFDA 1S8DA 1JTPA 1BQSA 4Z7UA 2AJ3B 5F7EH 3ZDYF 3C8KA 1TTUA 2AEIT 1FN4B 4OM0L 4KI5F 2IPTH 5HGHA 1G7JA 4X8JB 3R4DA 3NFPB 3GB7B 4JRYB 5HHME 3RWDB 5I1LB 4UNVA 2ARJQ 1FSKC 1CE6A 4H26B 4JRXD 3L5WB 3ZT6A 4MHHI 4NKDB 2RCSL 3C5ZC 3IJHA 2OJEB 4C56E 1ZT4B 1DBAL 1MFEH 4WO4D 2X4SB 5HI5D 3RWJB 1A6WH 5HVHC 1LP9F 1XR9A 3B9KD 4I5BB 4S1DC 5GRJL 1E6JH 5HHOB 1Z3GL 4OZHA 3QCUL 5E99L 5CBAB 4G6ML 4HKBA 4EN3C 5C0CA 5IIEB 4M1CC 2EDQA 1UYWL 4EDWL 3HC0B 4PJBE 3U0PA 1PW3A 3ZHKA 3W11C 1CDGA 3HZYB 4XPAH 1WCBA 3DRTB 3TV3L 5IB3B 1EFXA 2FX7L 4M48L 1S7WA 5LJYH 3BRDA 1U8JB 2R56H 1H3UA 2CUMA 1YEGL 4I0PC 3ARUA 3RRQA 4IMLB 1NJ9B 4W4OC 4LLQB 1IGYA 5HGAB 4X6EA 4I18B 5E8OB 4JZJC 4LSDA 4HPYH 3ZL4H 4H1LH 5KSUA 2DJSA 5EC2A 3DPBA 5T33H 2P45B 4JHWH 3P4OB 3EOYG 5EZIL 3BP5B 1FYTB 1UQSA 4IOFD 4OZFA 5ALBL 2CIIB 1EIBA 5I1KL 4QRPB 4ZFZA 1U92B 1ZGLB 5HYSG 5B21A 2X7LB 5BQ7B 2A38A 1KOAA 5GS2D 1MWAB 1AXTH 3FB6A 2ZNXA 5CEZH 4U33A 1DBJH 2E3VA 2R2EB 2XTJD 1R5IA 4OLYL 4F2MA 3DX7A 4FFZL 4HJGB 5GRUL 4YHNB 5DWUL 4PJHE 5TQ2H 4ZUTA 4NQVA 4NO2A 4HBCL 3TO4C 1H15B 4EN3A 3G5VA 3NCJL 3TJEH 4Y8AA 3STLA 3ARDC 1ACYL 3WNPA 1CFSA 3MRFA 2VXTL 4Y5VB 2C3XA 1NFIA 2F9BT 1DQJB 5ISZE 2IFGA 1LEGB 4Y8DC 3WIHH 2XY1A 1G9ML 4I0PA 1S7TB 3H9SA 4W4OA 4JFQA 1Y6MR 4WV1A 2DB8A 3SKNA 3SN6N 3VXRD 4UT6L 2EIZA 1TVHB 1NAML 4JZJA 1C08B 4MB5A 3BN3B 1U6AH 2YD1A 3HTLX 1CFVH 3TBYA 3T1FA 3MRPB 1RJYA 3T2NH 1UXSA 1UCBL 1DDHA 3BO8A 2W92A 5D7JB 1BVZA 4FOMA 3E6HB 3SDAB 4MZ2A 4GMSH 4RQQB 1MI5D 4OZIA 4TTGA 4MZ3A 1I7UA 5F1NA 3QQ9D 5DTFB 5C2BL 5FOBB 2UZIL 4G7YL 1FL5A 3NIGF 2Z93B 1CICB 1S7SB 4L8DB 5DD3L 4KH2A 3GMLB 4XAWH 4TPRL 3ZLQC 3B3IB 3K3QA 3J8F7 5L9DL 1L0QA 1JWMA 5J6GB 4XC1H 3FB8B 4F7EB 3NCCB 2XWTB 1S5IL 4DAGH 4QYOA 5DMGC 1CGWA 4TULH 1GOGA 2VISB 4BQCA 5JPMB 3VGDA 2R23B 1OLLA 3REWA 2EE6A 4ODUA 2Q76A 3JV6A 5EC1A 2NQCA 3F6IA 1GVIA 5HYJE 4ZNEE 5ABDE 3BKML 3FRUB 5D1ZB 3S8WA 1CR9L 2HJLB 1ODAA 1S9VA 2YWZA 3E0GA 3WUWB 3RI5K 3QPXL 1U95A 1IAIH 1YEDA 1M05B 1ZLUK 3HS0A 2EDEA 3BVNB 3WD5L 4KI5C 3VXQB 1M4KA 5KSVB 4XP5H 1T1YB 1JYVA 3U4BL 1VEPA 3G6DL 4NKMB 4P2RB 1IGCH 3M8OL 4OGAC 1YMMB 2ITDB 4O58L 4LHUB 5IM7B 1J12A 4JFXB 4Y5XA 4LHJB 1IL1A 4XWGL 1J0ZA 5IVZB 5J56B 2BRRH 1WIOA 1FFPB 4WI8A 2HTKC 5L2KD 5C0EB 1UEYA 3GSUA 3S4SA 3Q2CA 4HWZA 5KANG 3EAKA 3ESUF 4KI5E 4AEHH 2IG2L 2G9HB 4BZYA 5C0DA 1CLOH 1Q8MA 2YN5A 4JLRB 5HYJA 5TDPB 2HN7B 1RMFL 1KIRB 4R26H 1CE1L 5D72H 1ZHLA 3O3BA 2I9LB 2YD2A 4KMTH 4KHTL 5E8NB 1JPGB 2FCBA 5I66B 1JWSB 5B4MC 2UY6A 1G0DA 2HVKA 3LOWA 5EU6B 1XF1A 1FZJB 2V9QA 4LLAA 3QUYC 2FYYA 3CLFH 1SM3H 1TVBA 5ITBH 3OX8A 4LSRH 3I75A 3I6KB 1UJ3C 1A7RH 3ZO0A 3VXSD 4NZUL 2LTQB 2ADJB 1N6QH 2P5EA 4U1IA 4JG0L 1N3NB 2F19H 2FJHA 4JKLA 2AERT 4ODVH 1NGWB 3BQUC 4JRYD 3QI9A 5FF6A 1G9EA 4JVPA 3KHOA 4OBRA 4K8RD 1T89C 1UB5A 3KPQA 5IESL 5CMAB 3K1DA 4KJWD 3IU4H 2IANB 4TVPH 4HIXH 1CQKA 3AS0A 4R96A 4DGYL 2P1YA 4F9PC 4TQEH 3AU1A 3HMXA 4LRNL 4TUOA 1J0KA 1UH2A 2J5LC 2NPLX 5HDBE 5HHOD 3ULSB 1MVUA 4CVZB 2MSPA 1UB6A 2EYSA 2HWZL 4M4PA 2OS7A 2IC2A 2BSTB 4RISL 1AD9B 3KJ6L 4J1UB 4U1NB 1LP9A 3VXRE 4PLNC 3U6RA 4HKZB 4ZUWA 5EFIB 5D7KD 1MJ8L 3DVGA 5DHVA 3NCYP 5CWSB 1UADC 2HTLC 4L3EB 4K7PH 4U1SB 1BD2E 5D5MB 1IZJA 5ELIA 3QIWC 15C8L 4AL8L 5T3XD 1TMCB 4MWFA 5DMKA 4NWTH 1RUAH 5JOPD 5D2LF 3X3FH 3L5XL 5T1LB 3L3KA 4KUCD 4PGEB 4UNUA 3QUYA 3CVHA 3LKSB 4TVSa 2FJGA 3QFDA 5DEGA 2IQ9L 5DD5H 1QFUL 2D2OA 2L4OA 3DUUB 3H0TA 2X40A 1X7QB 3PABB 3VD5A 4W6XB 3SQOL 2OM5A 1QNZL 2Q1EA 1BVLB 1DL7L 3EO0A 1INDH 3OAUH 3VFRB 3VWKB 2AK1L 4YLQT 3BP6A 2B4CC 3BQUA 1FYTD 5E6IC 3T0WA 2MHAB 4HGKC 1E28A 5GS0C 5DSCB 4QRPD 4DTGL 1J1OL 3QUMH 1M7IA 1T89A 3N0PB 4WDIA 1BGXH 1OF2B 1CD8A 4Z5RA 3MOQA 1BD2A 5ESQA 3IB4A 1MH5A 4K7FB 4PG9A 4F9PA 4LDLB 3VMOA 1MCBA 5SX4I 5FA3A 1YEEL 4X7DC 1J0HA 4ZAKC 1YEJH 1CLYH 1I8IA 4XBGA 3VFMA 4PJ5A 1W72B 4WTZA 4I0CC 4UBDD 3NBNA 43C9A 5F3BA 1ED3B 4EI6A 3SPVB 2O61A 3S6CA 3HNVH 1WVZA 3DURB 4P9ML 2YSSB 4JREB 1BFSA 1IAII 2FBJH 3BKYL 4R0LB 5EU4A 2F8XC 2A77H 1E4XL 4MAYB 3QXUA 4ESKA 3QIWA 5A2IH 3CX5K 4XXDA 2M2DA 4NSKB 4UDUB 4UIKH 4XNYH 3HI6L 1YUHA 3IFLL 4P2QA 5FYJE 2CLRB 1ZVSA 3NIGE 3LIZH 4ODSH 3BT2H 2CKNA 4GLRH 1LD9B 5HGBB 1G1YA 3GNMH 1BEYH 3T0DA 3S5LA 4XX1G 1Q9LA 4YDLC 2BCKA 2VL5A 1KB5L 4OIAA 4GKNA 4U7SA 4EUPB 5D7JD 5CSGA 2Z91A 3T0EB 3NTCH 3SDAD 4R4FL 1UKQA 1OTTD 3OJVC 3N06B 4TUKL 1R5WA 5FYKE 4QXWA 3G04B 2ZCLH 5EUOF 5DD1L 3O11B 4HS6A 2EDLA 4JFPB 1ZLSH 1FFOA 4F37K 3O3AA 1OL0A 1P53A 5L7XL 4LEXH 1QBMH 1CICD 1UM4H 1KXQE 1NGQH 1AJ7L 5CCKL 1YY8B 2PETA 2XI9A 4G6KL 3B2VL 3KHQA 3NIFE 3QJHB 3S88H 2P7TA 2HKHL 1Z9SA 3HG1E 5DD6B 5DVOA 5GHWH 4P46C 2EIBA 1ITBB 3FRPG 5HHXL 3CFKA 1MLBB 5I8EA 2AXFA 5HJ3A 4NHCH 2ORBL 4NQEB 3PDDA 1MCKA 2VO5A 5D1ZD 3IJSA 3L5JA 5IBUB 4EBQL 4NP4L 8FABA 4M8QA 3AFLA 1GZPA 1WAAF 5DUPL 1KSRA 5IGXL 3SCMC 3MR9B 3KS0H 1FAIL 1K4DA 2ZCKL 5KS9B 4HV8B 4BFBD 1JNNH 5TH2A 2BOCA 4P2RD 1N0XH 1YMMD 4PJGF 1F90L 1QO3B 4QWWD 1LQSR 4LHUD 5GGRA 3AMLA 3PDOA 1B0RA 4Q9RH 3MRIA 3L9RB 1FH5H 5ICZA 2DWEA 3PWLA 3Q6GL 3ARPA 3MOAL 5CJ8A 5IFJA 5AWNL 5IMLA 5JW4Q 3CDGA 5B3JF 4PJCB 4OM0H 4YFDB 1DEEA 5FM8A 1A1MB 5MEPB 4LLYB 3T1WA 2XFXA 4V1DA 3L3IB 2OSLB 1LO5A 2YBRA 4NC1C 3LRSA 2IH1B 5EU6D 2RCSH 4F33B 7FABL 1AY1L 3ZYJA 4KK8C 3VG9B 3GJFB 4GKSB 1T04B 5GRJH 3TA3B 1FFQA 3QUXC 5MEQA 2UZYB 5E1AA 4P46A 4PLJC 1Z3GH 3PG2A 1GXEA 1FO0L 3ARRA 3QCUH 5C08E 2ADGB 5EUKB 3TZVC 5E99H 5HGGS 5C0IA 4G6MH 1UYWH 4YHPB 1G9NC 1OAKL 2QR0B 4EDWH 4EDXB 4ZFOA 4EIGB 2OL3A 2LAAA 1HH6A 4RX4A 3RY6C 3TC9A 2R1WB 4WEBH 1D7FA 2EDFA 1F3JB 3HLAA 2CKBB 1HI6A 1FG2B 3TV3H 3MV8E 3BZ4A 2FX7H 4M48H 2BY1A 1JGDA 1JYWA 1XT5A 3RI5F 1E27A 2IAND 3WE6B 4FHBD 1WZ1L 3O9WC 1YEGH 4N0FB 4MQXD 3QZWA 4LPTA 1PLGH 4HFUL 2Y25A 2C26A 3RIAK 3VDBA 1XH3A 2EIEA 2JJUA 4MNQB 1CE6B 4WFHD 5ID1A 4GG6F 3CX5J 4OI8A 3IJHB 1IC4L 5EZIH 5C08A 2IH3A 5E8DL 5ALBH 2P8PB 1XR9B 1BF8A 5I1KH 4CMMB 3CXDL 1OHQA 5T1LD 3X14B 3QDJA 5FUZL 3ZSTA 1MUJA 3WCYA 1T7ZA 2V9RA 4ONGL 3L3OB 4OLYH 3EOBA 5BRZE 2D7TL 4PYHA 4FFZH 2H9GA 5GRUH 4XAKD 4ODWA 1BJMA 5DWUH 2PKDA 3QUXA 5GIRA 5D2LA 3KYKL 3KXFE 4U6HB 2AJSL 4HBCH 1KTLA 3BN9C 3NCJH 4RGMC 3VWKD 5CIPA 1EFXB 2E7BA 3RY6A 2BDNL 1ACYH 1CU4L 2BC4B 4N0UB 1D6EA 1RUPL 3N50A 3MFFB 5C0NC 2AJUL 4MQ7B 5KN5A 4HT1L 3F6LA 2VXTH 4TSBL 3ILPA 2YD3A 4MA1C 4WFFE 1K5NA 1WZLA 3O9WA 1RHHB 1S9XB 1DUZA 3B4NA 4YHZL 5JZ7D 5DRWB 4CNIA 3MRDA 1HKLL 4OSUL 3VFSB 4QLRA 5ETUA 1NAMH 4LIQL 4H88L 4YWGL 4WHCA 2NY3C 3LKOB 1A4KA 1D5ZA 3OKKA 2R2HB 4M6AA 1FSKB 4UT9L 5CAYB 1NEUA 4LPWA 2UY7A 1ROWA 1I7RA 1A7PL 1UCBH 3PNWA 1F8TL 4H8WL 5JOFB 3C5ZB 5DRNA 3KXFA 3M45A 4MAYD 4ZDHB 4K23L 5KVEL 2R1XB 4HUUB 4EVNB 3OKOB 1R5IB 4J4PD 5EUOE 5DR5L 4KZDL 2EC8A 4ZQKB 1I8LC 3KPRB 5C2BH 4Y2OA 2UZIH 1B3JA 2ICES 4G7YH 4PJ9C 4YZFE 4MX7B 5DD3H 1AIFB 1EO7A 1AHWB 3UYPA 4TPRH 1RZ7L 4U1JA 5E5MB 1LNUB 3CFJA 4K71C 3UDWC 5L9DH 3E3QE 4MAUL 3ZKNC 2VNCA 2G75A 3QWRD 5DQDL 5DC4B 4QNPF 4N0YL 1S5IH 3RHWK 5FYLD 4EXKA 2HT2C 3I6LD 3T0ED 4M5YL 2V2WB 3QDGB 4I0PB 3H9SB 3HI1A 3LY6A 5I73C 5BXFA 3BKMH 1RK1B 4U49A 1CR9H 2XA3A 1XCTB 4NCDA 4TOYL 1NL0L 2K9UA 4N8CL 5GGSY 1WAAE 3QDME 3QPXH 5INCB 1BZ7B 1QQDA 2QHRL 2YD6A 4URTB 5FECA 3BPCB 5EUOA 3BWAA 2ZUVA 3WD5H 4U6XA 1HDMB 5DO2D 1NAKL 3U4BH 4WWKB 3SHSA 3G6DH 3VFNA 2LV4A 4QRSB 3M8OH 1AQDB 3ZZ1A 3IFNL 2QSTA 2IANE 2VJXA 3KAAA 1QPXA 4OZIB 3P30H 3HPJA 5F1NB 3U0TA 5JLZB 3BPOC 5K33A 4XPFH 8CGTA 4P99A 4NQED 3TF7C 3WV0A 4HS3B 4K2UL 4XPTL 1QFOA 3ARWA 1S7UB 3DI3B 3OKDA 2ICWJ 1FRGL 2KKQA 3R0NA 1I8LA 2IG2H 3T2PA 1QFPA 2EEBA 1T2QL 3MNWA 1XZ0B 2Z8WC 1WBXB 3WL9B 1J1PL 1HHHA 1SY6H 4PJ9A 1RMFH 4MXVF 3TO4B 5ACZA 1JZ3A 1CE1H 4L3EE 4LMQI 4KHTH 5I8OL 1MCIA 5D5ME 2OQJA 2HFGL 3ARDB 3UDWA 1WAAA 1M1SA 1INQB 1H5BB 3SDCA 3KYAA 2CMRL 4LF3B 3MA9H 5ANMA 3RNQA 1KEGL 4NZUH 3PUCA 4MD4B 2YR3A 4JG0H 4I2XE 1YEHL 1OAXL 5CFHA 4PJGA 1KIUA 1MHHA 2I26N 1DP0A 1PGRB 2CO6B 3I9GH 1EHLL 4D8PB 2N1KA 1F42A 1RJZB 2NW2B 2WBJC 4X4YB 5HHNA 4LP4A 4YGAB 5IBLC 3EGSB 5EBLA 3Q48A 4MXQD 1GC1C 2EDDA 4P59L 5IESH 2VQUA 3QNXB 4DGYH 2D4DA 1IGJA 4I9WD 2ESVB 4DW2L 1HN1A 4HWZB 4LRNH 1OPGL 3NZHL 5I1EL 1WWCA 1JF1B 2HWZH 2O5ZL 3QQ3A 4FQHA 1JGVL 5ADPL 1AQKL 2HJKA 4RISH 3EZ8A 3KJ6H 3O3BB 1KF9B 1T66D 1MJ8H 4PPTA 3O4LB 5D1QD 5DFWH 5BZDA 4HK0B 3SDXF 5C8JB 3OX8B 3KYMA 3RGVD 15C8H 4AL8H 2DQTL 3I75B 4WU7B 3D18B 5EZLA 4DWHA 3JXAA 2NY2C 2XICA 3L5XH 4XNQB 4BK4A 5JHLL 2AV7A 2XKUA 3RZCB 5C9KA 3REVB 4N9OB 1JRHI 2FJHB 4HLZG 2C4FU 3DSFL 4UB0L 3RWEB 2IQ9H 3S9DB 1QFUH 4JKPL 3TYFB 4DUVA 1HSAB 3WSQL 1PKQB 1H3XA 3SQOH 4MNQD 5FEBA 5GSRB 1PYWA 1QNZH 2DM2A 3W2DL 2OTWA 3CSPA 1DL7H 1ES0B 3ARFB 3WJJC 5L88L 2WM0A 2AK1H 5B39A 2YHGA 4APQC 5SWSB 3TNNB 2A9ML 1QSEB 1FVCB 1OD9A 3TBVB 4Y2DB 3HA0A 4DTGH 1J1OH 2CUIA 5TF1L 3B9DA 3ZE2F 1BOGB 3WIIL 3O6LL 3ZYIA 4GG6A 4X5WB 5EOTA 4DFHA 4LOUD 2DAVA 1G6RL 5KZCB 4HJ0D 5GRWA 3CH8A 2DJUA 1KCKA 5KOMC 4MMZC 1LP9B 1YEEH 3U6RB 2MCG1 4YBLC 3D85B 3IF1B 3OL2A 2DQFA 2ENYA 4EEEA 1EFXD 3GSNB 2GW5A 5JW4M 4MWFB 3PP3K 1TZGL 5DMKB 1YN6B 1UENA 3BKYH 3RBSA 1HWHB 5F21B 1E4XH 1A22B 1Q9KA 3SGEI 4CU8A 2FJGB 2PTUA 5FV2A 1T21A 5D6DC 4JEGB 4ORGB 4GXUN 4MXWL 1UJ3B 5I8CB 4NYLA 3IFLH 3U4AA 4PV9B 2VIRA 2XOTA 1UGNA 2I5YL 5TDOA 3DMMA 5C6WH 1NBZA 4X99A 5IB5A 1KB5H 4O02L 3GUTA 4ZO8A 1LO3L 2VDRL 1BFOA 1YMHB 1M7IB 2F5AH 1A9BA 3UZVB 3C5ZD 3WJJA 1A6ZB 2OK0L 1G9MC 4GG8B 4Z5RB 2P42B 1A6AB 4XCNA 4R4FH 4KKBC 4YHMH 3MV11 2I07A 4TUKH 5CJXC 1UA6L 4S1DD 5FA3B 3ES6A 5DD1H 1IQDA 4S10A 1EUUA 3KPRD 5F44A 1N8ZB 2J5LB 1QSFB 5BZWB 3RVTC 1UKTA 5DJ6A 3WEXB 1XGQB 2P8MB 4MNHB 5F3BB 5L7XH 2EEAA 1KGCD 2DI7A 2HFEA 3DX9A 3QYCA 4M1CD 4U1LB 3S7GA 3BAEL 1F4XL 1WK0A 5IHZB 4NQCB 4J12A 1AJ7H 3GMNB 3P9LA 4ZMAT 5CCKH 3W11D 1CQYA 1BIIB 4G6KH 4G8FB 5EU4B 3B2VH 4HIHA 5KAQF 2V2TB 3V4PL 3R8QA 2HKHH 1K3IA 4J3XA 2VR9A 2AV1A 4RWYL 4LGSB 2VDKL 3QDGD 4I0PD 5DUBB 2C4FT 5C07E 5HHXH 3H9SD 1U8MA 3RVUC 1HYSC 2ORBH 4R2GB 3I3BA 3EJZC 4NZJA 5D6DA 1M7XA 4NP4H 4V2CB 3MRQA 3PHOA 1Q9LB 1SQ2N 5DUPH 1QRNB 5IGXH 1YNLL 4MXVE 1FAIH 5DJ0A 4GKNB 4LFHD 4MS8D 2AEPL 2X89A 1N6UA 4WWKD 2Z91B 3LQZB 1UM5L 5E6IB 1F90H 3MV9B 3QXTA 3L7FA 4JQIL 1N59B 4HS6B 1RPQA 3SKUD 3NFNA 4U1HA 3Q6GH 3MOAH 2C5DC 5AWNH 4QF1A 5CJXA 5L2JB 5E4IA 5H94A 4H1LB 3WFHB 1GGYA 3BP4A 4PTTB 4WENB 4ZAKB 1T1WB 4BZ1L 1FPTH 2QKIA 2VN7A 2DQJL 3TO4D 3FTGA 1G7MA 2E9JA 1CCZA 2P7TB 3QEUB 4NJAL 3ARDD 4P5MA 1GZQB 1XGRA 7FABH 3CFKB 3DROA 2JTDA 1FL3B 1X6LA 6CGTA 5DJZA 1T20A 4JANA 3IJSB 1FCGA 4MD0B 2ED9A 5H37G 5HTSA 4A2LA 8FABB 4UDTB 3QBTB 2HFTA 1FO0H 1AGBA 2V5MA 2VXSL 3AXLB 2XKSA 1K4DB 2XKNA 3OWEA 1OAKH 3GGWA 3S96B 4PGBB 4JFEA 3PWNB 2R2BB 5GGVL 1NEZB 4WFGD 3H8NA 1KTRL 3SDXE 2OJZL 1DN0A 1G7QA 4Z8FL 4I13B 2VUYA 4GOSA 3GHEH 1DLFL 3FKUS 3WS3A 3RWFB 1WZ1H 4ZPTB 5JMRA 1CLZL 4K3EL 1FDLL 2ESVD 4C4KT 4YK4C 4HFUH 2VQ1A 4YDVA 4CADA 3U30C 4V1DB 3UZEA 3EO9L 3DV6B 2W0KA 1JWUA 2DTML 1N4XH 4JFFB 5DFTA 3LDBC 3FAWA 3O4LD 1IC4H 3ARGB 5E8DH 3MV7B 5DMGD 1KNOB 1VGEL 3ZE2E 3CXDH 5D7IB 2A6JA 3W9DA 4ZFFA 2P5ED 5FUZH 4KMQA 1HSBA 2I27N 3VJ6A 4ONGH 3SDXA 1GOHA 4KKAC 3KPRE 1MCFA 3BOVA 1Q9OA 2D7TH 4L4VB 3C9NB 3NCBB 4OF6A 4ZFOB 2OBGA 2OL3B 3KYKH 5KANI 3P9WB 2AJSH 3KWWB 4O2CA 3SCMB 5C0JB 3ARFD 4NCC1 3TFKD 5SWSD 2BDNH 1CU4H 1QSED 4RNRA 2AK4B 1RUPH 2W0PA 3T4YA 5E6ZA 2AJUH 4HT1H 4IJ3B 2H26B 3CDCA 4RAUB 4TSBH 2MCPL 4DGVL 4FQ2L 5EIQA 1E0OB 5KZCD 1EH9A 4LGRB 4RWHA 1HQRB 3G5ZB 2BMKA 4JDVA 4HZAA 4YHZH 4PRDA 3CSGA 4L29A 4HWBL 3MXWH 1CI5A 3MA7A 2ZWLT 3D85D 1EEZA 1HKLH 2GTWA 3WHE0 4OSUH 1MFCL 4LIQH 4H88H 4YWGH 3FOMB 4NN7C 4JN2A 3TNMB 4UT9H 3GMMA 4PRPE 3K8LA 5BO1L 2Q3ZA 5B4MD 1A7PH 4F7TB 3QDJB 2J1KA 1F8TH 3MO1B 4H8WH 3OG6B 3IKCA 4PJAB 4K23H 5KVEH 2X1XR 3EOBB 3ARXA 4HPOL 5DR5H 4KZDH 1JI2A 2O26U 2PW2B 4PRHE 3F7VA 2B39A 4X7TA 1OSPL 2Y9RT 3TZVB 1CDJA 1XGYL 1AO7A 1UEMA 1RZ7H 1INEL 1CD0A 2CDEA 3IFOA 4MAUH 5EO9A 4ZUUA 2ZOLB 5DQDH 1K9TA 5IB1A 5IF0A 3IDGA 1YPZF 4N0YH 4PGCB 1DEDA 4JJHA 2OYPA 1MCHA 3ILPB 3OPZH 4GH7B 4M5YH 1OY3B 1JGLL 3O9WB 1O7VA 5EO1B 1W0VA 1M71B 4GS7B 1QBBA 3HAEA 4PRPA 3VFPA 1QSFD 4PJ5D 1DFBL 3OXRB 4L8SB 4A6YA 3GJEA 4TOYH 4NC0B 1WWAX 1NL0H 3QJFB 4N8CH 4OUOA 4KRPB 1J9CT 5IW6B 3OKKB 4BQ8A 2QHRH 5HI3C 1R3JA 2IBGA 4NQCD 1FNEA 2J12B 4ZUSB 3UBXB 3MREB 2DQUL 1I7RB 3HRZA 3PIQB 1UFUA 2HTLD 1NAKH 3QQ4B 5FCUH 1J7VR 5JDSA 5C9JB 4LLWA 4HGMA 4LCYB 4HIIA 1E4KC 4P3WA 1EBPA 3IFNH 2EXWC 4RFEA 3RWCB 3TN0C 5ACMA 5IHBA 1T0NA 4H25B 2BY3A 4Z7VE 2A6DB 3B5HA 4P2QD 1JPFA 2ESVE 1MLCB 3V7AE 4R2GD 4K2UH 4XPTH 5SWZB 2Y1VA 5A43C 5E1HB 1FRGH 3WUWG 1QRND 3BHBB 1TVDA 4JPIA 4K8RL 3C2AL 3L7EA 3OV6A 4YHIA 3UTSA 3CH1B 1T2QH 3V6FA 2PN5A 3LQAC 1J1PH 2EKSA 3BUYA 3HHRB 4RGMB 1FLTX 3ARBA 5I8OH 4CMHC 5JPNA 5E70A 5E6ID 5JOEA 1U9KA 3MV9D 5GS0D 4GW1B 5K9KA 4GAFB 5ITFB 1A9EB 3CFDB 2CMRH 1T5XA 3QEHA 1KEGH 1YEHH 1OAXH 2VRAA 5M7QA 5BCAA 2YC1A 4YE4H 5CZXC 4ZAKD 1EHLH 2CDFA 2GKIA 4PB9L 5T3XL 3VGEA 2BRQA 1QKZL 3WHXB 2I60L 2J8UF 1TCRA 3VDCA 3LSOA 4P59H 1QSEE 3EYFA 1XF2A 3DUSA 4FQCL 1IARB 5CEZD 2ADIB 4GAGL 4O2FA 2Y36L 2J88L 3ARZA 1E4KA 3AROA 1CIUA 1YY9D 4DW2H 1OPGH 1MCPL 3NZHH 1MAKA 3AY4C 5EIVA 4QRUB 5H35B 5I1EH 1DQQB 2O5ZH 4QRQA 4DZ8A 1JGVH 1AQKH 4WW2F 4PJ9B 5ACZB 3LKRA 3VWJC 2ICEB 2VDLL 4Q97A 1J87A 3Q5YA 4KHXL 1RIUL 1KACB 3ROOA 2Z31B 5DHXB 2G5RA 1RQ5A 2DQTH 1U41A 5C0BB 1CS6A 3TLRA 2CR3A 2NX5B 2NMSA 5JHLH 4LSQL 1AD0B 2WIMA 4PJGB 3DNKA 5I73B 3DSFH 4KUZL 4UB0H 4JZNB 4JKPH 5GRVL 3WSQH 1JN6A 5F9JB 2ILLA 4V1DD 4QY8A 1NCNA 3W2DH 4XP6L 2R9HD 3UYRL 2GSIA 4JFFD 1CXIA 1EXUA 2DYPA 1WIPA 4N8VG 1BECA 1WTLA 4M7ZB 3DIFA 3SBWC 5D1XC 3ARGD 3V5KA 2NTSP 3MV7D 3L3HB 1IGJB 3VD3A 4WNQA 3DBXA 4MYWB 3LEVL 5TF1H 5HVFB 3WIIH 1I9IL 3O6LH 4P46D 5E9DB 4ENEC 2BXZA 1EHAA 2YZ8A 1G6RH 2FLRT 3QQ3B 4BELD 5B3NA 2VWEC 4FQHB 4NN6C 1QFWM 4RRPG 4L4VD 4IRSB 4X4ME 3TESA 2X4TB 4LQFL 4LQ1A 3VA2C 3AY4A 3OKLB 4ETQA 3PWUA 4FQIL 5BZDB 3SCMD 4NQCE 3ULVL 3FB7B 1FVDA 4IHOA 4Q9BA 4DEPB 2EDNA 2Q8BL 3VWJA 2DBJA 4OCMC 3O6FB 2AK4D 4XMKL 4P9HH 4PP2B 2PYFA 2GFBB 1HHKA 4MXWH 1HNGA 4P5KA 3PGCB 3MLYL 1MVFA 5DVLA 2WWKT 2FB4L 2ERJC 1DUYB 4YGVB 1UC6A 3EOAB 1AI1L 1I7TB 2I5YH 2CK2A 2WBJB 5FDWB 5BS0E 4N0CC 4OIBA 5JDJA 2XA8H 1LO3H 2VDRH 2WIIA 4X4MA 1B4RA 1A6TA 3QDJD 4JE4B 4GG6B 2IPKB 3S97C 2OK0H 4HW6A 3Q5TA 2VXQL 5D1XA 5CSBA 3NN8A 12E8L 1UA6H 4OUUA 1D3CA 4QRRB 5J6HA 1AR2A 2YMXL 3V0VA 4PLJD 3L3DA 2NY1C 1T1ZB 2DQFB 5F6IB 3TZVD 5F1IA 2B1AH 4KXZH 5EO0A 1NGZB 3BAEH 5IW1B 1F4XH 1TENA 1S9KC 3ARVA 1KG0A 4WJ5A 4N1EA 1GGBL 5C86A 2R29L 1A1NB 1Q9KB 3Q6FA 3V4PH 2KBGA 3EYVB 1F4YL 4EUPG 2ZG3A 4DOHB 4RWYH 2W0FA 4G6JL 4PY7A 5I18L 3O9WD 5BS0A 5BVPL 1AGEA 1YPZA 1EGJA 2VIRB 4JFOA 3VMPA 3AMKA 3QISA 2MMXA 3DVIA 2Z92B 4KRPD 3HNTL 1IE5A 3GIZL 5I1DB 3RDTB 2VLJA 1NBZB 4L8BA 4CN6A 3RVWC 1YNLH 4IOIB 5J1TC 1CGVA 3LKQB 2AEPH 3CVIL 5IG7A 2C7UB 5CJBA 4FFVC 2JCCB 1YNTA 4APQB 2WBWB 1UM5H 2AEQL 2I07B 4LCWA 4PRIB 4GFTB 4UU9B 4JQIH 1NKOA 3CSYA 4C4KO 1L4IA 3I3DA 2AXHA 4P5TC 3S3JA 1LE5B 2A6IB 1XCQA 3VGBA 2X4UA 3BH9B 2HFEB 1Z9MA 2FZ3B 4OQTL 4N1HB 5SWZD 3DETC 3E8UL 4CDHA 3L1OL 4MJIA 4WUUB 5EBMB 3FFCE 1FC1A 4BZ1H 4EQ2A 4KROC 2VLMD 3BGFC 2DQJH 3BXNA 4WW2C 5JIPA 3BN9D 1P7KA 4TUJB 4N8PA 4Q2ZB 5I2IB 4NO3B 2J8UE 4NJAH 4ELKA 5CSZB 2AV1B 3T8XB 4WY7L 4HLZH 2D0GA 2X70A 5C0ND 1U8MB 2AW2A 2VE6A 2RGSA 5EU7E 3AC0A 5A2KH 1MFAH 3OGCB 4WI3A 5CGMA 4G9DB 1KUMA 3MUGB 3PHOB 4YAQA 4ZXBC 4L4VE 4JJ5A 3H3PL 4U1GC 2F15A 2VXSH 2BOBA 2FSEB 4C54A 4RFNC 5GGVH 3V8CA 1A7BA 2OJZH 4Z8FH 4D0CB 3LD8C 1IEHA 2DDQL 1DLFH 5GS2H 1NFKA 3BP7A 4LEOA 2HLFC 2AQ1A 3FMGL 4X4ZA 4X83A 3GFUA 1CLZH 3MYJA 2ITCB 1FDLH 3L3GB 4HF5L 4K3EH 3SDDA 2OTPA 1CG9A 2J8UA 4KTEL 5I0ZA 1NAMB 4UOW0 2LE9A 3EO9H 4PJ9D 3QWQB 5DVMA 1NCTA 2DTMH 2ZUWA 5IT2L 4XCYA 1PKOA 1OGAA 4X98B 5HPOA 1JMXA 2VAJA 3ZKND 3VXMB 2Z31D 3QXDB 4LRIC 4PP1D 4WW2A 5C0BD 4G43B 5F6HJ 5HD8D 1T20B 1XR8B 1VGEH 3IDYC 2NX5D 3CMGA 4LLDB 2HT2D 1T6VN 2Y5TA 2ZG2A 5GGRY 2AGJL 4QHKI 3O45A 4C83B 1W72L 3FQNA 2JK5A 5IJVB 3IU3A 1IAKB 1ZT7A 1MEXH 2D31A 5JNYA 5E8EA 4W81A 3ALXA 2C1PA 1HINL 4ZXBA 5EIIB 5CKAA 4K94C 3HNSL 1AXSA 3V9FA 1J1XL 1MHCA 4YXKL 1PQZB 5F9WB 1ZMYA 3LN5B 3GSQA 4POZC 5E9DD 2MCPH