4RGOL

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
DIVMTQSPATLSVTPGDRVSLSCRASQSIGDYLHWYQQKSHESPRLLINYASQSISGIPSRFSGSGSGSDFTLIINSVEPEDVGVYYCQNGHSFPYTFGGGTKLEIRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgoL01
3V0VA 3NPSC 4FP8H 4PGDB 3RWGB 2FIKB 3LKSA 3PHSA 3K74B 1JPTH 3ZKXB 4LQ1A 1IBGH 2HMIC 3LKOB 4JQIL 1F00I 4LMQE 4JVWA 3VMOA 3MREA 4HK3J 2H3NB 7FABL 1QNZL 2FBJL 1U41A 3MRIA 3EBAA 5C0DB 3LS4H 4XMLH 4PLNC 3HE6A 2Y9RT 5ANMA 4M7LL 4P9MH 4IOFD 4NO0B 5D7KD 1RJLB 4QEGA 3QQ4A 2NX5E 3F7VB 3MV8E 4NO3B 3EOBA 2YPLD 1XIWA 2ADFL 4KRPD 4A6YA 1MIEL 3MRLB 3UO1L 5JOFA 4YUEH 1H3WM 4GW5A 4F33A 2HJLB 2CIKA 5DUMH 2CMRH 1NGZB 3WIHA 4CW1A 4M9OA 3FB5B 3PWLB 5EZOL 3MR9A 3MYJB 1M1SA 5BZDA 4RCAA 4OZHF 1N5YL 2ZUQB 3LD8B 1NCAL 4AG4H 1DLHB 1TLKA 4J4PC 2HFGH 5TH2B 2V6HA 3D0LB 3KJ4B 4CMHB 1JCKA 4TNWK 1H0DA 3SKJH 4LVHB 1RZIA 4OQTL 4DGIH 2V2TA 4K94H 3WS6C 1ZA6A 3REWB 3G08A 3VXOA 3BAEH 3MOBL 3RHWK 2N56A 3RX8A 3P4NB 5F1NA 1KCLA 4Z5RB 4LU5L 1JYXA 3RGVC 1AHWB 4NCDA 5DR5L 1IQWL 1MREH 4NC1C 5EO0A 1DUZA 1CN4A 2E27H 4IRJD 3CH1A 1G84A 2CPCA 4L4TB 3WSQL 3HPJA 5HHOA 4L4VD 5E6ID 1CXFA 3UJIH 1BBJA 3LDBC 4KKLC 4Z0BL 2YD3A 5LGHL 3PV7A 3NCEB 4Z95L 4MNQE 2I26N 4PJ8C 1YEKH 1T22A 4XWOD 4ZUSB 4DZBB 3CZJA 4U1LB 1A64A 4G42B 3V6BR 3GMNB 5JUEL 5DZOA 1SJXA 2R56H 2DKSA 1VGEH 2Q7YA 4HT1H 4YHMH 4JN2A 1XCQA 2H32A 4LK4A 2OQJB 2DQCL 3TT1L 1GRWA 4BFIA 1ZGLM 2P7TB 4LKXA 5LJYH 1VGKB 1ULVA 1WWAX 2OJEA 5EU6D 2R2BA 3KPQB 4F7EA 1QSFB 1T6WA 3X11B 3MBEB 1OPGL 2RR3A 4P2RE 1TCRB 4HIJB 5GJTH 1HH9A 4NZUL 4XPBL 1HCVA 3JZ7A 4ZD3H 2CLVB 1WWBX 2CK0L 2Y1VA 1Q0YH 3HB3D 4MMZC 2WK2A 4P2QA 2HA1A 2EIZA 4WTWA 1H8NA 1OGTB 1ZGLB 4J23A 3RUGA 3SDAD 4KHTH 5FDYA 1A8JH 5C3TA 4WFFE 4D9QE 5F7EH 4MDJB 1X4XA 1I1AB 1CLOH 1DQDH 1G7JB 3HMXA 4OLYL 5I17A 2EDHA 2EDDA 3UROR 5D1QA 2NY1D 1OF2A 1AD9A 3MJ7B 4HG4K 5IF0B 2CIIB 1UKQA 4ISVB 2FYYB 4ONHB 3S37L 4AL8L 4XPTH 4XC3H 3DVFA 5A3IC 5SX5K 2J1KA 1NC2B 5DEFB 4PJHF 1C5DA 1C12A 1AGEA 5JHDD 2E27L 2D0FA 4MNGE 2K7QA 2HH0H 1BFSA 4MGXA 4L8SB 1V3LA 4WU7A 4E0RB 2BCKA 2R4RH 4M4PA 4OF3A 4L4VE 1CDHA 2Z91A 1JP5A 1KLUB 4ZOBA 3PWNB 2H45A 1RUMH 4M6NH 1NBYA 5JPMA 3SCMA 12E8H 5T5FH 4MQSB 5C0FA 1JNLL 5L2KE 3L3KA 1KPVA 1BAFL 3MUGA 4HEPG 1YPZE 3C87A 1RULL 5D2NC 3VFMB 1I8LC 3HNVH 3SGEH 4RISH 1Z5LA 3ROOA 2DQEH 3PL6D 2FBOJ 3DJ9A 4Q74A 3HAEG 4GG8B 1HYSD 1JE6A 3N0PB 3SO5A 1J1XH 4JO2H 2A1WL 4OF7A 4GRWF 5INDB 4JEGB 5F70A 3GRWA 4NSKA 4XP6L 2PCPB 1NDGA 3DUUB 3FFCD 4WO4C 5F7KC 3UTTB 2AK1L 2NQCA 5SWZD 5IHUL 3PWLA 3ZE1F 3PQYD 1X4YA 3VXME 3TZVB 4PJHA 3PDDA 1IM9A 3FO9B 2D03L 2XXMB 5SX5H 1K8DB 3MJ9H 1NCCL 4LQFL 4TULH 3T77B 4P9HL 1FNGB 5HHPA 1IAKB 1YNLL 2NY7L 2PTUA 4EDXA 4G43B 4YBQD 2GI7A 1IZJA 4OLWH 2NXZD 3WUWA 4TUOB 4R4FL 3H7LA 5KS9A 1KB5H 5SWQA 2VZUA 3HPJB 3IKKA 2BNQD 5D1ZD 5KAQG 3QEGH 1C16B 3BW9A 3V4UH 2AP2A 2NY2B 3CFCL 3CFKA 3P4MA 5D1ZB 2NX5B 1YEGL 2E7HA 2Z8WC 3LQAL 3X12A 4LCIL 3KG5A 1ROWA 2Q7YB 5EUOA 4H1LA 4JN2B 4K7FA 1G7HB 4LP4A 2C26A 5E2TH 4ODXA 4IRSC 3LMJL 1IEBA 5LCVL 5E6YA 2QQNL 4PRIE 5CEXA 3MRFB 4JPVL 1EHLL 3V0WL 5FUOL 1HH9B 1CF8L 5CBAA 1NLDL 5BW7C 1X5LA 3LPWA 3ESUF 1KEML 2RCSH 3SO3C 1DL7L 2Y07H 3O9WB 4HBCL 3HC0A 3UTTD 1ZVHA 4F3FA 3P77B 4DKFH 2Y36L 1FO0A 5IMLA 4AK1A 1IAOB 4OI7A 5BZWB 1KELL 3D69A 5DJZB 5F9JB 1UVQA 4HUXA 1A6ZB 4G80B 5LQBL 2JJUA 1R3IL 4RIRB 2KUTA 3PL6B 2DJUA 5E4EB 2OR9L 4MWFB 1SY6L 1A6TA 5F7UA 2DQTH 2UZYB 3HR6A 4S1QL 4MHHG 3VD9A 3OR7A 4MD0B 2FYYA 3O45A 2PTTB 3LKQA 4KJYA 3MRGB 4DVBB 3QQ4B 5LWYL 1UGNA 1DN0B 4FXKA 4FFWD 5F88A 4MAYA 4PUBL 1BQHA 3CFBA 4TUJA 1X5HA 5JPNB 3RNKA 3MGAA 3QI9C 2HJLA 4BSJA 1JI2A 2ED7A 4YPGA 3GMOB 4XVJH 1VKXB 4OKVA 1S7WB 1CU4H 3VH8G 4P2RB 1VCAA 2GTWB 2R15A 4IBLT 5JW3H 4RFNB 3BD4A 4KUZL 5D96C 3VRJB 3W81A 1G9EA 4NYLA 5GRUH 2IMMA 3G08B 4OM0H 1CGSL 3JWOH 3C09B 1IL1A 2VAAA 3QAZB 4YAQA 1KPVB 4DOHE 4QHLB 1NUDA 1BQHG 3BGFC 2MCG1 4KGJA 2W9DH 4WVRA 4NDMB 1D9KA 5JQ6L 5FA3B 1C8PA 1XF2A 1B0GA 4YNYB 4JRYA 4R4BB 4A6YL 3UTSD 1BBJB 3TFKD 5HHVL 1P4IH 4PB9H 3C8HA 5D7JB 4ONFH 5T3ZD 1EBAA 3KPPA 1CXIA 1I4FA 2V5SA 1FZJA 4H8WL 2YSSB 3OHXB 1A5FH 3FB6B 3OJVC 4Z77A 3GMNA 3WLWD 4N8PA 1NCWL 1OP9A 5C0ND 1KELH 2QSTA 4CJ1A 3QQ9C 2C4FT 2HTKC 4S2SA 3V6OC 1NGXA 3KPNB 1F3DJ 1P53A 4G43A 4TVSa 4P2OD 3TBTA 5DFWH 3X11A 4O00A 3VRIA 4NPYA 4EBQH 3G6AA 5DD1H 3UYRH 3WUWB 3SDXF 4ZS6D 5KSBF 3UYPA 4KAQH 5IJVA 1QYGL 2D0GA 2BSRA 4GLRH 1D9KC 1KN4H 3E6HA 3R0NA 5ANME 2M8XA 1JZ8A 1C16A 3WHXB 4HIEB 3CMOL 4PJ7A 1F13A 2G60H 4YE4L 3QIUA 3MJ9A 2A9NH 2EYTB 3P4MB 4HWUA 1GZPA 4M7LH 4NOBA 4U3XA 3M1BA 5IGXH 5E9DB 1M05B 4WU5B 3VGAC 3FN0L 4QHNA 3G6DH 2FJFB 4XNZB 5C07A 1S7QB 5CHNA 1A7RH 4XVTH 2ZCKH 2APVA 1FL5B 2OTUA 4WFHD 2QADC 3GSWB 4L1DA 4WHCA 2EYSA 1MJ7H 1JPFB 1JGEB 1UB5A 4HJJH 3Q2CA 1GL4B 4Y4FD 3VXMB 2VDQL 3ZT5A 3QI9A 1ZHNA 4X6DE 3DI2B 5IFJA 5F21B 1HKFA 1QACA 4M6AA 1DEDA 4MXWH 3WE6A 1E4KA 5HVGB 4LGSB 5DZLA 2BNQE 3BDBA 4JQXC 5KOVC 4GAFB 4HC1A 3ZKSD 1ACYL 2YD4A 2D7MA 1CXEA 4OGAD 3I9GH 1P4LA 4O9HL 3L5JA 1IGJA 3HE7A 3ME0A 3CLFL 1GC1L 4QRUB 4JKPH 4UDUB 5DJAB 4CJ0A 2AS5M 3VGGA 3GSXA 1AO7D 2V9RA 3QG7H 2CUHA 4NO0D 1GPOH 4LIQH 3VFSB 2V9TA 2W9LA 1J0HA 3VXSE 3UTQB 4L29B 1NFDF 5BW7A 2IAND 5EDXA 5DJXB 4OZIA 2D7QA 1BAFH 4NNXB 1NFIB 2APTA 4N90E 4XCYA 1LO5A 3RNQB 3THML 5DFVD 4OKVB 1ZKAA 5I1LB 3FB7B 5KVGH 5C6PB 1X6LA 3EDJA 5D1QD 4LLUB 3WJJA 3CSBA 3T0WA 4PY8J 1IGFH 1WGOA 4RA3A 4W6WB 9CGTA 1LK3H 4TUKL 4KJWD 3FCTA 4G6KH 2VERN 2RAMA 3ARFD 3ARBC 3JV4A 2VAAB 4C56D 4AEHH 3X14A 4OLVL 3BKML 2VUOA 5HTSA 2E7LC 5JZ7C 3CD4A 3ET9F 1NMBL 3V4VL 3MZTA 2J12B 1P4BH 1PX4A 3RY5A 1T89C 3O4LA 2VLKE 3GUTA 1U95B 4EUPH 5DD6A 1PQZA 5C07D 4RDQG 2BNUA 2AI0H 2UWEB 4JFEE 5CCKL 1F6AB 3TBSA 2VLRB 1XGTA 1ZEAH 4MNGA 1EGJH 1A9EA 3SDDC 3I6KB 3RZCD 1RZ7L 4Z7OE 2VL4A 4WO4A 2JCCF 2VZ1A 4HQQH 3NGBB 4L4VA 5E6IA 3TN0C 5GGQH 3G6AB 3KYNB 4Z7VF 2ITCA 5EZLB 2B5IC 1W8NA 3HZVA 8CGTA 1UWEH 4FQ2L 5I1GL 3BHBA 5AG9A 4LEXH 3AXLB 3GIZL 1D6EB 5L2KA 2DM7A 3IGAB 4FS0A 3EJYD 1TJHH 1F3DH 3JWOL 3PHOA 2KH2B 2DTSA 2GSIB 3HNTL 3X13A 2DYPD 4YDIH 1UG9A 4ZO9A 3AS0A 1Y18A 5B8CB 4U1MB 4PJDE 4WHYG 4KTEH 1CZ8H 4UT7H 5E1HB 4ZFFA 5AAMA 4ZPTB 4Y4KC 5EC2B 1LO3L 5T33H 4LNRA 2VN4A 3BJ91 4X5WA 4Q7DA 4G6KL 4YFDB 5KVMC 3T0EB 5I18H 2VDPL 2EXYD 2YD8A 1DQML 4XP4H 4B53A 1BQHB 3CFBB 4OFYD 4TUJB 5B3JF 1F02I 5ESQB 3SBWC 3MODL 1LE5B 3BZ4B 2D9CA 3CSYA 4GBXB 2VC2H 3DMMC 5I6XB 1H15A 4PR5B 4NC0B 1AGFB 5GZOD 1MQKH 2GFBA 3BFOA 2IAMB 3VWKD 5J7CC 3ZHLA 1T2QL 3CVHL 2WUCL 4HUUA 3REVB 2GTWA 5J1AA 3D25B 3PDGA 1ZAGA 3IU4H 4QF1B 3N1FC 5L88H 1I3RB 2LQRA 3OKLA 3KYKL 3TCXA 5GGSA 5I1CL 3IT8D 3KXFD 3ILPB 1NFKA 5ANMB 1ZT1A 4WY7L 3UC0H 5CLWA 3TVMB 3U4EB 5I1HH 1EAPA 4PS4L 3QI9D 1I8KB 3VFSA 1D9KB 4Y4FC 4MDIB 4PTUB 1Q1JH 4JFOA 2H2SC 1SYVB 4FXGB 3FAWA 4NQEB 5F72S 2FX8L 4M8VA 2CRYA 4ZFGH 4NOFA 3CXHK 4F58L 3TP4A 5M94B 1GC1H 2IPKB 3VXPB 3VFRA 4N8CL 3ZT6A 3ARPA 4PRIA 3UMTA 3LHPH 3MV8D 1V05A 3P9LB 1PSKH 5IM7A 1TETH 2PETA 2HRPL 3LQMA 1OD9A 1DBMH 2YUWA 5D2NE 4XPAL 1JHTA 1Q0XL 5KAQF 4EI6B 5J6GA 4PRBA 4PTTA 1CF8H 5GRXG 1KPUA 2E9IA 2ZG3A 3VFVB 5ENWB 3LRSA 4CU8A 3OKOB 2QTEA 4QT5A 4AYFA 2AXFB 1DUZB 5JMOC 1FYTD 3CH1B 3C6SB 3ZTJH 2GJZA 1QSEB 4RFNC 1G6VK 3SDCD 5TF0A 4XBPA 4OV5B 3K2MC 3GDBA 3TT3H 4DJMA 1NUNB 3GBNH 4D0BA 2GITA 3VXSB 1PQZB 1D3CA 2I9LA 2PW2B 3MMEB 4GRLC 5FEBA 2LVEA 4PJCF 4PG2A 5E9DA 1OAQH 3KDMB 3BKCL 4GSDH 5CUSL 2AJVH 1DBJH 1RHHB 5ELIA 4I3RL 3TBSB 1S7QA 1T1YA 1CFVH 3OMZA 4Y19E 4W81A 4ZS6C 4H8WC 1CE1H 3QPXL 5EOQH 1RMFL 1DQJB 1FE8H 4MJID 1EJOL 3GSNL 1CK0L 4LNVA 3DHJA 4W68A 2EIZB 3IDXH 4XPGH 2VXTH 4NM4L 1N6QL 4LFHD 5FYKU 3CSPA 2YPVL 3ZE2F 1FRGL 3LS5L 3EO9L 3GMMA 3JTTA 2LE9A 4MDJA 4NRYB 4PJIE 1S5HA 3NZ8A 4G6JL 1YY9D 5J12C 3BZDA 5TPWH 1A7QL 4L4TE 5I17B 3HE7B 2B4CC 1FL3B 2XWBA 1N7ML 1ETZA 2O5ZH 4ZPTA 4NN6B 5HDBF 1FH5L 5EC2A 2BY2A 3X3FH 2E5EA 4HX1A 4MYWB 3JTSB 3RVVD 4EJ1C 2VLKB 4UV4L 2YRPA 4DWHA 3UTQA 2DM2A 2B7DT 3OKMA 3ZYIA 1YJDH 4XGZB 3DUSB 2UWEE 1WTLA 3H7BA 2MPAL 1E4XI 1OSZA 2H26A 3I75A 3JWDC 4LAQL 4NNXA 1AGEB 5IB2A 3WIFB 1PLGH 3BE1L 2UZIH 1FG9C 2KQNA 3WFHB 3RA7L 1OHQA 3GBLA 3SDXB 2PXYD 1KFAH 3EUUA 1YA5A 2XY2A 5L7XH 3ULUF 5INCA 3TA3D 4AIZA 2H6PB 3P73B 1R3JA 4G6AC 4ZMAT 4UMGA 5EBLA 3ILPA 3N9GH 3S5LG 3VFTA 1FJ1B 4W6YB 4NJAH 3QUYC 1KIPA 1LD9A 2VKWA 3IFPA 3OXRB 2HT3D 4OCRH 5H37H 4G7YH 4FXGA 2VLME 3FOLA 4PJDB 1QR1B 2V2WA 1MI5E 5FM5O 4K8RC 5FCUH 1I9RL 5C07E 5TQ2L 2COQA 4C4KO 4O51B 5JQHC 2IPKA 4OZFB 4PY7B 4LARL 1OB1B 4M1CD 1MCJA 3IDYC 3DHMA 2PCPA 5C71A 4ERSH 4XVJL 3ARGA 4G8GB 2XNAA 4JREB 1JF1B 1S7TA 3FO0H 4MNGB 1X5FA 2BMKA 2P43B 8FABB 3RVWC 3S96B 3EGSB 3ARYA 2ATKA 1P7QB 3C6LA 3LZFH 2DBLH 4BUGA 3MRNA 4XPHH 1FLRL 5E2VL 4M4RA 3MXWH 5I1DA 3ULSB 1MY7A 5A3ID 3KLSA 3KNBA 4K3JH 1YEJH 4K8RD 1DP0A 3Q6GH 1E4WL 2OBGA 1ZHBB 4JGMA 3IVKA 4EXPX 2BZDA 4NBYB 4Q9CA 3MRJA 3OG6B 5L2KB 5J9PB 3WLBA 3NTCH 4OZHE 3O6KH 2R56L 3V5KB 4TOYL 2A6DB 1XGYL 3QQNA 1JFQL 3VXSA 1TZHA 3S8WA 2I9LB 4KTEL 3SQBA 4U1MA 2R0LH 3N85L 5DHVA 4P9HC 5HGDB 4JY6B 1XT5A 4LLDB 4OZ4A 1PY4A 1G7HA 1OQOA 3WXVL 2JTDA 3O4LD 3WS3B 3TT3L 4ODHL 2CMRL 1YYLL 5CEXB 2EDXA 3SDCB 3STZA 4HFUH 1U91B 1T1ZB 5C8JA 2XPGB 2VDMH 4K2UH 3BZFA 5BXFA 4LPWA 5DI8B 4I9WD 3L3OB 4RX4A 5D2NB 1PEWA 3I02A 1A1OA 1CFQA 1YNLH 2NY7H 1A7OH 1KJ3H 2OL3H 1I1AC 2KL6A 4PG2C 4IMKA 4OIBA 2GFBB 2UYLB 4WWID 4XB7A 1CFNB 2ZUUA 2IANE 4GRLA 4AQOA 2NTSP 4EUPG 4X4ME 3P77A 5J1AB 5HVFB 3RFZC 4NRYA 2DICA 1IZKA 1INDL 2OM5A 4EZMA 1XGRA 3U9PH 4AY0A 1GIGL 3I85A 3VG0L 1QLFB 2OP4H 3GI9L 1ETZB 3PGCA 3TVMA 1I7RB 1J0JA 4JB9L 5I1IH 1A4JB 1U2CA 5BRZD 5BQ7A 4FXKB 3KR3H 3V95A 4F9PC 2X40A 2F5BH 3QIBD 4P9ML 1J88A 3GSRA 2EYRA 5I1HL 3VXPA 1R3LB 3VH8A 2W9EH 4PRIB 4XMPH 5F9OL 3RZWA 1MIEH 3UO1H 2QR0B 4PV9B 4YXKH 3KXFB 3WKNA 5T5FL 3MA9H 2DWEA 4GW1B 4TSBH 4L3EB 1TXKA 3QXVA 4Z8FL 5E24E 4YWGH 4CADB 4UU9A 5AWNH 5TE7L 4I13B 3LS4L 4GBXC 1CDIA 4GRLD 2WMPA 3K7UA 4PRBB 4PTTB 3TO2B 3VWKB 4EVNA 5DFVC 4OGYH 4PRAB 1AKJD 4WUUA 5FYJH 3V7AG 1F97A 1XF2B 4BQCA 2WIIB 1R0AH 4BZ1H 2J88L 2XN9A 4CVWA 4WDIB 1E27B 4XP6H 3UJJH 4XBPB 1CICA 5I0DA 1UWXH 1J1OH 3CVIL 5I71C 3W5MA 4CUCA 4R90H 1I4FB 2P5WD 4M7ZC 1FZJB 1YEIH 3H9YA 4MQTB 3ARBB 3BPNC 3U48A 3U0PB 4PG9A 4L5FH 3WN5B 3ULUE 4WENB 2CKBB 2DQHH 3N06B 1FAIH 4P4RB 4FQHB 3C2AL 3U4BH 4LPXA 5IUSA 1ODAA 1SJVA 3O3BA 3DWTA 2ADIA 1DUYB 1P7QA 3C6LB 1FNEA 3TEUA 2NY0D 4XC1H 4Y2OA 3NIDE 2OTPA 4G9FD 5GSRB 3SDXE 3GO1H 4O2FB 4JANB 4I77L 5IWLA 3OX8B 3TYGL 4HCRH 2EZ0D 3UTPE 1D5IH 1MI5D 5CP7B 1TQBC 3MRDA 5HI5C 3QCTH 4AEEA 3QCVH 1P84J 1ZTXL 5KG9B 3K2UH 3LEYH 4DOHB 4ODUA 2J4WL 5T5NG 2CO7B 3ZDYE 4HIEA 4ZO6A 4F7MA 3QUZD 2YZ1A 4LVHC 1KG0B 3DURA 1FL3A 5HHVH 1QVOA 1YEFH 1MI5B 1H3XA 3UZVB 3BYTA 1JHLL 5D70L 5LBSH 5C07B 1VSCA 4K94L 4Y88A 4FNLH 3OAYH 3TJEH 4ODSH 1INQB 5LG1A 3WS3A 4LRNL 4D2NA 1L4IA 2HJKA 2X4RA 4HPYL 1XEDA 4ELMA 3U0TB 3QDMD 2DMBA 1NPUA 4G8GE 1U91A 5HDQL 1J7VR 5IB2B 5GRUL 5HY9B 1E4XH 5DI8A 3L3OA 3NCYP 1LNUB 3VJ6A 1DBBL 5MI0C 4G8IB 4U6YA 1CFNA 2YUVA 2FIKA 3LKSB 4M3JA 4IOSD 4J3XA 5GGTL 1EEUA 3ARBD 2ID5A 5I8EA 3OV6A 1BPVA 4OCWH 4WWKA 2FL5B 4AIXA 25C8H 4AIZB 5IW1A 4V1DA 4FXLA 2IFFL 1N5AA 3L6FA 1N64L 2Q8AH 1QLFA 1E4WH 2GYSA 3Q6GL 4YGAB 3IRPX 4NN7B 5E8DL 1OP3K 2LU7A 3QXDB 5DJAA 2DQCH 4OZHB 2VL5A 4OM1H 3B83A 1SM3H 2WBJC 4OZGA 5L2JA 2P5WA 1KIPB 1LD9B 4LF3B 1T5XB 1HIML 4L29A 4B50A 5E9DE 1J8KA 4P4KD 3O6FA 4FMKA 4KK6C 2BOCA 5ITBH 2KKQA 4XMLL 2CIKB 1CU4L 2EYRB 5C6TL 2I9TA 5E2TL 4NJAL 4Y19A 1I8IA 2X7LB 2QR0A 2ZPKH 4PV9A 4OM0L 4NKQB 3ILQD 4EIGB 4Y4KD 4UB0L 4JO3L 3EYOB 4ORGB 5TH2A 3MV9E 1IT9H 1H0DB 1YJDL 1MNUL 3D18B 3ISWA 2F8VA 4YDVB 8FABA 3ALWA 1CFBA 1NLDH 1AXSA 3OKEA 4ALAH 1CD0A 2CLRA 2OSLB 2DTML 5ID1B 2XRAL 2Y36H 4M62H 1GJIA 2NMSA 5J11C 3HE7C 4OLWL 3RGHA 3QNZA 3VWJC 1DN2A 3BWUC 1S9VA 2ZCKL 1K2DB 3V5KA 5C0IB 2VAJA 4L4JA 1N26A 3W11C 3IFNH 1N7MH 5DHVB 5I19H 2UWEA 5IJKA 3X3FL 2WP3T 1MVUB 1J8HD 1JL8A 1H5BC 4BZ2H 1XCQB 2AJYH 1XGTB 4J6RH 1EV2E 4XP5H 1N6UA 5HYSG 3S35H 3O3BB 2YK1H 5C0BA 4QRQB 2VR5A 1WBZB 5C2BH 1TTUA 4H0HB 4NT6A 2GUOA 4Y8DC 1MSPA 3BGMB 4XAKD 4HIJA 4OF8A 5JO5A 3NFNA 3FN3A 5D2LF 4Z7WB 4OGXH 3SE9L 4NKOA 4JM2C 5CIPH 2OMNA 4G3YH 2PNDA 1K8IB 3ZHKA 5E7BA 1YPZF 3X17A 3PGFL 4ODVH 5C0AD 3FT4A 1QQDA 3I3BA 4EUPB 5GXBB 2A83B 2VQTA 2OCFD 4FZ8L 4HF5L 4RBPK 5FDWB 2VITB 4N1EA 5BVPH 1NCWH 1UFUA 2PF6A 3OQ3B 2QL1A 5I1JL 3WD5H 1V7ML 1X4ZA 5D7LA 1CI5A 1L7IL 2OS7A 5ISZE 1U8LA 4YR6A 3UYRL 4O2CA 1U8JB 4KKCC 5B39B 3HPLB 5DHVH 2Z92B 5J3HD 3BUYB 4PRPB 4OM1L 3A0OA 1UQSA 3BZ4A 2W9DL 4Z18A 1L0XA 4L8SA 5T3XE 4FQJL 4P4KC 4PR5A 2NY2C 5E95B 3KYOA 3AAZA 1IC7H 3KXFA 2HG5B 3I3EA 3REVA 1I3VA 2DWEB 1J1PH 3SCMD 2ATPA 2FX7H 2FL5A 3AB0C 1C5CH 3D85D 1I85A 3RVTC 5DRNB 2OZ4L 4HJ0D 1QFWI 2JELL 3S4SA 2FSEB 3L3KB 3RL1A 3TO2A 4EVNB 3U36B 3O9WC 5DRXA 4UOW1 1NDMB 4GKNB 1H8OA 3BESR 1CL7L 1NEZA 4TN9A 4OZGB 4ZO8A 2C7UA 5IFHH 4JFOB 3HS0B 3A6CL 2NY5H 5C0GA 3QZWA 1E27A 4U1KA 2Y5TA 1CICB 1CG9A 15C8H 4RGOH 1XF1A 2IH1B 2B5IB 1XGQB 2VQ1A 2I07A 2AXHA 5HDBE 2RFXB 5DVMA 5LGJA 3T0EE 1FORL 2QQKL 3SKMA 3GSQB 4LSRL 5HI4D 3VFNA 4OSUH 5B4MC 1NMCC 3QWQB 4GMTL 3P9LA 5EU6E 2KDGA 5IKCA 2ICCA 4NM8L 1IM9B 1MEXH 2H2PD 1PG7W 4NO2B 3IDYB 2YD1A 3CGTA 2Q86B 1LDPH 1R24A 3KYAA 5LXGH 2FEEL 3GMRA 5HHPB 4S11A 2IANA 4MX7B 1IEAB 3ZKMC 4QXTB 4X4MA 2VLKD 1AGDA 1FSKC 1L9NA 3U6RA 3WDIA 3LB6D 4XNYL 2EDTA 2FATL 1BQLH 1F42A 1UM5L 3HZYA 4HXBL 4KK8D 3TYFB 4DUVA 5I9QC 4GRMB 4Q6IB 5KSAC 2EDOA 2MCPH 3MJGX 5CJQH 3B2UC 3QAZC 2J4WH 4U6VL 2XI9A 3BW9B 3RY6A 5CCKH 4E5XB 4U1HB 2DKMA 3GIZH 3JUZA 5E6ZA 3WO4B 1YEHH 1YEFL 1HI6B 2CH8A 3U79A 4EOWH 1FZKB 4NQEE 1DBBH 2NZIA 4HLZG 2SEBB 1JHLH 4P59L 1RZ7H 3MXVH 5J6HB 2I60H 4RX4D 2X4SB 1IEBB 1K3IA 3WSQH 5EA0L 1WFOA 3B8SA 4PJFB 4Z7QE 4OI8A 4X4XB 1AQDA 3C60C 3O2VL 2DD8L 3BGMA 2ESVE 5DMGD 1WBYA 1XCTB 3MUHL 3MV9B 5LBSL 4AIOA 5JLZA 3B43A 1C5BH 4FNLL 1JNNL 1NL0L 4KV5E 4S1RH 2YPLE 5ILTL 4X99A 3VXSD 4S1DC 2FZ3B 2UZXB 3BKMH 5BZWA 1UVQB 5IW1B 1N5AB 1K3ZA 2XN9E 3GSOB 1QSEE 3PQYB 4I18B 3DX8B 4MWFA 1EEZB 5I16A 4LPUA 1A6TB 4RGMB 4FFZL 1HOCB 4OUUA 1YECL 3LKQB 4KJYB 3UJJL 5I75B 4NZRH 1MCHA 4NWTH 3STBA 4FQLL 1P84K 3G9AB 3T0EC 1P2CB 2QSCL 3QPQD 1JN6B 4Y19B 1AIFB 2IH3A 2P49B 2GY7B 3GNML 3QRFM 4RNRA 2BJML 3AAZB 3C2SA 5E8NB 3I9GL 4QXUL 3SDXA 3CC5B 2JB5H 1JPTL 4HWBH 2DQUL 5CKGA 5D72L 1LEKA 4YDVA 2H6PA 2BDNL 5F3BA 2XIDA 5FYJE 2HTLD 1GIGH 2OSLA 5I1EH 1JGVH 1I8LA 1HN1A 5L8LB 1D9KD 5CMAA 3NCYS 2MSPA 4YHZH 4PJIB 2O5YL 1A2YA 1RZ8A 2NLJB 2P47B 1C5CL 5HHQA 5EOTA 3QZWB 5FUCE 4PGBA 5DVLA 1A21A 5HGGS 1KV3A 1MJUL 2EE3A 5ISZB 4JZJC 1TMCB 3NPZB 1XFPA 4FQXB 3W39A 1WTGT 4KK9C 3SKMB 5HXMA 1T0NB 4JO1H 4MB4A 4YXLH 3HRZB 4GG6F 2NY6B 5F9OH 4XT1C 3B2VL 1LK2A 5FGBC 4M93B 1K6QH 1NKOA 1HXMB 1NUFA 4GBXD 4GMSL 5AZEL 3G6JF 5DMIL 3F7YB 4GAGL 3QRGH 2XY1A 4EQ3A 3VGEA 3UP1A 3NFNB 4Z7WA 1EHAA 5I8OL 2PYFA 2Y06H 4NZUH 2MHAB 5LAXB 4YO0A 5D7SL 4M6ML 4V1DE 1SMOA 5H37G 3H42H 2DWDA 3MBED 3UTSE 3W82A 1N8ZA 2AKRA 3PGFH 4ODVL 4HWNA 4HPOL 3KLAA 4GLRI 1H5BA 1CDCA 3T0AA 1QQDB 2UUDH 4LDEB 2CD0A 3FQRB 5IJKC 3QEQE 4OZGE 2P5WE 3RWCA 3UBXI 5KOMC 1DQQA 4JKKA 4R26H 1TJHL 4JY6A 1T21B 5F7DB 3WDHA 2AEIT 3Q5OA 1M05A 4WU5A 1Z0MA 3V4PH 1ES0B 4DAGL 3VWJA 1CT8B 1QBMH 4QHKI 4K8RL 1KJ2L 3SDAC 4YHNA 5DC9B 4U6VH 1HHIA 5TDPA 2EICA 2G60L 5CBEA 3TA3C 1OGAD 4HQQL 1BJ1H 1J0IA 3F7QA 2BVQB 1JPGB 2VB5A 2VXSL 3ULVC 3W5NA 4N9GA 3T4AA 4JG0L 4U0QB 4YDKL 1ZHNB 5T1LD 5HBBA 1VADA 4NRXB 3CK0H 5J57B 1CR9H 4M3KB 1ZLUK 1F6LL 4HC1H 4PJXA 5FUZH 4W70A 4G7YL 2Y72A 1V7NH 2F53E 1BQLL 1UM5H 1EEZA 1EBPA 5FYKL 4KJQD 3PGCB 3ECBB 3MOQA 1J18A 4JG1H 4Z0XB 4LHUD 2NYYC 3WIHL 4PRHE 3HS0A 2R0LL 3DIFB 3N85H 3WYRA 2CO6B 4HKBA 1JF6A 1CXKA 4HIIA 15C8L 4RGOL 1MF2H 5ADOL 2K1MA 5F97E 4ONGH 3T0DA 1CL7H 1NFIA 2NNAB 1TQCC 4WTZG 1X44A 5C0BE 4RNRB 4IIQA 2FATH 4WI8A 2CUIA 3FB7A 4W4OA 1U8QA 1CE6A 4Z7WF 4I3SH 3CC5A 3EHBD 1DJSA 3CFJB 5DQDL 2G75B 4CADA 2NY4C 3QUYB 1AXTH 2A0LD 4UV4H 3GSNH 1EHLH 4CMMB 3U0WH 3WFEL 3SO3B 2IANB 2O5XH 2GHWB 3S9DB 3IS0X 1HQ4B 1W0VA 3OKKB 5E2WL 4R7NA 2JJSA 5B22A 3U6RB 4DGVL 4OD2A 4Y5XC 3B9DA 1ND0A 1AHWC 2MJWA 4M1CC 3PQYE 5GRVK 1U8KA 4DKFL 5D7LE 1UXSA 4CN1A 5FUCC 4X6CB 5EULV 3FKUS 3TO4A 4LHUB 4L8BA 3QIWC 5CJBA 1B0RA 5L7XL 1SY6H 2EXYC 2DAVA 4XI5D 5IVZB 3WFCH 5IK3B 4ODBD 5SX4H 1HXMA 1FRGH 4CVXA 1DVFC 1K85A 1J05B 5TPWL 3MRQB 3F7YA 4GS7B 1BQSA 3R1GL 3P0YH 3IKCB 1NBVL 3GJFA 3KXFE 5KS9F 3SE3C 3DPBA 5EZLA 3EYUL 4O2FA 4L3EE 5T1LB 1ORQB 4NUJB 5B38B 1B2WL 5BO1H 2AJXH 2VNCA 3V6FB 3HMXL 4XP9L 2BP3A 4JFXA 1A7QH 3MRDB 4D9LL 2FGWH 1PGRB 3H9SB 2F8XC 4O02H 1RAMA 2MKWA 4IJ3C 2YD2A 6CGTA 1IAII 1NCDL 4F7MB 3EDDA 2W91A 4HKXA 4UT6H 3H9ZA 3G5ZA 1OAQL 4YXHL 3FJTA 5E8PB 1T21A 4WGVB 4ZFFB 2AV7B 2NR6C 4FQCL 1CICC 4QWWC 5JMRA 1HZHL 4LKCA 1MWAA 2QHRL 5D5MF 4YQXL 1Q0XH 5TDPB 5GS0D 1G7LB 4MS8C 2HJKB 2X4RB 1JPGA 4P2OB 1Q9OB 1CQKA 5ESAA 5EU6A 2JCCE 1HILA 3ILQC 4GBXA 5DWUL 3O4OB 4FFVC 3VXQB 4WTXA 1NBZA 1LNUA 2ICEB 4QTIH 4J1UB 1U8NA 3VJ6B 4XNXL 1B4JH 3BXNB 5TDNB 3K46A 2IAMA 2GAZB 3DV4B 4KMTL 1KIRA 1OP3H 1KIQA 1RULH 1A6UL 1E6JH 2IG2H 1RSFA 4JRXA 3IJSB 5E8OB 3TIEB 5LVEA 4NQCA 4V1DB 2RHEA 5JW5A 3UTSB 3Q6FA 1N6VA 1F3RB 1FPTL 1X6NA 2EKJA 3QJFB 2R29L 3BOVA 2X5PA 1U0QA 4PJ5B 2VL5B 3FO0L 4QTHB 4FQ1L 3L5WA 1EAPB 2ZCLH 4Z0XA 3QEQB 1CLCA 3DETD 1RIUH 4ZUUB 4LF3A 3VXTA 2H32H 4KWUA 3MCLL 2ZCHH 4NQEA 4HIIB 4NN5B 3IJHA 3UTPD 1RD6A 3EYUH 1EMTL 2QKIA 1I1RA 4LCCC 1KEGL 4U3HA 2FH8A 5E0QA 4MNQD 1A1MA 4RISL 2A6KA 4LAJH 1SJHB 4YHZL 4RGMC 5GGVY 4D0DA 1FL6A 5HD8D 3P3YA 2R0WH 5IBLC 4IIQB 4YHOL 3FO1B 5J8OA 2VRAA 3BP6B 5BCAA 2BSED 1IGIH 1I7UA 4F2MA 3D0VA 3M17A 1KYOK 2I24N 5GGUA 4HKJA 5BOPA 3RWHB 1JHTB 5JIIA 5CS7A 2NZ9C 5EORL 1P7HL 5AYUH 4U6XB 1RUKL 5FO9A 1HQ4A 1SEQL 2YMXL 3GKWH 4HCRA 2LV4A 1FFNB 4MAUL 5ENWA 2P24A 1Z2KA 4UT7L 1LO2H 5IBUB 4BSWB 2OTWB 2BRRH 3H2WA 4H88L 2B2XL 1AGBB 4KKAC 5IMKA 1OCWL 5EZJA 1F58H 1FV1B 5KSVB 2F53B 1Y6KR 4U2ZA 1FP5A 5JW4M 3EYQC 4N5UA 1I3GH 5C0IA 2X70B 4X5XB 1HINL 3MFFA 3DUHA 4NWUH 5E2WH 4D0BB 4PRHB 3QHTC 3NA4A 4N5ED 4OBRA 5C09B 1PYWB 4DAGH 1EO8H 4J4PD 1GGBH 4KZEL 3BZEB 4XC1L 4F7CB 1T66D 4RSVA 3EFDH 3ARFC 1NFDE 4YJZL 3VA2C 1WBXB 4JGJA 2BVQA 1REIA 4NQSB 1S9KC 5CEYB 1HSBB 4X4YB 4KRPC 1J0KA 3ZE1E 5ALCL 1RZGB 3DRQB 1S7SB 3S35X 3TBWA 1DBKL 3CMGA 3WIHH 3VDCA 1JNHB 4LLMA 1CR9L 1NC4B 1IGFL 4XWGH 4E41E 4JG0H 1OLZA 1FE8L 4QOKE 3GMMB 4KRLB 4AEIL 1YMHA 3MRMB 4POUB 1OP5K 5T3XH 1JTOA 3LEVL 2R2EA 2XWBB 4K7PL 2YD9A 4QHKJ 4XCFL 3OB8A 2AV7A 4OLVH 4XAWL 4OCWL 1EGJA 3DARA 1BREA 1A47A 3WFBL 5TGBA 4M6MH 5I1GH 4LLQB 2CXKA 5TE7H 3L3DA 1OM3L 1YNTB 4XNQA 3ZYZA 4PJEE 3O41B 3MJ6A 4HKBB 3S36L 5GS2D 4XGZA 2XZZA 1MCFA 3EOAA 2AXGA 5FV1L 1HHKA 3C8KA 4WI7A 2FWOA 4X6EB 1KCKA 1RZKL 5E4IA 4ZYKB 4PBVC 2FJGB 1MHPH 3B2VH 5CJOH 4MJ4A 3VXUA 1UZ6E 5C09D 1NANI 2R8SL 1FFRA 3CLEL 5SWZB 2YA1A 5C92A 5D4QA 3MCKB 2IQAA 2LABA 2Z35B 4Z7WE 3ZDXE 1VERA 1FFOA 1YN6A 5DRNA 1N4XH 4AM0A 1RUQL 1QO3A 4TUKH 1R0AL 1AH1A 3H9SE 4RGNC 3PABB 4U1JA 3T04D 3P30H 3U36A 2GTZA 1ZTXH 4NKMB 4OCYL 2AGJL 5E94A 3NIGF 4Y16D 2ADFH 5IHUH 5HGBA 3O3AA 4YUEL 1CG9B 3MLSL 4U49A 4MLIA 3CVHB 5DSCA 4PD4K 2A6JA 2FO4B 4LHUA 1E28A 3GJFK 4JFZL 3HR5B 5F3HA 1FL6B 1CD1B 1LP9F 4FZEH 5JZ7D 2A9NL 3FRUB 3KWWA 5IBLD 4ZFOB 4PRPE 5FB8B 2BVUA 4PS4H 2JCCB 3D0VB 3CFDB 2A6IA 4OAWA 4ZNCD 7FABH 2CRMA 2Q86A 3VXRA 1RJZA 5DEGA 1QYGH 3IDIA 2ADJB 4NC2B 4K71B 4WEBL 4F57H 5FV2A 2IAMC 1ED3A 3B9KC 1OM3H 1RIHL 4MA1C 4WI6A 4OGAC 4O2EA 3HAEA 4JFXB 4Q6IA 3THMH 2XWTA 3T2QA 1IC5L 1IGTB 3FQWA 2PW1A 4NZJA 4X6FA 4Y1AD 2D4FA 3FQNA 5F6HJ 3RI5F 5J89A 4PJ5E 1I1AD 1YC7A 2IBBA 5DMKB 4XRCB 4R2GC 1F11B 4ZFZB 4PRHA 3RWDA 5FIEA 5E8PA 4ETQB 1OL0A 4CU6A 1JK8A 2HTKD 1PYWA 3PV6A 3BZEA 3ZDYF 3MFGB 2AJZB 3BO8B 1HSAB 4MXWL 3EYVA 1D7FA 1BJMA 1MCDA 3QUMA 4C4KT 5SWSB 1G7LA 1QLEH 3MRKB 4RMVA 3PWUB 1ZA3B 3GSUA 3ULUD 4ODTH 4DN3H 3NACL 1OY3B 5EU6B 2R1YA 5E99H 3BX7C 4LOUC 1S9XA 1VFBA 1A1OB 3I02B 4KDWA 1F4WH 2APBA 3ULUH 1CS6A 1U8MB 1YC8A 3CPLA 3IU3B 1OQXA 4AMKH 1GAFL 4DKAA 4DGYL 3OKDB 1KIRB 3RAJL 3BP4A 4R97C 1KC5L 4GQ9L 2FX9L 4YHYB 1CD9B 2XRAH 2IGFL 1J0YA 2VLJB 1UYWL 3BN9C 1FNSL 2UY7A 1A6WL 4TVPE 4LLAA 1F58L 2CKNA 3RVWD 3ZE2E 3O2DA 3QIWA 4ZUUA 4U7MA 5IGXL 1KB5A 4KY1H 4H5SA 4N0UA 2X89A 2K3TA 1ZT7B 2XYCA 4NWUL 3EOAB 5C09E 1KNOA 4ZUTA 4R96A 3DECA 4IRJA 3HKFA 5LXGL 3VE0B 4WJ5B 3T3PE 3U1SL 1JN6A 4NZTL 2IH3B 2VZTA 4PJFE 3QULA 1MFEH 5ID0A 5DTFB 1EVUA 4XH2A 1JMXA 4YHYC 2ESVB 4ZUVB 4XNYH 2QQKH 1RURL 5HVHC 4APQD 5EPMA 1LEKB 5DMYA 3DX7A 4HLJA 5EORH 1FDLL 4GKZB 5C70A 4PJFF 3DGGB 2VDKH 1G6RH 1YQVH 5EBGA 4KRPB 2AEQL 1MHCA 3T4YA 4ZAKD 2YPLB 5IFHL 4G5ZH 4X6DF 3BQUC 2IBZY 4W4OC 4PRAA 3VG9B 5KZCD 5FA4A 3QXWA 1A2YB 1RZ8B 2X4NA 2XN9B 3EYFB 4H8WH 3GMQB 3PWVA 5GHWH 1NAMA 1MJJA 1CLYL 3QWRD 4LSRH 1F5WA 5C0EB 2HKHL 2DQTL 4LSVL 1E28B 3ARBA 5ACLA 3QEHA 5F1KC 5CZKA 3NVQA 4M00A 4M8QB 3LKOA 2BNRA 4F7CA 4IS6B 1KXQE 2Z31B 4MXVE 2VXTL 4NM4H 4JPIB 1VENA 1WSST 3QDMA 4ZOEA 3A6BH 3MRIB 1QNZH 2CGRL 5SWZE 32C2A 1I9RH 1ED3B 5HVWA 1JGDB 1IAIM 4I5BB 4Y5YB 4QRPD 3B9KD 4JRXE 1X5JA 1MRCH 5JW4Q 4OTXL 2E6PA 4LLMB 4TNVK 5K93A 1MFCH 2XTJD 2C1OA 2PW1B 4KROB 5D2LA 3QEGL 5I1JH 4NQCD 2R69L 1FZMB 3MBXL 2YHGA 3MLRH 3JVGA 3WXWL 3FQRA 4PJAA 3G5XB 4FFWC 1KG0A 1AD0A 3SDAA 2R29H 3QJHA 4PGZA 1GAFH 1MJ7L 4JN1H 1J1PL 3DX9A 1U3JA 3VWJB 5DMJB 3IXTA 4M7ZB 1UXWB 4UZGA 2G9HA 3QUMB 1A3LL 1BBDL 1YNTA 1M7DA 3GJEA 4G9FA 4MCYA 3UAJC 5CBEB 3VXOB 4QRSB 1A6WH 3MCG1 3DSNA 3PWUA 4WO4D 1S9YA 2X1XR 1NBVH 1OD7A 4YK4B 5IQ9B 1U3ZA 1W72L 1U6AH 4PJ9B 2AAVA 3BEVB 4MA8L 1A3RH 3QQ3B 2DI8A 3HMXH 1U8MA 3IU3A 3RTQD 3O8XC 2W38A 5GGVH 2F74B 5IOPA 3BP4B 1TETL 2WQRA 2R0KH 3QO1A 4WW2F 1X9QA 4TRPL 3L6FB 3MTRA 2CRZA 3ARGD 4L9LB 3BI9X 1BOGB 4XP5L 4JY5L 4XBGA 1ZSDA 1IM3B 3OAUH 3MLXH 3CUPA 4G8FA 1CGXA 3MGOA 4J12A 4U6TA 2P5WB 4U4BA 5AUMA 5HHXL 1AKJA 3FMGH 2J8UB 1L7TL 2W60B 4JZJA 1FIGH 3MLSH 5HGBB 1QSFA 3MUZ1 4NJ9H 3DYPA 3ZZ1A 3CDFA 5EOCJ 2BJMH 3EJZC 2G2RA 5D9SB 3MNVB 2CLVA 1VFAB 4KVNL 3W9DA 5IHZA 2FGZA 2ENYA 5E5MA 1QFPA 1U8QB 1Z6JT 2JK5B 4Z7NE 3EYOA 1RK1A 4ZUVA 3ORJA 5ITBL 3RDTB 2NY3C 1E4KC 3BVNB 2NY1C 5C6TH 1GXEA 1T2QH 4GKZA 2PXYA 5IROA 1U92A 4DVRH 2Y23A 1MCQA 2OK0L 5EIIA 1WUNT 3JV5A 5DJ8A 3I3DA 4YC2B 2YD5A 1ZLVK 2V2XB 2A77L 5IBTH 1AGCA 3S88H 1QR4A 4IRZH 1KJMB 4WNQB 4X9HA 4R0LB 4R7NB 4QOKA 1CWVA 4JFFD 4ISVA 1OAYH 4KHXH 4YEEA 4X0KA 2WZPD 4O9HH 2VLJE 3EO0B 2EE2A 4WY7H 3UC0L 1IGTA 3P4LA 2BVEA 4QHUA 3SY0B 1M7IA 1HQRB 3L3HB 3GHEH 3MNZB 5DK2A 5C0EA 1C12B 3I6LE 4I3GA 3EZJB 5JIHA 5I66B 1DTUA 1BM3L 3WUZA 4QOKD 2W59A 2JB5L 2WWMC 5IEKA 1MFCL 4UV7H 5ADOH 1GSMA 3OR6B 3TESA 1S5IH 2E8YA 5DD0H 1KLUA 2VXUL 1HSAA 1TQBB 1XGUA 4L9DA 1ZHKB 4JZOB 5C0BB 2DBJA 4XVSH 5FOBA 5GGRY 2WW8A 1JPST 2GUOB 1UYWH 4HAGA 1MWAH 4U6HB 4Y16C 2PXYC 4YHLH 4G9DB 5FHAL 4KKNA 3V6OA 4HMDA 1X7QB 3ROOB 2JF1A 2C1OB 3A67H 1PVHA 4WHTB 2F54D 1CZ8L 4QGTA 5ALBL 3D9AH 3OF6A 4PJAB 5D7KE 5FDWA 1Q94B 3PNWB 5D8JH 2CXGA 3BISA 3MZGB 2YN5A 4V2BA 1P1ZB 5D7LB 4PLKD 4X6CE 3TZVA 4DGYH 4AENB 1F2QA 1AFVH 1U8HA 4C58B 1U8LB 1GGIH 4LVOC 5DJDB 4L3AA 2F5AH 1OSPL 5FHBH 4H5SB 2GSGB 2DD8H 5HYSB 4PRPA 2J6EL 5F7EL 3SE8L 3L3IB 4PJ9A 1AXIB 3BEVA 2D2OA 5KS9B 3TNMA 3GRWL 3I6LD 4J1UA 3M8OL 1ZEAL 4N0FB 1MFEL 2P5ED 2QQQA 3PGDB 2CDEB 4OGYL 4FQIL 4PJXF 2BSTB 3QUXB 4U1IB 4Y8AA 4OB5H 5GS0L 4MNHB 1ZHLB 4XNZC 2ATPB 2XFXB 5IQ7H 4KUCF 1BM3H 3QUZA 2HRLA 5GGQL 4JRXB 1XF3B 3DX7B 4KK5C 1NGQH 4LCWD 3RWIA 2FSEA 4QLRA 4L8DA 1NJ9B 3HUJA 5MEPA 1ZSDB 4G8FB 1TZGH 4ZUWA 4OLZL 1NCNA 1D5IL 2DQHL 2W0PA 1SJEA 2VWEC 4PGEB 5C0GB 2AERT 3QWOB 1GGCH 1EERB 2WUBL 4Y2DC 3EW3B 3H6JA 2ZWLT 4YHPB 3RGVB 1U3HD 4DKDC 4BA8A 4P5TD 1SJHA 1IE5A 4JFDD 3EYSL 5KVGL 4TPRL 2Y25A 1A22B 5IHZB 5IV2A 2EH8H 3O9WA 1G7MB 2BSSB 2CK2A 3LCYA 4UNUA 4Z6AT 3LN4B 3OZ9H 3QG6A 3M17B 5IB5B 5H35B 1LEGB 1MHHB 3VFWB 4ZOCA 2PXYB 1JBJA 1KCVL 1YEDB 2FNBA 4JRWA 3FT3A 2DN7A 2V2XA 1LWRA 3ARWA 4I5BA 3OR7B 1KTLB 4MD0A 4WUUD 5CWSA 3BPCA 3O8XB 1TNMA 3HNSL 3P0VL 1KPRA 2GT9B 4IRSA 3L9RA 5J56B 4R8WH 1MFAL 4R4ND 3SY0A 1OAXH 2J88H 5DRWB 5ITFA 2OXHA 3MNZA 3U2SA 1MLCB 3PWPA 4IM8A 5T1DL 2WIMA 3QDAA 2J8UE 4LLVB 1P7KB 3BN3B 1AD0B 2F58L 3GBMH 4GAJL 2FLBT 3D6GA 1NAMH 4YGVA 3DYOA 4FN0A 3IXTB 3CH8A 2WLYA 5EIVA 3EDKA 2FEDC 1BEYH 3E3QC 3ZKXC 3T2NH 5I1IL 1B4JL 3F8UB 1PY9A 3QUXD 3S37X 4R7DA 4Y4HD 3X3GH 2FR4B 4IMLB 4C57C 4XPGL 2O5YH 1I9JH 2HFEB 1HSBA 1JGUL 1TZGL 2IG2L 4X4YA 2X9XA 1MRCL 3RIFF 5FA3A 3QHFH 3VD4A 3FZUC 3GMLA 2OJZH 1KCSL 4ZSOE 3KLHD 1IAIH 4WHTA 5GGVL 4ZXBB 3L7FB 3IDJA 1A7OL 1KJ3L 1XZ0A 3KPLA 4HIXH 2EDQA 1EFQA 3CMOH 1T2XA 5EWIH 5F93C 4KK6D 4C56E 1P1ZA 4HZLA 4N8VG 2V17H 5IVNA 4JLRA 4QYOA 1A7PH 1INDH 4OT1H 4H20L 2M1KA 5AUMB 1A7RL 5C6WH 2VOTA 5BO1L 4JO3H 4L8CA 4PB9L 3VRIB 2AXGB 3TCLA 1XR9B 4F7PB 4NPYB 5J1TC 3L3IA 4MS8D 4PP2A 4X7FC 2QADB 1ADQA 3LSOA 3PF2A 2AK4B 4PBWD 1NFDB 3QO0B 5HYJB 2CDGB 1B90A 4M7JL 3VGAB 5IMOA 1UM4H 5K33A 3W11D 1ZT4B 2D7TH 4WIQA 5IHLB 4MNHA 1OW0A 1FFOB 1YN6B 2Q20A 3BVNA 2VISA 3LIZL 4ESKA 4RWYL 4PJ8A 5HVHB 2WANA 5IMMA 3DROA 4E41B 5FOJA 4QRPA 4F8QA 4QOKB 4PJAE 5IW6B 1UJ3B 1CIDA 3FFDA 1K4CB 4PV8A 1SJEB 4U7SA 5EOTB 5DA0B 4PGEA 5D1XA 4TVPD 4ZFGL 4ZTOL 2R0WL 4PGBB 2BXZA 2R4RL 4YHPA 4H88H 1G1CA 4YK4C 5D1QC 3RGVA 1CBVL 4EKXA 1CGVA 2N7AA 3QI9B 2FO4A 2J8HA 4QHMA 1HHGB 3HAEH 4C83B 4PJEB 2B8OT 3L7EB 3FRUA 1L0YA 2FDBP 5I15H 3ZDZF 1B3JA 2DBLL 3KHQA 4JFYB 1G7MA 2JE8A 3IDUA 3LN4A 2AEWA 3RL2B 1P4LB 4Q6IC 4NFBA 3CFDA 4OAWB 3MREB 2OL3B 1I1YB 4LCYB 3TJEL 3VFGH 4D3CL 4WWKC 2DDQH 1DCLA 4XCNB 5D93C 1G6RL 3FT3B 1ZMYA 1UJ3C 4POZC 5C0RL 1NGWB 1JPSH 5EUOF 4PRDA 2J2ZA 5JIKA 2DIBA 4ORZC 3DETC 1EEYA 5DRZB 5E8EA 3HI6L 2HFTA 4NP4L 1FC1A 1IGIL 4U1SA 4CRPA 4LPTA 1P7KA 4XHJD 3RWDB 4JY5H 1IRAY 1T04B 4XP1L 4P2QD 2LU3A 3B3IA 2JJTC 4AENA 2AJZA 3T0BA 1OAKL 5MERB 1V7MH 4YHNB 3VFPA 2V2TB 5CGTA 1PW3A 1QFUL 2GSGA 5I8KH 2R39A 3C2AH 2EO9A 2DL2A 4WV1C 4FFYH 5BVJB 4OCNC 3RZCA 1WICA 2R1YB 4NGHH 1Q9KA 5JR1L 5JDSA 1MAML 5HYQB 5IWLC 1UWEL 3WS6A 4J2XA 1QHOA 4XZUB 1G1YA 5DJ6B 4YDLB 4YBHA 1RIVL 4Z0BH 3C08L 3OGCA 2BSTA 3Q1SH 4U1IA 3ZKND 3FT2B 2FEEI 4FQPA 2ZSVB 1DVFD 4JFPA 2CJUL 4I2XA 4YDKH 1I9JL 2VLRD 2VH5L 3N1GC 4OZFH 5BVPL 2YK1L 3F5WA 4G42A 1GVIA 4GJTB 5BV7L 2Q3ZA 1OAXL 3BAEL 3O0RL 1KENH 5L0QC 2R0ZL 2DJ4A 3NCBB 4UQ2A 3SGKA 4F9LC 2EC9T 5CINL 5HSFA 2FHFA 3RPIA 3K4ZA 4GAJH 4P2CG 2FHCA 4X6CF 3GK8L 4N8VA 3G5VA 1PZUB 4WJ5A 3HNVL 4FABH 2X4PB 5SWSE 4JPKL 4U1NA 3QO0A 2JIXA 1QP1A 3RHWF 4Z7OF 1D6EA 3S36X 5M95B 2A1WH 4M1GH 4X7DC 4JFZH 3CFJA 4P3CH 5IB5A 3FONB 4LSTH 2HVJB 1A7BA 3CZFA 2NW2A 4MZ2A 5FCSH 1SEBA 5IIEA 1Z3GH 1UEYA 4WGWB 1VPOH 4P23D 1EHXA 1WZLA 2HT4D 4ZSOB 3B5HA 4M48H 4IRSD 1NKRA 1W0VB 4I0PB 3BJLA 3MJ7A 4MD4A 4BQ6A 2W0FB 4JQVA 5FO7B 5CWSB 2RQ8A 5DQDH 3IS1X 3V5HB 1MFAH 1MCPL 3GMQA 3PWVB 3VG9C 1ZK9A 4HDIA 4FZEL 1NC2A 3QNXB 4X6CA 1LE5A 3DGCR 5JXED 2GK0B 2CR6A 5IP4A 1G7PB 4L8BB 3Q3GB 4P46A 4XAKE 3L7EA 1JUFA 4JB9H 1MH5A 5MEOA 4QKXB 4ENEC 1N4XL 1AE6L 4WW2B 1W0YT 1B0WA 4PRID 1X5YA 1T20A 3LQAC 4OLYH 4PYHA 4APQB 1I1YA 5KSUA 1MCBA 4JPIA 3SE8H 5ILTH 4XCEA 5JA9A 2B0SH 4HXAL 2JIXD 1JGDA 2VR9A 4UIKH 1KJ2B 4NUJA 2EIBA 4GXVL 3LKPB 1R5VA 3KPOA 5IQ7L 5DD3L 5E8EB 2C3XA 4G8EA 4JPWL 4P3DB 1FBIL 4HKXB 1NMAH 3VFRB 5KSBE 5GHWL 1NMCB 4DFIA 2CK0H 5E9DD 3U82B 4LLYB 4X7SL 4APQC 3D3VA 4M1DL 3SQOL 3U1SH 2FX9H 3FO9A 2AK4D 1H3TA 4LEXL 4N1HB 1SQ2N 1M7DB 1WT5A 1GGCL 2DQDL 3GJEB 4MCYB 3WJLC 4OFIA 1RJYA 2WUCH 1CLOL 4OD3L 1A02N 3RTQA 4IHOB 4JHAH 4LVOB 4NUGL 3CDGA 1YEJL 2AK4A 3GSVB 5K59F 5SWQB 4JKMA 5TDNA 2V7HA 3MGTB 1MCCA 2Q8BL 3MV7B 1FSKB 4OQTH 1KIQB 5GS1A 1QFOA 4YHKL 1QLRA 1T7YA 3F62A 4I0PC 3TH4T 1JTTA 4NZDA 2AABH 5TE6H 3VWKC 2C3VA 4XAWH 2NX5A 1Y6NR 3MV8A 4ZAKC 3G6JA 4BKLA 2X05A 3ARGC 1JZ4A 3RWFB 1IARB 3ZT7A 4D94A 3UBXG 5IB3A 4K7FB 3K1KC 1P5UA 1T1YB 3QR2A 1T0MA 1AY1H 2J8UA 3HLAA 1SBSH 1T03L 4Y89A 2MKLC 4K7PY 1CIUA 1KJVA 3QB7C 2Q6WA 4Y1AB 3DNKA 3ZTNH 3HZMA 1P7QD 3V5DB 3NIDF 2QKIB 4HC1L 4MA3B 1RIHH 2G2RB 3S3SA 1Y0LB 5D70H 3UPRB 1MJUH 1L6XA 3BWAA 1UT9A 3KPSD 2A38A 2EDFA 5E5MB 3JBG7 3MA9L 3QXUA 4HIHA 4URTB 4W4NA 1INEH 1WAAF 3BP6A 4K23H 1J9CT 1KYOJ 4F2MB 2Z4QA 3RDTA 3V8CA 3E0GA 2E9BA 4OLUH 3D69B 5CIPB 1S7RA 2NW2B 3G04B 5KN5A 1A6ZA 4G80A 4KMLB 1AE6H 1EIBA 3BH8A 3BN9D 2YRLA 5EIIB 1BD2E 2WBKA 4S1QH 1UA6L 4Q9QH 2KZ1B 5FO9B 3RWJB 1LGVA 1FFNA 5CZXC 4Z9KB 1U9KA 1UCBL 5E56A 5CILH 3O6ML 4EDWL 3O45B 4M1GL 3MRGA 1KN2L 4MSWA 3OKMB 3QWRA 3K0WA 4PRNA 3RZCC 5MP6L 1EEYB 4C56A 4WV1A 1F45A 3H0TA 5JPNA 4OFYA 3MLXL 4GS7C 5CD5C 2C3WA 3I75B 2H26B 3CU1A 3MRCB 4KKLD 2IQ9L 5HHNA 4JVPA 3LPGA 3Q3GA 4YX2L 1LVEA 5L8JB 4NJ9L 4U2YA 2PO6A 5FYLD 1FH5H 1RMFH 4TPRH 1EDQA 2HFFA 4TSBL 1PZ5A 1OAUL 5GS3A 3EAKA 1MLBA 3T2PA 1A3RL 4WFGE 5ICXB 4J8RA 3CCHA 2A74A 4WEBH 2XKUA 3P73A 4J3OC 3QRGL 1G9MH 5C0DA 5BVJA 3RUGE 2D31B 1S9WA 4X9FA 2R0KL 1BBDH 4UINL 3QDHA 1RJLA 5CEZL 5HYQA 4LIQE 4HH8A 3MLUH 4LDLB 4M5ZL 3VDBA 3CU7A 4LDOB 5ETUB 4NQXB 1J8HE 3EOBB 4DZ8B 4A6YB 2YC1A 5DYOA 2X9YA 3UTZA 2E3VA 1BVKA 4MA8H 5FKAA 4JRXD 5D96B 4QRPE 4JN1L 4LHUG 2DIAA 3F65A 2J8OA 3MJ8A 5DT1H 5AG8A 4TOYH 3BDYH 2DTMH 1T80A 2DQFA 2R2EB 5GZOC 1KN4L 5BZDB 4XMPL 1J11A 1A6PA 3ELAT 3LN5B 4P23C 2BMKB 3NFPA 3V4UL 4FA8A 1JZ2A 1NGXB 3MC0A 4EXKA 3O11B 2AQ2A 35C8H 1AP2A 1NC4D 1NSNH 5D1XC 4HFUL 4FG6D 1HDMB 4ZYKA 1Z0NA 3TNMB 4PJGB 3MLRL 4LP5A 4YXHH 3O0RH 2AJYL 1FHGA 3O2VH 3VRLE 5HHOB 3PP4L 5J9PA 1GYAA 5CKAA 4QO1A 4KQ3H 2DQJH 3E6HB 5F1IB 2CJUH 1KULA 3FONA 2DF3A 2VH5H 1R5IB 1U2HA 3CZFB 1AO7E 3ZSTA 3C9NA 4Q2ZA 4CAGA 4O4YH 2XA3A 1OW0C 3MROA 3N1QC 1S7VA 1JFQH 4ZUSA 3ZKQD 4DZBA 1YMMA 2BVYA 5MHSD 1JPSL 3GGWB 1FVCB 1NJ9A 1U8IB 3I50L 3R8QA 1G6RB 1Z9LA 1DE4A 4Y5YC 1FYTB 1RK0A 5FF6B 3U46A 3SPVB 4LASL 3ZE0E 3ZHDA 2BHUA 2WINB 5K9KA 4LKXB 4KUCD 4OF6A 2EYSB 3NTCL 1FIEA 5D6CA 4DGVH 2BY0A 5GRWA 2FHBA 4HW6A 3MBEA 1R3HB 3VXMA 5KVDH 3CVHA 1AR1D 2DQIL 5EFIB 4JR9H 4RMWA 1YY8B 2HN7A 2BNRD 3LZFL 3UPRA 1PG7L 2HKFH 3TIDA 1LDPL 3NIFF 5E2VH 5IV2B 5F9AC 1EFXD 4QRRB 4CGTA 1OGTA 1T66C 3IFOB 2CGRH 5I1CH 1X5KA 1T20B 2D7TL 5JW4N 5MEQB 2X9WA 1EUTA 1LEGA 1MHHA 3VFWA 1IGJB 4AQ1B 4B5EA 5KS9E 3IDIB 5KJRL 4KH2A 5KSUB 2ZKHH 4XCEB 3V52H 2Z93B 4NQED 5IR1A 4RWYH 1A5FL 1YNKL 4UDUA 1XF5A 3MV7E 3RWJA 4HUWB 5K9OA 1J12A 1UZ8B 5C08E 2W0LA 4ONHA 1U3HA 2DQGH 3DMMA 5F7LB 1D5BA 3F7VA 4NO3A 4TQEH 1EXUA 1DEEA 5C7XH 4ZTOH 1S8DA 3GSRB 3STLB 3LKNA 3JWNC 1RUPH 5LQBH 1F11A 3NFSH 3VH8B 4CW1B 5MENE 1E6OH 1JK8B 4Y1AE 3QNYA 1JHKH 1Q72H 1XGPB 4YIQA 4NN5C 5ERWB 4WFGD 3S88L 5JXEA 3VGFA 3CCHB 4WW1B 2V7NA 3VFGL 4D3CH 5JORB 2X4UA 4JFQB 2GJ6E 4Z5RA 2HFEA 4AEFA 5F89A 5I18L 3CFEB 4ONGL 3ES6A 2HMID 4ZS7H 4F37F 2X41A 2VDRH 4NQXA 4E42A 1BD2B 4TRPH 3MGTA 4LMQI 5IW3A 5MEND 4ZXBA 3HI1B 1ADQH 1W72A 4R97B 4DUXA 2DYPB 4Y4HC 4JZNB 1TCMA 3K4AA 4M61A 3OAYK 5H94B 4P4RA 1JI1A 4ZTPL 1AQKL 1BX2A 2ORBL 1RZKC 5FFLA 3FRPG 3S35L 2XZAL 3QIWB 2BY1A 4Y5VA 5EO1A 5C08D 2HLFC 4GQ9H 3Q5TA 3CVIH 2Q6WB 1FNEB 4F7EB 1JZ3A 3HZMB 4RRPG 3V5DA 4ZUTB 2A73B 4IRJB 4TUOA 1HDMA 5KW9L 2A9MH 4LPCA 3OX8A 1A0QL 4PJEF 1KCVH 1IKNA 4HK0A 1DLFH 2B1AH 3WL9B 4KJWC 1RZJL 5CP7A 5T1KD 3QYCA 4HIHB 4UUJB 1N2RB 1ZT4A 4FHBD 5F1IA 4RGND 4IDJH 5C9KA 5I2IA 1D6VH 2P48B 5IT2L 3QUZC 2R4SH 5DUPL 3MROB 5CD3A 1RUML 5D1ZA 4DQOH 1C08B 4RZCB 1U8IA 1TFHA 1KF9B 2MFNA 3MLZL 1DE4B 5EUOB 5IF0A 2EDYA 4QRPB 2CIIA 4XPAH 2FEDD 1R3KA 3NZHH 2WINA 4TVPH 2ZJSH 4C56B 3H0TB 3HMWL 4Z7NF 1BEYL 3S6CA 2EH8L 1CLZL 4CNIB 2HP4A 5B8CC 1H15B 2MTPA 3HZKA 2D7NA 2DIJA 4HWZA 3F6IA 5HI3D 5L6YL 5CGYC 3GBNL 2MMXA 3PWNA 5IB1B 2AK4E 4PJGE 5F9JA 5DQ9B 5FK9A 5HYJE 3BKYH 2VXQH 5C2UB 1IBGL 2QSCH 4MQ7A 4Z78B 5IR1B 2EDJA 2XKNB 2Q8AL 1WIOA 1XF5B 1S9WB 5CILL 3G5YB 1XH3B 3RUGF 2FECL 1JGLH 2K9UA 3CVHH 1KN2H 5KZCB 4BZ2L 4IOIB 1AO7B 5CGMA 3DMMB 1WVZA 1QRND 1Z5LB 5ETUA 3O3DB 1MCIA 4YHKH 5KVFL 1QFWL 5DYOB 1IVLA 3GB7B 4Z7VA 2BOCB 3W9EB 2YWZA 1P6AB 4YPGB 4NSKB 5IFAL 2ESVD 4OLZH 2VKXA 4KJQC 3P11H 3ZYJA 2HAZA 1T3FB 3ALPA 2YD6A 3MUJA 4X6DA 2R4SL 1OARL 1NGQL 3D18A 4Y4FB 4LSUL 3VXMD 5DJYA 5DZNA 4QRRE 2BNQA 1IC4H 1OT1A 4LPYA 2CLRB 4YBQC 4KI1A 4L3CB 4FQIH 4UIMB 3MRPA 4Z76B 3CFEA 1MCKA 2VDPH 4CL7A 2GJZB 1CYGA 3VCLA 4E42B 4BYHA 2X4TA 3D9AL 3OGCB 3QZWG 2VLJD 1QD0A 3QNZB 5DD3H 1OGAB 1F4YH 3HI1A 5D7JA 5C08B 4XPTL 5EIQA 3OF6D 5HGAB 1R5IA 4UV7L 4CBPA 4Q2ZB 4EOWL 3UJIL 5I1AB 3F6LA 4JZNA 2A2QT 5F71A 2XA8L 2PO6C 4L9LA 1GCFA 2Q87A 1SY6A 4X7SH 1BX2B 3QUMH 2X1WL 1ZWIA 3MGOB 4EN3A 3U46B 2P45B 3HI5H 1YUHA 2ZNWA 5KTEH 3B4NA 4JZJB 4S2SB 4XVUD 1X5ZA 2P8MB 4OJFL 2B2XH 5MENB 4HT1L 5D6CB 2DM4A 4KPHH 2WV3A 4HMEA 1BD2D 2BK8A 5DA4A 5SWSD 3U7YL 4YHLL 3MLTB 3GJFH 4F15B 4HHAA 3SGJA 5I0ZA 5JHDE 1QBML 5F7MC 4HK0B 4KV5F 3SKJL 1IKFL 1HYRC 1OPGH 2DLTA 5HJ3B 2MPAH 2GJ6B 4UI2A 3FT4B 2NY3B 1URLA 5IFAH 2HVJA 3QIUB 1MREL 3K81A 1ZANL 4KGLA 3CX2A 1FORH 4OCMC 4ZQKB 4U33A 1OTUD 5L6YH 2GEEA 3ARZA 4CDHA 2YOCA 2OR9H 4P99A 1HINH 5GISH 4HUNB 3R8BB 4HUVA 3T0XA 3BDXA 2GK2A 2VLKA 3TNNA 1MEXL 1R3KB 4OFKA 3GSWA 4JFEA 5FYLH 4RAHA 1P6FA 5KSAD 1I7ZA 3S3JA 5A16A 2ZUTA 4K3HA 5I15L 3STLA 2XZCH 4IRZL 1PKQE 3AY4C 4JM4L 3TLRA 2WWKT 3NCMA 1MH5B 5MEOB 3V0VB 4YWGL 3GIVA 4DCQA 4PJ8D 4ZAKA 3V0WH 3CX5K 4N0YL 3C5ZC 4OGZA 4P48A 1WIUA 4MZ3A 1BWWA 5ERWA 1NAKH 1XGUB 1AR2A 4WW2C 3BD3A 3OTTA 3K1DA 4S0SD 5FYKE 1ZLSH 4ACPA 2YUZA 2XKNA 1EFXB 4QRRD 1PJ9A 1T6VN 4J3SA 5DRXB 1KACB 3PJSB 4BK4A 4QHLA 3LKRB 4GG6A 4U6HA 2ZSWB 1FJ1A 1I9IH 3AREC 4LSQH 2AXJA 2PYEE 2C7UB 4F7TB 3T65A 3QCUH 3IDMA 4YNYA 3RTQC 5IVXA 1KTDB 1YMME 4N0RA 4PJDA 4MD5B 5DDHA 4CMHC 5DJXA 4OZIB 3AS3A 4J3TA 2R9HC 3WJLA 3ULVD 4FQCH 2OMBA 4OZFA 3DO3A 2OZ4A 1W8OA 5I74C 2G5BB 1NGZA 2ICES 1MCPH 2EDKA 4PB0H 1PDKA 3O9WD 1DLFL 2F54E 4P5KA 1EAJA 3WHE0 4DTGH 1DLHA 3IRZA 3FHQA 1YZZA 3WO4C 3MOAH 4JPKH 4Y5VB 5EO1B 2B4CL 4NNYB 4HJGA 1R24B 1LO0L 1ZA6B 3FO2B 1VACB 3EGSA 3REWA 3MRHA 5DUPH 1T4KB 1KBGL 5HHOD 1IEAA 4ELKA 2Q1EA 3ULSA 3FN9A 3I84A 1RIVH 2CLZB 2XQBL 2RIKA 4WUKH 1RFDL 3LVEA 3VCLB 5HDOA 3ZL4L 3WNKA 1RUAL 2NX5D 2ARJA 3MV7A 3U9UB 5C08A 4XBEL 5EG6C 4H1LG 2C3VB 1FVEB 4H0IA 3RWIB 5IVXF 4YE4H 1C08A 5EH1A 1I8MA 5J13B 1WFTA 1J5OL 1HE7A 3SGDH 2SEBA 4X8JB 1LEIA 4KI5E 1BWMA 4OZ4B 4P46C 3ZSSA 3WNOA 4BFIB 3Q5YA 3MSPA 5KSBB 2OP4L 5MENA 1JPFA 5CJQL 3RX5A 1KJVB 4BFEA 1JGEA 1UB5B 2IPUG 5DJ0B 3DBXB 5C8JB 2ITCB 5GGTA 4X98A 1WBYB 4YC2C 4P3WA 2X42A 5D2NA 2XQYG 3BHBB 3HZKB 4G6FB 4JFHE 2DDQL 2B1HL 5DD5L 2GJ6A 5DFTA 2QSQA 3C5SA 3FFCB 3O6LL 2AEPH 1XGYH 3PHOB 4NP4H 5FM8A 4OV6F 5JR1H 3LH2L 4X80L 1OCWH 2E6JA 2D3VA 3G5YA 4PUBH 4HS3A 4G5ZL 1HOCA 4OUUB 3IXAA 3BPCB 4RGNE 5C0CD 2ZOKA 2HLFD 4WCYL 4XP1H 4ZODA 1C5DB 4PJDF 3MRCA 3TH3T 1T83A 4GH7B 3CSYB 1EPFA 1V7NL 3SJVE 4NHUA 2HKFL 4Y7MA 3GIVB 3R06B 4DCQB 1FFQA 1Q38A 4YGVB 1MLBB 4GKOA 1WITA 5JHDB 1I3RA 2WNGA 2XZCL 3SCMB 5DJYB 5F3BB 1NC2D 5EUKA 3O4OC 4E9LA 5GGSB 3ARSA 5DO2D 1BZQK 2PKDA 2FR4A 1MPAH 4L1HA 3QEUB 1NLBH 2D31A 2P5EA 4LBEB 4D9RD 3X14B 1KC5H 3IDGA 4Q97A 4PJIA 4OZIF 2WWKO 2L7JA 4L4TA 3OKNB 4R2GD 1JRHL 3GMLB 4XTRC 2APWA 4RBPH 5C0JB 5D93B 5J3HC 1ZLWK 1BVKB 3IDJB 2IBGA 4HLZH 1T03H 4LRIC 4UT9L 5INDA 3EDEA 1U95A 1VFUA 3U0PA 1UWXK 3WDJA 2X10A 3BKJH 5CEZD 5J13C 5IM7B 4NHCL 1NQBA 4NZTH 2IGFH 3ARUA 4LSUH 1KJ2H 1YUHB 2GW5A 3D39D 3T77A 3NFPB 1A1NA 2OJEB 3FO2A 4LCCB 3MNWA 3MV7D 1ITBB 1KEMH 4HWEL 4G3YL 2EE9A 4LLWA 1TCRA 3LRSB 3V7AE 2OI9C 2NTFB 2V5TA 2IPTL 2XZQH 1CCZA 3U4BL 4KZDH 2E9WA 3C6SA 5HYJA 2EDBA 3BT2L 3QCVL 2VZOA 2FIRT 1ZLUH 2DWDB 1W2KT 4H0GA 5E99L 3MRBB 1N8ZB 3RUGB 1OT2A 5KG9A 3NCJH 3WHE1 3VGBA 2BC4A 1QPPA 2C4FU 3MACL 3KJ6H 2PYEB 1I1AA 3VRLF 1FVEA 2PW2A 1YN7A 3DXAB 3MMEA 2FD6L 1YMMB 1J8HB 2J3SA 3BPOB 4J4PA 4N9OB 2ITDB 1GGYA 1FVCA 1BJ8A 1MI5A 3RRQA 1RHHA 5BRZE 3ZL4H 5FF6A 1E0OB 3FFDB 2Y4SA 4PV8B 5K59E 4PFEA 3U0TA 3RU8L 4L5FL 5DJ0A 4MJ2A 4P2YA 1FAIL 4OD1H 3MBXH 1YY8A 3U30B 1VADB 4NRXA 2B4CH 4KKAD 3NIGE 4QRRA 2VDQH 4PJGF 1A6AA 5F6IC 3KLHC 1YY9C 2ZUWA 3D25A 3GSNB 4FTVD 3PUCA 1FZOB 3VGDA 2W9EL 5HHOE 4HIXL 4HBQA 5HYFA 1OTSC 4HAFA 5K9OB 2N7BA 3NGBC 3DMMD 3U4EA 4B7IA 2OL3L 2JJVA 3EYSH 4OLXH 3VFMA 2XG4A 4MDIA 4PTUA 1BGXH 5SV3A 1SYVA 5E2JA 5DHXB 3PWPD 5DJ2A 5DRZA 4UINH 4XX1G 1FYTE 3C60D 2VABB 1ZANH 3E2HC 4P5TC 4K23L 4KZDL 1MCEA 4OLEA 2G5BA 4EI5B 3LV3A 3ULVE 1LE9A 1T04A 3WFHA 3VXUD 1NAKL 4P2RA 1SBBA 1XAUA 1OP5H 1JWSA 4ORGA 5I76B 3PP3H 5JXAH 4Q9QL 1K8DA 1G7IB 5INCB 2G75A 1U93B 4HJGB 4NYLB 1QG3A 3QUYA 3B8YA 2EIEA 1R3JB 4MMXC 2WUBH 5GGSY 5EBLB 1T4KA 4G7VL 1KPUB 4XVUC 1QEWA 1UKTA 3VFTB 1RHFA 4PLKC 3IDGB 1SBSL 3FAXA 4R6UA 4NDMA 2ZUXA 4M03A 2EXWD 1H8SA 5TE4L 5DJ6A 1YDPA 2B39A 4PD4J 4KDTA 4OV5A 2ARJB 3D1MC 4R0LC 3PWJA 2NW3A 1S9VB 4BFGA 4P59H 4NKIH 4RGNB 5C3LD 3CFKB 3GI9H 4OCLC 4U7KA 3F5WB 1I8MB 5GS0C 4XMKL 3KDMA 5E00B 3OJDB 4H1LB 2NZ9D 1CGSH 3QSKB 1A1NB 3SJVB 4LCCA 5DHYB 4EBQL 1KUMA 5FHBL 1B6DA 2NCMA 5T1KA 5I1DB 3IU4L 5T1MA 1QZ1A 1K4DA 4NFCA 4OCSL 1YEKL 1UEMA 3QIWD 3KPTA 4NHCH 2VUYA 1ZHBA 2QSVA 2WP3O 2DKUA 2Q8BH 5E4EC 5IHBA 4UUJA 1MCOL 2OR8A 3ARXA 3HC0B 4WFED 3AREA 3GMPB 5F6IB 5E03A 3P4OB 4WCYH 2VC2L 3EFDL 3C5JB 4GG6E 3TT1H 4WUUE 4Y2DD 4PJ7B 1Q9LB 4KHTL 1K5NA 2PYEA 4IEFB 1TZHB 4CVZA 4EQ2A 1GZPB 4RZCA 3M1BB 4RAUA 1P4BL 2X2YA 2DQDH 4XPBH 3IXAB 3RKDC 4HX1B 6FABH 3C5ZA 5KJRH 4DVRL 5GSVB 4POYA 1U8JA 4DVBA 2ZOKB 1MRDH 3PXHA 4I1NB 5EB9A 4AG4L 2F54A 4OFVA 1TJGH 2X1PA 3DO7B 3HN3A 3QNXA 5DJCB 4PJHE 4LCWE 4TSAL 1NLBL 4CNIA 1W0WA 2I5YH 3TC9A 3Q0HA 1G7PA 5B39G 4P46B 5E5UB 5GGRA 1DQLH 3DX6B 4HV8B 5JUEH 2BOBB 2B20A 3KYOB 4PGDA 2NY6D 4GRLB 3RWGA 4ZNEA 2UZIL 3HFMH 1UZ6F 3VRJA 3IJSA 2HFGL 4L3ED 5DQ9A 2DI7A 5FK9B 5FGRA 4YAQB 3JUYA 3GSXB 3B6SA 5LGKA 4MQXD 4XPFL 3PHQA 5KANG 3DI3B 3IFPB 3VXTB 3DXAE 1R5VB 3S4SG 3SE3A 3QIBC 4OCRL 3IJHB 4UDTA 3BMWA 1F8TL 1F90L 3PIQB 5EU4B 4FQJH 5EUOE 1CXHA 3AB0B 5BRZB 2VABA 1CFVL 3KPPB 5KVEH 2VZ3A 2M26A 4UIKL 3TZVC 1TDQA 4K3EL 4R4FH 4U0RC 2C1PA 3GSQA 1F4XH 3FB6A 2J6EA 3FO1A 3B5GA 1RZFL 2XNAB 4G8GA 4EN3C 1A14L 2DS4A 4GW1A 3D0LA 4PJCE 1FO0L 4YDJA 4JR9L 5GGUB 4Y4FA 4LQFH 4L9LC 4ZDHA 4H20H 1LHZA 2ZP0T 3P4NA 1EMTH 4U6XA 4L3CA 1QEWB 1AHWA 1YECH 1BIHA 4Y16A 5D7JC 3WD5L 1QRKA 3ZLQC 2BY3A 5EO0B 5BMFL 2NTFA 2P46B 3CFIC 4Z7UF 1CE1L 2QADD 4TSCH 2JJSC 1FPTH 3HZYB 4RFOL 1YDPB 5DC0A 1FV1A 5KSVA 3IB4A 2X4TB 4JDTH 3J8F7 1QLRB 4JO4L 2BC4B 3IFLH 3UJTH 2L4OA 3O4LB 4TULL 1WZ1L 2A6DA 1QFUH 3MFFB 3GUTB 2HRPH 3WIIH 4PG9B 1OWRM 3WN5A 5HGDA 1ORSA 4IDJL 3SBWA 1DQTA 3P40A 2FJFA 5J6HA 5IT2H 3QPXH 2R69H 2FRGP 5T5NF 4F37K 2OTUB 4PGCB 2P7TA 4XNUH 3NH7H 2ADIB 4Q6YA 4ZXBD 1WBXA 4LHQB 3ARVA 5JW4R 1E6JL 5L2KD 1DBAH 3CX5J 2XPGA 3SE9H 2IPTH 3HZVB 2WSKA 2MWCA 3MXVL 5IFJB 1SVCP 4S1RL 3ABZA 2R1XA 1FLRH 1JNHA 5D6DC 1IT9L 2DRUA 1ZGLA 5DK3A 4ETYA 4C54A 3UDWC 3P4OA 4PREB 1UM6H 4JJ5B 3FQUA 4BK5A 3D48R 5CIPA 5BS0E 1W72H 5EOCH 3PG2A 4JRYE 4C55A 4KMQA 3DX8A 4RAUB 5DGRA 2P4AB 1OF2B 2W0KA 1OGAE 3ARDC 1BHGA 1T5WB 4MVBC 1CTNA 2XWJB 3HCVA 2AQ3A 5F1OB 2R9HD 5F7WC 4OLUL 3SDDA 5BQ7B 1MHEB 3KPMA 1FVDA 2WBWB 4ELMB 1YEHL 3T0VA 1HHKB 3KJ6L 3C8KB 3QDGD 4HUKB 3TA3A 2WBJB 3HNSH 3K8LA 3I2CL 5IEHA 1P2CA 5HHNB 1JNLH 1IM9D 3WNPA 4EI5A 1LE9B 4M02A 2DI9A 4HXBH 3SEPA 4LLUA 4QY8A 4HKZB 3VDAA 2BX5A 4J3WA 1FDLH 4J8RB 3HC3L 5JPMB 1QFHA 4UU9B 3V52L 3OKLB 4TSAH 4DEPC 4AM0B 1QO3B 4JY4A 3RA7H 2Z0BA 3O6FD 2E7LA 4HGKC 4RRPA 4MAYD 3PABA 1XF4B 3QISA 4NM8H 5IESL 4PJ7E 2ICWI 3PHQB 3V9FA 4TQEL 3TBYA 3HC4H 4LL9A 4F7TA 2BHYA 3IDMB 3RGVD 4GUPB 4YHIB 4YEFA 4WFEE 1BFOA 5HPOA 4KY1L 3WJJC 3VMNA 5FKAB 5HHMB 3DOSA 1PG7H 5BRZA 5ISZA 4MHHI 1R3IH 1QHPA 3GHBH 1Q72L 2C1PB 4GKSA 5FGBA 1X5GA 2AJSH 5A2KH 5JTWA 2D4DA 4P57A 5A2IH 2ZG1A 4PJHB 4LCWB 5FUZL 3EOTL 1PKQB 2VTFA 3MRRA 4KTDH 3VXRB 2A0LC 4JAMA 3ARQA 2BFVH 5L9DH 4UQ3A 4KDVA 2VO5A 3O11A 1AXSB 5GZNC 1DQLL 4K8RH 3KPSA 1GHFH 4I48B 3R0MA 5EU7C 3DLQR 5FYJU 5LAXA 2HT4C 3AXLA 1IAMA 2MQCA 4HPOH 2VSCA 3FQTA 4LU5H 4GMSH 3ETBF 2ADGA 5HDLA 2GJJA 5GZND 4ENED 2N4IA 4PBXA 2ARJQ 4JQXA 3SN6N 2R23A 4N90D 1MFDH 4OCSH 5DC4B 1KCSH 5FKPA 3UCRA 1S7VB 4CVZB 5I8OH 1D5ZB 1QVOB 3OXSA 4OZIE 5JOPE 4OJFH 1JV5B 1ES0A 1J86A 1WCQA 4LNRB 1FYTA 4KQ3L 3C5ZB 3BYYA 3T0EA 5K9KB 4QRQA 1IC5H 4PLJC 4PGJA 1NBQA 2F54B 1MCWM 4YXLL 5ESQA 3QXAA 1R3HA 4Q58C 1JGVL 1YJDC 1W0WB 4PJCB 4NKOB 3CXDL 3QIUC 5HYIA 4HV8A 3DX6A 4F57L 2F8OA 4G8IA 4U6YB 1YEEH 3MQIA 5CEZH 4PLJD 4F3FB 1QA9B 4JJHA 4XB8A 3MA7B 4QF1A 2HTLC 3PP3K 1MQ8A 4DN3L 4JO1L 1TPXC 1FAKT 2A77H 5IBTL 3QXDA 3KR3L 3FRPA 2DMCA 4HS3B 1OARH 4FTVE 3O4LE 4IRJC 3H3PL 1I8KA 2PTTA 4O2CB 4QNPF 5HI4C 3BIAX 5A2LH 4LVNC 2AJ3B 1T1WB 1DEEB 3QPQC 3BUYA 4CN6A 3PIQA 4M7KH 5EU4A 5L0QB 2H1PH 4YXKL 1EH9A 1VEOA 4I9WE 2B1AL 3MBEC 2IFGA 1OTTD 2W92A 3OB0H 3H9HA 1QFWH 5D7SH 3FN0H 1U8PA 3QNYB 3ZKNC 4PJAF 1C7TA 5F6HI 1JRHI 1UCBH 2LVCA 2D7OA 4F8TA 4KRNA 4NQDD 4WHYH 2NXYC 2O5XL 4X6BB 3QIBA 4CKVX 1V3MA 5JORA 1IL1B 2Q3AA 2YPLA 2IAMD 3QEUA 4LSPL 1ACZA 3FFCE 1CGWA 4HWBA 1F3JA 3FB8B 3GNMH 5GRYA 3AS2A 3QBTB 3OXRA 3OZ9L 1ND0B