4RH4A

Zinc-substituted pseudoazurin solved by s/zn-sad phasing
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Zinc-substituted pseudoazurin solved by S/Zn-SAD phasing.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Metal binding protein
molecule keywords Pseudoazurin
total genus 37
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4rh4A00
3WIAA 3CVDA 3CVBA 3T71A 1FA4A 5TK4A 2XUWA 5B1KA 6PCYA 5LDUA 4E9QA 1FFTB 2QT6A 2GC7C 2IDTA 5F7AA 4YSAA 1ZIAA 3G5WA 3FYIB 1SHWA 4NB7A 1IBYA 2J56A 3BQVA 4MFHA 4KO7A 1DZ0A 4KNTA 1URIA 2N0MA 2PLTA 5B1AB 4A67A 2XLLA 1A4CA 2X88A 1XB6A 3ABLB 3N55A 2H47C 2P80A 3NJHA 1E30A 1L9RA 3WNIA 4YSOA 4A66A 1JVLA 1OF0A 5I5IA 1L9TA 1ZDQA 1SJMA 2VSKB 5I6OA 3EH5B 4Q89A 2IH8A 2OJ1A 3UAAA 3JT2A 5B1JA 5D4IA 2GBAA 2UX7A 2H5UA 3D12B 3CG8A 1X9RA 3H56A 2HX8A 2CJ3A 2DWTA 2IDQA 4NAJA 1J5CA 1A8ZA 1NIBA 4CSZA 1BXAA 2JKWA 2GHZA 3DIVA 3QJUB 3FQ1A 2VM3A 5B3SB 1OCRB 7PAZA 1KDJA 4M4RB 4GP5B 2JXMA 4HHGA 3FU9A 5B7FA 4YSDA 2BWDA 3ASNB 3QQXA 1WAEA 4JHUA 1OOWA 2UX6A 2FQDA 3SQRA 1R1CA 5I6NA 3T6ZA 2HX7A 5PCYA 4E9YA 2YAMA 3NJIA 2H3XC 3EH3B 2E86A 2LLNA 3ZDWA 2VN3A 3V9CA 1JZEA 4A2GA 1AAJA 5A7EA 2ZXWB 4YSCA 1OCZB 4W9ZA 3H4FA 4E9TA 2P80D 1IUZA 1AG0A 4UANA 4BWTA 1L9SA 4E9SA 4YSUA 3PAZA 8PAZA 1IKOP 2VW4A 1MDAA 2FQGA 4N8UA 2IDUA 1TEGA 2I7OA 1NICA 2PPFA 3QJVB 2FT7A 1ZDSA 2XVBA 3MBWB 4PCYA 1NZRA 1JZFA 1B3IA 4UF7C 2BWIA 2AZAA 1I53A 2FQFA 1RZQA 4AKPA 2VW6A 1XB3A 2JFCA 3DKHA 3ZIYA 1JZJA 1ILUA 3V9EA 2R7EA 4BXVA 4DP9X 2FWLB 3T6XA 3FQ2A 2EINB 2UXTA 3AG1B 4FAAB 4KOBA 2BP0B 1KCWA 1CURA 1ID2A 1JZGA 2HRGA 3WG7B 4KNSA 1AZUA 1TKWA 2PCFA 1GR7A 2EIMB 2EIJB 3TBBA 2EILB 1GY2A 4WTQA 4DP6X 3ERXA 2FNWA 1X9UA 1NIAA 1AANA 2IWKA 4E9RA 2RACA 1GS6X 1NPJA 2NRDA 4G7SB 1BXVA 3ZBMA 4HZ1A 4GP8B 2TSAA 3NJJA 3NT0A 3EF4A 4N4YB 4BXSV 3AG2B 1AIZA 1AG6A 3PAUA 1PLBA 2XXGA 3WNJA 1XB8A 4RH4A 3NSYA 5AFAA 5PAZA 1GSKA 4KO5A 4WKXA 1L9PA 4PAZA 2QPEB 1M57B 3NJLA 3FU8A 3AY2A 5B7MA 4A2EA 2PPDA 2R7EB 3NJNA 3ABGA 3FSWA 2DV6A 4YVNA 2YAEA 2PPEA 4DP8X 1PCSA 1SF3A 2MRYA 5E9NA 2FT6A 1NWOA 4HHWA 2HX9A 3EH4B 3NSFA 2BW4A 5I6KA 2BP8B 2UXGA 4E9VA 1GS8A 1GW0A 1JOIA 4AX3A 2FT8A 3SBRA 2WSDA 4BK5C 2PPAA 4G72B 1BQRA 1BQ5A 1ADWA 1EHKB 3CDZB 4KO9A 1KCBA 2UXFA 1OV8A 2EIKB 2WO3B 3TASA 3OMIB 1OE1A 4GYBA 2IAAC 4TXVB 5TK2A 2Y69B 4K9JA 2VSMB 2BZ7A 1PLAA 2PP9A 3NJKA 4DP1X 3FU7B 3PAVA 2W8CA 3GDCA 3AZUA 2HXAA 2DY2A 3FSAA 1PF3A 4M3HA 4G70B 1AS8A 5B7EA 1NIFA 1SNRA 1V54B 3QJTB 3PXLA 2VW7A 1SDDA 1PZCA 3WKPA 2IDFA 1ASOA 1QHQA 1NIDA 1MG3C 4YL4A 1BXUA 2XV0A 3QJQB 1JXDA 3MX0B 2AVFA 2ZWNA 2UXVA 3UACA 3NJGA 3SBPA 2XU9A 4AZUA 4AI7A 2PP8A 2VMJA 1SHXA 3UGEA 1IBZA 4Q8BA 3UAEA 2VM4A 1KBVA 1F56A 1PLCA 2IH9A 1QNIA 1E67A 3HEIB 1ASPA 1HFUA 3NP3A 3IBOA 1ET5A 2BW5A 2CAKA 5FC9A 5I5JA 1L9OA 4AKOA 2GI0A 2YAHA 2J57A 1EZLA 1PMYA 3ASOB 2QDVA 3OQRA 1AZBA 2YAFA 4BWWA 2YQBA 4A2DA 4DPCX 2HLEB 1SFDA 1OE2A 3SBQA 1JXGA 1CYXA 5I6PA 4E9XA 1CYWA 4KOCA 3T9WA 1ZIBA 5F7BA 1VLXA 5I28A 3WI9A 5I6MA 1RZPA 1CUOA 1ETJA 1V10A 1FWXA 2Y1AA 3S3BB 1SDDB 2IWFA 4QKTA 1W8EA 4X4KA 2BHFA 3DTUB 1SFHA 3UABA 2I7SA 1JXFA 2YXWA 6PAZA 1WA2X 2ZONA 2QDWA 4HIPA 3S3DB 3S3CB 1JZHA 1PZAA 3PCYA 2BP0A 3T6VA 1NWPA 4DPBX 1CC3A 3ABMB 4DP4X 3X2QB 1A4AA 1M56B 1T5KA 3C75A 2CALA 1A3ZA 3RYMA 3OMNB 1TU2A 4QLWA 2AANA 3PPSA 4L0PB 9PCYA 1OCOB 4W1TA 1DYZA 1E65A 1E5YA 4ZK8A 1BYOA 4FA7B 4GY4A 2GB2A 2PPCA 2WO2B 2CCWA 3ABKB 1OE3A 4BDVA 1ET7A 1V55B 2YXVA 4G7QB 3IE9A 3FYEB 3AG4B 1AACA 3T6WA 1BYPA 1KBWA 3AG3B 1KYAA 7PCYA 2ZOOA 2TSBA 4YSTA 4F2EA 4P5SA 3S8FB 3X1FA 3OM3B 5AZUA 3OD3A 2GSMB 1A65A 3TA4D 1ZV2A 2PP7A 3TU6A 1M9WA 3CDZA 3X1NA 1N70A 1L9QA 4F7KA 1YLBB 1BAWA 1AOZA 2FQEA 3EHBB 3CVCA 1NPNA 2DWSA 1J9TA 2GIMA 3UADA 2YAQA 2AFNA 3U25A 4YSSA 3FSZA 1NINA 1W6WA 3IN0A 1WS7A 1AZNA 2BP8A 4NERA 4JKNA 1WA1X 4P5RA 2CBPA 2IWEA 1TEFA 1OCCB 4BDVB 3L45A 2CUAA 2XWZA 1AZRA 2W88A 2OV0A 2XX0A 3GXUB 1MZZA 4JHVA 1AQ8A 2MTAA 2X87A 4KNUA 3NSCA 1KGYE 4HAKA 4YSPA 3S8GB 4A2FA 2A3TA 2XXFA 1WS8A 2BO0A 1SF5A 3GYRA 1GS7A 2FJSA 1KV7A 2OCCB 3NSDA 3BVDB 5IY5B 2BZCA 4HCFA 2I85A 3X1BA 1PNCA 1ZPUA 4A2HA 3X1GA 1AS6A 3FPXA 1JVOA 1JZIA 2J5WA 1PNDA 5ANHA 2J55A 2B3IA 1BQKA 3JTBA 3IN2A 3HB3B 2PCYA 2XV2A 1NDTA 5D4JA 4HALA 3OMAB 1ET8A 4E9WA 1HAUA 4YSQA 1J9RA 3FU7A 4YVUA 5I6LA 1AZCA 1AR1B 3FQYA 1ILSA 5AKRA 1NIEA 4GXFA 3X1EA 1J9QA 5B1BB 3WKQA 1IC0A 2GC4C 4DP7X 3QPKA 1GYCA 4DP5X 4KO6A 2YARA 3FS9A 4A68A 2Q5BA 1KDIA 1BEXA 1XMEB 1UATA 3QJRB 3NJMA 3FPYA 3H4HA 2HRHA 2XYBA 4HCGA 4BWUA 2XX1A 5D4HA 3FSVA 3NP4A 5B1JC 3NYKA 3FT0A 4HCIA 1J5DA 3PLYA 4EF3A 4F2FA 3NJFA 3TBCA 2FTAA 3IEAA 1MG2C 3QJSB 4GP4B 2Q9OA 4G7RB 1HAWA 1RCYA 3CZUB 4CSPA 1A4BA 2YAPA 5I26A 2DYSB 4YSEA 1NTDA 4G71B 1PY0A 1ASQA 2DYRB 4DP2X 1MZYA 1PZBA 2AZUA 5I5MA 4YSRA 4UAHA 1E5ZA 1PAZA 1WA0X 3KW8A 2IDSA 2B08A 4DPAX 2QPDB 1GY1A 1JERA 4AKQA 3AW5A 1N68A 5EHFA 2YAOA 4ENZA 4DP0X 2HZHA 1W6LA 3KW7A 3N2JA 3ZX1A 1AS7A 2XV3A 1QLEB 1RKRA 1J9SA
chains in the Genus database with same CATH superfamily
3QG6B 1AR1C 4IGBC 3VXQA 2OSWA 1WH0A 1ZHLA 2A9MH 2ARJA 3EO0A 4ZSOB 3S3SA 2Q10A 1ZS2A 2KYIA 3RL1B 3PGDB 2XWBB 5CSGA 4H88H 5EU3A 2KLTA 4UMGA 3U83A 2XKUA 1CYGA 3D18B 3FYIB 1SHWA 4XCEB 4MS8C 2CNYA 1EEZA 3PY9A 1IBYA 3QS2A 3BW9B 1ND0B 3RB5A 1RP8A 4Q56A 5I66A 1URIA 3BSZH 4B0MB 2QQLL 2DWDB 2AXJA 3TNMA 4AV4A 1F4YH 1FIEA 3C6EA 1EHNA 3EJZC 5HDLA 1HDMA 4U7MA 3QYMA 4F9LA 1JVLA 4M8QA 2HVJA 4HW6A 4P3DA 1SJMA 2VSKB 3BZ5A 3EH5B 2IH8A 1IM3B 4YBLB 4BK8A 3LKOB 2DICA 2NY4B 3FTYA 1D3CA 1H3XA 3HI6H 5DFAA 4J27A 5I1JL 1FFPA 3A0OA 4UINL 3QIBD 2CLRA 3CG8A 4BHUA 4FFZH 2O6DA 3O6KH 2I9TA 5KSVB 3D30A 4D0BA 1EZVY 1EUTA 4PRBA 1NIBA 2B9AA 2K0RA 5DJAA 2P9RA 7PAZA 3OWEA 1AR2A 2DTMH 1RUAL 4JGNA 3L54A 4N2LA 5A3ID 1UADC 1N2RB 4Z6AT 4JX0A 2ZUQC 2XTSA 3QEGH 4A39A 4ZYKA 4PGJA 2UZXB 1YEJL 3ULUC 5CWSA 5CGBA 3IJ8A 5I1HL 3K2MC 2WC7A 3VCLA 1HHIB 3UPCA 4MNQA 5C0JA 1A4JB 43C9A 2VN3A 3DMMC 3UYPB 4JG0H 1R75A 5ETUA 3VI4E 2XTJE 2XCMC 5D6CA 5F8RC 4MQTB 3PAZA 5K9KB 3RY6C 8PAZA 1X4XA 9CGTA 4OSUH 1GGIH 4FULA 5IVZB 1AGFB 2VAAA 3VMNA 4AC2A 3MKGA 1HQ4B 3KWUA 3ZY7A 4RDQF 5T1LB 2FBJH 4LVNC 4N0YH 2LT9A 3EYVB 2EEAA 3KGSA 4Q7DA 4ZXBB 2WUCL 4UF7C 4Y9CA 1S7UA 2FQFA 2XPYA 3G5XA 1KIPA 3BP5B 4Z7QF 2C9AA 2L7UA 4EKJA 1HS6A 1ILUA 3QEGL 3QQDB 4HIHB 4L8DA 2GBTA 4B9YA 5F72S 3E2HB 4IOIA 1CI3M 3U9UB 1BQHA 1RK1A 2X0WA 3D39E 3IKCB 4I3SH 1KGCD 4QRBA 5FK9B 2YEVB 2VQ1A 3JWOL 3QISA 2ENPA 1RZKH 4NQCA 4A6YA 2ERJC 1H6UA 2WKGA 5DYOB 2ZYSA 3TNNA 5D8JL 2ZCLH 2GCYB 5B22A 2O5NA 1CGSH 5E8OB 2V3DA 5FO2A 4JKWA 4JQIL 4FOMA 4GSQA 5I17A 3Q9PA 4L5FL 4ZNCD 3NJJA 1YNKH 3CFBB 4BCZA 1E4XI 1KLFB 5DFTA 2J8UA 4JFXB 3SSGA 2D3VA 2AQ2A 3TIDA 4ABWA 4M62L 2PYEB 1MFMA 5AWNL 3VWJB 3P9WB 1YY8A 3WNJA 4M7KL 3HE7C 2WXJA 1QFOA 1UZ8A 5L9DH 5CLWA 3K72A 1QRND 3CFNA 2F54E 1ZOXA 1NCUA 3ZKQD 4W9CC 1MCKA 4LFHD 5EORL 4X5XA 5BZDA 4H8WL 4JCWA 5KSAC 1G0XA 2YAEA 3GGWB 3T0EA 3WFEL 2HWZH 3FUMA 1LP9F 1CR9L 3MRHA 5KS9A 1IJNA 4JFEB 4JGUA 4Y7OC 3N3EA 3W82A 3VFPA 2EH8L 5CBEA 5T5FH 2CMRL 1UWEL 1JYWA 1G9ML 2OTWA 4LLMA 4X5RA 4Y5XA 1MQ8A 5CILL 3SKNA 2EZ0C 4BZ1H 1BQ5A 1ZHBA 3PQYD 3KPMB 3NH7L 1EO8H 1TETL 2BZ7A 4M3KB 5DJDB 3I6KB 2BOBA 3OKKB 4DP1X 2V9UA 4WI0B 3GINA 3QJZA 2DWEA 3FFDB 2NX5A 3TYFA 5L4FA 3CLEH 3I9GL 5LWYL 3VW3H 3PP3K 1PF3A 4G70B 1OKEA 2E3VA 5CEZL 5KANG 1QRNE 4KVNL 1CIUA 2GJ6D 2BSSB 5AOIA 5JHDE 4XHJD 5F9JA 5K59F 43CAB 3WKPA 4LVNB 3P4MB 1CR9H 3RWEB 1QHQA 2DRUA 3BLKA 4F15C 4JVPA 5AAMC 4ZMQA 4KKLD 4NQDD 1IL1A 5CKGA 5GZOA 4QAMB 4WWKC 2Q76B 3FQNB 3I02A 4HUWA 4I48B 1ZT7A 3KBHE 1MRCL 15C8H 5ECJE 1TNMA 2VLRE 3LNIA 4I88A 1RURH 3G04A 4KUZH 2BH0A 4XXWA 2X4PA 2I27N 1NJ9A 2DQUH 4AI7A 1A1MB 2C3VB 4NNXB 2FGZA 1U8CA 2CO7B 2F7RA 2JI3A 3CK0H 3MLVL 3U7YH 4XP1H 4TUOB 3WUWG 4NN6C 2LLLA 2VM4A 2IH9A 4PJ7B 2YA1A 4OIIL 4Y2DB 5DYFA 3PQYA 2AQPA 4JFZH 1KCKA 4R2GC 4Q9QL 3FCBA 3KPRE 2ZKYA 3I50H 6TAAA 4R26L 3WE6A 3PQYE 3CMOL 3RWFA 5LLIC 3EYOB 3GSUA 1FQ9C 4HIQA 4NWUH 3O11A 4HIIA 5IQOA 5E6ID 5EU5A 4EI5C 3MXVH 1XV8A 1G4MA 3UZEA 3L4VA 3SBQA 3BP6B 1JXGA 2GJZA 3MTXA 3EG9B 3BRDA 4OY9A 4QTHB 1OZTG 3N06B 5IM7A 1GHFH 2GJ6A 2EDEA 3II2A 3VI3F 4XTRC 1VLXA 1YDPB 3TBSB 3Q05A 4N8PA 1HWHB 1WE5A 2WXRA 4HJIA 4F8OA 4NZ8A 4XH2B 1SFHA 1SYVB 1M1XB 2NY0B 1J1OL 4M7JL 2OX5A 4QXUH 2X4OA 3A47A 2BFVH 1LL1A 4HPYH 3HAEH 4ZO6A 2Q3XA 4ZX5A 1XH0A 4NT6B 3HG1D 5I0DA 1HHJB 2BP0A 2E6QA 3D9AL 3GXNA 2WXPA 4PJXA 3C8DA 2DF3A 2FEJA 1A6AA 1DUZB 4JO8A 1A4AA 1M56B 2C34A 4N2OA 4NM8H 1N12A 1MHPH 5I30L 3PWUB 3PHOA 3PPSA 5L0QC 9PCYA 3TF4A 3X17A 4G8IA 4BZ1A 4K4KA 2XDHA 1FHGA 2JKTM 2AXHA 2XQBL 3ZE0F 1KXQA 5ABZA 3A24A 1BAGA 1OE3A 4PJ7E 2ICWI 3DRQA 4WZ9A 4G7QB 4CN1A 4CL7A 2G5UA 5F71A 1FNGB 5D1ZD 4MNGA 4G3YH 5M94B 3VFVB 3AUWB 1N8OE 4GRLB 4MAZA 4WVRA 4P8QA 1U8OA 3AUVA 4X6CB 2K45A 4WTWA 5L88L 2ADIA 2G2RA 2ZSVA 4GAGH 5KS9E 4MD4A 2D9CA 2XWTA 2NY0D 1LEIB 3E80A 3RGVB 5AZUA 4MMYA 3V52L 4ODBD 5T3XH 1GC1C 4HETA 5IMOA 5KAQG 4P9HL 5KVGH 3BDXA 4GFTB 4XNDA 3PWPD 3WS6A 5D2LE 4F15B 4OIBA 2LW3A 3O6FC 4K94C 5EIIG 1IZJA 4F7KA 1DO5A 1A4KA 5BXFB 4JRFA 1GTFA 1YEGL 2WZAA 2JNZA 3EHBC 1MHHB 3BEVB 4YQXH 4J6IA 3UADA 3LVEA 2Q87A 5GQBA 2L4OA 5C6WH 2K6YA 1EAPA 1XGTB 4IBQA 5H4YA 4NKDA 2XACC 5AYUH 4ZZKA 5JTWA 1ZGLA 1WA1X 3RBGA 3GJFB 4I0PA 4ADGA 3QXDB 3P4MA 3RWEA 3A4DA 1N6VA 5DFVC 4QHLA 3ZUNC 3GSQA 3DDGA 2VM9A 4PJDE 4CDHA 3DX1A 3U9WA 3PABA 3WEBA 4IJ3C 4WUKL 4UYQA 4NQCE 1UJTA 4NLHA 2YXFA 5BS0B 4JL1A 1Y6KR 5J12C 3VXRE 3V95A 2L7QA 3BKML 3FU0A 1J48A 1TTAA 2CIIB 4LVHC 5IY5B 4PJ8A 3GBNL 1P2CB 2Q3AA 3I2CH 4AG4L 5D1ZC 5FDWB 3D33A 3BUYB 5C86A 1R3LA 2EO7A 3FPXA 4PU2A 2R0LL 3OLDA 2X9WA 1OCWL 4PR5A 1Z9PA 1TEYA 5CLZA 4XCYA 3ZIMA 4JFTA 3KG5A 3KPOB 4WHTA 3NEXA 5CN2A 3SKOB 2A1WH 2M1KA 1IC1A 5IV2A 1H15B 5E4EB 1NDTA 4KX9A 4I77L 2YGOA 1RI8A 2YSTA 1Q9OA 2HKAA 1J9RA 2LLGA 2YZ1A 4G9DB 3R7QA 2BVPA 4NYLA 3QQDA 4CKVX 1RIVH 4GXFA 3WIHH 1AQKL 4XP9L 3FDWA 2EDYA 3VRIB 4G8FB 1XGUB 4LSUH 2Z6FA 1UXWA 2R2EA 4BHUI 1FFQA 2NY5L 3TPUA 3LH9A 3BVNA 1AD9A 5C1MB 3Q9QA 4NNYA 2VNCA 4J3UA 2WMPA 3U7YL 3NP4A 1NSNH 3M8OH 4I13B 2ZKHH 1NLBH 3WFCH 5KVDL 4GQZA 2R4SL 3V6ZB 4HH9B 1S7QB 3OJVC 4L1DA 3JV0A 4BINA 3SBWA 1ZV9A 4DGVH 4IIQA 4L8SB 4G7RB 2ZX9A 3F85A 3MAWA 4NJAL 4LARL 3L4YA 4UDTA 5IQ7L 3WEMA 3SGDH 5LBGA 2ISDA 4YDLC 5CP3A 3DHJA 4PJCB 4JDVB 1XHHA 3L1GA 2ICEB 1QLRA 1K3IA 2GKIA 1RZ7L 2BK8A 4X7SH 1KC5H 2K7QA 3ARYA 3B56A 4F3FB 4U1GC 5GHWH 1DQJA 2HZHA 2Y4SA 4D9RE 4LCVA 3OKDA 2XV3A 3MUUA 3SKNB 2YK1H 1MW3A 3CVDA 1MHCB 4M1DL 1BFVL 3QORC 3W1ZA 4PBDA 1X4ZA 1UA6L 2HTKC 1NBVL 1TT6A 3BXNB 3SE8L 4AV5A 3OAUL 2GW5A 1N18A 1I3RB 3TOPA 2DL2A 1A4KB 5BXFA 2V8MA 3GFUA 4TMPA 2VZ3A 3OKLB 1D5XA 3TONA 1OAQH 2H3NB 5B4MD 1KTJA 3LSOB 2QGEA 1F86A 4YSOA 2IANB 4WNQA 2ATAA 4P57A 5I5IA 5AKTA 1TNNA 4UOJA 2O6PA 1MJ7H 4FZ8L 1ZWIA 4ESKA 4NLAA 1KCLA 1WAPA 1ZA3A 1U3HB 3HPJA 3VD2A 3FO9A 2ZPKH 5E0QA 4FQXB 2YD0A 4HH9A 5D1QD 2Y7LA 4MAUH 1A21A 4L37A 4Q2ZB 5ERWA 3FQRA 2A2QT 2I9LB 2BOCA 3MLTA 4KH2A 2NNRA 5DK2B 5L2JA 1NCDH 3IRPX 4AT6B 1NCHA 3QJUB 4UDTB 4BQ6A 4HVBA 4GI9A 1ES0B 3MNDA 4X6DA 1UOKA 1EJOH 1JGDA 2NYYD 3D50A 3GRBA 5IQNA 3WCYA 1G7MB 2BWDA 3K4ZA 3TJHD 1DFBL 2UX6A 2YPLE 1VCAA 2FQDA 4GG8B 3GJFK 3T6ZA 2H1LM 4F7PB 3A67H 4X9FA 1Q9KB 3ATFA 3BAEH 4LRIC 4Z3JA 4YLBA 4AH2A 4I3SL 3BP7A 5T1KB 5AW1B 2JKJA 5I0WA 1GGCL 1VADA 5IROA 3ULVL 2NZ1A 3L9RA 4HKXA 3V0DA 2CLVB 3BIAX 4LSQL 1IUZA 1DVUA 2VSDA 4E9SA 2H32A 5HDQH 4HMDA 4X6BB 3SDAC 4NYLB 5CR1A 4LSPL 4PWGA 5DJ0A 1MDAA 5HP5A 5LQBL 5HHMD 2AJUL 4FLQA 3GK8H 3QDME 2R2BA 4ZW3A 1N7MH 3R7RA 3Q6FA 3AITA 3HB3D 2MKWA 2XWJA 3EG9A 3FTWA 2OMUB 5MEND 4FQXA 1MLCB 4LPVA 5AVSB 3B8SA 5ALBH 4ODWA 3T0BA 1F18A 5I1EL 2CHDA 3P54A 4HJ1A 3ULUF 4Z7WB 2BDNL 3QUZD 3TWCH 2Q20A 4KOBA 5B38A 5SWZA 1LK2B 3MLUL 3P2DA 5I18H 5ISZE 5IVNA 2ESVA 4U3CA 2B2XH 3HG1B 5HDRA 2PCPB 1IKNA 2CD0A 4PY7B 1INEH 4APQC 1DL7L 2PCFA 1GR7A 4MNQD 1TQCB 4H5SA 1I9RH 4FHBD 4WU5A 3ERXA 4OI8A 5DQDL 4C56E 3L3OC 1MDTA 3MUZ1 4O2CA 4WU7A 4N2EA 3VD5A 4BH8A 1NIAA 2ICWJ 1Q9KA 4AW4A 5LN8A 3D2UA 4Z7OE 5IQMA 1GS6X 1LO5A 1RU9L 2IIJA 4AL8L 5LAPA 1H3PH 2YMTA 1CE6A 1ETZA 5H4ZA 1UH4A 5K9QI 3FB7B 3FN9A 2QHRL 3QA3B 1OARL 3NAAH 1SMDA 3QR2A 3HMXA 1H8NA 4POYA 2FX8H 3ZVVA 4C47A 4YS4A 1GIGL 3PV6B 1U8NA 3S88H 1IT9L 1A7BA 2EXSA 1U8OB 4JFHD 3EYQD 2B14A 5SX5H 3ZHFA 2QSCH 3HCVB 4QRTA 4ZO9A 1XF4B 1UCTA 1F58H 1ZLSH 5IFJA 1BP3B 2QPEB 4WI5A 1JNJA 1JPTL 1D7BA 4BSVB 3QEHA 1I3RA 5BW7C 3G6JE 1MCNA 1KJMB 1ZLWK 4YVNA 3HBPA 1K4DA 3L3KB 1LM8V 2J21A 2R2HA 4ZFQA 1ZLEA 1X3DA 3LKRA 4K5NA 3W0WA 3SKJL 3B83A 1QKZH 3JV6B 4XMPH 3WN5C 1MIEH 3U36B 3HLAB 1TOXA 2XG4B 5IB1A 1A0QL 3TF7C 3TBVA 1HCZA 1JOIA 2F74B 2OR9H 3GSRB 2ROYA 4LSPH 1PD1A 2L0DA 3KAAA 3Q43A 1WTLA 1T4WA 4XN9A 3WJMA 3WNNA 4L0YA 5HI3D 3CQFA 4ZS6C 3BZDA 2EXYC 4KKBD 5TK2A 2Y69B 2CBOA 3BYTA 3V52H 2FATL 3OR6B 2IFFH 4LVOB 2E7MA 3NJKA 3RHWK 3U0TB 1W16A 5JLZB 5M7QA 4EI6B 2VDKB 1F02I 4HIJB 1KYOJ 3MLZH 1CGVA 1JPFA 2WZ6A 4GAJL 4JM4L 2V2WA 5BZWB 3FSAA 4H1LG 3QJFA 4Y5YA 5LGKA 2BVOB 1IQDA 4L8CA 1NIFA 3IJHB 1P5UB 1SNRA 2JK5A 4OJEH 3TWCL 1FL6B 3PXLA 3LPWA 4WHTB 2VW7A 1PZCA 1DDTA 2VLJD 1RV6X 2MIZA 2RIKA 2OX5B 4IIQC 5DR5L 4YXKH 1IAOB 1MNUH 2CKNA 3R1GL 5INCA 5DRZB 4PRHE 3RP1A 3RUGE 3VXNB 1G7HA 4MS8D 3E1ZA 2QGDA 4LEEA 1I8IA 1G7QB 2V37A 3H9SD 4PIRF 4ZPVA 2VXSL 3S3PA 4F7EB 1XAUA 3HHSB 4PRPA 3U7WH 4PJ5A 4BZ1L 5IF0A 2W9DL 4I9WD 4E42A 4TQPA 4CVUA 3W3BA 5IMKB 4MYWB 3UGEA 2A6KA 1IBZA 3PIQA 3BH4A 4XPGL 1F56A 4LPTA 4LCCA 2Y06L 1KJVA 1VFBA 5D6DC 2R69A 5KWYC 2F74A 3SZKC 3HI5H 1I7TB 5FYKH 4QYOB 3WTXA 2P24B 1C5BH 2BIIA 3BKYH 1OGPA 5E2VH 3CXFA 2HKFL 2CGZA 4KHXL 1WHPA 1MVFA 2KH2B 4WFEE 4XNUH 3OHXC 5LN4A 1AZBA 1UEYA 1IFRA 1C8QA 1RSYA 3RDTC 1O75A 3RKDC 3JYBA 4GOSA 4FFYA 1S8DA 3CVIL 4OLWH 5IOKA 4KK8C 4UM9B 2WXFA 1QP1A 4D9RD 3VI3A 1LE9A 1CF8L 4K3DH 4PRPE 3S36L 4F80A 1EEYA 3GTVA 4R6UA 2AJZA 3BPOB 3FCGA 1AIFB 2YEZB 2ATPA 1CE1H 4KY1H 4EOWH 4KC3B 5GHWL 1W8EA 4X4KA 5TE4H 3SDCA 1IAIH 3B34A 4DVRL 2J2ZB 3VXRD 3MLVH 1BMZA 1WA2X 5CILH 5CINL 1AO7B 4Z9KB 2NNAA 2L7EA 2VIRB 3UZVA 3NH7H 2DQDH 1GJUA 1HI6B 5BVJB 2N59A 4XGZB 3TYFB 3VSUA 1YY9C 3GIVA 4G6ML 1I3UA 2CALA 4ECNA 2FCBA 3DIDA 4AYFB 5IVXE 5B39B 2Q1EA 4U7KA 5EPMA 2HT2C 2X4TA 3M45A 2VLKD 2BZDA 3DMMA 4BFFA 4AEFA 4N6RA 3ZJAA 3UTPE 2ITCB 1DN2A 2HWZL 3G5YB 5HGBA 3WGVB 2PR9A 2QADC 2IMMA 1V55B 3RAJH 1T22B 1PIFA 3QUZC 4N5EC 3ZUCA 1OT2A 2AC0A 2WYIA 2WLKA 2VDRH 3PHQA 4ZMYA 2Y7QA 4KMLB 4U7SA 3W0WE 7PCYA 1VFBB 1IM9A 4Z3IA 5ENWA 5F9WB 3UPAA 5DVOA 3FBQA 4WUUA 2V8LA 5E6IB 3C60A 3VI4B 4MLIA 2AVGA 1TETH 1WUNT 4J6RH 2V9QA 1DVFD 3TA4D 4NO5B 4LRNH 2MTPA 1CN4A 4PJ6A 4YX2L 3TU6A 3CJJA 3HE6C 4XZUB 3NCMA 5JO5B 1KN2L 4KJPD 1Z9LA 2NW2B 4A6YL 1B0GA 4AUJA 2YFNA 1U92B 2DIAA 1BPVA 1P5VB 1DBJH 5KVFL 1NEZG 3EXLA 2AXGB 5IQ7H 3Q3GB 3GWJA 5DVNA 1T1WB 2Y7NA 3J2PA 2YEZA 4FC3E 4JQIA 4ZFOA 4ZMOA 3QQ9C 4H8WH 1I1CA 3IN0A 4HGWB 3QH3A 1PG7L 2OMXB 5A7BA 4X8XA 4OGAC 1OCCB 2DM4A 2JCCA 4JGMA 3GMPA 3VWKC 5L8LB 2F53D 4GRWF 2YOAA 2OV0A 2ZQKA 4BFEA 1URZA 4Q6YA 4PJCF 2WLNA 4U1JA 2WP3T 4XVJH 2WB7A 2EKSB 1X5HA 1ZSDA 2ZAHA 4B60A 4OZIB 4YSPA 3ULSA 3GYRA 4IRJC 3OR7B 5JIMA 2W92A 4I48A 5E2TL 3DURB 2VN5A 1MLCA 3UG3A 4HS3B 4N2GA 4K8RC 4A7GF 4DKAA 3SO3B 2CJUL 4M6AA 2ZIDA 2ZF9A 4YGVB 1MCOL 5E8DH 2FR4B 3FXIC 1SXAA 4GBXD 2A4ZA 3BUPA 2BNQA 3ARGA 3Q6FB 1KGUA 4ETQA 2CBQA 2X53A 1I1AC 6FABL 2XV2A 1I8IB 1HAUA 4YSQA 4PN6A 5IQ9A 2C7UB 3AT9A 3B5HA 5E1AB 3VGBA 2ZUWA 4FQ1L 4FYSA 2X3CA 5F3BA 5BS0E 4OD1L 4DP7X 1RU9H 5F6IC 3UC2A 5EF1A 4H1LB 1PQZA 4BQ9A 1JBJA 3SJVA 1T89C 4HIXL 5DHMC 1JN6B 4U1LA 1J8HD 1S7WA 3FTGA 1CU4H 2XZZA 2Z7ZA 5EWIH 4TUJB 1YPZE 4RBPK 1QVOA 3RUGB 5B1JC 3CFKA 4YIQA 2WBWB 5E94B 1WBXB 3AM8C 3STLA 4BZYA 5KSVA 5GJTH 4POUB 1X5FA 3ZKSD 1KJ2B 4GQ9L 3MOBH 4JS7A 5TH2B 4ZMLA 3L4ZA 4XP6L 4EQ2A 4WEUD 2EKJA 5FHBL 4OZHE 2Q9OA 4S1DC 4HOXA 5ITFB 4DGUA 4KK9C 4RGOH 3QUHA 3LN9A 4UT7L 5EUOF 4CSPA 4LAQH 2YFOA 4YDVB 4AYFA 4OTXH 3QORA 4N2MA 3UEQA 4BCYA 2QQLH 1OIOA 2JMRA 1HILA 4YSEA 3KR3L 4NKMB 1ZS8B 4GW1B 4NP9A 1WTGT 1X7SA 5F7KC 3VXOA 4JFFA 4YSRA 1NDMB 4UAHA 1T5XA 3JTSA 3O2VL 2PO6A 1H8SA 1NGQL 1WF5A 1LDSA 1F1AA 2GHWB 2NY3D 3L9EA 4DERA 4HFWB 3FHEA 3O4OB 4RMSA 2BSEA 2EIEA 3HB3C 3HBQA 3LYRA 1IGCL 2YAOA 3QEHB 5C6PB 3LNEA 2DQFB 4MB3A 1DEDA 1HXYB 4F92B 5F0LB 3EJYC 4LIQL 4QXUL 4MJIB 1MRFL 4WF7A 1FNGA 4R4NC 5D5ME 1IGIH 1E5AA 1VA9A 2XUWA 4NM4L 1NAMA 1YSOA 2IFGA 4XVUD 3QQ4B 3KZ8A 3MSPA 3GUTA 1JFQL 1AR1D 2J1XA 4IGBD 5AOKA 1P53A 5C0CA 1Y6NR 5FB8A 2WD0A 2O5YH 5GGRB 4HEMA 2ZXDA 2OPCA 4WLCA 1SJHB 3RA7H 4NN7C 3KPPA 2D7QA 1MWOA 1Q9OB 1KFAH 2XQBH 5HVHB 1IFHL 1KTLA 4HJEA 1TCRB 5DCCA 3UTOA 1FV1B 4IRJB 1ZDQA 3LIZA 5E00A 1EFXB 1XGUA 3P0VL 3IPFA 3JT2A 1JPEA 1TENA 2F5BH 1H9DA 3ZYJA 2YPLB 1RUPH 3PXHA 3CZKA 4OM1H 4YHIA 5CEYB 5T5NG 5BV7H 3C08H 4RQQA 3NAAL 4WI7A 3GK8L 3M7FB 1NAKL 3LXUX 1MFCH 4HCRA 3ZSTA 4N90E 4OB5L 5CJXC 5DRZA 3V6BR 4Z7NF 3TBWA 1O5DT 5KJ4A 5IEHB 3A6OA 4M4RB 3MJ8B 5CZXD 2PYEA 2OMWA 5FM5O 4JPVH 2W9EH 4QGYA 4QOKA 1T0NB 1Z66A 3MA7A 1Z9NA 1JV5A 3FU9A 5T5FA 2NPLX 4YSDA 4AYSA 1KCUH 2BIQA 5I6NA 2GTZB 4M8VA 1C08A 4C55A 4P2QA 2OXGB 3UJTL 2GSIB 3DSFL 4E9YA 3PWVB 4M7ZB 2J5LC 4F7CA 3H8NA 3QRLA 2CKBA 4UQ3B 2NNCA 3HRZB 3QUMH 5DYOA 2A77H 5A2AA 4GKSA 2H6OA 5FFGA 4OT1L 5FB8B 5E8PB 3QUYC 3QZNA 4MD5A 2JB5H 4ANVA 2CDFA 1AI1L 4HUMB 4UANA 3JWNE 3PDGA 5MENE 3SGEH 3OAZK 4YNYB 4JVWA 1OGAA 4GUOA 3CN0A 5CJXA 1WQVT 2X4NB 1H15A 1OAXH 4HK3J 4IDLA 2K1MA 3RTQD 3S35X 3SGKA 5MENB 1EDHA 3NZHL 4UUJA 2DJ4A 4BKSC 5T33H 3C5ZA 4DQOH 1UUSA 2VYRE 4WEEA 3SDXF 5CGMA 2PXYC 4HS8H 3BH8B 2BNUB 1Y6MR 2JIXA 3OHMB 1NZRA 3ELQA 3U6RB 4TUJA 1JNNL 2DYPA 2X1QA 1K4DB 4DEPC 1VAHA 2DQMA 5DK3A 2I5YH 1XB3A 5E95B 4CC4C 1YEIL 4KKCD 3DKHA 5IIEA 3AS2A 1TF4A 2EVJA 3FQ2A 1U6AH 5DHXB 1OOAA 4WI0A 4NN5C 4OLEA 4BFIB 2NX5B 2CUIA 3FFCD 3VD9A 3DK0A 2EC9U 1ID2A 1WITA 1DUYB 4PGCA 1D9KB 5MERB 4HMCA 4YDVA 3TJEL 5JYLA 4KNSA 4L3AA 1E90A 1TKWA 2XWRA 1B2WL 2J7LA 4CGTA 1GY2A 1KT2A 2VXSH 3F7KA 1L3WA 3RU8H 4NSKA 1D6VH 3L3JB 1BBDH 3P30L 3UO1H 3IYLW 3HFML 4NNPL 3TN0B 3SPGA 5KZCD 2CO1A 3MRPB 2YK1L 5I1AA 2ZWZA 4OFIA 5FFLA 1A7RL 1OAUH 4WY7L 5I16B 2UY6B 2MNWA 2AAVA 1YZZA 4KK9D 3X13B 2YA0A 4LSRH 1OPGH 4HUXB 2XXGA 2FZ3A 1A6ZA 3US1A 4L1HA 1KIUB 3DYOA 1Y0LA 1ORQB 2AP2A 4PY8I 4Q6IA 4R96B 4Q4EA 5PAZA 1E4KC 1SXNA 4R0LA 1OTUD 4G1MA 3LKPB 3LRGA 3ME0B 3O3UN 5D7LA 2D0HA 4W9DC 3U30B 4HHAA 3AY2A 5BNXD 3M88A 3DJ9A 1LK3L 1RZGA 5E7FA 2IANE 3MA9L 4Y4KD 1MCPL 2FGWH 5DUMH 3WFBL 2ZCHH 1R3IH 3Q8EA 3QZBA 5KVEE 3DROA 4PHXA 1OAKH 4BFIA 2BW4A 1D5MB 3TT1L 1M7XA 4OM1L 1A8JH 2APSA 1X44A 1F6FB 4E9VA 4L1BA 1YDPA 1RHFA 3CTTA 4WWKB 4AX3A 4WO0A 5I9QB 3QB7C 3TA3B 2H6UA 5I19H 5JIPA 4MMZC 1N0XL 3RILA 1CT8A 4YHIB 3P4OB 2VDLH 4FNUA 2UXFA 4LLYA 3FRPG 4GBXC 3WLWD 4BZ2A 5BRZE 1YUKB 4HLEA 2B59B 5AZEL 3IFPB 4HAGA 2DAVA 1UD2A 4YBQD 2FJHA 2YQGA 2OW7A 2CDGB 5IB3B 32C2A 4K55A 5DS8B 4ADJA 3VFOA 1J8HE 1KYFA 2M83A 4WV1B 4X5QA 3MRBB 2XN2A 3ULVF 4P4RB 5GRJL 5EZIH 2A1WL 2H7WA 2BSDA 2F54D 3D48R 3L3JA 3S36X 3EJUA 5CSZA 2P8MB 1AE6H 2G3NA 3II1A 1MVYA 4QRUA 3WFEH 1AHWB 3D34A 2VQTA 4AIXA 5LVEA 1Y7VA 1S9KC 4HPHA 1MF2L 1BWWA 1MG3C 3JV5A 3T65A 4OZGF 4ZUUA 3PWLA 5EV7A 3MYJB 3IFNL 2F58H 2G9HA 5CGTA 3T3PF 1PLGH 3TZVB 2OR9L 5KSUA 1RUML 2HN7A 5IB5B 2J20A 4PR5B 1J86A 3BQUC 3PV6A 2DQCH 3BPCB 2XWTB 5EUOA 1A9EA 2EDXA 5DXWA 5EO9A 1CD1A 3DJZA 1X5XA 2YD2A 2NQ3A 4F8TA 1QR4A 5EC2B 2OTWB 1E4XL 4U6YB 4X6FB 2ZZUT 4HJTA 2JCWA 5I30H 4OZHF 3BP4A 1BZ8A 3HTLX 2EUZA 4RWYH 1PMYA 3BEVA 4FI8A 5DJAB 1RZKL 5I75B 2IPUG 2BIPA 4QDGA 2VAJA 3S7GA 1ZEAL 3HMXH 4R97B 4Y9FA 2Y5TA 3VMPA 2HVBA 3LJ3A 4LCYB 4QO1A 1LO3H 1U8MB 5IK3A 1HYRC 5ESQB 1PD0A 3T9WA 4JPSA 3TBTA 3MV9D 4EZJA 3S96B 5DHVA 4WJG3 1JZ2A 1LK2A 2EUVA 4NQED 1V10A 3BGMB 4G2AA 2H4EA 2IWFA 4XNMB 4NQCD 5GS1A 3DPBB 2FO4A 4JO3H 1E0OB 2D31A 3P3SA 4XPTL 3VXUB 3VM7A 5CF3A 3NEOA 1A6PA 4Z0BL 1ODUA 2O72A 2R56H 4MRCA 4E41D 4K3JH 5I1EH 4XXDB 1XCTB 5E2WH 3F7YB 1UKSA 4D2NA 3FB8B 3K46A 2HT3C 2N7BA 1MWAB 5JHAA 4GKNA 3IRZA 4FQQB 4MKTA 1QTPA 3VB9A 5C8JA 4NFBA 5I1GH 4R2GD 1LYQA 3SKMB 1AFVH 4ZS6D 2D4DA 3O11B 1VSCA 2CR3A 3WL9A 2HMIC 1JF5A 3GMLA 1WO2A 3QCVH 5DZJA 1TCRA 2DL9A 4JHZA 5E2UH 1A02N 3FO0H 3BO8B 1NANI 1MF2H 2QPSA 3L5XL 3PS6A 1WP6A 1KYAA 2W9LA 1ZLUH 4J3OF 3B37A 4ODVL 3D39D 2X1WL 3KWXA 3WTTA 1P4BH 1FVDB 5D93B 4G8FA 4P5SA 1BPLB 3QCUL 1LO4L 1ZANH 2VQ1B 4LSVL 3T0EE 1Q9LB 3RTLA 4HKJA 3VWKD 5F9OL 4KTEL 3WXVH 4QYOA 2VZVA 2WXOA 2X2JA 4OVVA 5K9OB 3JT0A 5CLTA 4XNQB 4IHOA 4H44C 3LQZB 3EFFB 4JPKL 4PJ9C 4YHKL 1TJIH 2X9YA 1PKQB 3JVGC 4BSWA 1AOZA 5ADOL 3CX5K 3FB6A 3GSNB 4L23A 1J1XL 1GXEA 2WQ8A 5IJKC 3G3LA 4FQPA 1U3HA 3DIFA 4JUTA 3DX6A 5AD0B 2GQHA 3MV7B 2AMGA 3NCXA 2ZJSL 3E0GA 3C2AH 2YEQA 1S9WB 2J8UE 4JPQA 1LMIA 4KZEL 1WS7A 1MRDH 1L0YA 4ZX3A 1HEHC 3FZUC 1KXVC 4MNHA 3ZE1F 3ULUD 3V4PL 3BFQG 1AHWA 2CUAA 4PJIE 5BZZA 1AVAA 5T5NF 2KPWA 3U4BL 2XX0A 2KQNA 1MZZA 5LNDA 2ZXQA 2YIHA 3MRIA 1SDAB 3NSCA 4NCDA 4M43H 5E0FA 3CK0L 5AW6B 2VKXA 4PYHA 1X9QA 4GG6A 2ZCKL 1HH9A 3R0MA 5GRZA 4JFOB 3T0DA 2VMCA 2IPKB 2CGYA 3B9DA 1J1OH 1WWBX 4G6FD 5IB3A 2YLHA 4DGYL 1U8JA 4P05A 3BCFA 4KKPA 4L4JA 4X8CA 1TQBC 1ACCA 3K91A 1MFVA 3RRQA 2LU5A 4E5XB 1G87A 1FVDA 3GMNA 2P4AB 2XG5B 3GSOA 4RIRB 1FDLL 3MNVA 2C26A 3ARSA 2VITA 4PJ5D 3CSFA 3OV6A 3RTQB 2EXYD 2AJSH 5SV3A 2KLSA 5IFAH 4JO2H 4LOVA 4N22A 4WI3A 3MXVL 5CEZH 4FFWD 4QIRA 4HXAL 3UJIL 2BXYA 4B50A 1ET8A 3C5XA 5F7EL 4E9WA 2BSRB 2FO1A 3X12A 2FH8A 3P69A 4OFYA 4B5ZA 4M1CC 5TPWH 4YDLB 2E46A 3EFDL 4OT1H 5TFSL 2QQNL 3V7AG 1PYWA 2WW8A 1BBDL 1CGSL 4YEEA 5BQDA 4FP8L 2YARA 1MHEB 2P48B 4JEGB 4XVJL 4OCYL 1H6FA 3LH8A 2HVJB 1LTXA 2FBRA 1IC7H 4GUPB 3HN5A 4IHBA 4RNRB 1WHOA 2AQTA 5E9DD 4EZLA 3UGUA 2ODIA 3D2UB 2B20A 1YYLL 3FT1A 4Z7VF 4EIZC 1U8IA 2IOMA 2XKNB 5EBLB 4X2UA 4A7TA 3FT3A 4X9BA 3VU2A 2WJ7A 3BKYL 3ECBA 4J8QA 3QA3A 4RX4D 3CZUB 3QWQB 3VTTA 2Z31B 2RMNA 4XWOD 2Y3NA 3EJRA 3ZT5A 5D93C 5D2LB 3AT0A 2PWGA 5I8OL 3HG5A 4UI2A 2G60H 4MCNA 3MROB 1L3NA 1NQBA 4UILL 1P84K 5SWSE 2ADGA 4UB0L 4N2AA 3ESOA 1GMEA 1EHXA 3NCBB 3OPUA 3T0EB 1G0DA 5L2KB 5E2JA 3P1VA 5AW5B 4AYDC 2ICES 3F01A 1N68A 4ZUVB 5K33A 3BAYA 4C59B 3N2JA 2X89D 5LGYA 1Z0MA 3SDXA 2EO1A 3EUDA 1I8LA 2QLYA 4N3TA 1OP4A 2DLEA 2JKRM 5I2IB 3TA3A 3CBKB 1NBYA 3ZRSA 4FCAA 1R47A 3RVTC 4DQAA 1HINH 4OFQA 5B1KA 5HHOA 6PCYA 5LCVH 4ELKB 2GUOB 3G6JB 4Z0XA 3ARDD 4EI0A 4YSAA 5EUKA 3IDXL 4JRYD 4F8QA 35C8L 5D1XD 3ZW3A 2Q3ZA 4HJGB 4LVHB 3DGCR 1Q94B 4NNYB 3ZMNA 3L48A 1SXBA 3ILQD 4FQLL 5F88A 2YMXH 4OUOA 2P80A 1K6QL 1A7QL 4NHUA 4PHZA 1SRDA 1OF0A 1T20A 4PB9L 3OXSA 4RMVA 2CUMA 2OK0L 4PLKC 1ML0A 4BUHA 4W70A 4S0SD 4XNAA 1Q8MA 3EOAB 3WU1A 4IK7A 1UH3A 2UX7A 3Q8AA 4TNVF 5GGSB 1JGEB 5CEXA 1WAAA 3DX9A 2BSED 4NDMA 4OSUL 4AY0A 4HISA 4P2OB 2XRAH 5DA0B 4HSCX 3GM0A 4PWIA 5LBSH 2WWMD 4AWJC 3OSVA 5E1GA 5F0MB 3ZL4L 2FB4L 1UYWH 1CD8A 2OMNA 5T3XD 4JLRA 1RZKC 5IF0B 2W5PA 1KT2B 5DUPH 1KTRL 3UTTE 3VSQA 1ZGLP 2XBDA 4KK6C 2E7DA 5J6GB 1TDQA 4MQXD 4S1QL 3KPTA 5PCYA 4JRYA 3FCTA 1PPIA 1MY7A 2JJSC 3PNWB 5CD5D 2NXZB 1CTNA 3O9WC 2FX7H 1W0WB 1RIUH 3GNMH 2G5BB 5AW2B 3ILPB 3V9CA 3SGKC 2DQJL 1LO3L 4P06A 3OHXB 1QSEB 5HYQA 1MJUH 3ZTEA 4GEJA 1ZY9A 3P2TA 3MBEC 3LX9A 1JHLH 3G6DL 3WNPA 1FYTD 1MCDA 2XIDA 5TGBB 2BSCA 1RUPL 3BEWA 5DHVB 4B6ZA 5CLYA 1ZLVH 3MXWH 3QIUC 1U8JB 1WWCA 5HHVH 4ZYKB 2KQMA 3NIFE 2Y5TB 2VXVL 5AZEH 1M7DB 4ANKA 2NY6D 3Q8BA 2VH5L 5C0ND 1FIGH 4HXBL 5JXED 2W81C 3U9PH 1UYWL 1AC0A 1X6NA 5DJZA 1NCWL 1JUFB 4FHJA 2PW1A 2VABA 4RGOL 4M8QB 1TVHB 4P3DB 5HD8D 3ZIYA 1JZJA 1CBVH 4B9PA 3RKPA 1JPST 3AG1B 4HMEA 2BIMA 5BRQA 1SVZA 4QHNA 4BBWA 2CPUA 5F96L 4QTHA 1FBIL 1PYWB 5AVZB 5DHYA 1QSZA 3H3PL 4F1SA 2HJKA 4H8UA 5LCVA 3PXJA 4ABUA 5I15L 2VDMB 4DKEL 5IJKA 1R3JA 1EA9C 3R06A 4OUUB 1A2YB 1LP9E 1B9KA 4E9RA 1G6RB 3JWOC 2WIIB 3MRKB 4PIBA 4QHMA 3B7TA 1CFSB 2AERT 5DRXB 2UYLB 3UJJH 4D3CL 5FEBA 3Q8FA 1GRWA 4MWFA 2FH6A 4NUJA 4PTUA 1AXSB 1HU8A 2Z7WA 1MJJB 2PYFA 2CLVA 2BVQA 1MQKL 5D2NB 1SQ2N 1VDGA 3WY2A 1TUPA 5J12B 3AFLA 1PU0A 4E41E 3QI9B 5K5YA 4XNQA 3TTYA 2GFBB 2PF6A 2XBZA 3EJPA 1L9PA 4NZUH 4WKXA 1MAKA 5FKPA 3MODH 3MNZB 1JTOA 1HHGA 4M5ZL 4A2EA 4HKJB 3MV01 2R7EB 3IDIA 3D52A 5DO2C 5ESAB 4KDTA 4RDQG 1IBGL 2AQ3A 3OJDA 4LHUB 4LNRA 3AGVA 4ONFL 3GHPA 1AY1H 3SBWC 1J5OH 1P5VA 5T1LA 4AJVA 1OSPL 4LNVA 1O7VA 4MNHB 4F33A 1RZJL 3EYVA 4IMKA 2DTSA 5DDHA 2WINB 1F8TL 1NMCC 1H5BC 1A9BA 3MRMA 4LSQH 2H26A 1ZHKB 1KB9K 3OPZL 1Y1DA 4CN6A 3WDIA 1ADWA 4X6CF 2H8PB 5DJCA 1KCBA 4KKZA 3U0PB 4ANWA 2HT4C 1JK9B 1HEZA 1JAEA 3CXDH 2WVSA 4L4TA 3SE3A 3AAZB 4P5MA 2AV7B 1TJXA 1GGTA 2DJUA 2XPGB 2YO3A 2XETA 4AM0B 3O9WA 4RQQB 1DLHA 2CIIA 2FWSA 2JCCF 1SYSB 3HG4A 2W8CA 2EH7H 1PZ5A 4B9CA 2IXQB 1ICTA 4S1SH 3D0LB 2DY2A 3HZYA 1YEHL 4AGPA 4NKDB 5IREA 3UYRH 2EC9T 4MBOA 1BM3H 2V5SA 3KYKL 1T1XA 1NPUA 4FNLL 1U8LA 5IBTL 3NCFB 3BAJA 3APFA 3FT9A 1I82A 5F7EH 4X4XA 4KDVA 5CBAB 1MFDH 1NIDA 3O3BA 4L9LB 5TPWL 4Y4KA 1BXUA 2R1WB 3GSOB 4RIRA 1MCBA 1WCBA 1CF8H 5D1QE 3O8XB 1UWEH 3MRPA 5ICZA 2QPFA 2UXVA 1KNOB 4FCHA 2PN5A 2EYRB 3NACL 4P23C 2NLJA 3T2OA 3LEXA 5C0NC 2XU9A 2VLLB 3UZVB 4LBEB 2DEYX 4MD0B 3U6XS 2ICEC 4Y19B 1Z9MA 4C83B 1KPUA 4OF3A 1J05A 1PL3A 3CAFA 2X4OB 5BS0D 1CXKA 3L1OH 1BVLA 1KTCA 4GKZB 4NO5A 4TQEH 5SWZD 1OK0A 3IBOA 4LSRL 5F1IB 1WG3A 4AQAB 5I5JA 3BPLB 3CE1A 3PNWA 4PGBA 3VW3L 1G7LB 1CDGA 3OF6A 3DOHA 5ICXB 5E7BA 5TDOB 3QFDB 2YAHA 3K81A 1FUNA 1UD8A 2J57A 3AU1B 4XPFH 3WIFB 1V7MH 4JZOB 4Y2NA 5LBVA 3FN3A 3WSQL 4EXKA 1UVQB 3UIZA 2P5WA 3FOMA 4O5LH 4PJBE 4HCRL 2ZNXA 1DQVA 2AKRB 2BIHA 4KK6D 3SDAB 4Z76B 4E9XA 1INDL 1HNFA 3L3HA 5FOBA 3P30H 3POHA 1RZIB 4P2AA 3DRQB 4W81A 4P2YA 1IGFL 3F6IA 5DMIL 4F7PA 4TNWK 2Y1AA 4OKDA 3RIAF 3U4EA 2WWMC 5CNHA 5T5FL 2WSPA 5E99H 1RERA 5DEGB 4Z78A 4O2FB 3U2SB 1KB5B 1BWMA 4OLZL 2YSSA 4LZKA 1QD0A 1CFVL 4YDMA 3S37X 2DMHA 1JZHA 4NM4H 4XHJC 4ODSL 2Q6WA 4L5FE 4U1SB 4MWFB 1KB3A 3NFNB 3ABMB 4TQEL 3VQ1C 1TTBA 5HJ3B 1MJ8H 3DTXA 2FJGB 1V3JA 2F7PA 4R4ND 4OCRH 4JHWH 3IVKA 5E5UB 5KOVC 1F0LA 4FFTA 4L0PB 2Z8RA 1XZ0B 2DIEA 2J4WH 4OLVL 1LXMA 3VQMA 4KAQH 1IBGH 2AQ1A 4O51B 1OF2A 3T1WA 1CZ8L 1E8WA 4YHOH 1ET7A 1MRDL 2YUWA 4OV6F 4ORGB 5D5MB 3AG4B 3LQAC 3GSVB 3RPIB 3T6WA 4IS6A 5DO8A 1KBWA 1DQQA 1HH6B 2HRPH 3N9GH 4ZODA 5EU5B 1QABA 3H53A 3EO1A 4JAMB 3VQ2C 3NFSH 4F2EA 4L5FH 5J6SA 3RGVC 4XN7A 4AMKL 1IB5A 4KHTH 4OCWL 3WE6B 1XGYH 4XPTH 5TJWK 5GRXG 4LLWB 1OAJA 4I18B 1XGPA 3F64A 1KSRA 3STZB 3QDMB 3WJJA 3MUY1 2A73B 3T8XA 2R2EB 4JM4H 5GS0H 5HPMB 1YEFH 4WI4A 1PIGA 1BMGA 4XCNA 5ILTL 5C0DA 1JGVL 3RI5K 1W9XA 4L29B 3EHBB 3C09C 3P4OA 2DWSA 1DEEB 3LQMA 1KENH 1OCWH 3MFGB 4N8VA 1QFUL 4LCUB 1GKOA 5B1CA 3ARDB 1KCVL 1DVFA 3CWGA 3GSRA 4KDWA 4NERA 4I7ZC 1YNTF 4M8RA 4JKNA 3DV4B 3ZSSA 5AW9B 1QG3A 3P9MB 3LV3B 1LE5B 4BE5A 2ZT9C 5I1DB 5JW3L 5AZ2L 2OMTA 4PWEA 3ABZA 2XTJD 3V4VB 4NKOB 4KZDL 2X87A 3HI1B 3MREA 4D7BA 2OSLB 5EZLA 4FFWC 5I1JH 1KGYE 4KJWC 4KTGA 5JMRA 2Z7UA 3HPLA 2G5BA 2IWGA 4L1SA 1IRAY 2VDLL 3HE6B 2R4RL 1LLAA 4TQIA 2OCCB 4JFYA 4Y4HB 2IGLA 4JO3L 2UVEA 2IV8A 3ENEA 1X5MA 5AYQA 2O4EA 2WLLA 3KXFD 1YEEL 1T5WB 2JKIS 5H37G 3RE0A 4PWKA 5EEXA 4B41A 2E7LC 5IHLB 5DS1A 4LCCC 5HHMB 3VB8A 2EAEA 2VDPB 4FX5A 2AI0L 4UDUB 3JTBA 2OZ4A 2DS4A 4FADA 5KVEL 5C71A 3WJLC 2I25N 4P3CH 5CGYC 2FHBA 4I2XA 4PJIF 3T8XB 2VDOB 5G4OA 3NEEA 4JW3A 1UXSA 5MEPA 4HV8B 3Q2NA 1E28B 3QO0B 4QTIH 4DKEH 5JPMA 5DQDH 1L5GB 1VKXB 4LLWA 1XIWD 2EDJA 3H42H 5GISH 1VRSA 3VSTA 1CFTB 3QXAB 4FFZL 3HZVB 3B9VA 4XCFL 4ODHH 1KCSH 1ZT1B 4RZKA 3ALWA 1QASA 4CMHC 3OC8A 5LBSL 3FPYA 4WY7H 4YJZL 2BY0A 3NFSL 4HEPA 1L7IL 5D4HA 5TE7L 2OW6A 4AW7A 1O7DE 1O9WA 2VR7A 3CX5J 3MRCA 1KB5L 1G7QA 2M8XA 2DEWX 4ZPVB 3IGAA 4KNQA 4R3SB 3T1FB 4AMXA 3TEXA 4PFEA 1E6OH 5DC0A 5E6IC 4DWHA 1ZCRA 5FPIA 3Q5YA 2CHWA 2IALA 4NQVB 4PS4H 2AJZB 5IHUL 1XT5A 5D7LE 1K8IB 3MNZA 1N59A 1JF1A 3JZ7A 1EGJA 1LGVA 1G9MC 2YMXL 3ECQA 3TP4A 3C9NA 3L95B 1KLUA 4N25A 4PB9H 1E5ZA 1QEWB 4E68A 1PG7H 2CBTA 1AQMA 3N43F 4XX5A 5IGXL 3FCUB 3QQ3A 4JPIB 4WUUD 3WJLA 2QPDB 3VRLF 5BOJA 2FZ3B 3AW5A 5IMMB 4U1GB 5C0FA 1WEJL 5AVWB 3BP7B 3MU3A 4FMVA 2IH3A 4I85A 3U6XA 4N9GB 1YNTB 2QTEA 5GRUH 4S2SB 4TPRH 2F1AA 1FA4A 2I9LA 1T0NA 3KPOA 2PO6D 3Q2WA 4JFQA 3TEZA 5HJBA 2QT6A 1WD8A 1IM9D 2FB4H 4BUGA 2HFGL 2XQ0A 2NCEA 1CT8B 2Z1PA 2R2BB 3QNXA 1UASA 2IOOA 4J3WA 1FG2B 3P3YA 1SM3L 2PUQT 5DVLA 4JDTL 3DVNA 3VFMB 2VDQB 3KHQA 2DJMA 3ESPA 3FUNA 5IVZA 3ABLB 1E9PB 3WNIA 5E24E 1AGCB 5E6IA 2WBJD 3G9VA 3OKKA 3NOIA 1N2RA 2Z64C 2JKSA 2F19L 2OJ1A 4JZNB 2BC4B 1FLTX 1RJCA 3QXVA 2DLFL 1EX0A 3MLSL 5FA3B 1FE8H 3B9KB 3RKDD 3BXNA 4ANXA 4EE2A 4WNSA 4MDIA 3TZVD 4ACTA 3IB4A 2BWQA 1OM9A 2HFFB 1EHLH 2EE0A 4DSYA 2AQQA 5MEOA 4HSAC 2WLZA 3STZA 5C2BH 1UB5B 3BIKA 3OR6A 4LLUA 1Q9WB 1BV8A 2JQZA 4FTDA 4HS8L 4GO8A 3VXMA 1U0QA 2Y22A 4F3FA 5AG9A 4TLTA 2R83A 3QEQE 2QQQA 3IDJA 3K8MA 2WWOA 4G8GA 4HHGA 5MERA 1WAEA 4HQQL 2ID5A 3QQ3B 1HOCB 2W0FA 1LWRA 3UXFA 5E1IA 2YAMA 3BJLA 2ZJSH 1HX0A 4DO4A 3L4UA 3BWZA 3D4YA 3QIBC 2B1AL 3TH2T 3L5WA 1IC5L 1BD2A 4GXUN 1AAJA 4LB8A 2C9RA 4YSCA 5SX4I 4F58H 2FEDD 3A5VA 3H4FA 3QWOB 3S36H 3VWJA 3ARGD 4BWTA 1U91A 5CN1A 4H20H 1KCSL 1NEZB 1IKOP 1SJXA 1XF5B 2VW4A 4NENB 4P2QD 1I9JL 5CN3A 5I8CB 1G5AA 3APDA 5D1QB 4ZFZA 3TC9A 3VXQB 1HYSD 5ITBH 1QMUA 3D05A 2PTUA 5L7XH 3IGKA 3QDJB 4XI5D 2F8OA 3DUUA 2R0WH 4PRIE 4OFYD 3EYSL 3GIZL 3TNNB 1CL7H 1I9IL 3BZFA 4OQTL 1KTDB 1T7XA 2EEXA 3CVHL 5EO1A 2Z0BA 3TBYA 1M1SA 3F7QA 5I1IL 4MA7H 2FHFA 4Y19D 1DUZA 5EA0L 1GTNA 1G43A 3IJSA 3VFPB 3KXFB 3ZTCC 4Z95H 3MCLH 1R24A 3NVQA 4X4MA 4M5ZH 4JDTH 5GS0C 4TSBH 2QFRA 4XC1L 4LBAA 5BRZB 2J1WA 3K6DA 2OMWB 1EBAA 2BRRL 1QR1A 1RIHH 1P9MC 3JV4A 5D7JA 2XA8L 4NZDA 1CVRA 1KLUB 3F2LA 1GZHA 5D5MA 5HYJE 2R23B 5TQ0H 1XSIA 3TCTA 5B8CA 4YOKA 5E08L 4U1HB 3IE4A 3HNSH 4PJIA 1MXDA 3AADB 3FFOA 4L48A 1WBZA 1OF2B 2VDPL 1K5NB 1IAOA 4J1UB 3CHXA 2VXVH 1AGBA 1NGZB 1JZ7A 4J23A 3W39B 5EEZA 1XGRB 1E3ZA 4PW3A 3WD5H 3FFCE 1QPPA 3ZHKA 2P5EB 4JFFE 4QI3A 2EXWD 3V0VB 4NFDA 5I2IA 2C3HA 2DMBA 2Z1KA 3U0TA 3ZT6A 5ICZB 1QUNA 2H32B 1MIMH 3FU8A 4QRAA 1TVHA 4Z3HA 5B7MA 5DJ8A 4KQ3L 4XPHL 5INDB 2F6AA 3FSWA 3V4VL 3C8HA 3TFKD 2YS4A 3F7VA 2AF2A 4TSCL 3IRCA 3P0VH 1E9OA 2WBKA 3IMBA 4PJFA 2WXLA 4JREC 5T3ZL 2H2SD 2D7PA 4UINH 1CFNB 1BJ1H 4ZNEA 5DI8A 3DXAA 1WC7B 3NJVA 2FT8A 3AJ7A 3Q8CA 5FUOL 4NPYB 1FLRH 1P6FA 2PYED 2BNRD 5FM5M 1J0ZA 5EZLB 5F6IB 3TVMC 2R9HD 4O58H 1OTTC 1AZZC 1OE1A 4CUCA 1GCYA 3D06A 3TJHC 1KB9J 1QSVA 3P3UA 4KJYA 3K74B 3S37L 5FUCE 3MRIB 3TIDB 1SN5A 3FU7B 1AGEA 1WGVA 1K5NA 1A5FL 2K7PA 3M07A 2J4WL 3ARVA 3PAVA 4OLVH 3GDCA 1NBQA 3CVHH 1MCLA 4N0UA 4N24A 1HL8A 5B7EA 2VIRA 2AQNA 4BFJA 2DQJH 2AS5M 3ULVH 3ARGB 4BQCA 4AQOA 2AK4B 2AMUA 3KPNA 1YA5A 5IQLA 1T1YA 2HLAA 1F6LL 4GKLA 2UZXA 5KVFE 5IESH 2M2DA 3N85L 3HZKA 4HWBA 5HGHB 3BAXA 1CJYA 1S5IL 2FJGA 3CFIC 2CRZA 4HWEL 3TTSA 1XGYL 3EGDA 3IMVA 3L5JA 3K6FA 1PD6A 5ID1B 2PP8A 4NKQB 2GK0B 3QUGA 4ALAH 2KERA 4M8UA 1NUGA 3M7OA 5ALBL 5GJTL 3N40P 4BGDA 1N5AB 2ESVD 4FJYA 4XP6H 3NP3A 5AAWC 2YBRB 2ZUVA 4ORGA 1Q0YH 2QV4A 3GI9L 3V6OC 4Q14A 5JIHA 4J7RA 2BNRE 4PW9A 4AXWA 1UFGA 2DD8L 2QQKL 3QDGB 5GRVK 3GMLB 1IGTB 1IARB 4OGYH 4IRSA 5AVTB 2DYPD 4JAMA 3P40A 4KZ0A 4YMPA 1S46A 5AQ0A 1OP5H 4IU3B 1FO0H 2BLFA 4M4RA 4W9HC 3BUBA 4FE9A 1VENA 3T1FA 4Z3TA 3TT3L 4XVTH 4Y5YB 5HD8C 1ZIBA 3THMH 1IVTA 2Z34A 2MOQA 5EBWA 1CUOA 1JDDA 1G6VK 4NUGL 4ZMZA 2VWEE 2HPOA 1P1VA 4I0PC 3EDFA 4WUUE 2KDYA 3DTUB 1J1PH 5F3HB 5C0RH 2D03H 1RPUA 2QLVB 4DUWA 6PAZA 2V7NB 1M7IB 5AVXB 4KHTL 4L4VE 4A1RA 3AY4A 4J6RL 3G04B 2MOVA 3BWUC 5DEJA 2VDNH 3GXPA 4N2CA 4PJGF 2OR8A 5MI0B 1A7OH 2X6AA 3KNBB 3MROA 5JZ7C 2MQ0A 3ULUE 1GGBH 1P4IL 1WISA 2BNRB 3L1FA 1RFDL 1ZSDB 2A6KB 4TQ8A 4UT6L 4NSKB 2X0UA 1SVBA 3MRRA 5CU5A 1DHKA 4HC1H 3QZWB 5E1HB 3NCEB 3S2CA 3MLXH 1MCPH 2FGWL 3L7EB 3O4LB 3JTTA 4Z1PA 2PPCA 5ICXA 3Q13A 2OK0H 1HHKB 4XBMA 3TJEH 3ARBD 4YDIL 2Q76A 1NFIB 3A22A 1H3VA 3QH3B 2PWEA 2R69L 3KJ4C 2YRLA 5HDBE 1ZA3B 4F27A 3H9ZA 3CFCL 3L5HA 2KBGA 2A9AA 3VDBA 4KUCF 2NR6D 4JQXC 2XQYK 2IANA 4QF1B 3OD3A 3VJ6B 1F6AB 5KVDH 1OAUL 1A65A 3WBDA 1IC4H 2B4CH 3L7FA 3QWNA 3ZTJH 2AV1B 4FFYL 4S1DD 4AQAA 2NXYD 3D5OF 4FFVC 1KELH 1BFVH 4TTGA 5KJ7E 2FYYA 2NY3C 3CLEL 3I9GH 5JQ6L 5LWYH 2KMWA 4HWBH 1WK0A 3SOBL 5LGJB 4XNZC 3IU4L 3KVDD 5FGCE 4Q9QH 2ED8A 2PR4L 3G6JF 3FH7A 4JRXD 4P2CG 1SM3H 5KSBB 1FAIL 2VDQL 3C6LC 5DZ9A 4L4TD 1JD9A 3RAJL 3WSQH 2DDQL 1RH8A 1DJYA 2IWEA 3UTSD 4NZTH 1UKTA 3WFHB 2X4NA 1AZRA 3GMOA 2VZSA 2ITCA 4KUZL 4FLRA 3THML 1AKJA 3CN1A 1OALA 1QBLL 1ZVYA 4FZ8H 1BXXA 1H9VA 2BXZA 4R5VA 4KNUA 4UTAL 3CFCH 3RVTD 1SMOA 5I0YA 5F1OB 4W4OC 4EIGB 1QFWL 4HAKA 5MP6H 4FXGA 3U2IA 5JIKA 3B7SA 3SHSA 4A2FA 4BM7A 3AREC 5E4IA 3VU1A 1M6OA 3R0NA 1X9LA 3OKEB 4GIPD 4FQHA 4OF6A 3RZWA 3JWDL 5T1MB 4Q9RL 3LS4L 3GI9H 5IB4A 1ADQH 5KBPA 4FDWA 4IEFA 3VGAB 1M6UA 4J3XA 4LEBA 8CGTA 1JVOA 3I9AA 4IRJD 1GGBL 4N26A 2J55A 3RX7A 1BQKA 4Q6IC 2QSTA 1TPXB 2XJLA 1PX4A 2V3EA 2JKXA 3FB6B 2NY0C 4HPOL 5KN5A 3CSBA 5D4JA 1BLIA 4NS0A 5IBTH 5K1NA 4ZX6A 3KPRD 1N67A 4XN2A 1DVFB 2F7IA 3VFWB 5JNYA 1RZ8B 1UT1A 5AKRA 4S0TD 5JIQA 1OGAE 1D2OA 4P3WA 3MV11 4KJQC 4MMXA 1VFMA 2VN6A 4XPBL 3U79A 1E8ZA 4ALAC 5EIIA 1FH5H 1UZGA 2QHLA 2WM0A 4KO6A 1WEJH 2CNZA 2B15A 5FYKD 4KI5F 3BUTA 3U1SL 1OPOA 2QHRH 4W4NA 4ZFOL 1JE6A 1OWWA 4BK5A 4ZW5A 4I87A 3RNKB 3MV9A 3RY5A 3QHZL 3T4AB 1D9KD 1TJGL 4XPGH 3DARA 3HAEB 1NMBL 3UTPD 4R83A 3W39A 4N0CD 4GT7A 1FFNB 4UQIM 2B1HL 4JY6B 3A6BH 3CSGA 4FXGC 1THCA 2GT9B 5KYUB 1AJ7L 1G84A 5J1SC 4YBLC 1AXSA 1ACYL 4RAUA 5KVEH 1C12B 4B5EA 2OTUA 4XBGB 2QVKA 2H1PH 1MCJA 2GCYA 3E9UA 3OKEA 1SBSH 4OGZA 5FO9B 4G6AC 4BSVA 3G5ZA 2BOCB 3V4LA 2NUPA 2A6DB 3OAWA 2CO4A 5I5MA 1QYGH 1M3JA 4LO9A 4J4PA 1YYMH 1SHMA 3KW8A 1BLNA 3CUPA 4LEXL 2VN4A 3M46A 2COVD 2K78A 5JHLL 2EEDA 3FOLA 1R34A 5AZ2H 5FF6B 5I1AB 1LEKB 1QO3A 5BO1L 4XVOA 3PE9A 1J1PL 1QLEB 4PRAA 5LG6A 5IW1A 3V5KB 3ETBF 1YRKA 3T71A 4HZLA 1H5BA 1KIUA 3HZMA 3LKRB 5DMJB 5LDUA 2OMYB 3E6FA 4E9QA 4WJ5B 3ARTA 5F7AA 2MMXA 4U1LB 3V4UL 2XOTA 4FHKA 4IJTA 1DSFH 3VD7A 3CFMA 4B53A 5A2FA 5JPNA 1KENL 1BOYA 2Z31C 1WBYB 2E8YA 5CUSL 2UZIH 1KCVH 3NQIA 4PP2B 5F3BB 4G9FE 4JE4B 4MDJA 5EZIL 4NENA 2ZG2A 4A67A 2ZUUA 1QBAA 1U42A 2DW5A 2V7HA 3CLFH 4KITB 1J0JA 2H6PB 1DL7H 4P2RE 3UPRB 4JN2A 2H47C 5D96B 1ZPLA 2W91A 3KEHA 2Z92A 3ARZA 5LAXB 3O9WB 3FBKA 4DN4H 5TGBA 3GPSA 3HUJB 3HC3H 4OQTA 4MA3B 3UBFA 5H94B 2HJFB 4AJYV 4RAUB 1OSZB 3ISYA 1CDIA 4JJOA 1IMHC 1ADQA 3CX2A 3D69A 3QSKB 4IBYA 3N0PB 2FL5A 2RTTA 2Y1ZA 4GW4A 1DUYA 4KXCA 4PGCB 5D4IA 3ILEA 5DMGD 4N2HA 1PKQA 1W0VA 3H56A 1LWJA 5GZNA 2WQRA 1IAIM 3I3EA 4NZRL 1U58B 4R7XA 5I17B 1GL4B 2ZKMX 2ARWA 2ED9A 2JKWA 3OX8B 2OTUB 4QKXB 5GZNC 2VM3A 1XZWA 4Z7VB 3DV6A 2F53B 3VFUA 4CJ1A 2PCFB 5C92A 1G7IB 2VLLA 1K8DA 4GP5B 4J3VA 2VDMH 4E0RA 2IBGA 3ASNB 4KKRA 4JHUA 5HHME 5SV4A 3DETD 3KVPA 3N42F 1WCBB 3WTUA 1G6RH 1SN0A 2E9BA 5DZOA 3WO4B 1HKLH 4YWGL 2MCMA 3ZQ9A 2F8XC 4WIQA 2FBOJ 2FHCA 2CU9A 1F13A 2MHAA 1F1DA 2WJ5A 1KJVB 1QUPA 4RGND 3FRPB 4XO5A 1A1NA 2DLGA 5A7EA 4MZ2A 1FF5A 2OCJA 1NAML 4OJFH 4NJ9L 1K4CB 2WBJA 4OF8A 1SHSA 3PJSA 2PCXA 4XRCA 4H13C 4QRRA 5C6TL 1ZAGA 5BUGA 4V1DE 3AU1A 4MGXA 3S3JA 3WIFA 2EDNA 5TQ0L 3OZLA 3OAYH 3CCHB 1IILE 2W94A 1DBBL 1QBBA 4AQ8A 3FQRB 3PWPA 1JZFA 4Y9GA 4NOBA 4DVBB 5IR1A 5IKCB 4GW4B 2DQCL 5KYXB 3LZNA 2EH7L 4PJGE 3PHSA 2PW2B 1R3HA 3OKOA 3TO2A 2GPZA 5JW5A 3DI3B 5H94A 5ACMA 4HQQH 2EECA 3BVNB 4G8GD 4FAAB 4LSSL 3NK4A 4HGMA 4G9FA 4L1TA 4XMKH 2G60L 3ISWA 3FB5A 3PP4L 5H37H 3RY6A 2BP5M 2CO2A 2ZWKA 3LKPA 3ME0A 5BZXA 3AGWA 5CWSB 4JY4A 4G43B 1U8MA 4P5KA 5IK3B 3LEYL 2V9TA 4FQLH 1GGCH 1QX1A 2X12A 4UOW1 1B0RB 1JMXA 3SDDA 3TBBA 3EJCA 5CEZD 4LSTH 2ETWA 5JR1L 3UEZA 2XKSA 5I74B 3OX8A 3O0LA 3VM5A 4HK3N 3TLRA 4FL4B 1UM4H 2CLZB 1K8IA 5E23A 1WFIA 5IHZA 4ENEC 4L1LA 3GXDA 1BVKA 1BXVA 3K80A 4PCTA 1NEPA 1Q0XH 4EIBA 3BT0A 2OZ4L 3RJDA 1BX2B 4C57C 4D9QE 3ETSA 1IAIL 3FH5A 3GSXA 1ROCA 2CKBL 5EDXA 3S35H 1ZRUA 3CHOA 4ELME 2WWKO 3CLWA 4BKLA 2FSDA 1TITA 5FWRA 4ZMTA 1DCEA 4NPJA 3W57A 2AQSA 4RH4A 4FG6D 1CFQA 1O9VA 1TKWB 1C8PA 2WNWA 3AM8A 1RUKL 2X89A 1WWWX 3TCLB 4KO5A 3FKUS 3FUKA 1XH1A 4ZUSA 5GGVH 2VXUH 3V5DB 2F8VA 5BCAA 1J18A 3MRLA 1FL5B 5C08A 4OD2A 4LDLB 4LL1A 5HHOD 4QWWD 2LQRA 4YBHA 3UBXI 2QMJA 1UB6A 3BZEA 4JHBA 4CJ0A 2OMZA 3JWOH 3BD5A 3ZMRA 1SLWA 2YBGA 4XNYH 5JR1H 4HHWA 1CMOA 2HX9A 5LAXA 5EZOL 1AQHA 1RSFA 3NSFA 3JVFC 3U6RA 2E7HA 1U30A 2BP8B 4UM8A 5D7IF 4Y2DC 3QPXL 4JFDE 4UQ2B 2P24A 3O8XC 1GS8A 5IVOA 2IPKA 3O2DA 4TVPL 3TA3C 1H3UA 2OYMA 3PWJA 4MMZB 1BQRA 5CIPH 3MR9B 5AVUB 4BH8B 2CE6A 2Y6TE 3U0WH 4UT9A 3RIKA 2KC0A 3GLEA 5C0EB 3A4AA 3RG1C 1EFXD 4JL2A 3CFDB 2HG5B 5I8EB 4MAYB 5ISZB 5L9DL 4MA8H 1QW8A 2WTPA 2ERJB 3SE4A 1A6AB 3NCJL 2UYLA 2FEEI 2YMOA 1XF2A 1HJCA 3AZUA 1MEXH 4Y1TA 1S9WA 1QFHA 2OQJA 3RBSA 3SOBH 4XCCL 4UZSA 2ZX6A 3B2DC 1WFTA 2FUTA 5E03A 4X0NA 4IBZA 4X4ZA 4PH8A 3KM2A 4M1GH 5C6TH 3SDAD 5D7SH 4AV0A 2EDOA 4DN4L 2IGTA 3OKMB 3C5ZD 4YL4A 1SLVA 1SXZA 4Z3FA 3FB8A 2EH8H 5HHNB 4M61A 4LE8A 4M6NH 1M42A 3LKSB 4PWHA 2Y5EA 4F33B 4XCFH 4YR6B 3BQUA 2AJXH 1VEOA 1MUJB 3T4YA 5ITFA 4HJ0D 5ESAA 1JPSH 3SQBB 2DM2A 3UAEA 1BD2D 3DJTA 4YHPA 4WI8A 4Y4FB 1KBVA 5FYKE 3M17B 4XP4L 3WFCL 1E67A 3NGBC 1HFUA 3IT8D 5J56B 3OZ9H 4GO6B 5AWNH 3I6LE 4BSJA 3D7PA 5IJBC 4WK2B 1TZOA 2DQ6A 4HV8A 1Y18B 3HBZA 4HWZA 1DJHA 1ETB1 1V27A 2AEQL 3MRDB 2EDBA 4KK5C 5D2NC 5DR5H 5DRNA 3VXUE 4CW1A 1MCHA 4OIFA 3M6DA 4M6ML 3ZRCC 4BZ2L 1PG7W 4JG0L 4RFEA 4U6VH 4KKCC 5IESL 5JO5A 2XG4A 1O5PA 1TYJA 5I6MA 3UJJL 4L3CA 3MN8A 4W6XB 4Y5VA 4AEHL 1JXJA 1A1OB 1DCLA 2V4LA 4MMYB 4TNVK 1MAML 3ZKXC 4MYPA 2OSLA 1HIMH 2X9ZA 3LVTA 2WXNA 4HIPA 1HTYA 3B6SB 1T5XB 3GBNH 4QHNB 3D2TA 5DURB 2WGXA 3PCYA 1CLOH 4MNGE 3ZXAC 1UJ3B 3PL6C 3QHZH 3WHXA 3UZEC 2DMGA 3JYCA 2WKOA 2HN7B 4PJ7A 4LU5H 2X9XA 1NC4B 3OGCB 1A6ZB 4G1EA 3CFEA 2GJRA 4LLAA 2J71A 2NUTA 2DD8H 2QQKH 3ARQA 1U2YA 1F4HA 3TIEB 1DYZA 5F89A 2X40A 2B0SH 1FFOB 5IHUH 4FA7B 5F97E 1TTRA 4M7LL 4NBYB 4BZ2H 3GMNB 4KMTL 5AYUL 3V6FA 2ESVB 4PJHA 2DOCA 3QIUD 4MKMA 2X38A 2C7FA 3TO4B 1MNUL 5HYJD 1E7UA 1BYPA 5L6YH 3GMQA 3GJFH 1LHZA 1E2VA 3CVHA 3QFDA 2TSBA 2HT4D 2GAZA 4DUVA 1EAOA 5DJXB 5F7YC 3RVUC 1YEDB 3BP4B 2ATPB 4UQAA 1GCFA 3B7YA 4D0DB 3RLSA 4C58B 3G6JA 3O9WD 5JQHC 3R8BB 4MHHI 3FMGL 1SBBA 4DESA 4MXVF 4L3ED 2F08A 3G5VA 1E9PA 2A0LD 4PTTB 5HVFB 3L17A 2MCPL 4PJBF 1VPOH 4H88L 3FN0H 1S7TB 2QR0A 1U2CA 4AEIL 1OHQA 1WICA 2OCFD 4AYEC 3EZ8A 4PGEB 4IM8A 4WWOA 5CLXA 2R9HC 1NA8A 2MHAB 3TJPA 4R7LA 3L16A 2BVYA 2CBPA 2FYVA 4LEXH 3DTXB 2X10A 4G3YL 2V2WB 3S5LG 4PJFF 1E2WA 4RZCB 3RDTA 1NM9A 4U6VL 3P73A 4I0KA 4BH7A 3W11D 2Y23A 3ZDXF 3F05A 3K8LA 1BQSA 4JPIA 4FABH 5CFHA 1XEDA 2ZYRA 1Q1PA 3GTNA 2IXQA 4O9HL 2ADFH 2NY2D 1XH3A 3D6GA 2ESVE 4RSVA 3WAJA 2RALA 3OXRB 5I71B 1S6NA 4C4KT 1F2XK 4MA1C 4XE0A 4L0ZA 5I1IH 2OMVA 5DQJA 4PY8J 2V5TA 3T0VA 5A2JH 1NGWA 5JHDA 1T1WA 4ZFOB 1U6AL 2J5WA 2P43B 3AS1A 5GGVY 1WZ1L 5EO0B 4ZAKC 5D2NE 1NLDL 1TSHA 4BGLA 5BZWA 2KDGA 3HS0B 4IKLA 2VR6A 2X09A 3GBEA 3MJ9A 5F7FA 4ZUWA 3IFOB 4LGRB 1VGEL 2F19H 4NUQA 5D5MF 5I6LA 1E4HA 5D7SL 2DWEB 4FYQA 3SDDC 4AEHH 1J9QA 1AO7D 4TLSA 4YHYC 2GC4C 3E8UL 2X6MA 1XEUA 1QI5A 3EBHA 1CLYL 3OC5A 4PJDB 3FS9A 4KZCA 4Z7OF 3EFFA 2ZOTA 3PABB 3BVVA 3WIIL 4HUNB 3QJRB 2B9BA 4TULL 1KGJA 3FUIA 3IDUA 5FGBA 2XX1A 3QXDA 4HUVB 5MEOB 5BOZG 3CHPA 3ECUA 2SODB 3I85A 4XWOC 1ADQL 3DUSA 3MBED 4CVXB 2AGJH 3EOTL 4X6DB 5BV7B 4IMLA 4MTMA 4WI6A 5F8QC 3SPIA 3V5HA 4AITA 4GG6B 1NJ9B 2R2CA 2DLHA 2FK9A 1IQWL 2DYSB 3VMOA 1EWHA 2XJKA 4HK0A 1OZUA 1NTDA 1E3XA 2AEWA 1ERNA 4XGZA 2A6JB 3GIVB 3WFZA 3UAJD 2VC2H 5A2CA 4OZIF 2DWDA 4LCWE 2EYTB 3IBEA 4OJYA 3IJ7A 1BD2B 4F8PA 2B08A 12E8H 4DPAX 3QPQC 4XBEL 1JERA 1I8LC 1I8UA 1QSFB 5TDOA 1ZHBB 4G82A 3NA4A 1S7VA 3V2AR 4ENZA 1F11A 3U0PA 4LKXB 1IC7L 1VZHA 4N0YL 5GRWA 2BHYA 4A7VA 5JW4M 1RKRA 5T1KD 1E5CA 4P46B 2BOBB 2W60A 4U49A 2HG0A 4ERSH 2DIBA 5JQ6H 1O7DC 2NSXA 1EJOL 4UQEA 5IBUB 5IUSA 1ZIAA 3F7VB 4CADB 1CB4A 4EI5A 3B2MA 4NB7A 1BG1A 1DJIA 2WCGA 3EDEA 2J56A 2J88L 3IAGC 3LD8C 1ZK5A 3LPFA 3O6FA 5D1ZI 2PNDA 2WGNB 5DI8B 3QIBA 4ZD3L 3RIAK 2IQAA 3EGSA 1LO0L 1R24B 3NJHA 1A6WH 2Z93B 1RZFL 2YD5A 4WO4A 1FSKC 3QDAA 3S0PA 4EZMA 3IS0X 3N41B 4C8XA 1FCGA 5J13B 1QRKA 1U8LB 1W0YT 4OJCA 3TEYA 3WTSA 3E38A 3TESA 2LABA 4R8WL 2WWKT 5GGSY 4ZMWA 1ITBB 2A9NL 3D1MC 5F9DC 2HX8A 3DUUB 4ZFFB 3KWWB 4U2YA 3NZHH 4U1HA 4GMTH 1NAMB 1DBMH 1EQWA 1SMAA 4PTTA 1I1FA 4AENA 1Q94A 3AAZA 4P5MB 3DIVA 1AGFA 3OKMA 2FBJL 2V5RA 4ODWB 1S7XB 5B3SB 2ZUXA 2UUDK 5D55A 3SE8H 3VI4A 1R0AL 3MLPA 4DN3L 3PG2A 4CMHB 2FJFB 4JKKA 3KLSA 2IQ9L 4ODTH 3X3GH 3UMTA 1YVLA 3ULSB 25C8L 1FYHB 4MZIA 1NDMA 3FJTA 4ZMXA 3BE1L 1D5XB 3DHUA 1D5ZA 3VTMA 3N91A 2D2CC 2ZXWB 5FFOA 4FXKB 1SOSA 4NC1C 3P4LA 4MJIE 4Y19E 2O6FA 4CU7A 4ODHL 2DM7A 1FV1A 4IRJA 4MB5A 3GMMB 2W38A 1QSFE 3SDYH 3L3HB 4NXSA 3SPCA 5B39A 1XF1A 5FW7A 3S97C 4Q2ZA 4BUQA 3TV8A 4JKPH 4Y7MA 1YNLL 1RUQL 4UIKL 3B1TA 2DTML 1ZWIB 2OMZB 5LXGH 2BWIA 5K1VA 4QHKI 2BFGA 3UYPA 4NKOA 4AKPA 5EOTB 3SDCB 2NT0A 1QA9A 1B4LA 4UTAA 1KCWA 4UYPA 3MLRH 3ATEA 4PSPA 1JZGA 3RA7L 1ED3A 3NPSC 3D09A 4PI0A 1CCZA 1X5AA 3FT2B 2CZNA 2IADB 3G9AB 3KPSE 4Z77A