4RH4A

Zinc-substituted pseudoazurin solved by s/zn-sad phasing
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudoazurin
publication title Zinc-substituted pseudoazurin solved by S/Zn-SAD phasing.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Metal binding protein
total genus 37
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4rh4A00
1ZIAA 4HHWA 1ET7A 2XX0A 1IBYA 5D4HA 3NT0A 3ZIYA 3ASOB 1BQKA 2AVFA 4JHUA 2WO3B 2VW4A 5E9NA 2J55A 1BQ5A 4E9YA 1YLBB 2PCFA 2PPCA 5I28A 2UX7A 2XV3A 3DTUB 1A4AA 2H47C 3FSAA 3X1FA 3SBRA 2WSDA 5I5IA 1XB3A 2BZ7A 2BP8B 1FWXA 1WA0X 1BQRA 5I6LA 5IY5B 2XUWA 2FJSA 2GB2A 1ZDSA 3JTBA 2FQEA 1FA4A 4P5SA 3FQ2A 5B7FA 1CURA 4G71B 2YXWA 4BDVA 4A2GA 1MDAA 4A2EA 2RACA 4JKNA 4WKXA 3TASA 2IWKA 3FPXA 1L9TA 1WS7A 2H3XC 1AZNA 1PAZA 2TSBA 3HEIB 2LLNA 2YAQA 1IUZA 1KV7A 1AZUA 4KO9A 3PAVA 1HAUA 1N70A 4BXSV 4N8UA 2XXGA 1SFHA 4ENZA 2J56A 4E9SA 1ZIBA 2YXVA 3SBPA 3T9WA 1PMYA 3CVDA 1RCYA 5I6OA 5LDUA 2QPDB 3BVDB 1OV8A 4YSTA 1SNRA 3QJVB 3PAZA 1E5ZA 3NSDA 2Y1AA 3T6ZA 1DZ0A 1A3ZA 2CAKA 3V9EA 1ILUA 2BP0A 1ET8A 2PP9A 1KBVA 4NERA 1W8EA 1TKWA 7PCYA 2FQDA 1KBWA 1M56B 5I6NA 1NIBA 3GYRA 2BO0A 1OCRB 2HX9A 1UATA 1HAWA 3TBBA 1V54B 2W8CA 1GS6X 1J9TA 2VN3A 1OE1A 1QLEB 4TXVB 2XLLA 3NJJA 2X87A 2AFNA 3G5WA 1NICA 3NJKA 2DWSA 1IBZA 3AG4B 3HB3B 2AZAA 1RZQA 3FSWA 3JT2A 3FQ1A 2A3TA 2GIMA 2VSMB 1V10A 1GY1A 3NJNA 4DPCX 1OE3A 1BXAA 2BZCA 1JZHA 2FT8A 2IDTA 1BYOA 4YSSA 5FC9A 1PLAA 4M4RB 3OD3A 4K9JA 3X1GA 1WA1X 1GR7A 2I7OA 3NSFA 8PAZA 3TA4D 1J9RA 5PAZA 1PCSA 3FPYA 4G70B 4AI7A 2PLTA 1NIDA 2IH8A 2BWDA 5B1KA 4AKOA 1WS8A 2OV0A 2QDVA 5B3SB 3H4FA 4HHGA 1WAEA 1NPJA 1BXVA 4AKPA 3WG7B 1A4CA 1WA2X 1JVLA 3UABA 4AKQA 3OMNB 9PCYA 1OCCB 5B7EA 4MFHA 3FS9A 2N0MA 1TEGA 1NTDA 1L9SA 4DP2X 4P5RA 1JXDA 4BDVB 1NWPA 1W6LA 4DPAX 2IDSA 2DYRB 1R1CA 1AQ8A 5ANHA 3OMIB 2EINB 2VM4A 3D12B 2HX7A 4GY4A 3IE9A 1SFDA 4A2HA 2CALA 2ZXWB 3MX0B 4GP4B 1KCWA 3PLYA 3SQRA 3CG8A 1CYXA 2XU9A 1A8ZA 2VSKB 3S8FB 3N55A 1NINA 2PP7A 1RZPA 4G7SB 5B1BB 2GSMB 3NYKA 3QJTB 1ASOA 1FFTB 3ASNB 1M57B 1JZJA 2YAHA 4GP5B 1SDDA 1W6WA 3AW5A 2P80A 2BP0B 3SBQA 2XXFA 4A2DA 1AIZA 1PY0A 2ZWNA 1I53A 7PAZA 4E9RA 1OCOB 4DP7X 1J5CA 2EIJB 3V9CA 1J9QA 4KO7A 3NJFA 1L9PA 1BYPA 3T6VA 1J5DA 2YAMA 4YVUA 1OE2A 1NZRA 3H4HA 4EF3A 2GI0A 4BXVA 1CYWA 2XWZA 2FQFA 2PPEA 3WI9A 2IWFA 3BQVA 4UANA 5TK4A 1AR1B 4KO6A 1JZGA 4FAAB 1PZAA 5D4IA 5AKRA 3FU9A 2WO2B 1GY2A 1AZCA 1J9SA 3S3BB 4QLWA 1AS6A 1X9RA 2HXAA 4YVNA 4BK5C 2YQBA 4A66A 1ILSA 2PPDA 2IDFA 2BW4A 5I6MA 2QT6A 4YSRA 3H56A 2YAPA 1TEFA 1E65A 4HCFA 3NJGA 4ZK8A 1JERA 3MBWB 1E67A 2VW6A 2UXGA 1HFUA 4DPBX 4YSQA 6PAZA 2YAEA 2HX8A 4DP6X 3IEAA 1E5YA 2DWTA 3WNIA 1GS8A 2YAOA 4WTQA 1QHQA 1JZFA 3EF4A 1XMEB 3NP3A 4GYBA 1QNIA 4YSOA 3S8GB 1NIFA 3KW8A 3FU7A 2UX6A 4CSZA 2FQGA 1NIAA 4YSCA 4GXFA 2IDUA 2VM3A 1AAJA 3OQRA 4Q8BA 3IN0A 3S3CB 1L9OA 3ABMB 4X4KA 3AG3B 3TBCA 2DY2A 1OCZB 2EIKB 1M9WA 1AG0A 1EZLA 2I85A 2QPEB 3WIAA 1ASQA 3N2JA 1AOZA 2AZUA 5F7AA 3NSCA 4DP1X 1AG6A 2Q9OA 2GC4C 3FQYA 4KNSA 2MRYA 3QJSB 2HRGA 1KCBA 3NJHA 5A7EA 5I6KA 3AG1B 3PXLA 2HLEB 1AACA 2BWIA 1MZZA 4G7RB 1GYCA 2BHFA 3FU8A 2OCCB 6PCYA 2GBAA 1OF0A 2QDWA 4W1TA 1ETJA 2PCYA 3TU6A 2UXTA 1AZBA 4QKTA 1AZRA 2R7EA 1SDDB 3IN2A 2NRDA 3EH3B 3PAUA 2EIMB 4N4YB 3UADA 1GS7A 1E30A 2BW5A 4PCYA 1JZEA 2DV6A 3T71A 4W9ZA 5B7MA 4GP8B 1PNCA 2VW7A 4KOCA 3X2QB 1TU2A 3X1NA 2H5UA 2IH9A 1B3IA 4CSPA 1BEXA 1NDTA 1ASPA 4UF7C 2B08A 4DP0X 2J5WA 4M3HA 1SF5A 3WNJA 3CZUB 1JXFA 3EH5B 3NJIA 3CDZA 1XB6A 5D4JA 2YAFA 3ABKB 1XB8A 3WKPA 1VLXA 1BXUA 4HZ1A 4A67A 1ID2A 4NB7A 2TSAA 3IBOA 1SJMA 3FYIB 3UACA 1KYAA 4A2FA 1MG2C 2CBPA 2B3IA 2UXFA 3X1BA 3AZUA 4E9VA 2ZONA 3S3DB 2J57A 3QJRB 4RH4A 2DYSB 1EHKB 1PZCA 1JXGA 1ZDQA 4NAJA 1CUOA 3RYMA 4JHVA 3ERXA 5F7BA 3U25A 2PPAA 4E9XA 1JZIA 2Q5BA 1PNDA 2Y69B 3UAEA 5I26A 4G72B 1RKRA 1IKOP 3AY2A 4BWTA 4AZUA 1MZYA 3QQXA 3FU7B 4BWUA 3NJMA 4YSAA 2ZOOA 5EHFA 4KNTA 4HALA 3QJQB 3DKHA 1PLBA 5B1AB 2XV2A 4F7KA 1A65A 1A4BA 1ET5A 2AANA 2XYBA 4PAZA 2MTAA 2FWLB 1ZPUA 1JVOA 4L0PB 3FT0A 1KDIA 1JOIA 5TK2A 3FSVA 3NSYA 2HRHA 4DP4X 1ADWA 2FT7A 3FSZA 1PF3A 3QJUB 3ABGA 3GXUB 3FYEB 2BP8A 3ZBMA 3ZX1A 2XVBA 4KOBA 4AX3A 4HIPA 2CUAA 3OM3B 2JKWA 5I6PA 4YSUA 2IDQA 3C75A 1KGYE 4DP8X 3T6XA 2IAAC 2FT6A 4HAKA 2CJ3A 2R7EB 3ABLB 5PCYA 5I5MA 2FNWA 1OOWA 5B1JA 2PP8A 1KDJA 2P80D 2FTAA 3EHBB 1SHWA 3KW7A 4G7QB 1L9QA 4UAHA 1NWOA 5B1JC 3CVCA 3ZDWA 3UGEA 1AS8A 4YSEA 2GC7C 5AFAA 1DYZA 2JFCA 5AZUA 1T5KA 4KNUA 1L9RA 2EILB 4E9WA 2E86A 3CVBA 4A68A 3DIVA 1SHXA 3WKQA 4KO5A 1PZBA 2X88A 1NPNA 4YSPA 3NP4A 3UAAA 2PPFA 3L45A 3NJLA 1SF3A 3CDZB 3EH4B 4F2EA 2UXVA 4FA7B 1ZV2A 4E9QA 5I5JA 2W88A 2YARA 2OJ1A 3T6WA 1NIEA 4HCGA 3GDCA 3QPKA 4BWWA 2GHZA 1AS7A 2IWEA 4DP9X 1GSKA 1MG3C 4YSDA 1URIA 3AG2B 1CC3A 4DP5X 1GW0A 3PPSA 3OMAB 4F2FA 4HCIA 2CCWA 1V55B 1BAWA 4E9TA 2XX1A 1IC0A 1N68A 2HZHA 3X1EA 3PCYA 1X9UA 4Q89A 1AANA 1F56A 2I7SA 2JXMA 2XV0A 1PLCA 2VMJA 4YL4A
chains in the Genus database with same CATH superfamily
1ET7A 5F6HJ 1MHCB 2JF1A 5JMOC 1VFAA 3QORC 1RZKH 1IM9D 5E6ZA 2O6EA 3LN9A 3MLSH 1D5MA 2VR7A 5I17B 5KS9E 3OZLA 3MRRB 3KPQB 3Q06A 4QXTA 5FW6A 4RETB 5D72H 1Z0NA 2FD6H 3QPQD 4LVNB 2B77A 2H6PA 3DMMA 4KNQA 2JJUA 3UX9B 3U30C 2R83A 3O45B 1P5UC 1KBGH 2BM3A 2YLKA 4I2XB 2IV8A 3OR6B 2ADIB 4QY8A 5TE7L 3SKMB 2Z31D 2XACC 3EJZD 4NIYE 2NW3B 1QQDA 1U95A 3IMRA 4WV1B 3AMKA 3WS6C 5CBEA 4P5SA 4IHBA 1OANA 4ORGA 4OZ4A 3INOA 5IVXE 5TJWK 2A77L 3UTQA 5CSBA 1S78C 1R3JB 3KL0A 3NZUA 4NIKB 4UNIA 2MPVA 1BF5A 1G9MC 1PAZA 5E51A 4PJ7E 1MVUA 1EDYA 3FTZA 3NACH 1WT5A 2G4EA 1QBLL 4FN0A 5F2FA 1IUZA 3WN6A 3SO5A 5EN2B 4MGXA 4A39A 1GHFL 5DYFA 4JY4A 4QAMB 5CZKA 4I1RA 1GAFL 1K9TA 1LP9A 1MF2H 1A3LH 1R0AL 2GPZA 3WEXB 1FJ1B 2VDKB 2YOAA 1RIUL 4HS6A 4W9DC 5HHXL 3TCLB 2F7QA 8FABB 5C97A 2HB0A 3O4LB 2PN5A 1KCVH 1KJ3H 5IHUL 1DBJL 1JNNH 1U8HB 2G3ZA 2W9LA 1DZ0A 4YXKL 3LZFH 2HVBA 1CN4A 2MOVA 3ISWA 1OWRM 3OV6A 2IAMB 1KEMH 3S8WA 5GS1B 4XXWC 1PD0A 3LPOA 4OCSL 4ZFOL 3HG1B 4PI2A 3WNKA 3CLFL 2DQFA 3KLLA 3GO1H 2XWXA 3KNBB 3TBBA 5EEYA 2FWUA 1QI5A 5DVNA 4PJHE 3ZKMC 3I6KB 2J88H 2ZXEB 3WLBB 1NMBH 4NJAH 1DBBH 3NCMA 3QIBC 1LGVA 2X3CA 3MLPA 1LK3L 2AZAA 2J6WA 4NP4L 4A7VA 2JXMB 5HGAB 4PB0L 4XBEH 1KTDB 1ZVHA 3HR5A 5KYNA 1OTUC 2QSCH 4G7VH 4WO0A 4Q58C 2O5YL 4WWKA 1FVCB 2GTWB 4PJIA 4XCYB 2LVCA 4Z7QB 5BZZA 3KGUA 5IQMA 1WA1X 3U1QA 2DZEA 2OZ4H 5BJTB 3O9WC 3FB5A 3QZOA 1K4DB 2X4QA 5PAZA 4ODWA 1PCSA 2G60H 4DAGL 3DNKA 3WUWG 1UJTA 2OW6A 4LOEA 4EKJA 3L9BA 3X12A 1M4KA 3KWVA 1WS8A 2ZX6A 4HPYH 4CUCA 5T8IA 4KMQA 1X5FA 2V3FA 1MVFA 4JFTA 3NA9H 5ISZB 4OI8A 5HGDB 2QQNL 2WLHA 4PJBA 3CPLA 3PWJA 2MJWA 1CJYA 3CAFA 1K3IA 3N1QC 4HBCH 4UV4H 4GRWE 5IJVB 3ZDYF 4XCEB 4JEGB 3B1TA 4BDVB 2LT9A 3N42F 3QAZC 4WUUE 2VM4A 3CU1A 1WWBX 4X7SL 4GY4A 1MJJB 2OL3H 5DTFA 3MYZA 5FHAH 4A2HA 1ECYA 4OZIF 5TE4H 4HHAB 1BGXH 1YECH 1S5IH 3H85A 3PGFL 4YGAB 4CC0A 4CC4A 4JCLA 2V17H 5I76A 5AW3B 2VKXA 3S48A 3KPRE 3S8FB 3BT0A 4HXBH 4UTAL 2PP7A 3LQAL 5F7DB 1YEIL 3EBIA 4FFVD 3K8KA 5SWSD 3UERA 1G7LA 4NQDE 3PWVA 1HQ4A 3ASNB 5ICXB 4UQ2B 4AQEB 2NR6A 1WWCA 1O7VA 4MSWA 3STZA 4B9GA 3HE6B 1UCBH 2WSPA 4HZLB 3A3YB 3KPPB 3O6FD 4PIRF 3QIUA 2EEBA 5DRZB 3QDMA 4PLJC 1E5BA 1PX3A 3LH9A 4NC1C 1BVKA 1OCOB 3L17A 3QG7H 2FB4H 2VC2B 5TPWH 4BKLA 3B9EA 4PRAA 3BEWB 5FFOA 2XJKA 1J0IA 5ESQA 1I3GL 3O6MH 5HHVH 3WI9A 4KO6A 1VPOL 3G6JB 1MY5A 4NQEA 3WE6B 1OPGL 4W9FC 2X41A 3QQDB 5KZCD 1GY2A 4Y1AD 1NGYB 4PW3A 3HI6H 2F7OA 4TMPA 2JKRM 3CMGA 3MO1A 5EEUA 5DEFA 2HMIC 5GGRB 2B15A 1I1YB 3QUYC 4X7EC 3NOIA 2VDQL 4YSRA 5HVHB 5TDOB 3TF4A 1J1PL 4U1NA 5EOCL 3S96B 4NP9A 3C9NA 4PV9A 4J8RA 1MNUL 3RJDA 4J6RL 3OPZH 3ARDD 2H2PC 1R9FA 3BZ5A 1U8NB 5IFAL 1YYML 1MCOH 4AGOA 1X5JA 3K80A 4I3SH 3VXME 1DQVA 3L7EB 3SIKA 2N4IA 4PTTA 1T5XA 1P84J 2XC8A 2DQDH 3C5SA 2DICA 3S8GB 2JKIS 3V0VB 4K7PH 4CSZA 3MOAH 5CWSB 2R2CA 4I18B 3W81A 4WO4C 2JK5B 5I8KH 5JW4N 5BRZB 1OB0A 3KH3A 1C08B 1S3KH 3IN0A 2BOLA 4P9HC 3PQYD 1XF3B 1FNAA 5SX4H 2F54A 1F86A 1SQMA 1RPQA 3LKQB 3WKMH 4X7TA 4F37F 3D0AA 1IZJA 1LM8V 4N0FA 4I0PD 1YMHA 5CIPB 1V5JA 2VLRB 5A7EA 1XQ4A 3EGXA 1H15A 3CIAA 1CO1A 5JORA 3IAGC 3MQIA 5DMKA 1VACA 2BHFA 2XIDA 5KSBE 2GW5A 2EE0A 4NKMA 3V7AG 1I7UB 4PWKA 3PWUB 1TZ8A 4MZ2A 3U9UB 2LU7A 1A4KA 2A73A 2D31A 3A6OA 4A1RA 4CU8A 1ITCA 1DUYA 5IW6B 1U41A 4Q4IA 1SDDB 4J23A 3EDDA 4G8GE 3OG6B 1ZKAA 3PAUA 4OD2B 4R7VA 2B5IB 5GGTH 1KCSL 3LMJL 2JJTC 2EYRA 1KPUA 2R29H 1USZA 3O81A 5J8OA 3TZVC 1FZKB 3D05A 4WGKA 3S97C 3DBSA 4Y19E 2B20A 2PW1A 4Y5XC 2AXGA 4EQ3A 3C5ZC 4RDQG 1H3WM 4NN5B 2ZP0T 4UU9A 2YMXL 1CGSH 1KB5B 1BEXA 1NDTA 4ZUSB 3OZ9H 4PJ8B 2CK2A 2P8MB 4PBWD 3NDYE 3LN4A 3IE4A 1H5BA 3D2UB 3L3HB 4QXUL 3VM7A 1GPOH 4IGBD 1JWUA 1FFNB 5FGBC 4YDLB 3VI4A 1N26A 5LBSL 4KXZI 2VMCA 1VLXA 5EORL 1XMWA 5C0AD 2LOEA 4Z7VE 3HRPA 1A7OH 3PXJA 1UJ3B 4U4IA 1XR8B 2EKSA 1HXMA 4IRJB 4Y89A 1CFSB 3QI9B 4WFEE 3S3DB 3MV01 5AVQB 2W9DH 4KJYB 1MCPL 2YXFA 1AD0B 1RULH 5J13C 1JXGA 4P23B 3QHZL 4RGNB 3MA9L 4FL4C 4QHPA 5IJKC 5D7SH 4MB1A 3S5LB 5AKSA 5I1JL 4H2CA 3Q5OA 4JQXA 4JX0A 2ZUWA 1BJ1H 4ALAH 5E70A 2EIEA 4Y4KC 1U8OB 3AY4C 3IDGB 3HN3A 5FGRA 1HL5A 1U92B 2Q87A 5MEND 3KEHA 3TBYA 1KJMB 3RVVD 2OMUA 3N04A 2D7NA 1WAAF 1X5GA 4PJFA 4P2QB 3UYOD 2XYBA 2IG2H 3U6RA 2MTAA 3CFUA 3FHEA 4N9GB 4PJXE 4PGBA 4MMZC 3EYOB 2R15A 3S9DB 4NO0B 2FSEB 4OZGA 3TIEA 2RJMA 2H1PL 3FSVA 3L1OL 1NOLA 5A2BA 4I77H 1A2YA 1GCFA 3WO4C 1BD2B 3GXUB 2BP8A 4M8RA 3WIFB 3BAEH 1RZJL 4MB4A 4PJCA 3VFNA 1XGUA 4P46D 2XRAL 5C6TL 3HIZA 2NY0B 1MWAH 4KTDH 4XX1G 3VD9A 5EBGA 1NCAL 3D85A 3UO1L 2VLKB 1TFPA 2H3KA 3D06A 4GAAA 4LCYB 2QKSA 4FFWD 4RBPH 4D0BB 1A3RL 4WEBH 5PCYA 5IV2A 1MCWW 4FQ1L 3FUKA 5E7FA 5DJDB 3TESA 4M62H 5TGBB 1WFTA 3ULUD 1E8XA 3KPSB 5BVJB 3FULA 3NCFB 3GMMB 1X5ZA 3MI6A 1V7NH 3BFOA 3K2UL 1TU2B 4P2CG 1A6TB 3VUAA 4WEUD 1DSYA 4Z7NE 1TITA 3O2WL 3UYPB 4NWTH 5CN1A 5GGUB 1T3FB 1HHGB 2WINB 2CPCA 4A68A 2P5WD 4RZKA 4P5TB 4NAQA 5AVSB 2X9ZA 4JL1A 4YSPA 2HKFL 2ED9A 3NP4A 2WQVA 4J3UA 1LP9F 5T3ZH 6TAAA 2FO1A 3RP1A 4Y2LA 4D9QD 4CRPA 3QIWD 4HJ1A 5MP6H 2ITDB 4MDIB 1YAZA 3DPDA 3BVXA 3LQZA 2XKNB 3GXIA 4J3VA 1U8QB 2EXYC 2CGYA 2NX5B 3TNMA 1GSKA 3TO4D 3HNTL 4TNVK 4K3JH 3FU6A 3G08A 4IMLA 5JDJA 4HWZB 4KGLA 3QXUA 1IC7L 1ZT7A 1TTRA 5F96L 4PLKD 1T1XB 5D6CA 5ABAA 1NCJA 4X80H 3CZGA 4MJJA 4QPEA 1RUML 2CPUA 4JFDD 3N0AA 4YIQA 3ZKNC 1ETZB 1S8DB 3IWUA 2V37A 1T22B 4YN3A 1YEFH 1TYJA 1CBVL 5E0FA 2R69L 1FO0H 1GIGL 1L0QA 1QRKA 4C58B 3DETC 5I8OL 2LABA 5ANMA 3GXMA 4N0CD 4LLAA 1VFMA 1A1OA 4UTCA 4N2DA 5LWYH 4N2CA 3CZLA 5IROD 5LAXA 5FAAA 1A0QL 1INQA 3O2DA 2QQKL 2QZ5A 3GPEA 1IBBA 1OLLA 5GJTL 5AW9B 2ZKMX 2I9TB 1R3LA 3EFOA 4TQHA 5E9DE 4F93B 2DM4A 4PJIF 3CHRA 3T2QA 1QVOB 2F5AH 4QKXB 2ZP8A 2MMXA 5JOFA 5EO9A 4OKVA 5CCJA 3LD8C 1BQRA 4DZ8A 5IKCB 3KCPA 4UMSA 2VZ3A 1R3IL 3CZSA 2GB2A 4G6MH 3ILEA 2GJJA 2BSTA 4JKPH 5IJBC 3E2HB 4HUVA 5C8JA 4IJ3B 1CL7H 3QP3A 3FQ2A 5H2BA 1WBZB 3KJ4B 1A5FL 3T5WA 5I1HH 1N8OE 4ZW5A 2YKKA 2JELL 1QLFB 3COOA 3RDTC 4K2UL 4PJBF 3T0ED 4CDGC 5IQ7L 2CIKA 2IWKA 5I9QC 3JWOC 2H3XC 3IDIA 2GHWB 1IKFL 2X0WA 3MBED 2YAQA 3U6XA 3V5DA 3BWAB 2BY1A 3V4PH 3MV8A 2DBLH 4ZOBA 1F6AB 4U1HA 2VMEA 1TG8A 3UZEA 1MRCL 4RNRA 1ZT1B 3CN2A 1EEYA 1PMYA 3HMXL 4A6YA 1NBZA 3G04A 3IXTB 4YHKL 3K72B 1ZLVK 3SQBA 3CSYB 3T4YB 5EO0B 4LP4A 2D73A 1JDDA 2HTKD 3RPBA 3V9EA 1ILUA 3RTQC 4S1QH 1EEZA 3QZWB 5LCVH 5TDNB 4KKAC 3BD3A 1IKNA 5D7EA 1J5IA 1KBWA 1J1OL 3I84A 1NFDA 3NGBB 1KYOJ 3MCKA 3OKNA 3UTTB 3ET9F 2OAAA 2NUTB 1GYWA 5I1GL 2PXYD 2Q20A 5E5UB 3ZTNL 1YJDH 1I82A 4AYGA 4F3FB 2C9RA 4G80B 2PKDA 1LTXA 2WYHA 2CA4A 1BOGA 4B5EA 3MUY1 3HNSH 4XNUL 1EK3A 1AR1C 2AK4D 5FDWB 1IBZA 3FRUB 1Y6KR 1MLBB 4OGXH 1G9NL 1O6TA 2WYTA 2Y06H 1EVTC 2EIBA 1V10A 3PWPD 3EJTA 4JM2F 4XN1A 1P2CA 3LYRA 4UINH 2IH3B 3FB8A 5AVUB 3DK2A 3RA7H 3ULUL 3PY9A 1Z5LB 1D9KB 2FT8A 2ZSWA 3W0WB 5FC9A 5F7MC 4EZMA 2JSFA 1P9MC 4X83A 3OD3A 3RX5A 4S1DD 4WF7A 5I0DA 5GSVB 1KEGL 2XN9E 3QNYA 4XVTH 3VFWB 1Q72H 3UBXA 2ICWA 5HI5C 1CFTA 1XFPA 2Z1KA 4L9LB 2A9ML 2EEDA 2L8AA 4Y2DB 4LLQA 4NN6C 3GRWH 3UZVA 2YK1H 4GRLA 3VWKD 3F2LA 3NIDE 4LSUL 3BXNB 1XD1A 4AKOA 2N1KA 2OV0A 5DMIH 2CM6A 1W72L 4KY1L 5D1XA 4JRYB 3MR9A 4R90L 3CHQA 3MLUH 4DUVA 3VTMA 5ADOL 1XH3A 2H32B 4GEIA 4JFYB 2B4CC 3D87B 4PY8I 5FK9A 1M05B 2CLZA 3FF8A 1JZ5A 2NSQA 2CR3A 5ANHA 3EOAB 3FOMB 2M83A 3BCFA 1XBDA 1TMCB 1RIHL 3WYRA 5F21B 4N6RA 5JHLL 2ZXWB 3CDGB 1DEEB 4HKXB 3FT3A 3S2AA 2DYPB 2V2XA 3BKCH 3VXSB 3WFZA 3AXIA 2EEFA 5KJRL 1FFOB 3FF7A 3ZSSA 2J71A 4L37A 1KTBA 2VDMB 3HZYB 3OLIA 4I8DA 3NH7H 3VSUA 5HD8C 1A47A 4ZMPA 3CC1A 3ZHKA 3F12B 3EJRA 1T89C 2BOBB 2WGNB 4N8PA 2I5YH 1BIHA 1N8ZB 1WEJH 1F3DJ 1KY6A 4FFZH 1AZZC 2COVD 1T5WA 3PWNA 3GZPA 1IGCH 5DJZA 3NZHH 4MJIE 3PHQB 2ZWNA 1KYUA 2YEVB 4L1DA 3GS0A 4KRPC 3CXDH 2WTPA 3Q5YA 3MLRH 2F53A 1J5CA 2OFQA 4M8UA 3A4AA 4FDWA 3AAZB 4XXDA 3RZCD 4GW5B 4YVUA 4C83B 1OE2A 2CBQA 3GSRB 1YNTF 4WI2A 5B4MC 4TSCH 1W91A 3SOBL 1EJ6A 2R9HD 2OZ4A 1TXKA 4IIQB 1K2DB 3RUGB 5IUSA 2NCEA 4GKOA 1MREH 4G9FE 1IL1A 3FQWB 1GGCH 1NEZB 3ABZA 3FU9A 1MHHA 5BMFL 1AZCA 4JPVL 5CLXA 3Q05A 2FH8A 1FF5A 4TQPA 1X9RA 5FYKE 4ODXA 1KGCD 4MBRA 2R4RL 1M3IA 1TTCA 4G5ZL 4ADJA 1DQTA 1OP3H 3SDDA 4MAYC 4U33A 4WDIB 5SWZE 2YBRB 1ZANL 5T1KD 1T0OA 1KPVA 2QBWA 35C8L 3F64A 4GS7C 4JDEA 2VDRH 1NEUA 1PL3A 1ZV5A 2DLHA 1DSFL 3OAYK 2UXGA 3QJFA 4H0HB 4LRIC 4M9OA 3BO8A 4X6CA 2YLHA 4NZFA 1I7ZB 2OL3A 2HX8A 4IMKA 4XHJC 3IEAA 2DI7A 4HSCX 1GS8A 1RL1A 5C92A 4PJ9C 1ZHLB 1D6VL 2AS5M 1AQDB 4LCUA 4K8RD 1KIRB 3DGGB 4KJPC 3SGKA 4OD1L 3B9KC 5I8EB 4WV1C 3LRLA 1F4YL 4GIAA 3SPHA 1GRWA 2D2OA 2F1BA 1EXUA 4FYRA 2NPLX 3FHQA 3SDAD 1OCZB 4X5XA 3TBCA 3P02A 4ZMVA 5CAYB 1ZXQA 2WCPA 2QLVB 1ASQA 2W91A 2IIJA 3EOTL 3FT9A 4MMYA 3RDJA 4M1CD 4FQXD 5HJDA 2AQ2A 3L2LA 1INDL 4F9PC 1WCBA 2MRYA 3N44B 4PJFF 1QW8A 3MRPA 3LB6D 5DQDH 2N7SA 4R3SA 3DX8A 3Q1SL 1JYNA 1WRFA 1JZ8A 2F61A 2YPVH 4LNRB 3BD5A 1KLUA 4MNQD 4QOKA 4ZFGH 4FQ2L 1ZLUH 2PCYA 1ADQH 2NY2B 3H3PL 5A3ID 4ZSOB 2G3MA 1GTFA 3JTTB 2C4FT 1AZRA 5IZ7A 5E0QA 1Z3GL 3I02A 3FXIC 4LBEA 4C56B 1E30A 3GINA 4CC1A 2ADJA 4HA1A 1TQTA 4FEIA 3UFIA 2Y1VA 4ZODA 1A8JH 2BNQD 4HW6A 3W82A 1FBIH 2R0KL 2AJ3A 3LKRA 1I1AD 3BFWA 1H0DA 2DQ6A 4TRPL 3U1SH 5E5RB 2H5UA 4O5LL 4PVMA 4N20A 2Z92A 4ATWA 4AK2A 4DP0X 3S7GA 4JY5H 2R2EB 1BJMA 1XH1A 1NQBA 3EJJX 4P5KA 4R7XA 3U2JA 4PLNC 5B3JF 2BNRD 4X6FB 3QJXA 1MCKA 1PKQA 1I8KA 3CC5A 4IOIB 3BZEA 4KHXH 4M61B 3SGEI 4APXB 4Z7WA 1EJOH 3WNPA 5JW3H 4MVBC 3NCWA 3TX4A 4JDTL 4E9VA 4ELMA 3GSNB 4XBGB 2VR6A 3GPSA 1PZCA 2GJ6D 4JHVA 5TD4A 1P4BH 2C9QA 5KYUA 2HVJA 1KBBA 5EU4A 4F2ME 4BGLA 3ZKXB 3RIFK 3ZDYB 2KHAA 1W9XA 3N42B 1Q9OB 5KWYC 1KELL 1TZGL 3S34L 4ADGA 4HALA 5E2JA 4HOXA 1BZDA 1TPXC 4FI8A 2CK0H 4LPWA 3R06B 2ZCLH 2ZUQB 3B7YA 4NKDA 3S36L 2ODIA 4OZIB 2R27A 5HDWA 3BMWA 1BQLL 5GGTA 3LCYA 5KVFH 3BH8A 1KXHA 4L0PB 4ODUB 1IC1A 1N6UA 1YY9D 2O5XH 1L0PA 1C5DA 1Z9SA 3Q2LA 2JQZA 1AMYA 1MI5E 4K5NA 5JO5B 3ARFA 2ZYIA 3DHMA 1BAFH 1JNHB 4CSSA 2HKHL 2V7NB 4HKJA 4XNZB 4JY6B 4HIPA 2JVUA 4WCYH 1JL8A 4GQZA 5I6PA 5FKAB 1DVYA 1RSYA 1XEUA 1NCCH 1NAML 3GK8L 3IGAB 4EIGB 1LEGA 2CU9A 1QZNA 4OD3L 1G6RB 3C5JA 5I5MA 3ROLA 2A9BA 1U3YA 3TWYA 4LOVA 3QBTB 2ZOLA 3V5KA 5L4MA 1KC5L 2G5UA 2FTAA 3VW3L 3V79C 4BHUA 1KF9B 2FBJH 2BIMA 1KBPA 5JW5A 4LHUB 4AQZA 2ZCKH 1FFPA 4K8RL 1FCCA 4UQEA 3QFGA 1S5HA 5CLZA 5DI8B 1IC5H 1LXMA 4OAWB 2HAZA 4E9WA 4BINA 4OIAA 2ZYHA 3K6OA 5FO7B 3THMH 1B6DA 1MAMH 4WHCA 3MRFB 3PUCA 2WQRA 3X14A 1EEQA 5TF0A 1W15A 1S9WB 4PW4A 3H0TB 2BSBA 3G6DH 2HFGL 1N5YH 3B2MA 3TVMC 1LE9B 5CILH 4ZAKD 3R4DA 4JL2A 4IHOA 4TUJB 5KYYA 5KYWB 3U0TB 3QGVA 4IBWA 3LZQA 4ZNEE 2ZYSA 1CZ8L 5I1CL 3AG2B 3EYSL 3S0PA 3LPWA 2PO6D 3EIFA 4HJSA 4FXGA 3SCMB 2BDNL 3EOBA 2J8UA 1BAWA 2DQJL 5LNDA 4F15B 3CZEA 4R0LC 2R1XB 2NY3B 4ZUVA 2EVFA 3HS0A 4WENB 3VXQA 3FFOA 4AZ8B 4QYAA 3V6OC 1MWAA 2XNAB 5GSRA 4AUUA 4UIMB 3HB3C 3VI3F 4CGUB 3D4GA 4W93A 4RIRB 1AR2A 5B39G 4OIIH 2V5SA 3WO3B 4ZOCA 1NBYA 1XCTA 1JFQH 3IMVA 3BPOB 1R5IB 2AQNA 4H20L 4ZG1A 2FO4A 4LGPB 4CW1B 2PXYA 1DQML 3CFDA 3NJVA 4Y0GA 3LZOA 3I6GB 5EU6E 3MRNA 1A4AA 2H47C 2RR3A 4K23L 4NYLA 3VRIA 5I0VA 1WHPA 4OFKA 4G1EB 2D0FA 4IM8A 4WZ9A 4X0KA 3V4VL 2CRZA 2A6KA 3HN5A 1DJXA 3TIDB 2YA0A 2WZ0A 4BZ1H 2CJUH 1K72A 1IFRA 3GNML 1GYAA 2FDBP 4Y4HD 4FLQA 4GSUA 5CZXD 3VRJB 4ZMLA 3MMEB 3RVWC 4NQCB 4YBQD 1G1KA 4V1DB 3TEUA 3ARUA 4GSRA 3ULVD 4Z23A 2CKBA 3HHSA 3OF6A 3ZXAC 4AEHL 1AH1A 1CE6A 2YXWA 4G6FD 1TVDA 1MCIA 1YC8A 2IQ9H 4JMNA 4FD0A 5EC2B 3HKZA 3L1EA 2B5IC 5HHPB 2VDLH 2YGNA 1G7QA 1W0WB 3HBGA 5D93C 2VABA 3ISRA 5MI0B 4O51A 3LSOA 1UM5L 1WIUA 4W9JC 3C2AL 1OAJA 4MNGA 3L9RB 3AUWB 4XPBL 4U6HA 2ZPKH 5E2VH 1NSNL 4DVRL 4KDTC 2QPDB 3MA7A 3IF1B 1CK0L 2LR4A 3FCGA 5C09D 2GAZA 3HNVL 3L4VA 4JANA 4PRID 1ANUA 4N26A 4QHNB 4QRSA 4YDKH 3HW7A 3RNKA 3Q6GH 2KLTA 3TA3D 3ESUF 2L7JA 2EXSA 4MHHI 1XT5A 3H9HA 1CDBA 1FO0A 1G0XA 3GS4A 3ZN6A 4LAJH 3U0WH 1MIEH 3IBEA 3I3EA 4HMCA 1KBKA 4B0MM 1ZGLP 1IZKA 2XQBL 3S2CA 4AOFA 4S0TD 3L5XH 4IRJC 4OZFG 1QP1A 4BFEA 2CO3A 3ILPA 3P2BA 5GS3A 4YAQA 4NCC2 3VXUB 1U8MB 3VXNA 3P3TA 2EEAA 3B9VA 4ONHA 3NJKA 4LEEA 1ZXKA 3FSWA 2QPUA 1PG7H 5GZOA 3D2TA 2MCAA 1T1ZB 5D1QC 1QYGL 4AY0A 5BS0D 4PGDA 1F3JB 4P59H 3PDOA 4B9ZA 1A7RH 3U7YH 1D5MB 5T1MA 4HG4J 5I23A 3JV6B 8PAZA 3I2CL 4RRPM 3QS2A 4XMZA 5JLZB 3DMMB 3V4PA 3CX2A 2OR9H 2Q0ZX 3H42H 4JFHE 3RGHA 3PP3H 1J1XL 3LRSA 3FHAA 1MPAL 3FRPA 4XH2A 3L4CA 3RKDD 1QQDB 4I48A 1AKJD 2APBA 3APCA 1OSZA 4POYA 5KEZA 1DE4A 3JV0A 1BQHB 1UG9A 5CBEB 3LH8A 3QEHA 4EZLA 3A67L 3NJXA 4OVUA 4OFIA 1KTRL 4TLSA 1MQKH 2CO6A 3NSXA 3ZZLA 1XCQA 3UTQB 4OW6A 1P4LA 4MQXC 4X7CC 5ECJE 4DP2X 5LCVA 2IDSA 3DC0A 3LVEA 3MBXH 1CI3M 3EFDH 1TUPA 3D12B 3WFBL 3G7TA 4EI6A 2ZICA 1MVUB 4JKLA 5KSAA 5E4IA 3EBAA 4YC2B 4WQOA 1YEKH 5GGSY 1RIVL 1QSFE 4NHUB 2XZQL 5AVXB 1MFNA 3SQOH 3CDYA 3P73A 3HG5A 4JY4B 9CGTA 5I0ZA 3L95A 4G7SB 1LP9B 4TM9A 1P6AB 5B1BB 4HKZA 4MXQC 3VFUA 3SDCD 4Y1TA 1VA9A 3OHMB 1JZJA 1CICD 3GXPA 5EDXA 5L2KD 1HSAA 1H3XA 3DROA 4B3VA 3QC5X 3MRLA 2PTTB 5HPMA 1TDQA 1TMQA 3ULAB 2BHUA 2WTRA 4FQXA 2FJHA 2BS9A 4Y8DC 3ZL2A 4HLEA 3CV5A 4JR9L 5J6GA 5F1OB 5CEZE 2F8XC 4DKDC 2OX5B 1ZEAH 3BP6A 4IIZA 5EU3A 4APQA 4I1PA 1AP2A 3MROA 3L3KB 2DQFB 4DWHA 2XWZA 2IWFA 2PWDA 4GAYA 5DD5L 4JKMA 3RWEB 5C08A 2B7DT 5I0XA 3VFGL 5JW4R 4AGQA 1J8HE 2V0AA 4XZUA 3ULVL 3GRWA 4KPHL 4WGWB 2FATL 2YIHA 1ICTA 3DUUA 5E1QA 1AGDA 2IADA 2CGZA 4YJZL 6FABH 4P4RA 3GBML 1IO4C 3JWDL 4F7PB 2JE8A 1C12A 3KJ6L 3OBAA 2Y3AA 2G3NA 3ZT7A 5LXVA 4X99B 2F58H 4HP5A 1QKZH 4TTDD 4ZK8A 3C8HA 3EKCA 4PJIB 5J4MA 3RVXC 3U9PL 3PIQA 4ZX3A 4KAQH 3WXVH 5BUAA 4NQQA 1VFUA 3FB5B 2X4QB 3DDGA 4ODWB 4Z7WF 5JPMC 1BQUA 5BXFA 2V2TB 3TJPA 3EF4A 3AQYA 3BPLC 5E5MA 3F3HA 3FU7A 2CGRL 3B2VH 3L4YA 4PJBB 3CPLB 4XWOC 1UH3A 2VM3A 3OQRA 4IJ3C 4QGTA 2H0PA 4FQIH 5HHMD 4V11A 1M2VA 3N1PC 3AG3B 3C6LC 4FFZA 1DQDH 1QPXA 4GAJH 1AG0A 3E6FA 5LQBL 3CN4A 4BSWB 3N2JA 2EDEA 3DJ9A 1O7DE 4ZS7L 3BRDA 4HUXA 5DTFB 3VWJD 4JFFE 3GZOA 3QK0A 4HGWA 3ZE2E 3MXWL 1RERA 1KN2L 2WAQA 3D9AH 5HGHA 4UQAA 4KZDL 3AU1A 1R4XA 4KVNH 4QRRA 3II2A 2GBAA 3I50H 1UWGL 1G7LB 1HQ4B 1O7SA 3B2PA 4JHAH 2R7EA 3STZB 4AXWA 4LHQB 3W56A 2Y07L 1JPGA 3W9DB 5HYJA 1MJUH 2WV3A 3PHAA 3QDMB 3FAXA 4EDWH 1AYRA 2ARJQ 4J1UA 1BVKB 4FZEH 4TSBL 4OCRH 2UZPA 4PCYA 1WWAX 4Y4FA 4H40A 1HCVA 2IPTH 1MFAL 1FI8C 1YNLL 2YUXA 4BKLB 4PRAB 1I8LC 2DLFL 3FTSA 4W9CC 3VRLF 1X3DA 5C0CE 5HYEA 3GLZA 4KMLB 1IAIL 4NQEB 1LO3H 5HDBF 3BWUC 4UF7C 4KUZL 1BYNA 4LQFH 4XP5L 3MTXA 5DLMH 1BVLA 3SJVD 1QFHA 1SXSA 4JRXA 4ZUWA 1JXFA 3O8XA 5DEFB 4ZYKA 5D4JA 3WKPA 1XB8A 2YXMA 3SDXF 4A67A 2X4UB 5C0GA 4YS4A 3DRQA 4NB7A 5ALCL 1IB5A 1SJMA 5DUPL 1G1CA 4TQ8A 4ZDHB 2H4EA 1D9KC 4F1SA 3C9NB 3W57A 4D0DA 4J8RB 3W11D 4J4PD 2UXFA 3DSFL 4P2RA 4KVCL 4YHYB 1EGJL 3QNZB 3ZZ1A 1J8KA 4ANKA 2HLFC 3L5HA 4Y2DC 4KQ3H 4EE2A 1T5XB 4FOMA 3C5SB 1EA9C 4O9HL 4PD4J 4R96A 5T1LB 4LRNH 3PL6A 2ZXBA 4GBXD 4AZUA 3U4EA 4YPJA 1M7IA 5E94B 4NLAA 2NYYD 2Y5TA 3MJ9L 2J8UF 4OU3A 3Q5TA 4FJZA 1ADQA 3DX1A 2KQMA 4EJ1C 3X13A 1KXVA 5AAWC 2YPLA 1A4BA 1YN7B 2A4ZA 1RZFH 4O00A 2F54B 2FH6A 4TOYL 3ENEA 4IBYA 4UILH 3QXWA 4X7TB 3IMTA 1EIBA 5GRVK 4N0FB 3EO9L 2BCKA 2MFNA 1YMHB 2VAAA 3UCQA 4TL4A 4LU5L 1WIOA 3RRQA 1UM4L 1N12A 3EGXB 1H15B 4QRPE 3ZX1A 4JG0H 4LK4A 5JORB 5DMKB 2OMXA 1VACB 2QV4A 3WIIL 2I24N 3OM3B 2H8PB 4NKMB 5BRPA 1FE8H 2VH5L 4MD0B 5J11B 1SM3L 3IPFA 4YUEL 3NIGE 2X1XR 1B4TA 2EIZA 2D31B 2VDOL 3KVDD 1NCBL 3AWEA 1MRDL 1DUYB 4F5CE 2QVIA 1SJVA 2FECI 3SKUD 2DQMA 2IV9A 1PZUB 2QKIC 1AHWC 1NUDA 1YNTB 4W6YB 2EDXA 3QZNA 3UJTL 1DBAH 2EYRB 1KPUB 2BVQB 2JNZA 1BW8A 4FTVA 1HWWA 4IQHA 1B2WL 4UAHA 5SX5K 5EDSA 3R1GL 4OF7A 2E7MA 5H4YA 4NCC1 5AYUL 2PW1B 4EDXB 4Q9RH 3EDJA 2AXGB 3S37X 4N25A 2XG4A 4YH6A 1CG9A 1XH2A 2KLSA 4UU9B 5JHDD 2CDFA 5JHMA 3GXFA 5IEKA 4CADA 3KG5A 4TVSa 3T3PF 1OSPL 4FQPA 3LN4B 3QFDB 4KH9A 2WMPA 3JWOH 5F7EH 1H5BB 4JFVA 3LZLA 1SXZA 4K9EC 4PB9H 3K2IA 3B37A 1JWUB 4KHTL 3EH4B 1P69B 3VI4B 1ONQA 3L6FB 2AJYH 2BCMA 3H8NA 4RFOL 3ECUA 3GJFH 4X5LA 5DD6A 1LO4H 3T6WA 3HBPA 2CHZA 4N24A 4JQIL 5E8EA 1R75A 4L18A 1CTOA 4NNPL 4ZX6A 2Q7AA 2MNWA 4ZOAA 1MG3C 5IWLC 1HXMB 3JSSA 1O0VA 3P54A 2V5TA 3A21A 4AW7A 1NCWL 3P9WB 4L8SA 3MNVA 4ZPTA 3P4NB 5D7JC 3WSQL 4JHWH 3FQTA 2BS8A 2HZHA 3TTSA 5LUMA 4H8QA 5DHYA 5ID1B 5GGSB 3QORA 3L3GA 4PVBA 3U79A 1X44A 1RHFA 3M8OL 4B6ZA 3NFNA 5DMYA 2C26A 4HHWA 1E6OH 4BSVA 2A7BA 1RHHB 4JMXA 3KR3H 4WLCA 2WO3B 3TBYB 4MJ5B 1QO3A 4B95C 2OMUB 4FCAA 3DGCR 3TXAA 1U3HA 4PJFB 4R7NB 5K59E 5D7LE 1YUKB 3CPUA 1P5UA 3BJ91 4WHYH 1HYSD 4PGBB 3RGVD 3SE9H 2OMNA 3C08L 1EAPB 1F4WL 4YHZH 3TIEB 2VYRE 2OSXA 4F1ZA 2F19L 5I5IA 1A2YB 1J05A 1XB3A 3F85A 5D7IE 1IEHA 3O3BA 3WS6A 2BP8B 3MV7B 4HIXL 4NFCA 5IY5B 1UOVA 4FLSA 1CU4H 4M7ZB 2NY1C 1XGUB 3VFNB 4Z7OF 3PRZA 1KTCA 3E1F1 3JTBA 1FGVH 1UM6H 5JDSA 3TN0C 1I7RB 3BE1L 3BDYL 3D85B 3T8VA 3O2VL 1HQRA 5EZJA 3TGXA 2BRRL 4ZW8A 1IM9B 3E7JA 2N1TE 4YFLF 4R7DB 2VT0A 1PPIA 1HXYA 4FA8A 2KS0A 5DJ2A 1R34A 2QSTA 2WJ5A 4ZMWA 4UTBH 4AE1A 3S37L 5L6YH 1B3JA 3PAVA 3G5ZB 3Q6FA 3E1ZA 5IFHL 1BECA 3SKJH 4TLUA 5BVPH 1DTUA 2YXVA 4LSTL 1UKSA 1MQ8A 2Z31B 1NEPA 4OB5L 5CFHA 3TYFB 1JGIA 5FOJA 2FX8H 4ODTH 4U1MB 2YKLH 1SNRA 3LNHA 1XSOA 1OGAE 1FC2D 1Q1JL 4XXWA 1E4XL 1RVFL 2R1WA 5E6RB 4M7KH 5JOPE 3INUH 2YD7A 3CD4A 3FO9A 2VDQB 2YZ1A 3IM1A 3LQZB 1FYTA 3MLWH 3I9AA 4PG9B 4XP9L 4ADIA 3TNMB 5HVFB 2VLJD 3F58L 1UATA 4AIZA 3AROA 4NNXA 4U1JB 1BPLB 1HINH 4IMLB 1NBCA 3QIBA 4AJYV 2X6CA 1RJLA 3OB8A 2BHZA 3CSTA 5DVMA 3BUIA 5D6CB 2HT2C 3CFBA 3DVGB 2FLMA 5ELIA 4BZ1A 1RZQA 2BMKA 4YIQB 3D3VA 2D3LA 3MZTA 1F8TH 2VQ1A 4ZW7A 2BZCA 5LNEA 4ACPA 4RMTA 5ANMB 4JO1H 3O9WA 3WNOA 1H9DA 1A1OB 4GG6A 1C5CL 3HFFA 1R5VB 4K9JA 2IF7A 4N8VG 2ESVE 4JN1L 4XO4A 5LAXB 4V33A 1INQB 3VO0A 3FCTA 3IDYC 5DURB 3KS0J 4Z7UF 3SO3B 2QFPA 2Z0UA 3ZMEA 1VCAA 1R3LB 3EFOB 3QCVH 5I74C 3SE8L 1KN4H 1OT4A 2K7PA 1DJWA 3ES6A 1UWYA 4GIPD 3NTCH 5DK0A 4OKVB 5EO9B 3VGGA 3UC0H 1JF1A 3KCPB 5HDOA 2XVGA 2VOTA 1A4CA 3WG7B 3D39E 3FQXB 3WLWC 2BSTB 1ZTXL 2BVUA 3CBKB 1WBXA 3K6FA 4I5BA 5C8JB 1OM3H 3KPMA 5H2BB 1WZ1H 2N0MA 2WXIA 5LB1A 3OAZK 25C8L 2HA1A 4O4YH 2WUCH 3Q8AA 1L9SA 4HVBA 5KVDE 1JXDA 5ADPH 4GQPH 2DYRB 3AS0A 3N43B 3FZUC 2AXHA 2CIKB 3PABA 2Y7QA 3IDIB 2BHYA 5IHZA 2QHRL 3D30A 3V5DB 4Z76A 3MV8B 1N7MH 1OAXL 2H9GA 2WTOA 3MLSL 2JTDA 3QEQD 4U1HB 2IAND 1ZLWK 1CCZA 1NGQH 4CMMB 4RNRB 4YR6A 1AR1D 2FD6L 2Y6SD 3VGFA 4NT6A 4XPAL 3IB4A 1ND0A 2HT4D 5D5MA 3SE4A 3U6XS 4A6YB 4LVOC 3SQBB 4I3GA 3FK3A 4FQJH 3WIHH 1I4FA 1CLZH 4BKSC 5DD3H 4AJ0A 2YD3A 1X7TA 1T2QL 4HLJA 4WY7H 5DUMH 1BFVH 3K91A 3AS1A 1EEZB 2AABL 4Q97A 1TZHA 4BQ8A 3I3DA 1I9EA 3QA3A 4K5PA 2JV6A 1HK6A 4DP7X 2EDOA 5HI5D 4EO5A 4Q6IC 2WXLA 1AVAA 1HH9A 3T6VA 5I2IA 4MMXC 4N86A 3ETSA 3CIQA 3F6LA 1ZA3A 2VDKH 5G5DA 1WD9A 4RMSA 4E41A 4M4PA 4XP6H 1HILA 1UZ8A 3B56A 3GHBL 3CUPA 2NZIA 3MACL 4LCCB 4XC1L 5AKRA 3SCMC 1BOGB 3W2DL 4L05A 1L7IH 1XSKA 2IGFH 2VE6A 5SWSB 3VI3B 3QUYA 4J3OG 5F3FA 2KZKA 3WUWA 1YN6A 3F84A 1NC4D 4YVNA 2DKUA 5C2BH 4M1DH 1PY4A 4TPRL 2ZSVA 5AW8B 5ALBH 1P2CB 4LPTA 4EN3D 3EGSB 1KJ3L 4A7UA 2ZSWB 1KB9K 1U3ZA 4HZAA 3BPOC 5G4NA 1GA2A 2HCZX 5JXAH 3QNYB 4MD4A 3Q2WA 5BV7C 4RLDA 2H0JA 2ICWB 3CQQA 2FL5A 1CFTB 1QLEL 2OMTA 4UQCA 5E1AA 1NCDH 2WP3T 3UZVB 4GRLB 4NQSA 4WO4A 3UTSA 4L2YA 4UDTA 3ZUNC 5KZCB 4ANUA 3NP3A 5TE6L 1H3PL 1CDUA 3MR9B 3IRCA 1XD0A 2CSPA 2UX6A 4W4OC 5EBMB 1XH3B 3TURA 1WG3A 3R0NA 2D7TH 2EEXA 4M6NL 1FVEA 5L4FA 1D3CA 5FK9B 4JFED 4X4KA 2CLZB 4JKWA 5CJOL 1FZOA 1JXKA 4HBQA 2I85A 3WIAA 4XBEL 3IU4L 1SY6H 3ARDB 1PBYA 5I73B 4G7VL 3D25A 2C1PA 3AREC 3WAJA 2C3GA 1OZTG 5AAMC 5TFSL 5I18H 4N6RB 1KB9J 2BIPA 1BQHG 3DJZA 3FT3B 5EO1A 2V2XB 4RMUA 1BVNT 1J0JA 2FX9H 1XXDC 3GI8H 4LVHC 2HUEA 5HVWA 1SHMA 4G6KL 3K1DA 3B83A 2ZKXA 3C09B 3OX8A 2ZAIA 1T66D 3T65A 1RFDH 1QFWH 1A6PA 3BSZA 2JJTA 2UXTA 3PQYB 3TZVA 1T5WB 3PWNB 4QTHB 4KX8A 1PX8A 5J1SC 1FORH 2WNXA 4WUUD 4Y5XA 1YEGH 3ATBA 4K7PX 3C5ZA 3TYGH 3GRBA 2F53B 4FG4A 5FUOH 3T71A 4XWGL 4I0PB 5DFAA 4CN6A 4HBCL 4J3OC 5B7MA 3HZ3A 5F9OL 1F02I 3MRCA 5G4OA 3PFQA 3IAPA 1TJIL 2A9AA 5FWQA 2Q8AL 2IH9A 3VB8A 1B3IA 4CSPA 2H0FA 5GRUL 5FGBA 5F3BA 4KJPD 1BGXL 1LO0L 1YECL 4NQDD 1MHHB 3BQUD 4BM7A 2Z34A 3F7VA 3ZT5A 4ODXB 3HLAA 3I6LD 2COQA 1ZV9A 2VC2H 2LVEA 3M1CA 2ZUSA 1NMAL 4C59B 3FT4A 3ULVF 3KYKL 3ESPA 4HUCA 4AVKA 1WFNA 1FH5L 4AEIH 5IJKA 3PUUA 4CMHC 2R2BB 2ZONA 1SBSL 1FNSL 4JDEB 1NL0H 1TQUA 3BO8B 5F88A 2PYEE 1KOAA 2OL3B 2CNYA 3GSVA 4BFOA 1EV2E 1OB1A 2D7QA 3FTYA 1JCKA 5KTEH 3EJYD 4Y4KA 2YA2A 2D4DA 4YDIH 1F3DH 4P8QA 4LASH 4PPTA 3RBGA 2V9UA 3AY4A 4B41A 4S0HA 4ODHL 2EVGA 3D5OF 2G5BA 4LCUB 4IGBB 4R84A 1GJIA 2NYZA 5CGMA 3AUVA 3UIYA 4YSAA 2K9UA 5C0AB 1GGUA 3HMWL 3CVIL 3IJ7A 1EHLH 4MMZA 3QO1A 1UT2A 2ZX5A 4X5XB 1IGMH 4LLMB 1JPTH 2G9HA 4MMYB 1IM3A 4OBSA 5L7XL 1YMMA 5JA8B 3DHUA 4S1SL 3RILA 4FLOA 4ZQTA 2WLKA 4M7LH 3II3A 1WCBB 5AZEL 4DP4X 1KGUA 1NGPH 3MRPB 1JTPA 1GKOA 2FEEL 1QBAA 5BQ7A 1ETB1 2ERJB 2WYZA 4Y1AE 4BQ9A 4I3SL 5CU9A 3UBXI 4DGUA 3D52A 2ICWI 2IDQA 3P30L 1KGYE 1RZGA 3MNWB 4QOKB 2YSTA 4GW1A 2NY4B 3LXCA 3WBDA 3QR2A 4Q0XH 1ZE3H 2DMKA 4M6AA 5DEJA 3KVPA 4HWEL 2WYIA 1KJ2H 5E8PB 1R33A 2FNWA 3ESOA 4K71C 4K7PL 3MOAL 4M56A 5F1NA 4NUJB 3BP5A 5F7KC 4QJ4B 1R47A 3OLDA 4PN6A 5I8KL 1IFHL 3I02B 5MERA 3GJEA 4P06A 1UYWH 2E5EA 4GUPA 2ADJB 4JPKL 3SPVA 5I1KL 2K6WA 3KW7A 4W6XB 4W9IC 3QDGD 5KSVA 4HJUA 5H4ZA 4YX2L 3V8CA 4PGZA 1LO5B 2X5PA 3GWJA 4KVPA 1T5KA 1EUTA 1QTPA 4P46B 2EILB 2I27N 2Z92B 3HJ0A 3VXRA 1ZK9A 4ZXBC 4IBVA 1T21A 4L29A 4F33B 3BMVA 3C8DA 4PRHA 5GIRA 3RWDB 2X88A 3ZE1B 2C9AA 3DWTA 3O6KH 3CU7A 2M8XA 3BISA 1PKQB 1I8KB 3CC5B 3BZEB 5DK2B 3MBWA 4AYMC 1NC2A 3T2NL 4M7LT 2YWZA 3MV9E 2JCWA 1ZSHA 1KB5H 3DXAD 3HE7C 4Z7WB 1IJNA 1FGNL 3KCWA 5D96B 4EZKA 1HJCA 3OAUL 3OAYH 4JDZA 1X5IA 5GGTL 2YOCA 3ZSTA 3RL1A 1L7TH 4ELMB 4NKIL 4LL9A 2R29L 2JCCA 4QNPF 4AL8C 3T2PA 4PJGA 1QACA 5J6SA 1N64H 4F9LC 1KGXA 1COBA 4PCKA 5CF3A 4HDIB 4NUMA 3ZTJH 2VO8A 3MUJA 4JVWA 2HVJB 1QR1A 3VM5A 5AWNH 4KZEL 5EU4B 5CD3A 3KD4A 2XV0A 3ZRFC 3OKMB 3WTUA 1U8IA 3ZOAA 4L4VD 3MJ7A 3KVQA 3UDWC 3NT0A 4HUWA 3LEXA 1OARL 2P8PA 4NKDB 5BOJA 3AXHA 3VD7A 2KDYA 5AQ0A 5IEHA 2R56H 1OAYL 1Q94A 5CMAA 1J0ZA 3QO0A 3BH8B 4WSJA 4XI5D 2WSKA 5JR1L 1A7OL 2C34A 3NQIA 4LCWA 4U3CA 3GUTA 1UZ6F 4GG6F 3KPNA 3ARFB 3BUDA 2XN1A 5EUKB 3UEZA 4X6DE 4LOUD 3G9VA 4EUPG 3FFCD 5EG6C 4HKJB 1HCFX 1JTOA 1RULL 3KXFA 2E9WA 3QJOA 3B6SA 3AQDA 1HHHA 4FQHA 3RDTA 5D7SL 1QSEA 1TTAA 4OGQC 3NFPA 2KL6A 5FM4A 1DO5A 4NJ9H 3RTLA 3ZYIA 4UB0L 1EAOA 3C5JB 4ALAL 3NCXA 2APVA 3V5KB 1WZAA 1KENL 5EOCJ 5BO1L 2CE6A 1T2XA 1VFOA 5HDBB 2Y2TA 4KO9A 5D71L 5E4OA 3TFBA 5EF2A 4HCRH 4BXSV 5JW5B 3KYNB 4YE0A 4D2NA 1JPEA 4BK5A 1FFPB 1HIML 4D3CH 1OAKH 4DEUA 5I6OA 2WJ7A 1S7UA 4GUCA 5EN3A 5KUKA 1NGWB 3OXSA 4I7ZC 3RTQA 3V2AR 2DTMH 4YHMH 1WTLA 4CVZA 4OFQA 4JM2C 4YSTA 1N19A 2J1ZA 1HU8A 3BAEL 3D6GA 5DHVB 3JQOB 3X14B 2PP9A 5KS9A 5MENE 5B3NA 1FHGA 1DVFD 4K94L 4DGVH 4X0NA 1E42A 4POUB 5KYYB 4AW4A 4MCYA 1LDSA 2MKWA 1K5WA 3S3JA 4ZNCD 3ARXA 5CEYA 3FT1A 3K4ZA 1WD8A 1G9EA 2UWEE 5C0BA 4HUKB 2WAHA 4D9LH 1U2HA 4P3CH 2J6EH 4FXGB 3EOBB 2J8UB 2KPWA 2X3AA 1JN6A 1UOKA 2HWZL 1ROCA 2QZQA 2VQUA 4ZUVB 5IVXA 5K9JH 4X9GA 3IAQA 2ICEA 3VXQB 3GSOA 3D4YA 4AMKH 4NWTL 3HG0A 1P9MA 3CNKA 1MWAB 1OE3A 2P42B 5GSRB 1HZKA 1J10A 1JZHA 2O72A 3GLDA 4PJ7A 4A7GA 1BVNP 3BUTA 4YSSA 1N6QL 4QHUA 1AXIB 1NBYB 1XCTB 4R4FH 4MDJB 1L0YA 4WU5B 3ULUE 1IBGH 1I9IH 2RGSA 2FO4B 2PXYB 3CFDB 1ZT4A 2VUKA 1UTDA 3VRIB 1NOAA 3DRTA 3MRNB 1CI5A 1Y6MR 1U8JA 2XKUA 3LKNA 3VGAC 4HC1H 3GTVA 5IGXL 3I9PA 2RCSH 4UAOB 1TVBA 1OP5H 1G1OA 4X0KB 2GFBA 2A6KB 4OI7A 1TQVA 2WOYA 4ONFH 3DUSB 1E2WA 43CAA 2GG1A 4PS3A 7FABH 5SX4I 1T7YA 2P5WE 4Z5RA 1EMTL 5TH2B 5JXED 4AUJA 1QBBA 4UOW0 3NN8A 2WUBL 4YLCA 3U9WA 4ATTA 4I1NB 4MFHA 1N4XL 3FS9A 4FQLL 2CKBB 3NFSH 4Q7DA 3RFRA 1RUPH 2BS71 2YRLA 1TEGA 1I9RH 4L48A 1NTDA 4Q4EA 3P4OA 2WXPA 5HDRA 3ZL1A 4EBQH 2DEYX 4I13B 5AVYB 4E36A 4YZFE 4QCIA 1JNLL 1YEFL 3MCLL 5LGKA 1T1YA 1FL3A 2G3XA 2YN3A 4R8WH 4AYEC 4GMSH 4PJHA 4H2AA 4XAWL 4XP4H 2VABB 3I85A 2PR4H 4O51B 3LZNA 4ILDA 3VWKB 2NTFB 4KK8C 3PLYA 2NXYD 4MNGB 1T89A 2C9UA 2PWFA 1VZGA 3CG8A 2ZOKA 4NXSA 1MCEA 2VSKB 3A23A 1JPSL 4KZ0A 2WBJA 5EB9A 4X4ME 3FTVA 4J27A 5LGHH 2GAZB 3QJTB 1SJHB 4JFDE 4QWWD 4JANB 4GP5B 4QRSB 3RNKB 1ACCA 2DM2A 3KYMA 4G6ML 4LLVA 3QUZC 1NUFA 2XVKA 4JKPL 4M3KB 1BCIA 3H9HB 5SWQA 3UP6A 5DUJA 3V9CA 1J5DA 2YAMA 4OUUA 2NY7L 1CDIA 3KHOA 3Q3GA 4M6MH 4OFVA 4ZMTA 3LAFA 5D2LE 3EJCA 4Z3FA 3QCTH 5FECA 5I1EH 5FYKH 4ZD3H 2DEXX 1I8IB 4HX1A 4KI1A 1AMXA 3ILPB 5E1HB 2BNUB 3VSQA 2DBLL 1HI6A 2A9CA 3WTWA 5DLLA 3VXNB 5ITBH 4G8EA 4GMTL 4P05A 4PRPD 43C9B 1A6UL 2L0DA 2B16A 4ONHB 3K4AA 4BHUI 5IMKA 1O9ZA 2EYTA 4DK6A 4MAYA 2R23A 3ARTA 1Q90A 3ECVA 5FCUH 1I8AA 4X9IA 1K8DB 5I17A 1DFBL 3T0EE 3WFCL 4PGDB 4LRIA 3X3GL 3RZCB 4KKCC 4S1QL 1RQ5A 1Z1WA 4GAGH 5T1MB 2LAAA 5AW4B 4HFUL 4PJ9A 4KK9D 4O02L 2J20A 1JHKL 1CLOL 3KPRA 4HIEA 4Z7OB 2IXQB 1LWHA 1F0LA 5CCHE 1BMGA 2NW3A 3B9KA 4PWGA 4UV7L 4WV1A 3TV3H 2XZAL 1Q0EA 4UYPA 2OYKA 1E4HA 3HUJE 3LRSB 3BIAX 3APFA 1EFXD 3FRPB 4I48B 1QRND 4HWBH 3WIHA 1OSZB 4YPGA 1JF5A 3LQAC 3BT2H 1R3JA 3CCHA 1AAJA 3HNSL 2C5DC 1YEJL 1NAMB 2E3VA 3QEHB 4MKTA 3S3CB 4ERSH 1A3QA 2CO6B 1CIUA 1VGKA 3L5IA 1XCQB 4F9PA 1P4LB 4ZSOE 3ARYA 3N40P 1A7NL 2XN9D 1FV1A 3WMSA 3RX8A 4DP1X 1XZ0A 4PIBA 4EI6B 2OI9B 2EDDA 5KSAB 1XIWD 1AJ7H 2VDNL 3LPPA 3QPQC 4NO2B 1K6QH 4X98A 1CFVL 5CZRA 2VZTA 5E6SB 5HDQL 1GGIH 8FABA 1Q72L 1AACA 1MW1A 4HAGA 3L95B 1FYHB 1CGUA 2AK4E 2Z31C 3ZIMA 6PCYA 3EJZC 4K73A 4R5TA 3QRFM 2WLZA 3QH3B 1PTZA 2QSQA 2CRYA 3ARZA 3BH9A 5EFIA 3TU6A 3LIUA 2VRQA 3PWPE 4AQ8C 1X9QA 1TFHA 4JGJA 4RDQF 1C7TA 2AQRA 3DROB 5GS1A 5HPMB 1ORQA 1G9HA 1S2EA 3MGOB 2XTJB 1Z9LA 2ZCZA 2WTRB 3HG1A 2FJHB 4FQXB 4LSRH 4KXDA 3B2UD 3BKJH 5FYJH 2JB5H 3KNBA 3CHXA 2E0PA 3VXMA 1XO8A 1M53A 2VDMH 2VDPH 3BP6B 5EU3B 3HC0B 4APQB 1AP2B 3MROB 1P7QA 3QVAA 3T3PE 2AEIT 3I6KA 1XZWA 1D5BA 4GAYB 3MC0A 1ZJBA 5C08B 4KRLB 4F8QA 1ASPA 2N7BA 2A9DA 4WI8A 4MNQB 4XZUB 5K39A 4JAMA 5HGAA 5BNXD 1F4XL 5JW4Q 3DUUB 2IADB 3TCXA 4P4RB 1Y6NR 1U42A 3C6LD 3CSGA 3KM1A 4ELDA 1FVCA 1BXUA 1C12B 3SYQA 4LLWA 3VCLB 4ENED 4Z7UB 2K1MA 3FO0H 2IMNA 3RNQA 4DEWA 1G7IA 2B2XH 3DX6A 1FH2A 1K4DA 3HZMA 3NZHL 4H0GA 4XPFL 4Y16D 4F24A 3PIQB 3CXDL 1MCHA 3A0OA 4RH4A 3IJYA 3X11B 4HJJH 2P5EE 4QHLB 1GL4B 2YJLA 5KSBA 1TYEB 1UKQA 1CFQA 1TCMA 3C2SA 2F8OA 2DWXA 1ZLEA 2Q5BA 5HGDA 4CA4A 3E0GA 2ISDA 2K6ZA 5A40E 1IT9L 4AG4L 5E5MB 5CD5C 4G8GA 3FCSB 3FU7B 5E6IC 1MREL 1AGCB 2DQEH 3HN8A 3SGDI 4BWUA 2ZOOA 1GGCL 3BN9D 4O2EA 5GJSH 5AL0A 3QJZA 5SWZD 3M46A 1JDCA 1GVIA 1MJJA 4Y19A 3RHWK 3GMNA 1K3ZA 2IJ0C 5L88H 1JOIA 1L4IA 4NC0B 2E7BA 2H2SD 2XCMC 4HGWB 1CL7I 3QJUB 4L4TE 3ZL4L 4XXCC 5HGHB 5F7DA 2CMRH 2VLLA 4QXGH 2XVBA 3BKYL 5T1DL 4XN8A 5ICXA 4AX3A 2VLME 4QRRB 4Z3HA 2BVTA 3REVA 4AM0A 2QVMA 2XG5A 5F9JB 4MX7B 3IMWA 3U36A 1ZHBA 3ZDZF 3T6XA 1KGCE 3F7LA 2IAAC 4Z7VA 4TNWK 1MCBA 4OJCA 2R7EB 2BC4A 4AXWB 5HYJB 1MXGA 3TCTA 1MFUA 4XNDA 4KJWD 5BRQA 5IM7A 2K7QA 4JB9L 5I24A 5L2JB 3BEWA 4RISL 4HEME 2L3BA 3LNEA 2NNRA 3BHBA 4N2LA 4HMDA 1GW6A 4Y4FB 2OTWA 2BOCA 4GXUM 3G6JA 2HLFD 3POCA 4JGMA 4J3BA 3AS3A 2VDRB 3K4DA 1HE8A 4DK5A 5LXGL 3HHMA 5GISH 4F58H 5F8QC 4LCCC 4MZIA 4FFVC 5GGRA 1BVLB 4JGUA 4MA8H 4BRVA 4QO1A 3TVMA 3UAAA 3AC0A 3O11B 3BAIA 4JRXB 1SF3A 5TDOA 2YPVL 3O8XB 4E9QA 3O6FC 4GUOA 1D5ZB 1AFVL 2N3JA 3KLKA 2V8LA 1TQCB 4PJXA 1R5WA 1NIEA 4HULB 4PUBH 4WWPA 5EU7C 1KXTA 5FYLD 3LEVL 4MA1B 1U8NA 2GHZA 3DI3B 5BW7C 3LOWA 5KS9F 1URIA 2OSYA 3L7EA 5DC9B 2ZIDA 1G7PB 3RAJL 1KXQE 3DUHA 4PCSA 4R0LA 1OD9A 2QVFB 1XF2A 2R0ZH 1UWFA 3ALXA 5LGJB 1JWMA 1QNZH 4HF5H 3V6OA 1Q0XH 2PWEA 2Y1YA 5CWSA 4I18A 3JUYA 4IOFD 4Z3EA 4NPKA 4R96B 3U1SL 1C08A 3PL6B 3U4EB 1M7IB 1RZJC 4QF1A 4WJ5A 1FLRL 5JOFB 4JY5L 3WDHA 1XF3A 4NQCE 1S9YA 2DQCL 2RHEA 2Z0BA 3X13B 1KJ2A 2V6HA 1BBJA 2J8HA 2J55A 2YPLB 2M1KA 4OLUL 5E9NA 4M7JH 4E9YA 3RVTD 2GUOA 3GS7A 3T8XB 2BNQE 2WM0A 2UX7A 4FXTA 4Y5YB 4G42A 4KHXL 3ARDC 2FEDD 2FUQA 2PO6B 5I19L 5I73C 4PJ7F 1MELA 4A7GF 2BCKB 2VAAB 2W80C 1T2JA 3RY4A 5JW3L 5DEGA 4J2XA 5KVEL 2OMXB 2WGXA 1UD2A 4AV4A 2WXMA 3TNNA 4BK8A 4F8LA 3SD2A 4FTDA 3TEXA 2XPYA 4D94A 2BNRE 3QW9A 3BAKA 1BZ7A 3QDAA 2AERT 2EIZB 4OD2A 3CMOH 4I89A 5D1ZD 3AACA 5BCAA 1O5PA 1FZKA 2Q8BL 2CUIA 3QEGH 4O2CA 2RACA 4RRPG 4WKXA 3TASA 3P2DA 4LDEB 1YQVH 2NXZD 3D34A 4RGMC 2CK0L 1P4IL 1BIIA 4H8WL 2ZCLL 1RK1A 4FTVB 5HHOE 3BPNB 4I0PC 4KDTA 5DVOA 1KB5A 3IFNH 4JLRB 2IPKA 4NEHB 2GJ6E 2X40A 1ZIBA 3OB0K 3QUHA 4MZ3A 5LAPA 2XG4B 1CG9B 2AJVH 1SBBA 2CDFB 4PJHF 4CADB 4EOWH 4OGAD 3PDDA 5EF3A 1MHPH 1G6RH 4WK4B 2HT3D 1CS6A 1BWMA 3LNGA 1OTTD 1WPCA 3BAXA 1BAFL 3QC6X 4PJ5D 4MAZA 2CAKA 3IFOA 3TBVA 2BP0A 5GRZA 1UENA 2VM9A 4TS6A 1ONQB 4WCYL 5F97E 1RUAL 7PCYA 1NCCL 1EO8H 5DD6B 4IRJA 4OZHE 4ABUA 3QWRA 5IB4A 5I6NA 5E8EB 5JHAA 2AI0H 5E9DA 4D9QE 3PG2A 5DWUH 2ZKYA 3RVUD 4XCCH 3CFMA 2HRPL 5B39A 2HX9A 4FGMA 4GQ9H 2EABA 2YD2A 4UBDD 3VFOA 2ZUVA 2X1OA 4L3CA 4LAQH 1B4JH 4N85A 1OE1A 1SOQA 2NY1D 3PU7A 4L8SB 4M3JA 2FBJL 4JO3H 3D50A 4ZPTB 4AMWA 3RJQB 5FA3B 2A6DB 2J5LC 3G5WA 5DT1H 4L9DA 1YYCA 1NA8A 5D1QA 5DHYB 3LXAA 3QORB 3ARPA 5LGYA 1U92A 2JKSA 4JO4L 4IGBC 4C55A 3NJNA 1OTSD 3NFNB 4YE4H 4M9PA 4DPCX 4BSVB 2B3RA 4A04A 3L48A 4N9GA 3LH2H 1I8MA 3HRZC 1QO3B 5DMGD 4GRWF 2FSEA 3PP4L 4KMTH 2AJXL 1P5UB 1OK8A 2XQYA 1N5YL 3U4AA 1KNOB 2FHFA 3DJSA 2GUYA 4HU2A 3RL2A 4MBOA 4KTEH 3Q0HA 4P2OD 3CZFB 5T33H 3SHSA 4Q9QL 3WIFA 2GEEA 1J05B 2CDEA 3JVGC 3M6DA 4HCRA 3O3BB 4JFSA 4UNTA 2BWDA 4GSQA 1TJHL 5KOMC 1CGVA 1T20A 3M07A 5E8DH 1NPJA 3O0RL 5EEWA 1NBVH 4LCYA 3S5ZA 1H3VA 1P53A 4ZUTB 5AUMB 5IG7A 3D4CA 1SLWA 4ZW3A 1HQRB 1Z6JT 1SMDA 5BS0B 5FYLL 5AW6B 3RU8L 2DQIL 3DJTA 5TGBA 1NWPA 2WLYA 3RVVC 4GAFB 5CO1A 1HXYB 3TS8A 5BVJA 3HFMH 1BF8A 5DJ2B 4XB7A 3WXWL 1PG7X 3IE9A 3CXFA 1A6TA 1X5MA 4ZBJA 4X5PA 4P4KD 2OMWA 1JFQL 3HI5L 3CFIC 2EP6A 1HKLH 2C9XA 2Z6FA 5E1IA 2MKLC 3Q6FB 4GEJA 2ORBH 2H0EA 2HT2D 2YSSA 3V0DA 3IDXL 1HVXA 3MRIA 1T3FA 3RWGA 2XU9A 1CQKA 1A8ZA 1RUQH 4DOHB 3LXBA 1IBDA 2J44A 1N6VA 3CVHH 4OZFA 5DC0A 4JCWA 5F7FA 4P46C 5IB5A 2ROYA 3E3QC 4EI5C 2IH1A 4TNVF 4G83A 2KQNA 1KYDA 4G43B 1IGTA 3RZWA 1GMEA 4KGJA 1CTMA 2XKNA 4N2BA 1PY0A 5EUOF 2R1WB 4YHOH 1G9NC 2D3VA 2UUDH 4OF0A 5FUCE 3ILQD 4PQXA 3N06B 4CDHA 4ETQA 3N85L 3I9IA 2DLEA 3QQ9D 4HETA 3ULUC 1RZ8A 2IQ9L 4UWQB 3MKKA 4N0RA 4P07A 5HHNA 3VQ1C 5IHWA 4NNXB 2VDLL 5I6XB 1U6AL 3QIBB 4HC1A 1RJLB 1AGEA 4F91B 1IAOA 3D08A 1ETZA 3CFBB 3KPLA 1T22A 1HNFA 4MXWH 2X53A 1EQWA 1CICB 1ZVSB 3ARGD 3MXVH 5I75C 2ZPKL 4OLZH 3ULVE 4J3OH 3ECBB 5L2KB 2BMKB 5C7XL 3D3VB 4AIEA 4PJAE 1MHEB 3QIWC 3JT0A 3EF7A 1HWGB 1L0XA 2YO3A 3DVFA 3H9SD 1I3UA 3DV6B 2AQ3A 5IQ9A 1SVZA 3NPSB 4GG6B 4XGZA 2IC2A 5AL8A 3SBWC 4I3RL 3TO4C 5IJDC 1QVOA 2B1HL 1Q9KA 3V6ZB 3FCTB 5FGCE 4K5MA 2WZ5A 1RK7A 3WNIA 5IKCA 4BFIB 4PLKC 4WTQA 3ES6B 5HTSA 3L5XL 4X6EA 5DK0B 3UOAB 3P77B 5C09E 1JF1B 3GHEH 2VXUH 3OGOE 1RUKL 1NOFA 1R3HA 2VSCA 2O6CA 4PRIE 1BV8A 5KSBF 4MJIA 2E6JA 1AO7D 4KKNA 1PDKB 3KPTA 3QXTA 3SKNA 5HHQA 1H3UA 1WBXB 2XWJA 3KPMB 4GXVL 4B5ZA 3ABMB 4LSSH 3HS9A 4N0CC 2VXQH 4IRZH 4FJ6A 2I26N 5C6PB 1V8HA 2JTYA 1KZQA 2AZUA 3A47A 3PABB 5IROC 2Y36H 4AEFA 5J1AB 1JAEA 5L8JB 1MEXH 1WH0A 2E46A 5IHZB 1PAMA 2PETA 1ZT1A 5L4IA 1F58L 4G8FA 4ZFZA 4LIQL 4G9FA 1WC7A 1V27A 3T4YA 1W2KT 1M7DB 1OWWA 4FKHA 4JFHD 3P9LB 4JUSA 5AW7B 4YR6B 2J4WH 4NT6B 1ND0B 1N0XH 3JZ7A 2BIIA 1Q38A 3SYCA 4DEPB 4W1TA 2WWKT 4B9IA 2H41A 4Z77A 3HG3A 1M71A 4NFDA 4OH2A 5HHMB 1S4IA 4L8CA 1FDLL 1ZA6B 3N1GC 2WZPA 3WY2A 4NM4H 2L04A 3SPIA 1TZHB 1N9PA 2GKIA 3NRFA 3QA3B 4L5FL 3T0EC 1I8LA 5IF0A 3KS0H 2AQQA 5H35B 1UOWA 2MWCA 4FHKA 3VWJB 4W9ZA 4Z7AA 1HH9B 3MBEC 5HGBA 5I2IB 2ZXQA 4GP8B 5F9DC 1QSFD 3DX3A 4G80A 2B1AL 3WEAA 1MJ8H 3BAWA 3BUYA 4UIKH 1ZA3B 2OPCA 5G5DB 4DN4H 3MBXL 4E41B 4HAFA 4PREA 1UZ8B 2ZG3A 5FDWA 3FRUA 3MODH 3R8QA 1SOXA 2B08A 5B38G 2JJSC 3MN8A 5HI3D 2VE6B 2HTKC 3BVNB 4ZRGA 3QUYB 2YGOA 3EH5B 3F7KA 3CDZA 3HG2A 3IK2A 4HK0B 4U1GC 3WUWB 5JMRA 2QGBA 4LPCA 2CJSA 1Z5LA 1D9KA 3W0WA 4NBYB 3D4ZA 3FB7A 4HWBA 2ZSVB 1FUNA 2DIEA 1MIML 5CEZD 2D0HA 3ECQA 2OCJA 4ECNA 3DVIA 3MNZA 3AZUA 5DHXB 1JZ4A 2DJUA 2W1NA 4Y2DA 4PJXF 4MD4B 4N0YH 3REWA 4DERA 5BQDA 2OMTB 2W5PA 5SV4A 2F54E 1U0QA 5ECGA 3S3PA 5E1AB 3CFKB 1J8HD 4JRYA 1MY7A 1SN5A 4JVPA 4KDWA 3SPJA 4MNHB 3QFJD 4NQSB 2CJTA 4WO4B 3UTSB 5I71C 2E75C 2Y69B 1EZVY 2WZAA 4BWTA 3GIVA 2PTVA 2WKOF 1HDMA 3V0AC 1OL0A 2ADFL 2QQLH 2K78A 3VG0L 1M05A 3V0GA 5AAWA 2P26A 3JZYA 1GJUA 2Y24A 1QEXA 3Q2NA 1FVEB 4RAVA 4IJTA 3EOAA 2YRBA 3FOMA 5CSZA 2X09A 2B9BA 3L3OC 4Y7MA 3QPXL 5FCSH 4S1DC 2C1PB 1ZK5A 2EDYA 1GGBH 1XGTA 1LJMA 4URKA 1QKZL 3C6SA 1ZLWH 5TDPB 3WTSA 5EO1B 1RJCA 1WICA 3ZKQD 3VWKC 1IGIL 4H8PA 5J1TC 4NM8L 1ACZA 4Z7NF 5ICUA 3WFDL 4XVSH 3BDBA 2XY1A 2AEQL 4YSUA 3OX8B 3U2SA 2QKIA 2WWOA 1AHWA 2E4TA 3T65B 4IDLA 3PHQA 3J2PA 1ZPLA 1TCRB 1SEQL 3CH1B 1C1EH 3TZVB 3VJ6A 4LSVH 5AZ2H 2WQUA 2PP8A 3AAZA 4U31A 1CD1B 4C83A 2NY6D 2P80D 4JHBA 5HDLA 2DOCA 1RXLA 4JFFD 1NANH 5AW1B 3RUGA 4UYQA 1NMCC 2FLBT 1DQDL 3MRCB 2ATKA 3IDMA 1CPUA 1MVYA 1H3GA 1PLGH 5A6IA 2JFCA 5C0EB 1R6VA 2W9EL 1UWXK 5AAPA 2VZUA 4F57H 5ACLA 4WWOA 1MKFA 4FNPA 3MLTA 4G7YH 1U8LA 4N0UE 2EDWA 3VD3A 1GGYA 1OKEA 1RPKA 2APWA 1ZLSH 3F7VB 4JPQA 5FXCH 1U2YA 4KVNL 3HLAB 3FMGL 4ZFFA 1BEYH 1ZV2A 1HSBB 3I50L 5IWLA 2AEWA 2YBRA 2YS4A 3SYPA 1KJVB 3TT3L 5C07D 1IGJB 3QQ3A 4X6BA 3N41F 2UV3A 4JHAL 2VWEC 2VR5A 2IWEA 5J13B 1MI5A 1PZDA 1I7ZA 2VZSA 3RZCC 1MJUL 5D7JA 1CLYL 4FL4B 4P0DA 4B9CA 5GRVL 4CILA 2WVUA 3SZKC 3PPSA 2UVFA 3GF8A 5JHDB 4FQQA 3OMAB 4FZEL 4GSDL 3PXHA 4R7LA 5F88B 1S7QA 1Y1UA 2R9HC 3A6BL 1ED3A 3GSVB 4FNLL 1OB1B 4GOSA 1KIRA 3DGGA 3LKOA 2XX1A 1XF5A 4OZGE 4Y4KB 2XTSA 4Z0BH 1VKXA 5I8EA 3I3BA 1F56A 2G5BB 4BFNA 1W8OA 2DQTL 1JRHL 3QJHA 4LQFL 1EXGA 4PJCE 3VFSB 5D70L 3LRKA 3UJJH 4MMZB 4OLYL 3QO1B 3BLPX 2V3EA 3VGDA 2PPCA 3WO4B 2G9HB 5KOVC 1IM3B 4QT5B 1OXYA 5BOZG 1LK2B 1NGXA 3L54A 5TE7H 4NC2B 3O41A 3LNFA 4PBXA 4Z18A 3NZ8B 3TN0A 1FWXA 4DUWA 1OCWL 4B3EA 3ARBD 4XTRD 1HHJA 1XSIA 3ATFA 4KJQD 1AQKL 5GGQL 5BQ7B 1UD6A 1KIUA 4OFDA 4U49A 1DFXA 5EWIL 3SJVE 1VHPA 4K8RC 2HFTA 3WY1A 1RZGB 4KQ3L 2P5PA 3QNXA 5B7FA 1XWVA 5CEZL 3GIZH 2EECA 4GXUN 4XMKL 5CM1A 5F0JB 3F7YA 2KPNA 3QUXD 4HOMA 3SDAC 5F1NB 3LIZL 4QDGA 2Q3ZA 3QCUH 4GI6A 5MERB 3GJEB 4GUPB 3BKMH 1UGKA 4M1CC 3SPVB 1KV7A 5F6HI 3VG9C 3EHBD 4KTGA 1EWHA 3VU2A 3SD5A 1X4ZA 4N8UA 1GAFH 1RZFL 4JZOB 2Y2YA 4E9SA 2D4FA 1FZJB 4UILL 3LB6C 2W92A 1RIUH 3KBHE 1YQ2A 5C3LD 5HHXH 4LEXL 2ZCHH 3S35L 4RWHA 5IHUH 1L5GA 4YZWA 4BFFA 2ODHA 4YBLB 4I87A 4BV1A 1OV8A 1XGRB 3PAZA 4L29B 4B53A 2BSEA 3C87A 4L3ED 4PS4H 3NSDA 3HAEG 5GIRB 5A3IC 5FV1L 4JG0L 5IW3A 3C60D 1ET8A 4H8HA 1OGPA 1VENA 4APXA 2ZUYA 5EU6A 2WIMA 5IMLB 1TF4A 1QLRA 4OCSH 1MCRA 1NC2B 2VQTA 3CLFH 2ENQA 2K3TA 2DWDA 3RIFF 4B97A 2DWEB 4JDZB 3NUKA 4WWID 5F7UA 3RL1B 4HXAL 1I1AC 1QSVA 3PS6A 3K3QA 5EZIL 1QLEB 2HN7A 3Q8FA 5DGQA 2G0LA 4FABL 3K2MC 4NP4H 3NIDF 1X5XA 5GRYA 4PB0H 2K70A 2YFOA 4KQ4H 2CIIA 2V5RA 2GCYB 4H13C 2VR8A 5CD3B 4UQIM 1WTGT 1B88A 2O5YH 2VSMB 4WEEA 1A6WL 1U8IB 2H6UA 2LHAA 3MJ7B 4OZIA 3QDJD 2YRPA 5F7EL 1KG0B 3LEXB 5A6LA 4NENB 4PB9L 2P8PB 5KVGH 5I1DA 5IOPA 5J7CC 3ZR6A 5IEHB 1VJSA 1ZY9A 1Q94B 3NSFA 2BLFA 3QO0B 3LD8B 4OFYA 1LO4L 1JNHA 3T1FA 1Q0YH 1FNGA 1SYVA 3GUTB 2Y25A 3KL5A 4Z9KB 4JY6A 2IH8A 2FGWH 3ZDZB 4HGKC 1QG3A 2DTSA 2QQNH 1WAEA 3FQ4A 4H8VA 3KXFB 5J9PA 4G6JH 3VD5A 3B6SB 4IBTA 1G6RA 1JP5A 2XXCB 4JHWL 3M7FB 1UT9A 3RDTB 3SB3A 1QSEB 3NFPB 1ZTXE 4NZUH 4UQ3A 4L0ZA 1ZLDA 4X7SH 5D7LD 5IIEA 1BVOA 3U1PA 5MEQA 1E6OL 1UA3A 1YUHA 3PGFH 3ZYJA 4F8NA 1TT6A 2BJMH 3HC3L 4KKBD 1KTLA 5EMYA 4UTAH 1NFDE 3LQAH 3ROOA 1KYFA 1YEIH 1VERA 5GGVY 1DVQA 2XICA 5FO7A 3N55A 1ITBB 1QBMH 4YHZL 1S7UB 4LSPH 5I15L 3RTQB 2GSMB 4CVZB 1UASA 4X9HA 1E43A 3PV6A 1X4XA 4PJDF 3ZMNA 4IKJA 3LVTA 2B59B 1FPTH 1CXFA 4NGHL 1LE9A 3O4LD 2VN6A 4Q6IA 1THAA 3Q44A 1G94A 5KS9B 4MMXA 3DSNB 4L23A 4DKFL 4PG2C 4E9RA 4R4ND 5JYMA 4JFUA 3NJFA 1L9PA 1I3GH 2NNAB 4WI0A 3ZGHA 1MAJA 3DHPA 2IAMD 4LXFA 1VPOH 3F83A 1ETA1 4IRSC 3FUJA 4K7FB 2QGCA 5CEYB 3SCMA 3WN5C 4S2SA 3K5SA