4RH4A

Zinc-substituted pseudoazurin solved by s/zn-sad phasing
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudoazurin
publication title Zinc-substituted pseudoazurin solved by S/Zn-SAD phasing.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Metal binding protein
total genus 37
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4rh4A00
1BQ5A 1BQRA 1A4BA 3IBOA 4HCIA 2GC4C 3T71A 1QHQA 1MDAA 4MFHA 4DPCX 4JHVA 3SBPA 4KO6A 2YAEA 1E30A 1JXGA 2CAKA 2OV0A 3ABLB 3DIVA 4F7KA 2QPEB 3S3DB 2UX6A 4YSDA 2XU9A 2CCWA 2IH9A 2YAPA 1PLAA 3ERXA 3QPKA 2CBPA 3OQRA 2FQEA 1ASPA 3FYIB 3H4FA 4DPAX 3S8FB 3NSYA 4E9QA 3NJJA 2I7SA 3UADA 3X1FA 2J5WA 1BAWA 3OD3A 4KNUA 1GYCA 2XVBA 4DP8X 2PPDA 5B1JC 3TASA 2RACA 1N68A 1B3IA 4BWUA 2BWIA 3CVBA 4HHWA 4AKQA 4A2FA 4ENZA 2XUWA 5I6NA 1V55B 2XX0A 1HFUA 2XYBA 2XWZA 3N2JA 2UX7A 5ANHA 4G7QB 3FSZA 4JKNA 4NB7A 4YSOA 4G7SB 1ASQA 1NIFA 5PCYA 1ZIAA 1AOZA 2UXGA 2XV0A 1PNCA 4HHGA 3T9WA 2UXTA 2UXFA 1NDTA 4JHUA 4BXVA 4FA7B 4F2EA 7PCYA 1OCZB 1GY2A 4AI7A 4W9ZA 1IUZA 3FPYA 1HAWA 2GIMA 1AZNA 5B1AB 1KCWA 1PMYA 5B7FA 2VMJA 3T6ZA 1BEXA 1JXDA 3JT2A 4YSEA 1PY0A 1JZIA 1NICA 2IDQA 4YSUA 5I5MA 4YSQA 1PLCA 1ET8A 1T5KA 1ADWA 3SBQA 4KOBA 3UGEA 2PP7A 2BZ7A 2I85A 2PP9A 3X1NA 3FT0A 3U25A 2AZUA 4BK5C 1TU2A 2CUAA 5IY5B 1SNRA 3WIAA 1BYPA 3PAZA 1ET7A 2IWKA 4DPBX 3AY2A 1ILSA 2A3TA 3NT0A 2FQGA 1OCRB 3EH4B 5EHFA 1AG6A 2IDTA 1OCOB 1AQ8A 3ABKB 3UAAA 4GP4B 2VM4A 4KO9A 3T6WA 2FWLB 1ASOA 1KYAA 1JZEA 2W8CA 1AR1B 1RKRA 2XV3A 2P80A 2HX7A 2YAHA 2DWSA 3FU7A 5D4HA 2EINB 2YQBA 1IKOP 3ABGA 1UATA 4GYBA 1OCCB 4M4RB 3V9CA 2B3IA 2IWEA 3GYRA 1PZBA 1J9SA 1XB8A 4UAHA 3AW5A 5I26A 2VN3A 2FT7A 2FQDA 1WS8A 3OMNB 2XX1A 1A4CA 1MZZA 2B08A 1W6WA 1AZUA 2EILB 5AFAA 5B7EA 3CVDA 2BW4A 4E9WA 1I53A 4HZ1A 1AZRA 1W6LA 2UXVA 1L9SA 3MX0B 1BXVA 3FQ1A 1FA4A 4YL4A 2FT8A 1NIAA 3G5WA 5E9NA 2H5UA 1MG3C 2Y69B 2I7OA 3EH3B 5B3SB 3GXUB 2H3XC 2HX8A 2BO0A 2XXGA 4BWTA 4WTQA 4X4KA 1L9TA 2VW6A 1EZLA 3NYKA 2JXMA 1MG2C 4E9RA 1NIBA 3D12B 2P80D 2PLTA 3PXLA 2IDUA 3MBWB 2BP8A 5I5IA 2QDVA 2LLNA 1AIZA 2QDWA 2GB2A 1J9TA 1A4AA 1J5CA 3CVCA 3WKQA 3BQVA 2Q5BA 4AX3A 2DWTA 3PPSA 1J9RA 3RYMA 5B1KA 4DP6X 1L9RA 4KO5A 1JERA 1R1CA 3SBRA 3NSCA 4G70B 3NSFA 3ZX1A 1FFTB 3EHBB 1AANA 4P5SA 1JOIA 1XB3A 5I6KA 1JZFA 3TBCA 9PCYA 4N8UA 1GS6X 5F7BA 1KGYE 2MRYA 3TBBA 1AAJA 1A3ZA 2YAQA 1E67A 4QKTA 4QLWA 2BW5A 2H47C 1AZCA 1X9UA 2AVFA 3QJSB 4DP9X 1PNDA 1TEGA 1X9RA 2IAAC 1AZBA 3NJGA 4PCYA 3IE9A 1AS7A 2X87A 1JXFA 1GR7A 4CSZA 3OM3B 2HRHA 1V10A 4DP1X 2MTAA 1GS7A 3FU7B 1OV8A 2BHFA 2GI0A 1L9PA 3FS9A 1NPJA 3GDCA 4AZUA 1CURA 2NRDA 2YXVA 5TK2A 4E9VA 1SDDA 2VW4A 4BWWA 4F2FA 2EIJB 2WSDA 8PAZA 1WA2X 1OE3A 1ZDQA 1SF3A 2YAOA 3FSWA 2PPCA 2DYSB 2DYRB 3QJQB 5I5JA 3NP3A 3H4HA 2BP0A 2IDSA 2YARA 1WA0X 4Q89A 4UF7C 5FC9A 1AS6A 1GW0A 1GY1A 1JVLA 2BZCA 2OJ1A 4GP8B 4YSPA 2JFCA 2XLLA 1ET5A 3UAEA 1JZHA 1NIEA 2AANA 4M3HA 2J56A 2YXWA 2J55A 2BP8B 1SHXA 4G71B 3WG7B 3PAVA 1QLEB 3FSAA 3HB3B 4AKPA 1AACA 1SF5A 3WNIA 4EF3A 2PPFA 4WKXA 1NWOA 2AZAA 1OOWA 3FQYA 1XMEB 3DKHA 2CJ3A 3QJVB 1GS8A 1BXUA 1ZV2A 4G7RB 2DV6A 3NJIA 1KDJA 1V54B 3CZUB 3NJFA 3SQRA 4DP0X 5I6MA 4E9XA 4KNSA 1CC3A 2WO2B 2VSMB 2IH8A 1RZPA 1QNIA 1SFHA 3T6VA 4K9JA 1PZCA 2E86A 2R7EA 3QQXA 3NJHA 3NJLA 2GC7C 1KV7A 3EF4A 1F56A 4A2HA 2HXAA 2PCFA 3ZBMA 2ZOOA 2ZWNA 4GP5B 4HALA 2DY2A 3CDZA 4DP2X 2BWDA 5I28A 4BDVA 3IEAA 2HX9A 1J5DA 3OMAB 3N55A 1YLBB 4YSTA 2J57A 4HCGA 3AG1B 2OCCB 3C75A 1KCBA 2PP8A 3ASOB 3FQ2A 5AKRA 2VM3A 3X1EA 2IWFA 3PAUA 4DP4X 2N0MA 1SDDB 1AG0A 2TSAA 5A7EA 1URIA 4YVNA 1RCYA 2EIMB 3EH5B 1IBYA 2QT6A 4TXVB 5I6LA 1BXAA 3ASNB 3IN2A 1PF3A 4NAJA 5PAZA 1M9WA 1KBVA 3CG8A 3KW8A 1CYWA 2BP0B 2PCYA 1TEFA 2JKWA 3AZUA 2Y1AA 3S3BB 5TK4A 1HAUA 1NTDA 2FQFA 3QJUB 1PCSA 1E5YA 3FSVA 4E9YA 2HZHA 3OMIB 1L9QA 4KNTA 1SJMA 1NPNA 3UABA 3AG4B 4A67A 5LDUA 4DP5X 4RH4A 5I6PA 4YVUA 1WA1X 2ZXWB 1NZRA 4W1TA 2VSKB 1IC0A 2X88A 3BVDB 4YSAA 6PCYA 5D4JA 3NSDA 1AS8A 7PAZA 1CYXA 1ZIBA 2FTAA 1BQKA 3HEIB 3FU8A 5I6OA 2GSMB 4P5RA 1JVOA 3V9EA 5B7MA 4L0PB 2Q9OA 2VW7A 2R7EB 4GY4A 1E65A 4E9TA 4HCFA 4A2EA 3S8GB 1SHWA 4CSPA 1FWXA 4A66A 2AFNA 1JZJA 1NINA 1J9QA 1KBWA 1ETJA 3X1GA 1SFDA 3ABMB 3NJNA 4G72B 3X2QB 2PPAA 1WS7A 3DTUB 2FT6A 3X1BA 1RZQA 2IDFA 3CDZB 1JZGA 4UANA 3WKPA 1CUOA 1TKWA 4BDVB 3TA4D 3NJMA 2GBAA 4Q8BA 3L45A 4YSRA 1NWPA 4DP7X 3FU9A 5D4IA 1PZAA 1VLXA 1BYOA 3FPXA 4A68A 4FAAB 3NP4A 2HRGA 5B1JA 4N4YB 1MZYA 3JTBA 5B1BB 1OF0A 4HIPA 2FNWA 2GHZA 2W88A 3QJRB 4A2DA 1EHKB 3AG2B 3PCYA 1A65A 2XV2A 4GXFA 3NJKA 2WO3B 1KDIA 1OE2A 2CALA 3KW7A 1PAZA 3S3CB 4PAZA 3UACA 3T6XA 3QJTB 3TU6A 4BXSV 2YAMA 2ZONA 1IBZA 2YAFA 4KOCA 1L9OA 4KO7A 1E5ZA 3ZIYA 1WAEA 5F7AA 4E9SA 2FJSA 1OE1A 2TSBA 5AZUA 1M56B 1ZDSA 3WNJA 2HLEB 2XXFA 1W8EA 3FYEB 4HAKA 1XB6A 1M57B 3H56A 1PLBA 4AKOA 4NERA 4A2GA 4ZK8A 4YSCA 6PAZA 1DYZA 1NIDA 2PPEA 3ZDWA 3AG3B 3WI9A 3PLYA 1ILUA 1ID2A 3IN0A 2EIKB 4YSSA 1N70A 1DZ0A 1GSKA 2QPDB 1A8ZA 1ZPUA
chains in the Genus database with same CATH superfamily
1CLOH 1EJOH 2K6YA 5A2AA 4P2OA 3SDDA 3VYPA 3WKNA 4WFHE 3OBAA 2JJSC 2ZUYA 3AXIA 4MFHA 4JHVA 2CGRL 2GK0A 4NT6A 4F15C 1I4FB 2LLLA 3RFZC 3ABLB 2Y1YA 4F57H 3QO1B 2DD8H 4FMVA 4TTGA 5F70A 3OGOE 1PD6A 2APXA 4HJIA 4R5XA 1J8HE 5BVPH 2DAVA 2E9BA 3EOBA 3Q48A 1N6QH 1GAFL 4BRVA 3L3JA 4F3FB 3DX0A 2UZIL 5F0JB 1QRKA 2WJ7A 1HSAB 3O9WA 2XVBA 5FEBA 4WY7L 1F1GA 4FLQA 3EYOB 4CMHC 4DW2H 5KVEH 3FFDA 2J1ZA 1I85C 1IC7L 1NCUA 3I2CL 1U58A 2RD0A 4RVBA 3LN5B 1HHHA 4Y88A 2DTML 4U33A 2CM6A 5EEXA 4WHYH 1QVOA 4B3VA 1DSFL 3DI3B 1HFUA 5E9DD 1I3UA 1EMTL 1Q9KA 4XCYB 4AGOA 5CZRA 3Q8EA 2R29L 5A2JH 3OSKA 2WLLA 4U6XA 1FG2B 5BQDA 4Z77A 1DZBA 4N2HA 12E8L 1IFHH 2AGJL 3QNXA 3OJDA 5HGAA 1F8TL 2PXYC 3OB0H 3ZTDC 3R7RA 2IH3A 1JTOA 4WW2F 1R0AH 2XI9A 4WU5B 4Y19A 3WIFA 3QA3B 1CFNB 2HJLB 4RGND 2Q8AL 1DQKA 1SDYA 2OJZH 2G75A 4PJ7E 3KPTA 4K9EH 3SDCA 1CIUA 1PDKB 2WANA 4X8CA 4UINL 1WCBB 4TVPL 4AYGA 2I69A 4OZHA 2ADGB 4PFEA 3VB9A 3F58H 5HYSG 5EU4A 4WKZB 5HP5A 2MKLC 1QFWI 2JKTM 2L8AA 3MA9H 2XN9D 4IBSA 4Q2ZB 2ZT9C 4OJDH 2VMCA 4APQC 4LCCC 1NSNH 3U9PH 3ZDZB 1ZRUA 1NCJA 4F7TB 5D6CB 1BD2D 3X17A 1E5UI 4FGMA 4NQDA 1U9KA 4XBGB 4F7CA 1D9KD 2XTJB 3RNQB 1W8NA 3BD5A 2B14A 4WNQB 4Z76A 3Q1SH 4JPKH 4DK6A 2IWKA 4LMQI 4U1KA 1FNSL 4P0DA 4WWPA 4OLZH 5D7LD 4ZYKB 1HYSC 4HKXA 1JGVL 1AGEB 3IFOA 5AVYB 5IJCC 4NO5A 1AQ8A 1FZJA 2ZUSA 4RWHA 3HZMA 3OR7A 4I5BA 2Y0SA 2E6PA 4KRPD 2VLLB 2W8CA 1OGAE 3F7KA 3QSKB 1AHWA 1KJMA 4IRJD 5HI4C 3LKOB 4IOSA 1FN4A 2F8IA 3V9CA 2J8HA 2NCMA 3OF6A 5DA0B 4HIJA 1T3FA 1S9YA 4IW4C 4HV8B 5DWUL 4HIXH 3T1FA 3TIDA 4U1GB 1S7XB 2GAZB 2OMVA 4JQXC 1MZZA 2EDKA 2EUZA 2F8OA 2XBZA 4J3WA 3W9DB 5HI5C 2EIZA 1OWRM 1OAKL 2YR3A 1GMIA 3SPIA 2APBA 4HH9A 4O02L 2F0CA 5DLMH 2F5AL 1AZRA 2ZCZA 1DVUA 1RZJC 1SLWA 3EJCA 3IBEA 1HN1A 4L1HA 5EUOF 2ZOKB 4WI0B 3FTZA 3ZE1B 2VDNH 2HG0A 4JPIA 5F7YC 1JNLH 2C7FA 2J8UB 3QULA 5I1LB 3O6LL 4E9RA 2WLHA 2GFBA 5FGCB 1KTCA 1DJHA 1KB5B 2DI9A 1E90A 1J9TA 5HXMA 3E1ZA 3VD2A 5D7IB 4F7PA 3JV4B 1KN2H 3K46A 1G0XA 3S5LG 3V5HB 4Y9CA 1WEJL 1OSZB 5CWSB 1HI6B 3LRSA 4BFIA 1MW0A 2ARJB 1TZIA 3GRGA 3EFFA 4HQQL 4WW1A 3ATAA 4FJ6A 5SV4A 4CN6A 5MERB 5JXAL 4NXKA 3VXRE 4PJGA 1LHZA 2OMZB 2ADIA 3P3TA 3BUBA 1G7MA 4J2QA 4HJ0D 1TU2B 3D85D 3KYNA 2YD4A 4L4JA 4EI6A 1S7WB 3TIEA 4AJYV 4F2MA 2HPOA 1RUQH 4LFHD 1G5GA 3QI9D 3AWFA 3IAGC 4OCYL 2A4ZA 3KWVA 3SQBB 4PJEE 1UB6B 5D1ZB 3VH8G 1U8LB 5H94A 2Z92B 3GTTA 3RY5A 3MRGA 4A7QA 1VKXA 5JORA 2ESVA 3VRIA 3IKKA 4NQTA 2IAAC 5E8EB 4JREB 5DLLA 4NM8L 5AOKA 2HRHA 3K6FA 2BM3A 2WYZA 2CDEB 5JHBA 4OZHE 5F9WB 3WMSA 1HEZB 1KOAA 4QPEA 4LCIH 1S6NA 2WINB 2YKLL 3WHE0 1MREL 3HVNA 1KCRH 1TO5A 4JDZA 4APXA 2VLKB 3EG9B 4GEIA 2E9IA 2VE6A 1BZ9B 7TAAA 3WENA 3DUSB 3H9SB 4Z0XB 2V2TB 3WN5A 4NQDE 4BM7A 1N26A 1TQTA 2FYYB 2YGQA 4OKVA 1EV2E 1HEJC 1JGEB 3ZIMA 3KHQA 5E1HB 2XWJA 3ZDZF 3DYMA 1BZDA 2DYSB 3RZCC 2F74A 1AMYA 3B8YA 5CU5A 1JHLL 2R9HD 3RPIA 3TN0D 3E0GA 4ALAL 4JO4L 3BRDA 2BFVH 1RZJH 4JRYA 2BNQA 1TT6A 4B9IA 2FLRT 2G5UA 2W0LA 2X40A 4PLOB 1A7RH 2BVEA 4NJ9L 2VLJD 4N24A 5TD4A 3WG7B 3FUFA 2CDGA 5IB3B 3FSAA 3GMQB 2HFEB 2IXQA 1N18A 2WNXA 4I77L 4LEEA 1TUPA 5J6HA 4U7SA 5ERWA 2GVYA 1KJVB 3F6IA 2XWXA 1EGJL 3ZUNC 1KGCD 3BVVA 5JNYA 5LBGA 4YDKL 3BKYH 4QF1A 1Z9PA 1BIIB 3JTTA 2GBTA 3VGHA 4RMVA 2ZAGA 1QBMH 4OBRA 2VL5A 5DT1L 1JPTH 3AGVA 1ADQA 1RZPA 4NP4L 1SY6H 3JZ7A 3F7YA 4S2SB 3NJHA 1CLZL 4QO1B 4Z1PA 3WEMA 2AP2A 1ACYL 4PRDB 1BVNT 4OLVH 3ZE1F 4ZMNA 5IW3A 1HXMB 4WWID 2J8UF 4B97A 1QBBA 1NC2A 5IEHB 3HS0A 3HE6C 1ZEAH 3QUXB 1B4LA 3FTGB 3I6KB 3WAKA 2B1AL 1PZ3A 1O6SB 4GKSB 4AC4A 2HFFA 5I28A 3V0HA 4KJQC 3VWJB 5EF2A 1NBQA 3LJ3A 1YPZB 3JZYA 4KJYA 4ZMLA 1KG0A 5DD0L 35C8H 1NCNA 1GJUA 2JB5L 1JK8B 4HFUH 1UC6A 2WLKA 5D7IF 2WWMD 3FQ2A 4L3FA 5L88H 1HNFA 2R23B 3L3OB 4MD0A 4Y4KA 1UFUA 2R0KL 3CFMA 5D55A 1KTLB 2EIMB 5GISH 3WIHA 1X44A 4F2ME 4HGKC 1EAJA 4HOMA 3M1CA 2BIIA 1CD0A 4DO6A 4Y16C 1UVQB 5DQJB 1MLBB 2X2UA 3MUGB 5CFAA 1NPUA 1CD1B 3MGTA 2OMTA 4DUXA 5A43C 1CE6A 3DHMA 3QUMH 4LU5L 2DQEH 3T2PA 3S3BB 1YSOA 2ESVE 2Y7QB 3BVNA 3MO1A 5BJTA 1NTDA 1JRHI 3G5ZB 4M5TA 3UTSB 5MEQA 2IALA 4HLJA 4NAMA 4HOZA 5LBSH 3G7TA 4LP4A 1G0YR 3LZNA 1OT4A 1EHAA 3R4RA 3COOA 5AVXB 4QJ4B 2W0KA 5I6XB 3BGFC 5ETUA 2D4FA 1RJZA 3GSNL 2NZ9C 5DZVA 5K1VA 5KS9A 2XZQH 5J12C 3RIFK 1BYNA 1IE4A 2YMTA 3GNMH 4FG2A 4WEEA 4B9GA 2W9DL 1W16A 4CJ1A 2R4RL 5LCVH 1BVOA 4G1MB 1A2YB 5DA4A 3I02B 3KNBA 5HVGB 2R1YB 4WZ9A 2WZPA 1O6VA 3WL9A 4Y2OB 5GGSY 4L8DB 5CSGA 1T6BX 2QHLA 3AY4A 4XTRC 3D09A 4J7RA 5EBMB 2E0PA 4H25B 4JRYE 2BNQE 4O02B 5FR3A 3MV7E 1UJ3C 3IF1B 1UCBL 1UZ6E 4IRZL 1CMOA 1BWWA 3I3BA 1IC4H 3VSVA 2Q3XA 4URKA 4U1NB 1SJEA 3HG3A 3UL4A 3ARBA 5EU3B 1JNHB 4IIZA 4OM0H 3E7JA 3NZSA 2JELL 4BDVB 1CICB 3O3AA 1MF2L 3FH7A 3RAJL 1P4LA 4YSRA 4YO0A 5D7SH 1I9RL 3O0LA 3ZYIA 1A3LL 2XWTA 1AGDB 3NP4A 2WBXA 1MCLA 1T5XA 3D2UA 3DRTB 1ZV5A 4UU9A 5DZPA 5B1CA 3ISWA 3L7EA 5J57B 2WCSA 3TH3T 1OSPH 4QUOA 1OF0A 2A9DA 2FD6L 1MFDL 1ID5I 3VD4A 2G3XA 1Z9MA 4DN4L 2I60H 3GKWH 3PFUA 1CGUA 4LOVA 3W38A 3TT1H 1JWUB 2NOYA 3AG2B 3QXWA 1DJYA 1QFHA 1I9IL 1TPXC 2X0VA 2Y06H 3ECWA 4FS0A 5JUEH 1P1ZA 5I8OH 3RGVC 1XBRA 2EH7H 1BZEA 3BYTA 2YA2A 4GW4A 1KGXA 2CR0A 3JSSA 3PP4H 1MRCH 4OZFB 2I32A 1FNFA 5IQOA 5KBDA 5FCUL 3ROOB 2K7QA 3P11H 5F1NB 2AQNA 2V2WA 3CDYA 3BN3B 2HKFH 4NO3A 5HDQH 1NCHA 3L54A 1LM8V 4U6YB 2FUTA 3BZEA 4M48H 4GW5A 4GG8B 1FH5L 5F7EH 5IUSA 2BSCA 1UOWA 4F93B 2HTLC 4GSXA 2BP5M 4YFEA 1Z9SB 5BS0D 5EO0B 4JO8A 5AOIA 4YPGB 1JI1A 1PLBA 3VFWB 3J7HA 3N85H 5C07D 4FTVB 6PAZA 3AREA 3MLUH 2AV1B 4FQJL 3HAEA 1TJHH 3OG6B 4JFXB 3JVGC 4YSSA 1A6TB 2NY1D 1U0QA 1FZOB 3NH7H 4KRLB 3D87B 5AAMC 1D5ZA 2ADFH 1JHKH 3TFBA 4FFZL 3H9HB 2ERJB 4LEBA 1BQ5A 4YHML 5I75B 4CVZA 1DUZB 2OSYA 1HL8A 1QSEB 4FEMA 1QHQA 3KJ6H 25C8L 1MDAA 1J05B 5FW8A 3FFOA 3LS4H 3W5MA 1RURH 2YAEA 4QOKB 5KYXA 3VI3A 3DIVA 4HK3J 1HQ4A 2Q86B 3SE4A 2MCG1 1NA8A 4H0HB 3WY2A 5HD8D 2YD9A 1T22B 5C0RH 4TRPL 1KFAH 1RU9H 1S7VA 2X4SB 4CKQA 5KS9E 1B2WL 4X8JA 3PP3H 1NAKH 5BZWA 2I7SA 3CU1A 4KGLA 4F8NA 2J5WA 3K71A 5T1LB 3LS5L 4IKKA 2EH8H 4JFED 2Z7UA 2N3JA 5I1JL 4GT0A 2YKKA 4TSCL 3P69A 1N68A 4NUQA 1JK9B 3HW7A 1TVHA 2O5NA 3L13A 5T33H 3QWOB 4PLKD 3LIZL 3WNMA 4H0LC 3HHMA 4UV4H 1ZWIB 3T2NL 1FFPB 2HWZL 2UX7A 2WQRA 3BH8B 1QHOA 3ISYA 4JVUA 5ANHA 1UH3A 5SWSE 1BJMA 1F6AB 1XF3B 3QEHB 4WO4D 3LPOA 3PGCA 3AADB 4HJJL 5TDOA 3NIDB 5JW5B 3W5NA 2KQNA 1P4BL 4MJJA 2CM5A 2ZG3A 3GO1H 4XMPH 1I8IA 1YG9A 5FHBH 4I0PC 4HKZA 3MACL 4LIQH 1EO8L 4JDVB 5F3BB 3RGBA 1Z3GL 3MRCB 1RZFH 5MEND 2I25N 5D2NE 2P5EB 1RIVH 2SEBA 1RK1B 5CP3A 1VADA 1FP5A 2BHUA 1IUZA 3CSYB 3FPYA 4BELD 1Q1JL 1MCCA 3KWWB 5I1EH 2P24B 1W9XA 1YYMH 3AB0B 1DVQA 2AJUL 1MWAL 3IETA 4IEFB 4R4BB 3QZLA 2AEQH 3L3HB 4YUEH 1NGPH 1T1WA 2YUVA 5LWYL 1F1AA 3FBKA 5TQ2L 4JFOA 1AQKL 1PD0A 2QKSA 1CCZA 3P73B 4MS8D 2ICEA 3LPFA 3T5WA 2WLIB 5ESAA 3U6XS 4RGMB 4HU2A 2LU7A 4P05A 2H8PA 3DUHA 5EZOH 5GS2D 1ET7A 4KHTH 2IMMA 2O6PA 4ZW6A 2ATPA 4JG1L 3QZBA 4HIEA 4BFJA 5E5MA 4Y0GA 4Q9BA 4ZSOB 2X4QA 4LLDA 3PDOB 2A6JB 4LLYB 3VU1A 3AJ7A 2X28A 4ZMAT 2VM4A 5B8CB 5EBLB 3M6DA 1LYQA 4KFMA 4E41E 1AD9A 4AENB 4AL8H 1T5WA 1GVIA 4JO2L 1MFEH 4XPTL 2EINB 3CZLA 2AI0L 3OLGA 4C54A 3QS3A 4I88A 1UATA 4XP1L 5DQDL 4LZKA 5GZNC 1BG9A 1XB8A 3SGEI 4UAHA 3GSNB 2VN3A 4C4KO 3IMUA 1YUKB 3REWB 1NCGA 2VJ0A 1UZ8B 5I76B 2DMGA 4WFED 4EN2A 1TDQA 2YSSA 2IGLA 1TO4A 3MLWH 3N42B 4BFEA 4HXBL 3TESA 3OQ3B 1M42A 3P3SA 4MKTA 4ERSL 1FA4A 1SOSA 2K3TA 4FE9A 4LHUA 1N2RB 1QLFA 2F7RA 2X44D 4IRSB 1WJ3A 4MWFA 3QZWG 5HI3D 3LZFH 3UPRB 3VI3E 3CIAA 2ZX8A 2BC4B 4Q52A 4EI5A 5B3SB 3BZ5A 1LEKA 4HEPA 2ZAHA 1L9TA 1DDTA 2ZG2A 1T20A 5LDSA 2W0FB 4MJIA 5ALBH 4HVBA 3QXDA 1E4JA 3BMVA 4KY1H 1D2OA 5DJZB 5DK2A 4WEMB 5HDBB 3CN0A 4FFWD 4Y9GA 2CIIA 5KVFH 4IBLT 4QD2E 2GB2A 2GY7B 3HI5H 2Z7WA 3KPQB 5D1XE 4KDVA 4Y9BA 3MYJB 4GRLD 3RX5A 2OL3H 3E6HB 4QRFA 2RCSH 2ZUUA 1UWGL 4I9WD 3B2VL 4JM0A 4Z7WA 1I8AA 1NC4A 2RH0A 4X7SH 1KYUA 4UM9B 5C08D 4OSUH 1JCVA 3V0EA 3EH2A 1TQVA 5INDB 3ZDYE 5CMAB 4LP8A 3EHBB 4ZW7A 2IV8A 5GGQL 3LCYA 1KYFA 4PVNA 3U7WH 3P4NA 1TQBC 2GABA 4NLAA 2B2XL 5DJDA 4UTAH 4N2IA 3FTSA 4YHIA 5GZOC 4N8UA 5KAQF 1J1OH 2F8VA 4JM2A 2E6QA 3NIDF 1UGKA 4EN3B 4UMSA 1HOCA 1HIML 4GO6B 1BIHA 5CSZB 3P4OA 1X9UA 2AVFA 4HOXA 4DP9X 2FHBA 3PL6D 4P06A 3T2QA 1Q0XH 1IM3D 4Y5YB 3C5ZB 4BZ2H 2X87A 2HT4C 3WFBH 4F5CE 4WJG3 4HFWA 3V4VA 1AR1D 4AQOA 3VXSA 4DP1X 5AZ2L 3VSQA 3VXUB 4TUKH 3DBXB 4M3JA 4OIIL 5EO0A 3A4EA 1U3JA 4N86A 2JF1A 5LB1A 2AQRA 1IGIL 2AJVH 2PYED 5JQ6L 3WS6C 1S9WA 1UA6H 4BUHA 3B5GA 1UWXK 4E9VA 3ATEA 3OL2A 4XO5A 5DC9B 3TBSB 4KXZH 2WKOF 4BH7A 1MY7A 1CFVL 4BWWA 5ICZB 3L4XA 5ALCH 5DHXB 5AKVA 3V0GA 4J3OC 1IAKA 1MJ7H 2WXLA 4UILL 2EUVA 3WD5L 4UF7C 4ZPTB 3H6JA 3ULUE 3P0YH 5DUBA 4C83A 3BYYA 1RJLA 2BZCA 1H8SA 4GP8B 1F4AA 2MPAH 3SE8H 4XBPA 3UAEA 1J5HA 3UBGA 4DO4A 3HC4H 4FLHA 3VXMA 2MWCA 3OC5A 2ZYHA 1SLVA 4G8GA 2H6OA 1CGXA 4G71B 2Y5EA 4HPOH 5GRUL 4HWUA 2BSSA 3TWCH 5I0ZA 4ZTPH 3BAIA 4AQ8C 1E8ZA 4IGBA 3HB3C 1OHZA 5IG7B 2R39A 3FT4A 3MLSH 3RFRA 4PY7A 1JF1B 1CF8L 1RUAL 4BE6A 4UT7L 1CXKA 5HBBA 4KRMB 3IDYB 1V54B 4WEBL 4AYDC 4X80H 2CO3A 2P46B 3P77A 5DD5L 4DP0X 1G1CA 1Q0EA 5LQBL 4HC1L 5DI8A 4HUUB 1CLYH 4R3SB 3MRMA 5FK9B 3U0TB 1E4XH 2EDMA 5AOLA 1K72A 1K4CA 1NFIA 4FQIH 2R7EA 4PS7A 4FQCL 2Z4QB 2G5BA 4YHLL 1Z9LA 3X12B 2QPUA 2VZ3A 1F1DA 4G9FD 3QG6B 4KMQA 5IOPA 3PWNB 3S97C 2AXFA 3OKMB 3VX1A 3BKMH 3EXLA 3CC5B 2F7PA 1BLNA 5FM8A 1BJ8A 3VMPA 4GG6A 4OF5A 1S9XB 3CDZA 1EEZB 1J87A 4QWWD 3TBWB 5L2JB 1HINL 5L6YH 4XXDB 4IU2A 1LK3H 2D9CA 4X6DB 3GPEA 4ZFGH 4NJAL 5HDBF 1UG9A 2P47B 5IREA 2NY2D 3VNZA 3K2IA 4AG4H 3MBED 1RP9A 1AKPA 1BGXH 1FYTA 4JDTL 2VABB 1NDGB 1MHEA 3PQYD 2ENQA 4JKMA 5T3ZE 1E8YA 1MWAB 1EHLL 1YCSA 2N0MA 2Y7MA 1URIA 1CXIA 1Z5HA 2W38A 2EP6A 4FC3E 1F4WH 3FTXA 1ZLDA 2N7SA 2BPBA 2PWDA 4P99A 2HT2C 1U91B 2GCYA 3CQQA 5KBPA 4U6HB 1Z5YD 3QIBC 3B83A 1SMDA 4CUCA 4GEJA 2EDJA 3PF2A 4J3OH 4A7TA 1MNUH 4W9LC 4TKWA 4K7FB 4KRNA 3ZKQD 1VB9A 3B7YA 1L3WA 2VR3A 1E5YA 1TMCB 4M6ML 5GRWA 2VN4A 3VXSE 2WO4A 1PU0A 5HHOB 1Z9OA 3U4KA 2NY6D 2F54D 4MB5A 3D0AA 3KL5A 4OCXH 2OTWB 3EOAA 1A6WH 1JP5A 4EVNA 1UURA 1QUNA 2V9UA 3PNWA 2F1AA 1UM4H 1N6VA 4JFPB 5FYJU 4TSBL 3NSDA 5F9WC 2XOTA 4X0NA 4LNRA 4O2FB 1RZ7H 3KXFD 3NJXA 2WQ8A 1UGNA 4XMWA 2FX7H 2VJXA 3GHEL 3WUWA 1XR8B 3B3IB 5IW1A 5JPNC 1YNTA 3OKLB 5EUKA 4E9TA 1P7HL 4MAYB 2X10A 1U3HD 1WK0A 2OJEB 3GZKA 1OP9A 2ZYRA 2EEXA 2JJSA 3IFNL 4FYTA 1KPVA 3U82B 1AHKA 3ZMEA 2YA1A 3X1GA 3CMGA 4G72B 2WTRA 1YECL 2LQRA 4HG4J 3WKPA 4ZW8A 4ODBD 3O81A 5C0BE 4ABVA 1SHMA 1GCYA 1R3JB 1NL0L 3TA4D 2NMSA 1XH1A 3KPSD 3DBSA 1NWPA 2ITCB 5JA8B 1PZAA 3EADA 3D08A 2K7PA 5GSVB 4AM0Q 4FAAB 1G7JB 4X9BA 3RWEA 1H6EA 3QJZA 4P5TC 1I85A 1WWAX 3QQDB 1GJWA 3TO2B 4ORGA 4ZQKB 3VCLA 4HIPA 4MMXB 1R3IH 1FLTX 5JOFB 1CFSA 1E4KA 1OAZH 4HX1B 2DM4A 3QJRB 4XCCH 4OZGA 5KJ4A 1XQ4A 1Q9OA 1YDPA 1U8OB 4W9JC 4K3JH 4TLUA 5IMMB 3RB5A 4LSVH 5KTEH 2WO3B 4R5TA 1TLMA 1KPRB 4LRNL 5HYFA 3OLIA 3OV6A 4R90H 2AXHA 4YDJB 2HMID 4YHYC 4IBYA 5FA3A 3SOBL 4GG6E 2PXYA 1WWWX 5DMIL 1L9OA 1PG7W 3JUYA 1U8JB 4FL4B 3OKEB 1LEGB 3PJLA 4UB0L 4WI6A 4P2CG 3ZLQC 5KVEE 1A02N 5F7AA 5T8IA 4E5XB 4JQIH 2BS71 2WZ0A 4XVTL 4MZIA 1JV5B 5G5DA 1Y07A 3DVGA 2VWEE 3QFJA 4ZMPA 5C0JB 5C0ND 1BF8A 4R0LC 4EE2A 1NLBL 1LJMA 4X6DF 4A7GA 5DF0A 4NHUB 1WAAF 2HLAB 4U0RB 3FFCB 4H26B 2KZ1B 1HE7A 4C4BA 1DHKA 1QR1B 5GIRA 5A2LH 1BOGB 1F42A 1CS6A 1A1MB 1RSFA 1YO4A 3ARXA 3CUPA 1N6UA 4G8IB 3VFSB 4APQA 1NIDA 1YEKL 2PPEA 3EUUA 3L81A 5EZLA 3WI9A 4DAGH 4NKMB 1GOGA 1ID2A 4OD2B 1UT1A 1XCTB 3X11B 3FQRA 4W4OC 1RUMH 1MCJA 2AHIA 4BFKA 2OYPA 1N70A 5CR1A 4YX2L 5L9DH 1DO5A 4YZFF 4F58H 3WTWA 4R84A 3PRZA 1CL7I 2B1OA 2KT6A 2DQIH 1E3FA 4PGDB 1QEWB 4G11A 1ND0A 1OARH 2CXKA 5E1AB 3DURB 4WFGD 5CEYA 4QCIB 3SKMA 5I15H 4C56B 1G6RL 2PW2B 2YN5A 5KYYB 2IH9A 2OI9B 4Z95H 3WKYA 4JFSA 2O6DA 4EDXB 1KCSH 3QCVH 1AGCA 2WCGA 2FCBA 4GUCA 2FZ3B 1U8QA 1R17A 4XPFH 3NN8B 5FYKH 3U4EA 1IGYB 4URTB 3AQXA 1Z1WA 4JQXA 1GC1L 3MLXL 2Y25A 2DLHA 1I1YB 3RBSA 2PWFA 1XT5A 4V1DA 2MCAA 4DEPC 4R7DB 2A9AA 3QISA 1KGWA 2A9ML 4HJTA 1AO7E 1R34A 3SYPA 3SD2A 3C08L 5BUAA 2JB6A 1OD9A 3O4LA 2ZKMX 5JIPA 3BT0A 3EBIA 4P59H 5IHUL 1XIWC 3C6LB 2YUWA 2UZIH 3Q5TA 4I3SH 4UI2A 3DX6A 2UXGA 5DSCA 3MA7A 2CKBL 1CR9L 4D7PA 3EJSA 1IC7H 1MCDA 3SDAC 3U1SL 3I2CH 5KVDL 5TF1L 3HE7A 1CE1L 3K72B 4OLXL 1OALA 2YGOA 3WJMB 2H6PB 1D7BA 1EEYB 1HAWA 1FLRH 2V8LA 5AZEL 3QWNA 4U3SA 1DSFH 3ZRSA 4WF7A 5AYQA 4PRNB 1EMTH 5DEJA 2UWEE 4N3UA 4JAMA 3ENEA 1P5VA 1S7QB 2R29H 1P7QD 1X4YA 2GSGA 3ARQA 3FMGL 2V17H 4DOHB 4M7ZC 3DECA 2ICWJ 1FL5A 4HS6A 4KUCF 5EU6D 2AGJH 1WO2A 3GFUA 4PSRA 4G8FA 3S96B 4NQXB 2BRRL 4E0RB 4YPJA 4HZAA 4WSGA 3LB6C 2AZUA 3Q5YA 1J1PH 5F9AC 4NQSB 2V9QA 1SNRA 4EQ2A 3V7MA 2N7BA 4KH2A 2JIXD 4DKFL 1PX4A 2BIQA 3NRPA 4O51A 4NM4H 1QRNA 4PRID 1FGNL 3PIQB 4TVPH 2A6KA 3WELA 3O2VL 4TMPA 2WV3A 3MRKB 2VZ1A 3D39A 3L1GA 4KO9A 2O5ZL 2FJUB 4WK0B 1RHHA 2Q7YA 4G42B 2H32B 3GSRA 1B0GB 4FQPA 4M93C 4Y1AE 1G0DA 5AW4B 3R19A 2UUDK 2ZXQA 3P30H 3FO1B 1KN4L 4RRPM 3E8UH 4N2DA 4OF6A 1QWHA 1ZLVH 1WS8A 1FNSH 1MHHA 3VRJA 4FD0A 3ET9F 1MHCB 2QSCH 1JGVH 3QUMA 3NCBB 4F8PA 5ANMB 3QDGE 5E8NA 4EZJA 5IJVA 2NXZC 3RZCA 1P7KB 1W6LA 1D6VH 3RWHB 3AACA 3TVMC 1I7RA 4U1MB 4MRBA 1ZANH 5TDNB 1QZNA 1PZDA 5LBSA 4XWGH 1TMQA 4GMTH 4DKEL 2HFGL 2BXZA 1E43A 3BP4B 3QHFH 4YBLB 2YBRB 2DYPD 4X99B 4KZEL 1OT1A 2JXMA 2BHZA 1DEEB 1NIBA 1TNNA 2B5IB 3EF7A 2F58L 5D1ZI 1W0YT 5KJ7E 1J86A 4PGJA 2F5AH 1H15A 3L1FA 5K93A 4TPRL 4NUJB 4O5LH 2ZKYA 4JM4L 3MLRL 3MC0A 1GH7A 4EIZC 5KW9H 5CINL 1U21A 2AK4D 5F71A 5MHSD 2V2XB 3FU5A 3CK0L 1KTBA 5DVLA 1R5VB 4PRPB 3SBRA 5C3IA 3MLPA 2W60A 2XQBH 4XAKD 5TH2B 3UCRA 3HZKB 1MHPL 2DPKA 3II1A 1A6UH 1J8SA 3WGUB 5KANI 2VITB 2EO1A 1OCWH 4KKAD 4MXQD 3VWKB 2B59B 3D30A 4P2OD 3SDDD 3ZYZA 3V8CA 1A3ZA 2RB8A 3F04A 4R2GD 2OMBA 2GTWA 5E5RB 2D2CC 2C3XA 1AZCA 5EPMB 5EOCH 1UYWL 5F8RC 3ZMNA 4PWKA 2GW5A 5E2WH 4NQVB 1JGLL 2A6IA 4N25A 2ZP0T 1KJ2H 4RFNB 3GMPB 4HQQH 2W65B 3VSTA 2HN7A 3LD8B 3LKQA 5FKAA 2BWQA 3L5WB 3P0GB 4ONGL 5JZ7C 2BHFA 2WWNA 4PRAA 1G7IB 3O9WD 4K5OA 4CDGC 4D3CH 1L9PA 3CVIH 3ZL1A 4MMYB 4LAQL 3NABH 1WZAA 4S10A 3ZE2E 3BZFB 1CURA 4AYBA 5HYJA 3CBKB 3IXTA 3ZKND 1N3NA 5DTFB 1GKOA 3S98A 4AH2B 2MQCA 4Y16A 2UV3A 4XXCC 5JPMB 1LNUB 4PTTA 1FE8H 3MREB 1Y18A 4JRFA 3CZFB 4B50A 1WA0X 4O4YL 1PZUB 3D39E 1CGVA 5EC1B 3C8DA 2QGCA 1R46A 4XE0A 3NPSB 1URZA 1HILA 4Y19D 1RK0A 3ARFC 1MCOL 3EFDH 1I3GL 3B2UD 1MCKA 1BBJA 3NIGB 4KXCA 2CRZA 3SDCD 2NNRA 2YA0A 4P46C 4GT7A 2VDMH 1G6RB 3WNIA 5EC2B 3NAAH 3QXAB 5ICXA 2C7UA 3SE6A 3ZTEA 5M7QA 3BXNB 2D3NA 1A9BB 1JHLH 3VI4A 1ED3A 4OFPA 3W9EB 1ZV2A 3MRRB 3JT0A 3N3EA 3PHAA 4RCAA 3HRZA 4JO4H 3QGVA 3PREA 3HUJA 4GSDL 1T2QL 1Q4NX 2CWRA 5LGJA 1CDIA 3ALXA 3H7LA 5I6MA 2FHCA 1P4IL 1XF5B 4L9LB 3O0RL 4XNQB 4RGOH 4NQDD 3ZDXE 1OPGL 4YFLF 4BINA 1UJ3A 2DBLL 4J3SA 1YEHL 4I77H 2X0WA 1CVSC 3HZYA 4WI3A 1F3JA 3BH9B 3LSOA 4X6CB 3G08A 3JWDL 2BVQB 1EGJH 4LPCA 1INEL 4LOFA 5ECJE 1XGQB 4IRSC 4OF8A 1SMAA 1VPOL 2CKBB 4PJ5E 2ZUWA 2FX9L 4RA0C 4IOSD 3EJYD 3O6KL 4R8WH 1BMZA 5DT1H 3OMAB 4IKLA 3T0VA 4YSTA 2CRMA 4JRXB 2K9FB 4S1DC 3AG1B 1DQVA 4XNAA 5BPPA 3OF6D 4POUB 4Y2DC 5CILH 2VDKB 2ZOLB 3SJVE 2C9QA 3UP1A 3BP6A 3U7YL 3O6FB 4XP4H 1XSIA 1E27A 2X05A 1WRFA 1J12A 3IMTA 3EH5B 4GMSL 4NDMB 2BSRB 1A9VA 3FUJA 1ZT7A 4PIBA 3ZHLA 2Z31B 3M7OA 2V0AA 4FX5A 5IQ9A 4QRUA 3Q8BA 2G3MA 2PN5A 3G6JB 2O6CA 4BFRA 5EULV 3HG5A 3QUYC 5DD0H 3BSZH 4OJFH 1EEQA 5EOTB 4FFYL 2NX5B 2JB5H 4P3WA 4PJIB 3SDXB 2CHZA 5JMOC 1PJ9A 3KPOB 1BFOA 5FF6B 4E9YA 1XF2B 2R0KH 4A67A 7CGTA 4G80B 4UBDC 1P5UB 3MV9B 4NO0B 4MNGA 4K23H 3BP7B 4XNZC 1S9KC 3JWNC 5DRWA 5IQMA 4WAFA 4NEHB 2X88A 1MI5D 5HYJE 5L7XL 3LZQA 3NMEA 4NI3A 5BO1H 3B2XA 1FVEA 2P1YA 3P40A 4QRQB 6PCYA 3D48R 4OLUH 2FO4B 5FO9A 3WNKA 1CYXA 2FTAA 4LLUA 1L4IA 2X7LA 3LRHA 5IEKA 1UXSA 3M7FB 1NCCL 4OTXL 3JVGA 1WWCA 2KZKA 2RALA 4JFTA 3IFLL 1C7SA 5AAMA 2Q9OA 3MROA 4HUWA 2GJJA 4M5YL 1YY8B 2KKQA 3H42L 3BQUA 4YAQA 4A2EA 1Y7VA 5C0AB 1DVFB 2Z6FA 3V6OC 2PCFB 3MNWA 3QNYA 1A6VL 5FWRA 2AFNA 4FLRA 1L9NA 3ZZQA 4G8AC 2W9DH 2X6AA 1PKQB 4I2XE 3BWAB 4RRPG 3KBFA 3BPCB 4GRWE 3NJMA 2E74C 3NIGF 5J8OA 3L45A 2YEZA 4DP7X 5IB4A 2XY1A 3Q9PA 4U3XA 1VLXA 2BOCA 3TYFA 5DHMC 3VI4E 4A68A 4O00A 1SYSA 3VGBA 2E7HA 4JN2B 4X9YA 4PB9L 8FABA 3ESPA 1UCBH 4FI6A 3DGGB 4IRZH 1XGRB 3CPUA 5HGBA 1VIWA 4IHOA 4PJCA 4NCDA 4C57C 1EFXB 2K8MA 4OF0A 5DQ9B 1BZ7B 3UBXB 1N0XL 1TQCB 5DD6A 3FAWA 5GS1B 1SVBA 3LKPB 2KDGA 1A65A 4GXFA 5TE6L 4F9LC 2JELH 3IDYC 3RI5K 1I1AB 4OVUA 4NQEB 4D0CB 3L7FA 2CALA 1VFBB 4PIRF 4AQEA 4GFXA 4UOJA 4HAFA 2D0FA 4I0PA 1IBZA 2BNQD 4JRYD 2QQLH 1JWSA 3WSQL 3EBGA 3LQAH 3Q6FB 1WAEA 1CLVA 5I30H 1X5LA 1MH5A 2OL3A 4R83A 4UMGA 2FD6H 3E1F1 4OZFG 1G9EA 1MFDH 4D9LL 4FABL 3STZB 5C1MB 1ZS8B 4DN4H 1T7YA 3I6LE 3WEAA 1DP0A 5ESQB 3IE4A 1I9IH 3VA6A 3QIUA 1W8EA 1DBKL 2JJVA 1PEWA 1UZGA 4ZD3L 4U05A 3RWIB 1XB6A 1QO3A 3F5WA 2VLRE 2P49B 4KVNL 3DARA 4GAJL 4UTAA 3GHBH 3JWNH 3C9NB 4I85A 2ZSWB 1RUPL 5KOVC 1LO4L 2IBZX 4LIQE 4QY8B 3BO8A 5F89B 1LP9B 2X3AA 1TJIH 2A9CA 4UUJA 2WMPA 3Q7JA 3O6ML 4OCRL 1VGKB 2KZBA 4BZ2A 3FCGA 1BA9A 1CPUA 3ELAT 5ID0B 1EHNA 1JZDC 3WNOA 3QK0A 4MB4A 4OCSL 3ORJA 4FXKC 2J88H 4PJIF 3SDXF 5CEXB 5MEOA 2QPEB 4LPYA 3ULVD 1QSFB 5T1JA 1YQ2A 2X89A 3MGOA 5IBTH 3DIFA 4FQJH 4FJZA 1F4HA 3QUZB 3VFMA 3UH8A 5GZNA 4H20H 4LOUD 4FFZH 4OW6A 4M03A 4GPVA 4Y4KD 1XF4A 5E4IA 3TASA 4Q56A 5DMGD 3K80A 2CA3A 4HMCA 4AKQA 1IEBA 3RVTC 2XTJD 1MEXL 3NUKA 2X4RA 4LSSL 2VSDA 2W07A 4KKLD 4MA7L 4FZ8L 1YMMB 4N0RA 3FSZA 3QJFA 1S7SA 1B2WH 3KYMB 5KZCB 3QR0A 4G59C 2ZKXA 5KAQG 1ZIAA 4FKKA 2XV0A 4X9GA 3LS5H 3DXAA 3BLBA 4KWUA 2OZ4H 3MUZ1 4GQPH 4FA7B 3TEZA 7PCYA 1TENA 1OCZB 4FG6C 5F9JA 5I71B 3HHSB 3U46A 4AEIH 3UAJA 1D5MB 4DUVA 2VQ1A 5T3XL 3RILA 3LIZH 5CD3A 3IXAA 5B7FA 4GXVL 2L0DA 2HWZH 3CWGA 1P2CA 1G4MA 3V6FB 3RIKA 1NGYB 3TCXA 3CHQA 2ZWYA 3EO0A 2EDXA 4PJCE 4S0TD 4HJJH 5DFWH 4ZJ9A 4OGZA 1AIFB 4PR5B 3UTTA 2YD6A 3W0WA 1P4BH 4PMEA 4BUQA 2EC8A 4PS4H 4X0KA 2WZPD 5HHPA 4R9HA 3BRGC 4FI8A 4Y5XA 1ADWA 3I9PA 1S3KH 3MACH 2FIKB 5TE7H 4IKJA 4DVBA 2ZNXA 3BSGA 2HH0H 1F4XL 2G0KA 3FUDA 3QHZH 3G5YB 5GZOA 4YHZH 2YPKB 3MZGB 1G6VK 1R24B 5KVFE 4AQ1C 5D1QE 1EUTA 4J8RA 4F80A 4ZO6A 2VR6A 1CF1A 2FEDC 2CA4A 2JKNA 1M7XA 3DV4A 3HPJA 2DMBA 3N91A 2AJUH 4PV9A 4PGEA 3E38A 4GKLA 1OCRB 4L3EE 2GJ6B 1V8HA 3ARBD 4HZLB 4JW3A 4LQ1A 2XIIA 1YN6B 4HWZA 4M7LH 5CLWA 4IMKA 4JG9A 4RFOH 5TQ2H 3V5KA 1E50A 1OB0A 2Y6SC 5GGTL 5DO2C 4BE5A 3D2UD 3GBNH 3V0VB 5AUMA 2EVJA 3LNFA 2B3IA 3GSXA 3GYRA 3WS6A 5J11C 1JZ7A 3U7AA 3ZRCC 2FBJL 5I26A 2FK9A 1M7DB 3C87A 4JG1H 2A38A 1MCNA 3W2DL 1E28B 4MDJA 1FIGL 1TZ8A 4OLWH 4BH8B 3NCMA 4GRMB 3CVDA 3LH9A 4NS0A 2FH6A 4HF5H 3MXWH 3U6RA 1GYAA 4G6JH 3VQ2C 4I18C 3QEQB 5ID1A 3LNDA 4IOFC 3MTXA 2NUTA 4NXSA 4NQCB 1H6UA 1M6OA 3G3LA 4W6YB 3EFOB 5DFTA 4DFIA 1IBDA 4GBXB 4L4VA 4HWBL 3Q8AA 1MXDA 1I1CA 3KDMA 4KPHH 4JCLA 3VJ6B 1EJ8A 1MG2C 1U8MB 3ZHNA 5F0PB 3D12B 1PQZA 1LO2H 3NCCB 1ZVSB 2P43B 3PJNA 4K5MA 3RWDB 2QDWA 3VD9A 5AALA 3MCKA 5AW9B 5AENA 3S48A 1M2VA 1A4AA 4LGRB 4HSQA 1QNZL 4HXBH 2VXUL 1NFKA 4BHUI 2LVEA 2E8YA 1RV6X 2Y07H 3HR5B 1IGJA 3B6SB 2XRAL 1OEZW 1QEXA 3TF4A 2MPVA 1R5IA 3ARED 1HHIB 3DWTA 2E47A 4Y4HB 5C3TA 4CKVX 2CPUA 1G4RA 3HZVB 4NIKB 1A0QL 1WBXB 3UZVA 4MS6A 5EOQH 2ZCKL 3KPRA 3KPLA 2VXTH 4MJ6A 1QHPA 4K07A 2Y1VA 5EUOE 1DUYA 2XWRA 3PHOA 1XEUA 4P2RB 4P5MB 5LO7A 5FO7A 1UWGH 3DMMB 3EJJX 3L3IB 2XTSA 3L5JA 2NXYB 4XVUD 1ITBB 1PNDA 3A0OA 3C6LC 1JXFA 1GR7A 5C0GB 1JPGA 3SY0B 3TBVB 4LPUA 3H0TB 4WRLA 3RVXD 1GZQA 2WJ5A 1NEUA 2NYYD 4ICWA 3UTTE 1S5IL 2AEPL 4YR6B 1YZZA 3W0WE 5I24A 3GRWH 5SX5K 1ZT4B 5D2LB 4MQSB 5T5FA 4AW4A 3VFPA 1A1NA 3EYVB 3BWSA 4L8SB 4LCUB 1F2XK 2IPTL 3OZ9L 2LAGB 1JMZA 4JY4B 1ZDQA 4FFTA 3QIBA 3LKNA 3G6DL 1T0OA 4A7UA 5CM1A 2XFXB 4JQIA 2EYTA 3I9GH 4Q89A 1UM6H 4X4YA 3QUXD 4KX9A 4OIIH 3CDGA 1XO8A 4KK6D 4DK3A 3NEXA 1AFVL 4R7XA 1EJ6A 1U8CB 2NUPA 1IGIH 4N2AA 3LN4B 3VXTB 2R2EA 1BAFH 3LQZA 3PGDA 4BCXA 4JFQA 4N85A 5KSBA 2UYLB 1MVUB 3AS3A 4YHPA 4HJGA 2AZAA 4RISL 2APVA 1G1OA 3H9ZA 1ACXA 2X2JA 4QRTB 2B16A 1QFUH 5F9OH 2CZNA 2R4SH 4CDHA 3W39A 3N1FC 1GYWA 4GIAA 1T2XA 4XI5D 4Z7AA 5C2UB 4XPBL 2X4OB 2E8ZA 3C5JA 1ETB1 1JFHA 1F58L 3L5XH 5JPNA 4Z0BL 3ZDZE 1YEDA 3QFGA 5C0EA 1ZHLB 4KKZA 5GRUH 4QRRA 3U2SB 3T0AA 2F2HA 3QDJB 4RESB 1IJNA 4NZUH 4CMMA 1AJ7L 5D93C 5ACZB 4HA1A 3ZBMA 1EZVY 3SKOA 4QT5B 3UO1H 3DDFA 4KTYA 4XP6L 3V4LA 1IBHA 1CF8H 4H1LB 1FIEA 1LTXA 1OB1B 3RWFB 4WEBH 3AXLA 1S5HA 3P2BA 2YSTA 4W9FC 4M8VA 5DD5H 5LQBH 3TEUA 5E99L 1HZLA 5H2BA 3H1ZA 3VFUA 4JCWA 4P5TA 4FYSA 5CGMA 3GJFH 3OKOB 4OY9A 1BM3H 3SCMB 1A7QL 2VR7A 1H8LA 5AKRA 3NG5A 4ODHL 3HI1A 2EDOA 2VC2H 2DQ6A 3KPRE 3FB8B 5G4OA 4M43H 2Q76B 2XZCL 4TXVB 4F7MB 5HGDA 3DK2A 1XD1A 2A77L 3IN2A 1M9WA 1HL9A 1HINH 3UJJH 5EIIA 1RIHL 5EU5A 4YDVB 4LHUD 1J0JA 4JJ5B 3ELQA 1I8KB 4TTDC 4XMXA 4RQQA 4EI5D 4TUJA 1KXQE 4OLYL 2JKJA 3ZE1E 2XY2A 2J8UE 4JDTH 2HFTA 3KVQA 1QABA 4MJID 1TQUA 3UABA 4MX7A 4YLQT 2R29A 5FGCE 4YLCA 4R0LA 1G84A 2DLIA 3A6BL 3TNMB 3I6GA 3D4CA 3V10A 4JKPH 2BVPA 3IU4H 1X3DA 4E42B 4L8CA 3TNNB 1TEYA 5FLVA 1M7UA 4RZKA 5I1KL 5CEZH 3IFPB 1IC0A 3LRGA 4RFNC 5D7IE 1A6PA 1NC4D 1VACA 2ZKHH 5HHME 3LD8C 4X98A 5KBKA 5D2LF 4MRCA 1Z3RA 1MOEA 4ZMTA 4FYQA 4AGQA 3HC3L 1UXLA 1E2WA 3EYQD 4M6MH 2XN0A 4W4OA 4YEFA 4FQLL 4GSQA 2IBGA 3LV3B 2WKLA 5A16A 3S37X 3PDDA 3D3VB 4DCQB 4QHLB 3QQ9C 5D8JL 3F12A 1DE4A 3D0LB 2CQVA 3ARUA 1A7PL 5IB2B 4P23B 3L4WA 4OV6F 3DX4A 2WUBL 3CJJA 4OT1H 5I66A 4PJ8C 2YIHA 4GUPA 3K8LA 3RG1C 3TT3L 4TSBH 4IBZA 4FNQA 4Q0XL 4U1SA 1WLHA 2OM5A 3MRHB 5MEPA 4JLRB 2BOBB 5I1IL 3SGJC 3QPQC 4WJ5B 1XGYL 2AJZA 4WSKA 1PG7X 1M05A 4N4YB 5T1DL 4DK5A 2R1WA 1W72B 2VLKE 4TQEL 3MLYL 1H0DB 2AKRA 1LK2A 4B9JA 1RHFA 1JXJA 4HUXB 3IFNH 5FOBA 3H9SE 3KWTA 4Q9RH 1YEEL 1YNLH 2APWA 3OHXB 3FQNB 1YNKL 4GAGH 1T0NB 1THCA 4LDCA 1CFTA 1YN7B 3BIBX 1ETZA 2EVGA 1FZMA 2E7DA 3PWLA 5F88A 4LKXA 2KI6A 1BECA 1WD8A 1KXVC 1NL0H 2ATKB 3AAZB 1XIWA 2C3WA 3BJ91 4BQBA 5HPMB 2I9LB 4L9LC 4PJBB 1GC1C 4QYOB 5JA9A 2OMYA 1OAXH 1AKJA 5FYKE 4HS3A 3SDAA 1FORL 3VXMD 2CJUL 4G8GD 1YJDL 2AJXH 4QTIH 4R97C 3QCUH 1FF5A 1X7TA 2TSBA 4RGNB 5DYFA 4M8QB 4FHJA 2ZICA 1MVFA 2E7BA 5ITBH 5DVMA 4BKTC 2HLEB 4IGBD 2X1QA 1MFBH 2MFNA 2WNGA 2A0LC 3FKUS 4EIUA 1MUJB 4WWKA 2DEWX 3KLQA 1SN0A 1GZHC 1JFQL 2WXPA 3TF7C 3SOBH 4Q4EA 4DT2A 2XN9B 4L29B 2JI3A 1KIRB 4HJUA 2MOVA 5DHDA 1KTKE 2O4EA 4QHUB 4OCNC 5DEGA 1KYOJ 4ODVL 2EEDA 1S8DA 1BD2B 3DTDA 4D8PA 4OD1H 4DIXA 1DDHB 3W82A 5D96B 5IK3A 4Z3GA 4M6OL 1EXUB 2QPDB 4PG9A 1ZPUA 2AEWA 1DJWA 3NFNB 1BQUA 1KPUB 3KE0A 2C4FU 1KJ2A 2CJSA 5D7LB 3WFEL 4JFDA 1KY6A 1E9OB 1TCRA 2J1YA 2P5ED 2GEQA 1I7UA 4ZUUA 4U4IA 4CNIA 1DFXA 4PY8J 5T1KA 2VLME 4NRZB 3LKRA 3QVAA 4GNKB 1IAIL 3VO0A 3MFGB 1HWGB 4KRPB 3H4FA 1F3RB 4PW4A 4JHWH 4GINA 5GGVL 2E7LC 5E0QA 4IRJB 3E9UA 1RFDL 3DPBA 1F3DJ 4X7TB 1WFOA 5ABAA 1FYTD 4R7LA 5E6ZA 1C5DA 1KJ3L 2PPDA 1DQML 2OSWA 3GXMA 4F37K 4MA8L 6FABL 1FC1A 1OTUC 3BP5B 3MODH 4CBZA 2IANA 3OR6B 1NCBH 1S9VA 1W0VA 1B3IA 1HHJB 4TVPE 4G83A 3VXNA 1YEWA 1A47A 4ADGA 2H6UA 4NPYB 3BN9D 3WFHB 4BKLA 3TVMA 3ZTNL 2APFA 2CSPA 4JFHE 4MJ2A 1Z5LA 3R06A 4G7QB 4PJDB 1E6JL 1TZOA 3UCQA 3UERA 1E9PA 2Y6TE 4MYWB 5E4EC 2BVUA 4HUVA 4HKJB 3UYRL 3D2TA 1X5ZA 2ZZUT 3L3KA 4BK4A 1NDTA 2F61A 3O45A 2NT1A 4X5WA 1DVFC 2QVKA 4MB3A 3ZHFA 3MQIA 1GC1H 3UTSE 3MLXH 4WK2B 4I48B 4DO5A 1R5WA 3ZTJG 3BW9B 3BPNB 1SBBA 4QYAA 2KLRA 1BX2A 2ZUQB 4GLRH 1NAMA 3F83A 3QYMA 3HFML 1DCEA 5FW6A 3C08H 1FUNA 4W6WB 3EXJA 1JZIA 4K71C 3KVDD 1K8DA 5IHUH 3QUGA 2CHDA 3FO0L 3TA3C 3MRLB 4ZFFA 5EZIL 5AAPA 3WXVL 1T21A 3LZOA 3CFCL 1OGTA 2NW2A 2PP9A 3QO0B 4Y2NA 2FE0A 3U1SH 3NCFB 4DKDC 3KZ8A 5TF1H 3D85B 5CHNA 4M02A 3FZUC 1EGJA 4OLXH 5D71L 4PV8B 2R1XA 4NRXA 3OPZL 3QI9B 5AZEH 3INUL 4LVOC 3OAUL 3WMPA 1TQCC 3ABZA 3S3JA 1UADC 5DVOA 4PJBF 2YC1A 4YHNB 2VMDA 2HUEA 1CT8B 2JTDA 5EZJB 5BVJA 4YFLI 3FMGH 3EO9H 5A6LA 1C5CL 2PW1A 3B7SA 2NZIA 3GMNB 4OJCA 4LQFL 3MV8A 4I4WA 4TS6A 5K1NA 4PVMA 4UCFA 2NSMA 2R69A 5D4HA 4UM9D 1IKOP 5D7EA 2G9HB 1VFOA 4PVBA 4AEHL 3KLAB 4ZUWB 4AIZB 3U1PA 3AW5A 1ZMYA 1M1XB 1AGFA 1VFUA 2CIKA 4NBXB 4YGAB 2YPLA 5FA4A 5FIEA 4XXCA 5C86A 3BSZA 3FOMB 4L1DA 5LNGA 3RVWC 4QRSB 2O5ZH 2D3VA 4P23A 4IOIA 1ZHKA 3FB5B 4UNTA 1L9SA 3QQ3B 4X6EA 4EN3D 2QMKA 3LNGA 2LT9A 2EDTA 3TTYA 2PXYD 1KLFA 1IVTA 2JI2A 3C5ZD 3O3EA 4KTDH 2B7DT 3ARFA 2VCOA 1MW2A 4EI0A 3O3DB 4WFFD 3VFTB 2P80D 1BF2A 1AI1L 2WLJA 3QFJD 2LLNA 4LKCB 2EIEA 4P46A 4XZ4A 2VLJB 2ZUTA 4FZEL 3PNRB 4NENB 3GJEA 2XPGB 5DR5H 2CUIA 1SUJA 4HUXA 2QFPA 3BIKA 4WCYL 1AXSB 1CFQB 4HDIB 3OHXA 4G7VH 4L1SA 4DKEH 2HFGH 4AXWB 5D70L 4APQD 5D5MA 3UJIL 4P3DA 3NSCA 3LRMA 5DXWA 3VNYA 4XX1G 4AZ8B 3R8QA 1MFCL 4W81A 3TBYA 2EYRA 5E2VL 3EYUL 4Q6IC 2DB8A 2F58H 2Y7LA 4UQAA 5AVRB 2R15A 2F7QA 4X5XB 4PJDF 1HYSD 2UZXA 4W68A 5IFJA 4J3VA 5HJ3B 4FYRA 2KDYA 3GUTA 4P4RA 4TPRH 1CK0H 4HKBA 1IU1A 1OAQH 4QKTA 3RURA 4JM4H 2AV7B 3MLRH 5C9KA 1KCUL 3QJSB 5FYKU 3VGAB 1J5OL 5C0FA 3CK0H 4IDJL 1H9DA 3NA4A 5F7UA 1CXFA 1LE5B 2Y7SA 3VMOA 1NCOA 2OP4H 4PUBL 4XWOC 5ENWB 4O9HL 4CSZA 5HHQA 2NTFA 2AJ3A 1MUJA 3BVTA 4IRZA 1UWEL 1MHPH 1OV8A 2VISA 4Y2DA 3VQ1C 1NCAL 4Z7IA 4L18A 5IVNA 4S11A 4AVKA 5IKCB 2EIDA 3QXUA 5I71C 1RZ8A 4D3CL 3BUYB 4LCWB 3GGWA 4TULL 5HI5D 1AZZC 2WNWA 3IDJA 1SDDA 2NSQA 3CLFH 2QR0A 4WJKB 4V1DD 3TM6A 2IPKB 5KVGL 5KYNA 2BNRA 5BRPA 1XZ0B 2HAZA 1SF3A 2N01B 1X5MA 2MOGA 1JGLH 4POYA 5AD0B 2I07A 3O4LD 3T8VA 2WXRA 2QKIB 3QUYA 5F7NC 1DQJB 3RIAF 4V2BA 1FL3B 1O5PA 4XMLL 3NIDE 5DK0A 5DVKA 5JDSA 1AYOA 4H8WL 4KXBA 5DC0A 4UM8B 3T08A 4DZ8A 4J27A 1N8ZB 3RA7L 3MV8E 4GUOA 4BCZA 3HE7D 3CN4A 4YIQB 5KUKA 3PHQB 1Z6JT 2LU5A 4PMFA 2Z35B 2QPFA 3Q44A 1U8KB 2I9TA 5HDWA 3MRIB 4FQQA 4U1HA 3U9UA 4BHUA 3HC0A 3NA9L 4EF3A 2EKSB 5J13C 4FADA 3A47A 1M6UA 2C1PB 4DGWC 2YPLE 3CBJB 4AVHA 5J9PA 5CLTA 2BMKA 4O4YH 1JF5A 1K5NA 4LSTL 4OJAA 1XHHA 1NMCB 2Z0BA 3GB7A 3L3GB 4AYMC 2CUHA 2DWXA 1K3IA 1I3GH 4ADIA 1MCRA 3BEWB 4UT9L 2BINA 2CHWA 2HLFC 2VRQA 2MTPA 4P5KA 3V6OA 2H7WA 2NY0C 2WIIA 3ZHKA 5K59F 3GLDA 1NLDH 2HXAA 1QRND 1TVBB 2ZOOA 2BCKA 4HLZH 4PM1A 4U49A 4ETQB 4ZSOE 4OZIA 2YLHA 4ZXBA 4IM8A 3VW3H 4NN7B 3WEXA 2VM9A 3FONA 5F96L 3HBGA 4FFZA 4GBXC 3CFEA 1SJXA 1AR2A 3O11A 3NK4A 3OX8B 1Z9NA 1YLBB 4M29A 4HK3N 3S6CA 4OZ4A 2G2RB 2MNJB 3Q8CA 1RLBA 4GI9A 2DBLH 5FOJA 4XVJL 3X1EA 2IGTA 3MKGA 2X4UA 4Z78A 2UVFA 2OYMA 4JR9H 4F33A 2OK0L 3CCHA 1IBYA 2QT6A 4LLMB 4KQ4L 2OXGB 4JO3L 1FPTH 1MRFL 1E6OH 4F9LA 1GKEA 1J8RA 1RSYA 5TE4L 3M8OH 1VPOH 2I24N 5JW4Q 1GL4B 2OZ4A 2N1TE 3O6KH 4NUMA 3QJOA 3BKCH 3QQ4B 5K9OB 1MCEA 5BZDB 1HAUA 2TAAA 3OXRA 4G2AA 3LIZA 4R6UA 1JN6A 3U7YH 4G43B 4NQQA 4IBUA 3LHAA 2FYVA 3FQXB 4GMSH 4U6VL 5HDBE 1ZTXL 3VFRA 2Z1PA 3TURA 4W1TA 3ZR5A 4C58B 4LT7A 2D7QA 3THMH 5DJ8A 5C70A 1WQVT 3CFUA 2F53A 4G82A 4HT1L 5BS0B 3RU8H 1XWVA 4LBEB 4XH2B 1WBZB 2J44A 1A9EB 1DBMH 4H5SB 4MASA 1QATA 3HLKA 5C07B 2FO1A 2A9BA 4XC3L 3QQNA 1RULL 1VJSA 4BJLA 4WTZG 5JHDA 1B0IA 1WZ1L 2NR6C 4L8SC 2ZXEB 3JTSB 3L4VA 3MMEA 4IKNA 3AS2A 1SHWA 3QIWA 4MA3B 1XTMA 4X83A 3UBXI 5HHNB 2DLEA 3P4LA 4FXKA 1EDQA 5AOJA 3FW6A 5IWLC 5L7XH 1NGWB 3ABMB 1QTPA 3ZOAA 4KJQD 1QA9A 1ZCRA 4D9RE 1UASA 1AXIB 4HK0B 4FERA 3RPBA 4LRIC 3WE1A 3T09A 5TF0A 2DJSA 2HRPL 5E6IA 2KZWA 3IFLH 1BYOA 1YEGH 4M5YH 4FQXB 3APDA 1TTUA 3KPNB 3H42H 2FB4L 5L2KA 2W91A 4JFEB 4XZUA 4IMLB 1TZAA 1H6FA 4ZTOL 1YHPA 1RVFL 3KGUA 2W88A 3KH3A 3QBTB 4AOFA 3BPLB 2X4NB 3IJHA 4Y16D 4N0CC 2Y5TB 4XPHL 1NQBA 43C9A 2EVFA 3WAJA 5SWZA 5MP6L 3WDHA 4MBOA 2JMRA 5H35A 3BD3A 4WO4B 5FM4A 3UBXG 2R0LL 3KW7A 3VFVB 4ZFZA 3UACA 2J4WL 2K3HA 3ZN6A 3FSOA 1N59B 1SGKA 1IGMH 1FRGL 1OWWA 1SM3L 3VFNA 1U95B 3EZJB 4XNBA 1NUDA 3RVUC 2C26A 2JCCB 5MENB 1Q94A 1E5BA 2DQFA 3LKSA 1TETL 4PCKA 3U4BL 1ZDSA 2KPNA 3GM0A 3T0EA 4TSAH 4U1IA 2NZ9D 1ZA3A 3SGKC 4QRPA 5E8PA 1ZLUH 4C4UA 4OM1L 2EC9T 3BPOB 1OP3H 4HJEA 1TZHA 1KIUB 3TJHD 5LAXB 3IT8D 1X5AA 2VDQL 1R3KA 3H56A 3PWUA 4N0FB 4LPWA 3L2LA 1TQWA 1DN0A 3PABA 5J0BA 3Q2NA 3N0AA 2DIBA 4XTRD 2ZX7A 2HA1A 2CKNA 4U1LB 3SB3A 1RY7B 4A39A 3DSFH 4AQ1A 1KYDA 3FUMA 3OKKA 2FJGB 2MSPA 5TDPB 1QACA 4L1BA 2WUCH 3NQIA 1KEML 3L9RB 5C6TL 4RAUA 3FT3A 3OKNA 4ZAKC 2ADJB 5MI0B 1DBKH 1XCQA 2CHXA 5GGUB 2VKWA 3ARZA 5DJYA 3MRPA 4ZD3H 4F92B 3OXSA 2DQHH 1O9ZA 3SPGA 2OV0A 2NLJB 3CZSA 1ES0A 3KVPA 3MLVL 4GAJH 3GRWA 3QPKA 1PLAA 4XWGL 5AW3B 4FG4A 3HBQA 1LO4H 2GJZB 3NSYA 1RJYA 5E2TL 1VA9A 4A55A 3WHXB 3WLBB 3EDJA 1SYVA 1TNMA 2QGEA 4XHQA 3BGMA 1CVRA 1GIGL 4GJTB 3NQKA 4NKDB 5E6SB 1ZLWK 4AYEC 5JHDE 3L95A 3WO3B 3CXDL 4EZLA 4FN0A 4OCSH 2WXGA 4BFOA 3UIZA 4ANKA 2WQXA 3ZKSD 4DVRH 1MCPL 3ME0A 1HNYA 4I18A 3RL2A 2MJWA 2XWZA 4PRHA 4IBTA 1FNEB 3NSXA 3MX0A 3C8KA 4YZFE 1D7DA 1G9HA 2E46A 2WSKA 4NB7A 2J43A 4N2FA 4N26A 3SKJL 1ASQA 2VDOL 1NIFA 4MJ5B 4QXUL 2R0ZL 1NDMA 1X5JA 2A6DB 4QTFA 4Z5RB 3PWJA 2UY6A 4IJ3C 4TF4A 3WTSA 5B38B 1ZK5A 3OKYA 2NNXA 2CO6A 5DRNA 2NT0A 2A73B 1GY2A 3GSQA 5HHOE 2XVKA 5IMLA 1S7UB 4PWJA 4LSSH 5HYQB 3Q5OA 5L2KE 5AEAA 3FB7B 4OQTL 2HTLD 4UZUA 5JOEA 1Y6MR 3P9LA 1CDYA 2VMJA 4GRLB 4FZ8H 4MA7H 5BOZG 1QFPA 1PY0A 5KN5B 3RUGB 3TP4A 3NZ8A 4NCC2 4YWGH 1XR9B 5C08B 4JFFA 3UTPE 4G8EA 5FO2A 1G7LA 4UIMB 3KEHA 5SWZE 1E8XA 4O58H 1I75A 1G43A 3FCBA 3JV6B 3V4PL 4ZUSA 1DLFL 4LCYA 4L23A 1I7TB 5DJAA 2CLVB 3X1NA 1XCXA 5IIEB 3BQUD 1FNGB 3BESR 2WBJA 3FCSB 3WIAA 5EEZA 2I5YL 3R7QA 1F4YL 5T3XH 5IVZB 5CBEB 3DJSA 4XBEH 3MJ9H 2EC9U 4GXVH 5FYLL 2R56H 4EZKA 1VFMA 3ZL4H 1AY1L 5EIIG 4BZ1L 4LXFA 1TZGH 3GJFA 3PL6B 4QAWA 3D05A 1IM3B 3LEXA 4TQ8A 1XTLA 1I8LC 2XWBA 4N6RB 1AR1B 4B9ZA 3RTQC 3MUUA 4UTBH 1BQHB 1OAJA 5HHVL 4K73A 3FU7A 2C3HA 4UDUB 3U36B 1GPOH 4JPWL 2YQBA 3LPGA 1BQLL 3DO3A 2P8MA 3E6FB 1BJ1J 3GMMB 2PYEB 4PRPD 1PZBA 4L48A 2XG5B 4AW7A 1CDUA 1UENA 2Q2LA 4I3GA 4EEEA 3TBTB 3AT0A 5JO5A 2D31A 3KMDA 2Y7NA 2DMKA 1WIPA 4N22A 4P9HC 1O7DC 3NTCH 4CW1B 4RMQA 4S0HA 5E7BA 1QPKA 2BW4A 2UZPA 4R96A 3BRFA 4LLVA 3V4UH 3LYRA 3WDJA 5GGTH 1IEAB 1NBYA 2CR3A 3O2WL 2YD7A 5BV7C 4I0PD 1EXGA 2I7OA 3GXUB 3I3EA 3GIZL 2CLZA 3IJ8A 3REVA 1H9VA 3NYKA 1D9KC 3R0MA 4Q6KA 2VH5L 1KIPB 2H4EA 4UOZA 1I7ZA 1FIGH 4FQXA 43CAA 4LPXA 5IVXF 2UY7B 3QIUD 3CVCA 4W9IC 3GQFA 2ADYA 2NW3A 2B77A 1DBJH 1L0QA 1IILE 4MMZC 3GSWA 1NFDF 4XOBA 3FFCE 4ZUVA 1U8PB 2C1OA 2DLTA 3HG1A 3HLAA 5C2BL 4HWBH 4LSUL 3AS1A 4PRHE 5I2IB 3QJHA 5D4QA 3SYOA 4HIHB 3ZX1A 1KEGL 2OMXA 3MJGX 3S37L 4GIPD 5E9AA 5DUPL 3IYLW 4QXGH 3VFVA 5I6KA 3BE1H 3I3DA 2F9BT 1HHGB 3EGSA 3DX7B 3NGBB 1QYGH 3PG2A 2DQGH 1ITCA 1QNZH 3H2PA 4BFBD 2BNUB 4PP2A 2H47C 2XSKA 1DQDH 5EBWB 3RY6A 3X13B 5I17B 4AM0A 2XRAH 1A1OB 1F2QA 2WXFA 4XVSL 1JZ8A 1TG8A 4U7MA 3HI6L 4C56E 2X89D 1NBZA 3BAWA 3TEYA 4QDGA 4H13C 4NNPL 5GZND 3DVFA 3QH3B 2NY2B 5F1IA 3MBEB 4JFFE 3HPLA 4B60A 4AQAB 3PQYB 1T1YA 3SD5A 3TZVB 3RUGF 4HCRL 5ADPL 2ZUQC 5INCB 4KTEH 1WUZA 1Q72L 4I7ZC 2VDQB 3O4OB 1NEPA 3T77B 4ZFOL 4FXTA 3TTSA 5IHZB 4FNPA 3AVEA 2L4OA 3QJQB 5JW3L 4P9HH 5B39B 2IADA 2JCWA 4Z7QF 3KYOA 4X6FA 2AEPH 3DXAD 4S1RL 3UG5A 2JFCA 2CD0A 3VMNA 4UAOC 1B0RA 5BV7H 2IOIA 1H3PL 4ODSL 1MLCB 3PS6A 1DANU 2NY6B 4G6KL 1IL1A 4NUGH 3UAJD 5L0QC 2F54B 2P5WA 5FECA 4ACPA 1QLEB 2QVIA 5B4MC 1OIOA 2KC0A 5K9QI 3W37A 3BGAA 3G6DH 4WDIB 4Z7VB 3IVKB 1V3KA 2MNUA 4QR7A 2PTTB 5AB1A 1F97A 3UTTD 1OKEA 1GGYA 4G7RB 2FSEA 3HJ0A 3QCTL 4ELMA 3BT2L 4N2KA 3CZUB 2Z31D 2BS9A 3KXFB 5EIQA 5GS3A 3HMXL 3WFDH 4KNSA 5DHYA 1OT2A 3JWOC 4FNTA 5GZOD 1YY9C 2DH3A 3MI6A 5DHVH 1AH1A 2A74A 1HT6A 2ZXBA 2KL6A 4PBDA 5LXGH 4NRYA 3B7RL 5JW4N 3LNHA 1OW0C 1M7IB 1U3HB 2VDRL 3HMWL 4PJ8A 5I1HL 2GEEA 2CNYA 4RISH 2ZWNA 3BKJL 3C09B 2CK2A 2HT4D 5HJDA 3FC8A 5JW4R 3ESVF 5GGRY 3RL1A 1FSKB 3TN0C 4DP2X 5IZ7A 3OAYH 1V05A 5ITFA 3ILEA 4XRCB 5K9QG 3C12A 4H1LG 3SGJA 3KPSB 5CJ8A 1F58H 4WHTB 4Z0BH 1RUKH 4K3DL 4XXWA 3HG1E 4J1UB 2YLKA 3MRDB 3UX9B 3ZK0A 3MOAL 4EUPB 4R7VA 3KYKL 3H2QA 3FTUA 2N4IA 1AG0A 3KLDA 2P44B 1ZHNB 3SPJA 4XP6H 1MCFA 2G3ZA 1H5BB 4FXGB 1XGUA 4J3OD 1FNGA 1S7TB 3N0PB 1KXVA 3VQLA 5D72L 1UQSB 4A6YH 3WE6A 5KEZA 5PAZA 5E6UB 4JHAL 1KTDB 2PO6C 5AW5B 1IQDB 1T83C 1NMAL 4H2AA 3V4PB 3VFOA 1IFRA 5E99H 2OMUA 3AUWB 3UP6A 4L4VD 1HHKA 1A3RL 1JPFA 4G5ZL 1A7QH 1PCSA 4EOWL 2DQJH 4ODHH 2CO7A 4HJSA 2V3FA 3KEDA 4AYFA 1D7FA 3ECBA 4WI4A 5CBAA 4WU7A 5KSUA 5IT2H 3E2HB 2XZCH 3ESOA 3HB3D 5FGSA 3ZKXC 3CMOL 1UACL 5AW0B 3V0WL 1U6AH 4FA8A 3EIFA 4PJFA 3BVDB 3V0IA 1OD7A 2VXQH 4XAWL 2DZEA 1KC5H 2IAMB 1YJDC 9CGTA 1IO4C 2D4DA 5IMOB 1IGFL 4XP5H 1SOKA 1NCWH 2NYZA 3MRBB 4NQED 1DQQB 1ZJBA 2WWMC 4X5QA 3M1BB 4L0PB 1OM3L 1N8OE 4OKDA 1BVZA 3CVHH 5E00B 3A6BH 1I3RA 3FT2A 1FJ1B 2N0KA 1T80A 3JWOH 1E9QA 3ZVVA 4R7NB 5I1KH 4TLTA 2W1NA 1C8PA 4KXAA 4FQ2L 2AABL 2XA8L 3X2QB 2ED7A 4OLEA 3GPSA 2A83B 2O6EA 2HG5B 2YRBA 5L4IA 4BQCA 1IZJA 4CJ0A 4JQVA 4NO2A 4FQLH 3IAQA 4TV3A 2WLZA 5E7FA 4I0KA 1HWWA 1IMHC 2VDLL 4Z6AT 1NM4A 2AXWA 4Z7VF 2P8PB 4EZMA 1HS6A 3GLZA 4X7EC 2Y1ZA 1LD9B 3FTVA 4MNQA 5HHMD 3ML8A 1LEIB 4WLCA 1MRDL 4NP9A 1B88A 4DQOL 2IJ0C 2EDFA 1WZKA 2AQ3A 2R2BB 3D52A 1IGCH 3QIBD 3DO7A 3BAXA 4XMUA 3IDNA 1KDIA 2WQUA 3T3MB 2WAQA 15C8H 5I1IH 5EBWA 3C5SB 4P2QA 1BMWA 3A21A 3L4ZA 5DZOA 2IH1A 2DQTL 3RIFF 5IB5B 4K4KA 1CN4A 3QAZB 3ZIYA 2DH2A 5LGHH 3VXOA 4W93A 3MLYH 4JZJB 3QUZD 1JZ5A 1FDLH 2GIYA 3UC2A 1R3HB 3S0PA 1NANH 4N1HB 1YEEH 4X8GA 4JANB 3VTTA 4ODXA 3NIGE 1QBLL 5IV2A 4A7SA 5KSAC 3M88A 3SDYL 3G04A 5EEYA 4U1JB 3MHZA 3NFPB 5D1XC 3E3QE 3KM1A 3QRGL 4XMKH 4MQXD 3TA3A 1RMFL 3QJXA 1IAOB 1LDSA 2IBZY 5E03A 1OXYA 1YYLH 2Z93B 3ZR6A 4A2GA 4NHCL 5EU6B 1FAIL 4WTXA 1FVDB 2D7TL 1EVUA 3ZDWA 4DUWA 3PWPA 3JVFC 4L1TA 3HHRB 2EIKB 2BIPA 5ECGA 1URLA 4QRRD 4D94A 3BEVB 5CN1A 2FHFA 5CUSH 2EYSB 3NRQA 2Q6WA 2NY7L 5EO9B 2JIXB 2N1KA 3OG4B 1A4BA 2GC4C 4NFDA 2H2SD 1MIML 4DGYL 1JHTB 2CAKA 3R1GL 3F2LA 2WVUA 1GGBL 3VGEA 3E80A 4JY5H 3CXHK 3OAZK 3EKCA 3DPDA 3FH5A 2J71A 2CBPA 4J6IA 1LO5B 1YVLA 2IQAA 3U79A 1BBDL 3S8FB 4E9QA 1ZSHA 1FVCB 5BXFB 3N41F 4PJ7B 2DL2A 2QQKH 3BHBB 4JRXE 2NDGA 5DYOB 1SEQL 4MA1C 5E0FA 4P4KC 3G5VB 4M6OH 3H85A 1YEIH 4M4RA 2ITDB 5I1AA 3CPLB 3DVNB 4RBPH 2C3VB 3K2KA 3QXVA 4DGIL 3NCJL 5ESVA 2BWIA 5FYJH 4PEEA 5F1OB 4A2FA 2XUWA 2QEJA 3BUIA 4H7VA 4NFBA 4YMPA 4QNPF 2CH8A 4AIXA 1A4KA 1IAIH 3CFKA 4J2XA 4NQUA 1U2YA 4QXTA 2DLFH 1RIUL 1ZOXA 2CK0H 1VZHA 1S7RB 4G7SB 3T0DA 2XIBA 3SPHA 2VDPB 4I3RH 1AOZA 2A1WL 5GJSH 2X53A 2NY1C 3KPMB 1G7HA 5FKPA 1KJ3H 2VDRB 3HC2A 4JG0H 4W9HC 4PJIE 3SDXE 3EGDA 4LLWB 4MA8H 5I1CL 2EVHA 4HGWA 3J07A 3IDIB 5FDYA 4BXVA 5C3LD 5KOMC 4MD4B 5DK3A 1U92B 4XOEA 4PV1C 3V0AC 3A6OA 3MV9E 1IC5H 4KMLB 2CMRH 3ZTNH 3ZZLA 3L6FB 1KV3A 3SBWC 2RIKA 1A6AA 5DMKB 4MNQE 2MQ0A 3QNFA 2P8LB 3CFDB 4YSQA 4KROC 4W9KC 5A6IA 2AK4B 1PLCA 2ZKWA 1F11A 1H3TA 3P9MB 1O7VA 1U8NB 4YGVA 3TCLB 2OSXA 3UYRH 1CGTA 2R2CA 4LF3B 5FGRA 4ZDHB 2XICA 1SEBA 4ZPVA 3V2AR 4TL5A 2CGZA 4N8VA 4Q6IA 1BVLB 4XPGL 4RIRA 5D7KE 5DD1L 1BYPA 3ETSA 3L2MA 1PYWA 2OQJA 3BPLC 3IDXL 4YJZL 1RZIB 1FV1A 4P2OB 3SDDB 4MQ7A 5ISZA 3T3MF 4C55A 4R2GB 3H6AA 3HFMH 2O72A 4F7EA 2F8XC 1OAYL 2JQMA 3FHEA 2FQGA 4K5LA 4XO3A 4BSWA 2GK0B 1F90L 4NT6B 4CADA 2FGWL 2Y3NA 3ABKB 3L1OL 4MHHI 5IESH 4RZCA 1HVXA 4IU3A 5EZIH 4KHXL 2DM2A 4GFTB 5HVHB 1ASOA 1M1SA 3EOBB 3QR1A 4YDIH 3CFCH 1SXSA 3GSOA 3KJ4B 3L3JB 4PJAA 3UFIA 2ZG1A 3MYZA 1CU4H 3FQWA 1AXTH 2IAMA 3O9WB 3IMWA 3PE9A 4MLSA 1K9TA 5D7JC 3FFDB 3T3PB 3QW9A 4U0QB 3PWPE 1U58B 2Z7ZA 1H19A 1HHHB 4HD9A 2EDRA 3MSPA 3BPOC 1QVOB 1S78D 4PYHA 5AFAA 3NVQA 1BEYL 2P3YA 4OGYH 2OMWA 1Q9KB 4HZ1A 1T03L 1C5CH 3MJ8A 1TJGL 3GMOA 3LMJH 1XIWD 3RX9A 2WLLB 4LQFH 4U6XB 4MS8C 2OTUA 3MRNA 3B4NA 4Z77B 1N67A 4MHHG 1AKJD 4OFVA 4WUUA 2HX8A 3OJDB 5HGAB 3IPEA 3SDAD 3ULVL 3MVSA 2IH3B 3B5HA 4KKQA 1FGVL 4Y19B 3WIFB 4IBVA 1DTUA 3PXLA 2NNAA 4L8BA 4S1SL 4MQTB 2G75B 4LDEB 3SDCB 1ZGLP 4DWHA 2NZ1A 4WWKD 4H8WC 1R3LA 4OZHB 4MYPA 5EU4B 5IF0A 4S1QH 3WIHL 5KBNC 4LARL 3FN3A 4WI2A 5B1KA 2VDLB 5HSFA 4YXKL 3LB6D 1JGIA 3IJSA 4B3EA 1AI1H 4NQDB 4F7CB 2AMUA 4ELKB 3N9GL 4FZEH 2FEJA 3O8XA 1GS6X 4Z76B 4AGPA 4BIKA 4U1KB 4JFDD 4HKXB 2AQ2A 4X9FA 1NGZA 2IG2H 3IFOB 4QLWA 4NKIH 3IWUA 2WP3O 4NO5B 1FZJB 4KJWD 2F5BL 4Y9FA 3HZMB 3K1KC 4KAQH 4A2LA 3OR7B 4KJPD 4I5BB 4ZRGA 5D70H