4RHEA

Crystal structure of ubix, an aromatic acid decarboxylase from the colwellia psychrerythraea 34h
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
202
structure length
202
Chain Sequence
DFNGKITLAITGASGASYAMRLIECLIAANYQLYILCSSAGRIVLDTEVGVKIPSSPDAASKFLTEKYQAKDQQITVFGKEQWFSPVASGSSAPKQMVVCPCSTGTMAAICHGMSDNLIERAADVVIKERGQLILMVRETPFSTLHLQNMLSLSQQGVTIMPASPGFYHKVETIEDLIDFMVGRVLDHLGIEQDIMPRWGYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of UbiX, an aromatic acid decarboxylase from the psychrophilic bacterium Colwellia psychrerythraea that undergoes FMN-induced conformational changes.
pubmed doi rcsb
source organism Colwellia psychrerythraea 34h
molecule tags Lyase
molecule keywords 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
total genus 67
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.-:
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 4rheA00
1P3Y1 3ZQUA 4ZAGA 4ZAVA 4ZALA 4ZAWA 3LQKA 1MVLA 3QJGA 1QZUA 4ZAZA 4ZANA 1SBZA 4RHFA 3WISA 3MCUA 1MVNA 1G63A 4ZAYA 1G5QA 4RHEA 4ZAXA 4MWGA 1E20A 4ZAFA 2EJBA
chains in the Genus database with same CATH superfamily
3VC3A 5CH3A 1MO2A 2PMKA 1Y6RA 4NJMA 5AK3A 2AF4C 4ARZA 3ZTWA 4U8GA 4ZK2A 2QI9F 1A9YA 1HFKA 2RARA 2GPAA 3WL7A 1XMPA 4YT5A 3D0KA 4P7KA 1E7QA 1ZR2A 1HE2A 1TAHA 2C7GA 1QOPB 3A9CA 3C14C 5A7GA 1ZOPA 2NX2A 5AK6A 1MH9A 4DF3A 1OF1A 2ASEA 3LA6A 1S8AA 5DVZA 4RBNA 1UBKS 5FEUA 5CDUA 1D6SA 1XWFA 3E2MA 2B1IA 2K6GA 5AICA 2JFXA 2PBZA 2O2GA 3MWFA 4UC0A 1VMAA 3VKUA 5D3KA 2V7QA 3A05A 1XQ6A 1FVOA 3KYCB 2I1WA 4PXSA 1IE3A 1JPJA 3IVRA 5AK4A 1B8UA 2OZVA 3TX6A 4BFZA 4RDXA 4OGWA 4YMLA 5EZQA 1KZ4A 2IEBA 2BEVB 3CBGA 3R5KA 2C97A 5AVZA 2B78A 4JFAA 5AVQA 1OI4A 1W19A 1L4YA 3V8MA 2X6TA 2Z30A 1T1JA 3ZGZA 1NUAA 2GKGA 4PAOA 1AURA 1ZK0A 4Z0PA 4Z4IA 5JNWA 1TJYA 4IS2A 2OB2A 2YWDA 3L40A 4FQ7A 2O48X 3MOIA 1KTIA 3C3MA 1Y4AE 1C0KA 1YZVA 1QLHA 1V4NA 3QE3A 4P36A 5AJXA 5FPTA 1NC1A 2EGGA 2H0QA 4LMPA 4NL4H 2O2EA 3PRYA 5A05A 3QVJA 4BVEA 3LC7O 4D02A 1U8EA 1MQ9A 4RYDA 3W6UA 4Q9NA 1H65A 3NIGB 2PX8A 3K94A 2B8TA 3QFRA 3NNSA 1DWQA 3MGAA 1KEUA 2JARA 3CVOA 1J5XA 1K6EA 3GLFE 1TXGA 3WY9A 3C8ZA 4DLVA 1UZUA 1RBZA 4G9BA 1AGPA 1YUBA 5TE9A 3KR9A 5ILGA 3G0IA 1VPLA 1DC6A 2IYVA 2PN1A 4HK4A 4TZ6A 1IONA 1K5GA 1YULA 4N5MA 4YPOA 5LYJA 4P53A 4GFDA 3BYZA 4R2JA 3BFKA 5C3UA 4AO8A 1VFNA 4BBJA 1OFTA 1ESMA 4YO8A 3FUCA 2XUPA 5AI9A 1K7XB 2O9JA 1UR5A 1WKCA 2XNCA 3VVLA 1ID1A 1WAMA 3QFFA 5L4SA 1Q0UA 3PC8A 4CEHB 4A0HA 3NEPX 2ZYTX 3P2KA 1T3LA 5G4LA 1T5BA 1RZUA 1R12A 1TYDE 1UKEA 3FZQA 3UG6A 2OAP1 3GT7A 5KS2A 3PHCA 5F21A 1HTTA 4FS8A 5B7NA 5BY2A 3LY8A 5CT4A 4KWCA 1DWOA 2PH7A 3TNLA 2X2EA 2GN2A 1UIMA 3UW1A 4Q37A 1VGRA 4ME6A 3G85A 2OV4A 5HSGA 5IJ0A 1L0BA 2C4TA 3K5HA 5CDYA 4MCHA 3HL0A 3II6X 2VYVD 2WYWA 1GPJA 3B1KA 2NUAA 3TR0A 4ZT7A 5FOXA 5FIUA 1ZGJA 2P3LA 1P6UA 1RE0A 2DCMA 4JVNA 4PXAA 4DLPA 4IGIA 3LUAA 1OXBB 3ESXA 2P9JA 3CU5A 4O4HA 5FUMA 3IX7A 2W2KB 2PQ0A 4D9MA 1XZAA 3UHFA 3JQRA 3P71T 4IJUA 1OC2A 1OFHA 1M6VA 1VE7A 1Q0TA 2EGUA 5TS3A 3UC5A 2AKYA 2R7NA 4YJ3F 1TU4A 2SKDA 1R0KA 5EESA 4ZZ0A 1T9AA 1KVTA 2Q5JA 3LCJA 2II6A 5INTA 2AFIB 4G0UA 1SY7A 1P39A 1K5PA 3WOHA 2XYPA 4FM9A 3F6PA 1WKVA 2VYCA 2WFAA 4ND8B 4DSNA 5SY6A 2PRYA 1Y1SA 3RYHA 2R6HA 4HHEA 4JB3A 3VKHA 4W5OA 3PWSA 1RWNA 4LNUA 4Q82A 5CCDA 4TUYB 2PHZA 4S05A 4O02B 2ZIZA 1AIPA 3QLJA 4KXFB 4V24A 4GDFA 4KHZA 5A1JA 3G0BA 4V3CA 4LX8A 5I7EA 1ZUHA 3AXSA 4RMHA 1M6NA 2LTAA 3QYPA 1Y5IA 3OCZA 1G2OA 1VL8A 3ZV3A 4URVR 1VB3A 1PZXA 4G65A 3BGIA 4HDNA 1U2EA 4F2HA 5BRJA 1PLJA 3ASZA 5J5VA 4BC1A 2G72A 2G63A 5DTIA 4DQVA 4ZYUA 2BTQA 1WUHS 2MSWA 3M7IA 1NZJA 2VDKB 2QV0A 3K96A 4Q1BA 3DVRX 2YYYA 4I5FA 5IH3A 3TO5A 3OZAA 4BAZA 2BEWB 2WTEA 1YIDA 1Z8DA 1JB9A 3ZBTA 3G0HA 3A1WA 3OF3A 5K8LA 2X1MA 1P1KA 5FCDA 3GT3A 1CFZA 1X7XB 4JB2A 3WWDA 1UJ5A 4IXTA 4EI9A 5JQWA 4EAQA 3BUSA 1Z15A 4WBNA 3FBGA 3EZ7A 4J2HA 4IOJA 4Y6SA 2YXBA 1CQXA 1F9EA 5G53C 2FDCA 2G9VA 3U7FB 3NIDB 4QOEA 3AGQA 1LQUA 4D5EA 1QGUA 2R1TA 1NMXA 1JSRA 1JZSA 1IPHA 2O1XA 3PD7A 4YCJA 3D81A 2BDEA 3HXLA 1XZGA 4GX1A 5GWXA 1M9NA 1O1YA 3VJLA 2FX2A 2JH8A 1L5ZA 1O96B 3N74A 3TQRA 4A8HA 4BGEA 4NG4A 1GPYA 3AUXA 4IVPA 3B1XA 2ENWA 2FFAA 1Q0QA 4PYQA 1B7GO 1QF7A 3L7NA 4FB5A 2PAFA 2YZKA 1T1RA 1T2AA 3ROEA 4BO4A 4CKXA 4G9GA 5TARA 3K35A 3ZV5A 1OIWA 3FTCA 3VH2A 1H8EA 4JR0A 1CRQA 1H66A 1RM0A 2OZKA 2XF2A 2VH5R 3IB3A 4ITUA 4MVWA 3UJDA 5ITWA 2QM0A 2CL5A 1RR6A 1TNDA 3LO5A 3GPLA 5I4BA 3GPIA 3V1LA 2VZLA 3DV0B 1FS5A 3KAJA 2IV2X 1A3CA 1LNZA 2CCGA 4J90A 5EPEA 1GFSA 1V5WA 1YVUA 1AZSC 2YOGA 2ZPAA 1UZLA 3PEFA 5EJMA 5IAGA 3WLHA 2AE2A 1QO9A 2FCRA 1RLOA 4CMHA 4JCCA 2DZDA 2AUMA 4G86A 5GV7A 5CBPB 4B32A 1N36B 2O0MA 4V0MA 4AZTA 1T8YA 1Y7TA 2NLOA 3ES9A 3LZ6A 4O4HF 4ZARA 4PEVA 3ZDRA 4KMRA 2WHPB 1BQ4A 1THTA 1GA6A 1AKWA 4WBSA 4BLQA 2X0JA 4C6TA 1RM5A 3T34A 3V4FA 2XQJA 4L4UA 4HLDA 2GX6A 3OCCA 1WDWB 3WK7A 1C4OA 3IRVA 5IAEA 4AUNA 2QLNA 1J6UA 3RB8A 3HB7A 2A30A 3BDIA 1L4MA 1NU8A 4YA6A 4KI0A 4QQRA 3W79A 2J31A 2NYUA 1QZ3A 2PD6A 4HGQA 5JNSA 4MVJP 3UY4A 5L8VA 1TFUA 1E58A 1G20A 1ZIYA 4JXKA 1NSFA 5F35A 2A78A 5JSKA 5HE8A 1UMBA 1JVNA 4H3KB 3AUFA 2EP7A 1N8SA 3RS0A 3KEOA 4MA4A 3LBYA 1UC4B 3C3DA 2UZIR 1X1DA 3GLVA 1VE9A 3PZBA 3SM9A 5BNWA 5JFTA 4X65B 5BYJA 2W43A 3QFSA 2WV9A 1ZIPA 1WXQA 4CM1A 4AD8A 2OYRA 1IHYA 3DBIA 2XEXA 4BQQA 5IWCA 1JW9B 4PZ9A 1SQ5A 3BH0A 2AK3A 4G0OA 4MUIA 1JJFA 5G1OA 3N0VA 3GEGA 4I3HA 1QH8B 4N7JA 3WTBA 1VBKA 4OP2A 1Z2DA 3ORQA 3IXQA 3O8DA 1RYBA 4KFSA 3RTCA 3CVJA 2FEAA 2FPSA 2W71A 3ILHA 4JJAA 4JLJA 1FFSA 3ELUA 1Z0AA 4A03A 1AA9A 3RVOA 3SK0A 4PHGA 1OKKA 4MKHA 4ND3A 4KDFA 5EQDA 1BJTA 3TLXA 3GJYA 5DFAA 3J7TA 3RTGA 1LC0A 4UM7A 4KYVA 1KNQA 2IYOA 1WZNA 3OEWA 1GKUB 3VR4A 5B7PA 2XIJA 5H7XA 1UPUA 2G82A 2NZYA 3NIFB 4ZVPA 2HREA 3DEIA 3LTNC 1UC5B 4YXWA 1MEEA 1MIOA 1TM3E 1BCSA 4L7QA 5E6RA 2BUBA 2GBGA 1PG0A 4UARA 3ZDQA 3PUWA 1P6XA 3D1VA 4KR9A 5IFLA 1Y42X 3D5TA 1XCLA 3T0GA 4IQ0A 4WEQA 2W2LD 4L95C 3NDJA 5A0TA 4GLFA 1VI2A 2PD3A 5I8WA 1GG2A 2JK1A 2QRPA 2DFLA 4UQOA 1QHNA 3BE8A 4GMFA 3B2NA 3IP7A 3FNEA 4BV8A 1KORA 1C0EA 1SZPA 4JIGA 3ID6C 1PTKA 1PT8A 1YDWA 2QENA 2Y0PA 2ZIGA 1MC5A 1IG0A 3DAPA 2ZSAA 4IIJB 3ZW7A 1B8VA 3CRRA 4YS6A 5E9WA 4ZYVA 3FNBA 2O5EA 1QXSA 5ALXA 3C3CA 3TNJA 3VMMA 4B40A 3RHTA 3U4QB 2VWHA 2FZKA 4TSFD 2FN9A 4RKWA 4WUTA 5EWLA 4AS2A 2IYNA 4F2DA 1U2RA 3M4XA 4CCYB 3VR1A 3KK0A 5EUQB 1F2VA 4ESVA 4EKEA 1QVRA 4O1IA 1JHMA 3ETLA 2VPQA 1VKZA 3GG9A 3IT0A 3I1JA 3LQ2A 3G89A 1NI4B 4LC0A 4JSRA 5HKLA 1SOUA 1CY6A 2J30A 1ZUWA 2PT7A 1QG2A 3KJXA 3NTQA 1SUPA 1V3VA 1XLTC 3GQBB 1VLMA 2HEGA 3LHSA 3LYAA 3EXG2 1P1HA 3HH8A 3T3OA 2ARKA 1ST2A 5KVAA 2XMCA 4DBZA 1JHYA 2BR3A 3KS9A 5TB5A 3TJZA 4BBPA 4OMUA 2FSVC 3TSOA 5JCZA 4KR7A 2B4YA 1WR8A 2J9FB 1ANKA 1HY3A 1OYYA 3JWJA 4HTFA 1L9XA 4NH0A 3PXXA 4GR4A 2D00A 4B84A 4JB8A 4FYMA 4GYYA 2UYGA 4FMDF 1ZVJA 4BKMA 4OREX 4X44A 5ELMA 3X2SA 4EL0A 1MKYA 4ED9A 1G8PA 1GNPA 1ECJA 2JNWA 3GJRA 3H97A 4I1UA 4DUGD 4ZC1A 1GVHA 2ZVDA 3QUSA 3ZH2A 2NSYA 3DDHA 4IO0A 1JYSA 2D4HA 2QQEA 3S2EA 5KHOC 4C4OA 3PC3A 1DEXA 2IXEA 3BVPA 3KKOA 3M5PA 4H7EA 4C76A 1NXOA 4DHEA 4MYUA 4QLBA 2GXAA 3BGWA 3ESCA 1TF5A 3RVPA 5CT9A 2H16A 4AURA 2J6CA 3LXRA 3A9VA 3BH6A 5DYGA 5K51A 4GYJA 3S70A 1XFAA 1E9SA 1TTPB 1ISHA 3NAMA 4BN0A 1HTWA 2REQB 3M83A 2P41A 4AZ0A 3PTLA 2GZSA 1RI1A 2QW0X 3NHAA 4RK0A 4RJKA 3UNXA 2DBYA 4GGOA 3NU1A 1GNTA 3L4KA 2D2IA 1MRNA 3C74A 4UEKA 5DLQC 1N5OX 4R69A 4LK3A 3WZLA 1X39A 3DE5X 4LNAA 1S9DA 1BN7A 4GMHA 5E4YA 5M04A 3Q8MA 2BFNA 2XZLA 4HDNB 3EULA 3FUXA 5A4IS 3I9MA 3CBQA 3JQCA 3JVIA 3LBNA 1P29A 3Q6IA 4RACA 3ZK7A 4KBGA 4GP9A 3WWZA 1ODSA 1UOPA 2FMKA 3TH5A 4TXJA 1ZM3A 3O2QB 4JEHA 3GT4A 3P20A 1JLRA 1R6XA 2IKSA 2YQ5A 5HJ5A 3EJ6A 2GQ0A 1FQKA 3EF3A 3Q12A 3V8RA 1AOXA 3I64A 1W581 4DLWA 3EEOA 1LK0A 2XMRA 1XZBA 3GI1A 3LY7A 4UVEA 4G4JA 1MX5A 1ZH2A 1U9ZA 2QMQA 3AJRA 3EGEA 1JX6A 1FRVA 5B4TA 1ZK4A 5DE3A 4X1IB 5CNJA 1BU5A 3UMJA 4PGFA 4HY3A 3HA7A 4DEVA 5I6DA 4J1QA 3L4EA 4C7BA 5JPIA 1Z5VA 4OA8A 4A0RA 2NSHA 4K86A 2PPLA 3AV3A 3TWOA 1Z8FA 3BORA 2AOUB 2WIBA 5JR3A 4V38A 3WDLA 2H7YA 1UWKA 5FUWA 4KXMA 4I2NA 1L5KA 1X1QA 2OESA 2DQZA 5G0TA 4D9EA 1SCUA 2Q8PA 1MVNA 4DDUA 1VHLA 4HC4A 2QGFA 2X86A 1LW7A 2A88A 3DEFA 5LDGA 2A94A 2ZUTA 4DUYB 4M7OA 3K9FC 1S01A 1IPEA 1NG9A 3P5BA 1XEFA 5JCJD 3FYTA 2OPBA 3F8TA 4JOQA 3TXXA 1NJ8A 1Z29A 4HFJA 4J91A 4FNMA 3OHPA 4G37A 2L19A 5LP6B 3KVYA 4IXWA 1PL0A 2PZJA 4L0DA 1U8TA 3OWHA 3OY2A 5M7EA 1HE3A 2PBRA 4ZV9A 5K6AA 1KOLA 4FR2A 3NT4A 1AGRA 1SIOA 5ALPA 1TQ8A 1ZI6A 2H7XA 3HJAA 5AFSA 1I7DA 1D9XA 2QORA 3S99A 2J9YB 1G64A 4AJKA 3GQVA 3A7DA 3FGNA 3KZMA 1ZVKA 1JKFA 2DOKA 2HTEA 2ZSHA 3DM9B 1G4AE 3O9MA 4B9EA 4EA8A 1FFYA 5KBYA 1P3JA 1RYFA 4QUJA 3EZ6A 3D1LA 4R2XA 4CGYA 1LK7A 3KPJA 1KK1A 3FETA 1JHRA 4Q4LA 3NVAA 5J2UB 2X22A 3L1UA 1CF4A 1XMJA 4AJHA 1Y1KE 3M6UA 5B5SA 1A8IA 4TVBA 1H2EA 4HAVA 1U28C 5L9AA 3U4QA 1T8RA 3GW8A 4P2GA 1RPTA 2F8TA 4WXHA 4NEQA 3WFJA 2Q41A 2Q0HA 4TKVB 3P9KA 2C82A 2E9SA 4DLNA 2CXQA 1FP2A 2APJA 3TZBA 4OM7A 4II3A 2WICA 2CYBA 2EFEB 2J4CA 4HEA6 2BFMA 1CNEA 3UCFA 1C1YA 1T25A 2VUHB 2NU9B 2AI2A 4MO2A 2AXQA 3B70A 4C06A 4QQ8A 4O4JB 3UOWA 4P84A 1FUKA 1PNOA 3OQJA 1CW2B 1U9IC 4OGLA 4QU5A 1NVEA 5MF6A 1LV8A 1Y1LA 5FKJA 1T1SA 2VUSA 3BT7A 3KWMA 1BH6A 4EB6A 5FV4A 2CB9A 4AKTA 4W5NA 1J90A 1N6OA 2PG3A 3BB3A 1PHPA 3H2YA 3RIHA 3IT2A 4FWTA 1OH5A 3GDOA 2AXPA 1C9DB 1VHWA 2R4TA 3T7JA 3EXIA 4YRTA 3B3QA 1FNSA 4LXUA 1EWQA 5G1PA 1SURA 5FLEX 5TEWA 1KEEA 2ZLBA 4KWIA 5BYBA 1EP9A 5FADA 3HU2A 4EKGA 4ZYZA 1QGUB 1NN0A 4IW3B 5FI5A 1L3CA 1HL3A 3OUUA 4DV1B 2RHMA 3OM1A 4A36A 4GM4A 4XX1A 5DCUA 1BEZA 3JU3A 4RNDB 1J0XO 1G38A 4FHDA 2YTZA 4FW8A 2NMVA 2PFKA 1YKSA 5ECGC 1GPKA 3IAAA 2JGRA 2XOXA 4YRFA 2VF2A 2C5GA 3GJTA 4MQ4A 2CLHB 3L0OA 2JHPA 1JA1A 2WA1A 1M2OB 4EY6A 1JEJA 1KO7A 2CF5A 3SQXA 1F8YA 4N0EA 1Y4DE 2VA9A 1HOTA 3MRSA 3N2EA 1FTWA 1SQ6A 1C30B 2FFJA 3KXDA 3ZXXA 4CR6A 4BE7B 3EIHA 1CPYA 1G4HA 4NOMA 3G0OA 3Q7QA 2JKZA 2VP4A 4FZVA 4IMIB 4D26A 1NUSA 5ELLA 1NI4A 3TRFA 4EENA 2OECA 1J00A 5ALYA 4XJSA 2ZJBA 3WWCA 3AK4A 4QVGA 3C1TA 4UDNA 3C3KA 2DTEA 5JIBA 4IAOA 1FYWA 1T4CA 1RD4A 1M33A 2OCKA 5D84A 1ZJWA 3LKDA 3A0RB 5DLDA 5REQA 3CF6R 1KEKA 3EOZA 4TWZA 1OXXK 1P31A 4Q21A 2Q5FA 2QU8A 3IUSA 3KOUA 4HNTA 3KV1A 1LBIA 1MGOA 4XD7A 5HQ3B 3NHSA 3OM0A 1NW6A 3KKKA 3OQVA 1UEXC 1V6SA 2GILA 3AM4A 3D5EA 2XXBA 5E8RA 4HL6A 3HCAA 4QPNA 1UJBA 4KMSA 3K0CA 1QQ7A 3C70A 4KZKA 1RLIA 2QN6A 1ICEA 2IHKA 4ZRDA 2O3SA 4XVHA 3AMVA 3MLAA 3PQ6A 1DLIA 4Y6RA 1A2BA 3KUUA 2JJYA 4DVJA 2QG4A 1U8XX 3CUVA 4FZJA 1SQFA 3L79A 3PT9A 2O06A 2ORVA 3R5SA 4MAAA 3VAZA 1H5NA 1Z68A 2JRCA 1SEPA 3P9PA 4CG3A 4YY3B 1SG0A 2NZ8A 5A03A 3CLSD 4FCTA 4P0PB 4I4IA 3FSGA 3GOHA 2JRLA 4PVCA 2GCNA 2HB6A 3KQSA 3P8ZA 3I73A 2X0EA 1H42A 3WADA 4TMXA 5U9CA 1RVDA 3ZE8A 4XGRA 1SUWA 1U0OC 2HU8A 1M1UA 1DAPA 1EM6A 5AHKA 1Z5WA 4QDOA 4RLQA 4EO9A 1PLKA 4D8VA 2EARA 3X2FA 1IY1A 5B30A 2GARA 1W1UA 1VP3A 3TZHA 2WMOB 2ZJ1A 2V7VA 2ZYVX 2JC3A 2QQGA 2MTBA 2DSNA 3AJEA 2CT8A 1F9AA 4FX5A 4MI1A 1UZMA 1RCTE 1LWNA 2WIFA 5HR5A 1ZM4A 1RFGE 1C7ZA 3AESB 2NXCA 3VHXB 1E1MA 1J0CA 1HSZA 2XUQA 2EWMA 4D4GA 4HRYA 2V4ZA 1DRUA 5DGHA 5MN4A 3GMSA 4J0EA 1VE1A 2UYYA 3AFOA 3EE6A 4MS3A 5AKGA 4YUAA 3BH7A 1ZD5A 1EFRD 1GLVA 3LCMA 4MA5A 4PY2A 5I9TA 1VSUA 4HLQB 1PJZA 5KVCA 4RM3A 5EN4A 2X14A 1SUBA 5I47A 4WASA 1VSBA 1BW9B 1Z74A 3F9CA 3O3NB 2PH5A 3PEUA 1JALA 1QHEA 3X1WA 1ZD2P 3BD7A 1L3BA 4AG6A 1EJBA 4LJ5A 4DYVA 4U7DA 3FB1A 3QUAA 1V9LA 3E05A 1NQ5A 4JITA 2OB1A 3RAEC 4A10A 1VPEA 4K26A 1U2DA 3ESDA 4D9BA 2A57A 4TSKA 3IDQA 5EE9A 1E9EA 1SHJA 4BJ6A 1BWQA 2CLCX 3G9ZA 3NOXA 3DEZA 1DDOA 3GFVA 2Z6AA 1P60A 3AX6A 3L07A 4DADA 1NF9A 4UAGA 1UKBA 2C7VA 5CNMA 3K1TA 5KTNA 3HP7A 4DZZA 1BS1A 4K9QA 4ASUD 3CN7A 4HVAA 1X94A 4H08A 4BLUA 4OFZA 3VQTA 4I1RA 5FI1B 4YCMA 2XE8A 1U3CA 1XELA 3HWX1 1BVYF 4C4TA 5BMVA 2KMLA 3DXFA 3B5EA 4NENB 4RMGA 1ZISA 4Q9HA 5AOCA 1KRXA 1VJ1A 2O4CA 2AH5A 3R5JA 1CUIA 4DDHA 4S1TA 4OLJA 1WW2A 1EX9A 1C8BA 4F5WA 3X0DA 1W4BA 1T8UA 2OLJA 1NXPA 3GO4A 1RHUA 2J8ZA 5JI3E 2WWXA 2Q7XA 3OWXA 3IILA 3VNBA 1P2SA 2AFHA 3DOEA 1R6AA 2AZ4A 4AQYB 4XB1A 2XZTA 1KFJB 4GBMA 4NH4A 4DLSA 1FQOA 1WU8A 2I99A 4LE0A 1PNTA 2WDZA 4X20A 5KYXB 1V7QA 4CJXA 2A5GA 3RYFB 1MH1A 1ULAA 2C4NA 2PO7A 1N0WA 1NBMD 1V7ZA 4LXYA 3SZGA 1C5KA 3DZDA 4DQUA 1CE8B 3BMOA 4Z99A 3O26A 1ENYA 5TV2A 1BS2A 1Q0ZA 2YMQA 4M1SA 2OGUA 3EEFA 5JJLA 1BKYA 1KMCA 1PR1A 1LI4A 2DT5A 2ZTHA 1J7JA 5F7JA 4D0NA 5TX7A 4F3NA 5JFGA 3HVHA 2CHVA 1DG9A 3L4BA 2AJ8A 3W34A 1CQIB 2IBSA 1GTG1 4GRDA 4MR9A 4P3PA 3AHCA 5LQJA 3W5AA 1CHNA 5IJXA 1RWOA 1OT5A 2NSJA 1BOOA 2JFUA 3HVUA 2IS4A 4RVOA 5IKOA 2WIAA 1I2BA 4QRIA 1Q1AA 3H6HA 2CXSA 4JC5A 3HXQA 2JCSA 1UBLS 4OV6B 3ICWA 5ECWA 4N48A 4LNUB 3OKAA 1HT0A 1T4CB 2LUOA 1P17A 1IEQA 2X9NA 2G88A 2Y1DA 3O47A 4AM8A 1I30A 3BSWA 1LPAB 1B16A 3DAGA 3GA5A 3V2HA 3RYCA 1MV5A 2PZ8A 1RI4A 2BY4A 2HLHA 4LY6A 2GT1A 3IBFA 1R0ZA 1W5BA 3IHWA 5GJCA 4QQFA 1FMLA 2JGNA 5EHZA 1ISPA 4RLFA 2PV0A 1UC9A 3QPAA 2GZRA 4M98A 5GM2A 2W4IA 3O4VA 4FHZA 3OM8A 1S2IA 4NE2A 3RASA 2PX4A 1RWQA 2Z6UA 1C7IA 1N3YA 2W83A 4EG0A 3AL0C 3IQGX 1V8ZA 3H13A 2J1LA 3L0YA 1X15A 2VAPA 3EISA 3P2JA 4MS1B 1YCHA 2IZZA 1I3KA 2BZGA 3AJDA 5IYZF 1DO0A 3QTLA 4XRRA 3MVEA 4ZYXA 2VHXA 3JAKB 2PMFA 4ZDJA 2GJKA 1Q1NA 2H1VA 2PUEA 1P19A 1CUXA 3PKZA 4W1SA 2G3YA 2X8WA 1IVNA 4MJ7A 3JQEA 1EFHA 1FYFA 3I1FA 3P9CA 4JJ7A 1KRWA 1MV8A 2D2VA 4A4DA 3EZ9A 3AI2A 4YV2A 1AKVA 3KSDO 3JV7A 5HUHA 2DJ5A 5EA2A 5K8VA 1Q0SA 4H18A 2Z6QA 1AGNA 3R5XA 4BX0A 3P2EA 1IG3A 3I8SA 1P61B 1OX4A 1OA0A 1V3QE 2AMYA 3VPGA 3VTFA 5KTYA 4BEVA 5L95A 3UB3A 4ZD6A 2P9EA 3WRXC 3Q9NA 5LQMA 2FCAA 2O3TA 4LBZA 3HJUA 3SS9X 2JBAB 4J43A 3WHKA 5ICMA 4UU1A 2I4LA 2VJNA 3P0EA 2HPVA 4LV6A 4NZPA 5C7YA 1PYOA 2RJ3A 2FZLA 3LX5A 4DCJA 4P1ZA 3JQGA 3VOBA 1ID8A 2NV6A 2XVMA 1LSUA 1W7AA 4XJVA 3BE6A 4TMYA 4DJ5X 3VO9A 4DXHA 2R8XA 3A3KA 5DHAA 4ZCSA 2RDMA 4CWAA 5D3MB 1P4SA 3NANA 4KQCA 4UBNA 4OUDA 3WGOA 4E3WA 5K0GA 3VYUB 3ZHOA 3DV9A 2O1EA 1JG4A 1F3LA 2BPOA 1ODIA 2JF0A 2O2ZA 4HYEA 2HA3A 1KFCB 4Z4GA 4C5AA 4NMLA 4TLMB 1N2HA 2L18A 1ZH0A 4PM4A 3SYNA 2BKXA 3PHLA 3T61A 2I34A 1ODCA 1QGOA 1XU7A 1DCTA 2AOTA 4B7UA 1UFKA 4MEAA 2EOAA 5G40A 4N3CA 4A73A 1VKRA 3H2HA 2GBIA 4MCJA 4ZVQA 1XJWA 4TZ0A 3TVYA 4ER5A 4JX8A 3CB4A 3H8SA 2GPYA 2IYWA 2O7VA 1QRTA 5GPBA 2VK2A 4UTVA 1B74A 1MC8A 2D1QA 2AWNA 3GGSA 3TZLA 1YASA 3WMRA 1Q0RA 2EF1A 1E1QD 1ZUNB 4LXGA 4OKNA 2NSDA 4RZSA 2VDWB 2IZ6A 2PVCA 2OA0A 3RABA 4GR5A 4N6NA 5T4EA 3PF8A 3J7AC 2ZG6A 4ABTA 3NHPA 3TOCA 3ZDZB 3IBSA 1VIMA 5ALZA 1PT7A 4KE8A 4QPCA 4JLSA 5EAIA 3UMYA 3GNQA 1EDZA 2ZIVB 5CYPA 4QNNA 4QOIA 1LSSA 1MOZA 4EPRA 4EX6A 5JU6A 3TRHA 1I3CA 3SHOA 1OV6A 3BL6A 3KOXA 3SMQA 2CLOB 4JJ6A 1OLUA 5E38A 3RREA 3FRHA 2FPPA 4DZTA 5LD2C 2O20A 1NUUA 1WHSB 5FLKA 4R9RA 4CPDA 3AFGA 4JI6B 4L8LA 5K45A 2A5DA 4NAVA 5KIAA 1IOVA 3P9IA 1MA3A 2VN8A 5G0WA 2I33A 3G8DA 4BIIA 1KY3A 2C95A 4H6VA 4IFBA 1XQVA 3QU2A 4EA9A 1BCRB 1J0BA 2POQX 4PLWA 3SYKA 1ZIDA 2EFGA 4PLZA 5IAJA 1FDRA 4EFDA 1YUMA 1A4RA 3PR2B 2H1HA 1AN9A 4EBBA 3QELB 2B36A 3LQ1A 2Q6IA 1XA0A 4RPCA 2L82A 4CF6A 3L43A 2OCGA 4FD2A 3EGXA 2BZ0A 3E7DA 5F77A 5J47A 1TCVA 2BDTA 1GITA 2BGTA 2YXPX 4E4TA 5B1EA 521PA 1GFZA 3ESBA 4I6GA 2EFJA 1W1WA 1SA0A 4LVNA 1J07A 5E7QA 1IUNA 1TW3A 4MWDA 3V8EA 4OHCA 2QL9A 1QLJA 1X7YB 1PO7A 1YU6A 3TSAA 4D3YA 2XMBA 1NUTA 13PKA 1VSVA 2RBKA 2X8BA 2VZ0A 3JRXA 1XI2A 2HHLA 5EZ5A 1E62A 1B23P 1FFXB 2A5LA 3GCGA 4L16A 5BT9A 4BO0A 1XMOB 1SR8A 4B8ZA 1YVPA 3L2OB 2WVHA 3D2CA 4ZT5A 3ZU3A 3H9CA 1E1RA 4RF4A 3IQDB 3K5IA 4IINA 2J59A 4ACAA 2GA8A 2WT8A 3NTLA 4RD1A 1LF5A 4NICA 4URWR 4ZALA 4OHYA 1JIVA 3KHUA 1NPYA 1R0SA 3LWBA 1QP0A 1D8AA 3B36A 3W06A 4F04A 4QXPA 2B21A 3N7TA 3OPXA 4H7KA 4NJOA 3T5PA 1OH8A 3E3LA 3G9TA 2ZXFA 3M2PA 8LDHA 1E32A 2QLTA 4Y2VA 2CMDA 1ULSA 1DCFA 1QSGA 5L3ZA 1MGPA 2A7XA 4G5RA 1RWWA 5E1DA 4O4LA 4DSOA 2I6SA 1Y1TA 2HL6A 4WXRA 5HFJA 4BJ3A 1BJRE 3LC2O 2GFQA 1N9GA 2Z1MA 1G6KA 1P1FA 3QU5A 4TOIA 3SAJA 3W7AA 4CI9A 4REQA 4ZVLA 5HZMA 3EUAA 3SYRA 1O96A 1QTIA 1NJSA 3REQA 5MFZA 1A1SA 3NYIA 1WM1A 4YLGA 3C2QA 1BSVA 2X1HA 5A4MS 3NYWA 4BWGA 5KYUB 4O08A 1BX1A 1DXOA 2QAIA 2AVNA 3E7PA 4U9HS 5FTMA 4D0GA 5K0JA 1HV8A 5EYPA 3LYLA 2VF8A 3L7AA 3O3MB 1U0FA 4QVKA 5E2AA 2DPYA 4KQFA 3SJBA 4NBVA 1AH2A 3W8NA 5E2IA 5J63A 1FJXA 4LAFA 1XTRA 3GY0A 4Q7LA 4WTOA 4N6GA 4CN8A 5JH7B 1T2UA 1KYQA 3R6TA 1ADGA 4IHJF 5ER9A 3HJCA 4QUAA 2AJTA 4K5QA 2IYAA 2AL7A 2P2CA 4P4SA 2FWJA 1G0NA 4J0GA 2PGNA 3KVRA 1P1CA 2HA2A 1CUFA 3CX7A 3SR0A 4AN1A 2H7VA 3LL4A 1FBTA 4HAWA 4Y2QA 2QR2A 3FZNA 3G82C 3N86A 4WV3A 3U4HA 4F3YA 4GZ6A 1P2VA 1H9CA 2IQIA 2OP0A 3TZCA 2CVHA 3V4OA 1Z18A 3STYA 2TSYB 5HFNA 1BEUB 2QVZX 1V47A 1BIFA 1MB4A 2JBAA 2LXNA 1LV7A 3D3WA 2FWBA 3NEAA 3OJCA 4FUTA 4RO0A 3U26A 1GHTA 2OHFA 3OZXA 3NFYA 3CE9A 1U11A 1BVRA 1UM9A 3TIGA 1N5JA 5ICCA 1TT5B 4UHCA 2X2FA 2BR5A 2GN0A 3PX7A 2DHCA 1PG5A 1T2CA 1XHLA 2H4JA 1DCKA 1D0VA 2CLLB 2HQBA 1SVSA 3HYLA 3EGCA 3PR1A 3WRVA 4F91B 5TVKA 3T3NA 1PQYA 4M6WA 2IHUA 4E32A 1SKUA 3DUFA 2Q5LA 2PX6A 4JHLA 4TQAA 1GA1A 4RPGA 1RYNA 4PRLA 3FKJA 4XKJA 2JIPA 4MUNA 4RZUA 3SHTA 2F8SA 2AXNA 1NMQA 2MT9A 1QWSA 4II7A 5A6VA 2PUVA 1EX7A 2HWWA 4V0NA 3GGPA 1TK3A 4V0KA 4P83A 1XGKA 3E22B 1V2GA 1KJQA 4FYKA 2CXRA 4TL7A 5FOVA 1ZHFA 4PN3A 3GCXA 5T6BA 1KAHA 2IGBA 4WXEA 3UT0A 1F48A 1Q84A 2NZXA 2G5PA 4U2CA 3AY0A 2VJDA 3NYRA 2YYSA 3CXUA 4RV9A 5TJ9A 2QTVA 2XQFA 1FFGA 3KQUA 3I2GA 4GPAA 2JZOA 2GN4A 2EBHX 5DYYA 4G07A 4B17A 4PBRA 2O5RA 1YE3A 2C5BA 2YXLA 3KZOA 1IM8A 5FA5A 3ZK9A 3J80A 1EVJA 1O9BA 5AI0A 1KJNA 4QBTA 3AERB 4JJZA 4DDKA 1IEWA 2OZLA 4HXYA 1UBFA 1G42A 4D9FA 3RCBA 1R8QA 4RKYA 4BX8A 4GRIA 3U1VA 1E5TA 1TUIA 3RPEA 3BIJA 4KGXA 4BNDA 5BRAA 3I52A 4BEWA 4JBXA 3IE2A 2ZM6B 3L0DA 1PDOA 4RKQA 3DFUA 4KKXB 1D4FA 3GQBA 4TYMA 1YGYA 3GBSA 3IUYA 1FDSA 2I7VA 4TWJA 3LNTA 4BGDA 2AG0A 2EIHA 3JATA 1ISIA 4Q48A 1N5KA 2CVQA 1Q1ZA 2XZDA 3LM8A 1B76A 2W70A 2BUAA 4KFUA 1PEYA 1Y3AA 4OX9Y 1K68A 1I7LA 2VLBA 4JKIA 4DSZA 5BV7A 4NARA 4CKBA 3DCYA 2AUNA 5AJUA 3AI7A 4I4TA 1EFAA 2YUIA 4BNVA 2AG5A 5GONA 4B4KA 4OQLA 4IVNA 5CPBA 2RK3A 1MF7A 1AUVA 3QKSB 5KMGB 1KEWA 3NLLA 2NYAA 5ADHA 1NFQA 4X1YA 2ZYAA 4KIJA 1VG9B 1O94C 3GU3A 1VL2A 3NH9A 4WE3A 4IO1A 2XXAB 2QRMA 3N5KA 3RFXA 2IS1A 2C2XA 4OVKA 2PUHA 3DE2X 3V4RA 4IVRA 5CA0F 4DG5A 4QJ5A 2WU1A 4R2HA 1ZEMA 1EB8A 2VP9A 3KR1A 1RJGA 1I3MA 1IULA 2I91A 2XH8A 2E1PA 1T8TA 1EWTA 3C5CA 4D43A 2ZUEA 4R8MA 3QNMA 5A06A 1UDCA 5HQJA 2PM8A 4C43A 1AZTA 2ID8A 4RVUA 3JQ6A 2I8AA 1L7NA 3IALA 3HFJA 1IU9A 3MXOA 3T0IA 1LRLA 2ORED 4XCQA 3BQNB 2YFQA 1M1NA 1JDSA 2WF7A 4BQFA 2QIOA 2C8LA 3EQ7A 3HN2A 4IX1A 4Q1VA 2RJNA 2G9NA 2HH9A 4N1AA 5GINE 2I1VB 1KDZA 3LS2A 3EFEA 4I50A 1BMFD 4ER7A 1BFDA 1G21B 4WK6A 4A8PA 1YS2X 4LSMA 3GMIA 3KSAC 3WJ1A 2HSGA 1SVIA 1G3QA 2P9TA 2VXCA 5TEVA 4YRAA 4ROSA 9LDTA 1FPMA 4YRJA 1WW3A 5C51B 3L01A 4RX1A 2V0NA 1FUIA 4Q7QA 1KP2A 2FPIA 3IKVA 2HWKA 4FEAA 4QARA 4WNAB 3R7BA 1WZCA 2BKLA 4A15A 4NULA 3HP1A 4KQ6A 1XZQA 1ZWLA 1NSYA 2G25A 2P1ZA 5ALIA 1DAMA 1D5CA 1T5LA 3DFFA 5DK4A 5AR1A 3ZWVA 4ZOAA 1Z56C 5KYYA 1IBMB 2ZWMA 3FUUA 5K8TA 1NVBA 4ZJYA 5JTTA 1GCOA 2XLBA 5GP1A 3ICVA 1NT4A 1WUKS 1Z88A 3A10A 3RUPA 3YASA 4OM8A 1X19A 2RGNA 1OWPA 2C5SA 3DXXA 3K2EA 4XQEA 4DRXA 2HK9A 4EHNA 4H3SA 2ADFA 1T15A 4TQ9A 5CB8A 2M6RA 3BSFA 1YFKA 4YQYA 3C6BA 4LRYA 1N2EA 4YECA 4G4GA 2F48A 3ESAA 5J43A 1UJMA 4KWHA 4COKA 3IFSA 5KNBH 1P4RA 1Q1BA 4BP3A 3ZGVA 2GYWA 4YRBA 1MX1A 2Y68A 5TRTA 1AT1A 1DOZA 2H54A 5I7VA 4KREA 2WOOA 4NYJR 2XUIA 4S35A 1RQRA 1NPTO 2QTTA 4JEIA 3O1LA 1MHPA 2BFBB 3ZEAA 1SOWA 1WJGA 2Q3BA 3OMWA 4K6MA 4NDAA 3V97A 5JAMA 1MW9X 2QTMA 4NV3A 1IBLB 4MARA 1E6UA 3AB8A 2IFTA 5BVHA 5JAUA 5EE3A 2LP4Y 2PDAA 4YV1A 1E1QA 4WNCA 3ZG6A 2M1XA 2RBEA 2ZCUA 1KZGB 2QVBA 3IMGA 3QOXA 1KU0A 5DXFA 2P27A 3VTAA 3VH4A 3DZFA 3HQ4O 5CGZA 4DJJA 4HUTA 5HZHA 1PK9A 1KJ8A 3RSOA 5B57C 3O8CA 2AOVA 4RJ2A 2CHGA 1M34E 4LECA 4AXBA 5JD6A 3ADCA 2PT9A 3QVUA 4KAJA 2MSLA 1SCBA 1XAGA 2Z4TA 2A9QA 2RGXA 1FXWF 1NQVA 2PX3A 2XA2A 3WLJA 1NJ2A 1HDEA 1TQDA 4OIMA 3ZS9A 3IEUA 4Y9UA 3NG1A 3RF6A 3UPUA 3AEUA 2QYTA 4G4SO 1NWCA 4I9FA 4BHTA 3HEAA 2P0YA 3NNDA 4BMXA 2HHAA 2PYZA 4MWZA 2OHJA 5DMHA 2FUCA 5C80A 5ALHA 2NAPA 3HNRA 2IPLA 1E9AA 1H6BA 1N2SA 2ZBQA 4KFTA 1QF6A 4F8JA 2MINB 1YHYA 3DBRB 3V1KA 3I2YX 3DC2A 5AKZA 1VM6A 4N7RA 4J6EA 5IN5A 1JHPA 4FR5A 1ZG3A 1IN6A 2V7TA 3FR8A 3N8GA 1T9CA 5C8YB 2QUKA 4KU4A 3T99A 3VR3A 1DRVA 2VTVA 1JQ3A 4D57A 4MQBA 4XM2A 3DHYA 4RV4A 2G1UA 3UFXA 1B3BA 1XK7A 2NZJA 4JOSA 4JP3A 4PPGA 3OIGA 3UJAA 4GR9A 3STUA 1BMDA 1TVEA 5EVCA 3M4JA 3C8DA 4RNCA 3KZVA 4C2AA 5JH7F 4RQUA 2OFPA 3BEDA 3LZDA 4B6RA 4TT3D 1TC1A 1JEYB 3G1WA 2QRHA 2X3YA 4MV1A 3PQEA 2A86A 1NBHA 2R87A 3GBVA 4Y2SA 2IWRA 5J2TB 4M89A 3O1JC 3Q3CA 1DO8A 3RYIB 2GVZC 1AN0A 1U8YA 1N6RA 1BCRA 2Q0QA 3P52A 4MP3A 2FHPA 2CMKA 2IOQA 4JS0A 4UFNA 4M6WB 3T38A 4DABA 4G8BA 3D7RA 1TLLA 1F7UA 2RHRA 4WN3A 3NJ4A 2OCIA 2XD9A 4BFUA 4L4RA 1FUUA 4PG6A 2ZUDA 4PU0A 4YGYA 5DNUA 2F8LA 4BECA 1V41E 1MNAA 3WXMA 4B80A 5JOQA 1EBBA 3HWRA 4GUAA 4RAOA 4V0OA 3T5BA 2CFSA 1B26A 4D82A 3IYLW 1XIVA 4ZJUA 1Y6JA 5HGXA 3GEEA 5JRJA 2IYXA 4XGKA 1NQTA 2D0PB 2PMDA 4AZSA 1RM4A 1XVTA 3KU4A 4U3JB 5ADWA 5LUAA 3PYXA 3OZSA 3DHVA 3Q3IA 5C34B 4FFDA 1GAWA 4OK3A 4V3BA 3VDRA 1CJUC 5J4HA 1ESNA 4DR3B 1VKJA 2B2NA 2WTAA 3PUYA 1SAYA 3TTSA 4DYHA 1GNQA 4PGAA 1YCFA 4YJFA 3A2MA 4I36A 1E0JA 2BDUA 2NOAA 3AKEA 1QVZA 1U7UA 4MVJE 3M3DA 1Q6ZA 4Q6WA 5AI4A 1LNQA 1T13A 4B5KA 4KEAA 1Q20A 3A1CA 5DTRA 4HGRA 2ZYSA 2E4YA 1B1AA 1CLEA 2H1SA 2P9CA 2XNHA 2WKPA 1DXYA 1T0JB 1U2DC 2C2OA 3WSVA 5J1TB 1A2QA 3G5TA 4ZQHA 3LLSA 3ECCA 3K09A 4Q4HB 1QQ5A 5CJJA 5B6IA 2O3QA 4HZUA 3PDJA 1BXKA 2F1RA 2V58A 3EIOA 2P6OA 4KPUA 4J76A 5F2EA 3S2UA 1T9ZA 3BGSA 5CYFA 1SCJA 1B73A 3RROA 3SEZA 2GBLC 2W7TA 3AP1A 3MTGA 3CUUA 1H1TA 2B1RA 3OIVA 2ZSUA 1LY1A 1NE2A 3A7EA 3F96A 3L6OO 1FS6A 4I6EA 3TE6A 3WZMA 1LGYA 2NG1A 3WGLA 1J8MF 3BULA 1NBMA 3HXOA 1FU8A 3PD1A 2POCA 4IKPA 2KX7A 5FBVB 5AP9A 2HR1A 3M6WA 1E2UA 1B0UA 1I6LA 1TCAA 2Z3VA 2UUPA 1IZZA 3HBNA 4KV9A 4WACA 4POAA 4XM0A 2PK3A 5D51S 3VDNB 4ER3A 1ZDMA 3Q7PA 4KDCA 3HUUA 1FRQA 3LDHA 1XMXA 3QKSA 4YRRA 4D9NA 1C7EA 5BWLA 1XZIA 1HEYA 1EIZA 2EQAA 1UMDA 3S8EA 1RAHA 3H17A 3IMCA 2BH2A 2CE7A 3AT1A 1EAYA 4E5UA 1YIAA 1GQ2A 1RHJA 2NO0A 1L7AA 5AKKA 1MB2A 2P30A 1E66A 2YV2A 4KQKA 2CBGA 3FH0A 2JHGA 5B3KA 1G5PA 4LSGA 1T5SA 3ORHA 5TT0A 3LVFO 3VAYA 4CV1A 4RC9A 4FMDB 5FRDA 1F14A 3RWBA 1GUDA 4PYLA 1PR4A 3QYJA 4UHDA 3W8FA 4BQSA 4UTNA 3M1LA 4BV9A 2B69A 3ECSA 1DTWA 2DWUA 1M2KA 1SIUA 4OMDA 1QE0A 4UTZA 1ZRSA 2HJVA 1PZMA 3QHPA 4QQKA 3OZBA 2Q4RA 3QF4A 4J16A 4KBFA 4EW6A 4NKRA 3ZYCA 3MERA 3GJ6A 2HCJB 5ENZA 2XKKA 5IM4A 4FKMA 4RVCA 3W2HA 1P80A 3JZDA 3JVUA 5DIZA 5LOVB 4BNJA 3TGLA 3CTPA 2PUJA 1DSSG 1U0HC 1HDYA 1PR6A 2C8VA 4EHJA 5DRYA 5T4BA 5L3SA 4X54A 3L1JA 1R66A 4RZIA 4EIWA 5JT1A 3B1JA 1KKLA 3DZ8A 3KQWA 2R8BA 4GBED 4GPIB 1KDYA 1T4DA 3S2FA 4A9AA 4F12A 4O29A 4E15A 1I4TD 4FYWA 2F43B 2Q28A 3JQ8A 1W4LA 5AW6A 1R9NA 2PZEA 4OHWA 5EHNA 1TQHA 3REGA 3KXPA 5BXQC 1CUVA 1MEOA 3TS1A 3WA7A 1TGVA 3CF2A 1QHYA 3M5DA 2EWWA 4P7JA 4WZBA 3RG2A 3SBXA 3UW3A 7ABPA 1G19A 4ZT4A 4GICA 3L05A 2Q1YA 4O4LF 3WLNA 1MHTA 2VVTA 1U9JA 1QG0A 3I9V1 4MIYA 4Q1AA 4BKQA 4RWEA 1DMSA 5E6UB 4PLYA 5CT8A 4OSPA 3O74A 3URKA 5DBGA 3EVTA 5DXAA 4YROA 1U1CA 3EIFA 1H2AS 3V2GA 4BVBA 2OOSA 3L84A 1JIJA 4XWOA 2JJ8A 3VHQA 5LVAA 3BHJA 4J7XA 2DLCX 1IBSA 1MZPA 2H59A 2XUFA 4ZCQA 2V7BA 2CNNA 5K3BA 1E2QA 2OG2A 1ZL0A 4B75A 3R4CA 4RA6B 1ZU4A 4Z7JA 5JVDB 2PVSA 3DL2A 3SGLA 4I19A 1JHDA 1V25A 2IEDA 3BIOA 3PT5A 4QGBA 4OSOA 1OX5A 1I2AA 3FSGD 3LT5A 3TOVA 4EJ2A 4PN7A 5DN9A 1F6BA 1ZLYA 2H5JA 5IP5A 4BQIA 4P6VF 2RGAA 4EHBA 2QM7A 1K8QA 1OCEA 1TD9A 1Z25A 3MFQA 4H16A 3JATB 4IGKA 3RC3A 2WINI 1DC7A 1CC1S 1L1QA 4F60A 3MAJA 1ECLA 3KXLA 1H9BA 1QGAA 1N92A 2A9OA 2REXB 3ZOKA 2RHCA 3RLFA 4Y2TA 4F96A 5DYNA 2IL1A 1O4VA 2ORYA 2WHYA 4HP8A 4NQRA 1JI0A 4BBZA 1Y34E 3OBIA 5LB2A 4FKZA 1Z13A 3UA3A 3WVNA 2BW0A 1SKYE 2NTNA 3ZWWA 3QLVA 1ISMA 2ONZA 2RAUA 3QI7A 2FPGA 5DU2A 2MR6A 3OPNA 5AKLA 2PCLA 1UBUS 3NBAA 2FR0A 5THXA 2AC7A 1YI8A 2JLBA 2MSEB 3NT2A 4U2GA 1IN1A 1KOJA 1IDOA 4HDKA 3UKJA 3BAZA 3AVVA 2BGRA 3DKRA 3G5AA 3I9LA 5ALJA 2Z4RA 3WC4A 4CG0A 1CYDA 4MR9B 2RH4A 1XTQA 4ZKEA 1Q3TA 3SC4A 2PGOA 1MG5A 1GCGA 1MO3A 1VJRA 1XA3A 2DFPA 4FMBB 1DC5A 4EQ6B 4OOFA 4US0R 4Z1MD 4J4BA 1V3UA 3Q15C 1G8AA 1SCKA 2WM2A 4WMLA 5I45A 2Q21A 4LE2A 5IEBA 1ECPA 1UDRA 1Q5PA 2VDRB 1WV0A 3DQQA 3OP1A 3W4IA 1QH8A 2C9MA 2F3SA 4Q7EA 1TJ5A 2W2MA 1ZAKA 3B48A 3AUTA 5FTKA 3S27A 4LYAA 1NUPA 2ZJ4A 3GF4A 2GN8A 2FEXA 1QX4A 1MTZA 1DOHA 1ZGGA 2OBNA 3KDSE 1FNCA 4K9PA 3CRNA 4Y9SA 5D7NA 4BMCA 1XLVA 3FYSA 2YIVX 1W8DA 2AFVA 3HACA 5KTTA 5AIBA 4YJ3B 1OXKB 3ZU5A 5BNIA 5AW3A 5LMNB 1ECCA 4HN9A 1E2HA 5DLYA 1OAAA 1E3EA 5AVRA 3B85A 4LRTB 4TV9F 3UWDA 2NP6A 1YXMA 4HCJA 1VLHA 4YJHA 1TUBA 2OFWA 5TLSA 3LECA 2WFZA 5DIFA 1BGVA 4OHRA 4B83A 1GQRA 2AQKA 2X4GA 4DUZB 2XRZA 1PUXA 3GFSA 3OKPA 3PB3A 4JT2A 4LTNA 3AZOA 4ZVRA 1BHSA 4R01A 3SR3A 3JVVA 1LLDA 3PE3A 4C7MA 4DLZA 3L6BA 4CUZA 4Q16A 2HU7A 5HF6A 1GQYA 2P4QA 5K99A 2NIPA 4LDRA 1J1UA 1T3HA 2ZRCA 2I1QA 2R2AA 1IXRC 1P5ZB 1HKUA 1PNQA 4H0FA 3TBKA 3DTNA 1T9KA 3GLKA 1HA3A 2H18A 4URUR 3WQSB 2X0IA 2UVPB 4X95A 3ZQKA 1AKQA 1WXFA 1QOQB 1XRLA 4WDQA 3TJRA 4BP1A 5CB6A 1FFBA 4G0ZA 4EOGA 5J4VA 4ZDWA 1XD2A 2Q9BA 5AD1A 4I5EA 5BN1A 5KTSA 2JIQA 3QBVA 5CYOA 1NPDA 2Q6TA 3MPUA 3N59A 3MK31 4M1TA 5AJYA 3D02A 4L5JA 1N5LA 1T2FA 3L77A 4QJIA 3KAQA 2HBQA 4DYDA 3TLKA 3H4MA 5FXMA 4EVIA 4XCVA 4JZYA 1QKJA 2P3OA 3AF2A 1OAOA 3D7KA 3EXEA 4B6OA 7AT1A 2E4WA 4K3VA 4E07A 2F43A 1UKZA 3EB9A 4LSZA 1I0LA 1K9SA 3BMQB 5ALNA 5B6PA 5FPKA 2O5CA 4E13A 1PS0A 3RS4A 3K0SA 2KLHA 3IV9A 3F1LA 2AJDA 2Q4TA 1BDBA 3LLUA 4H59A 4U0JA 2ZEJA 3V2UA 1W6RA 5JXJA 4OTZA 1L5HB 3UXYA 3E8MA 3PJEA 3CGWA 5C18A 4EDHA 4Q9IA 4JKYA 2PWAA 4HUJA 1GNLA 2AOUA 3FIJA 2ACVA 2OC9A 4ZKDA 4TVSA 4L50A 3GDHA 4QE3A 5COBA 1N5RA 5WRFA 2QEQA 4HMPA 2R8YA 4G6ZA 4WXYB 3ZHBA 2GH1A 2IYQA 3ZXIA 3MQFA 1I51A 4BN5A 1QIDA 2P5TB 1C0IA 1DFHA 2WLSA 5AKHA 3R7WB 1KVRA 3N6XA 4TV9B 2HTFA 4YI5A 1SXPA 3HBAA 2P6PA 3B6IA 3LVQE 1H23A 1JJ7A 1Y1RA 2CZCA 3U7IA 2EZ9A 3Q7TA 1L5MA 3W5BA 1GZVA 1O2DA 5BN5A 4TXHA 3T4UA 1GM5A 1O4WA 1V4BA 5C8YA 4F7DA 1LJUA 1CY7A 3MCUA 4C2BA 3OTIA 3K8ZA 5JNTA 4GXQA 5CDGA 1ND5A 3ZZNA 1FK8A 5BWMA 4L4XA 4DPMA 3R6WA 1E3TA 2BI7A 2ZJ0A 1RJWA 3B1WA 1NVAA 4KUHA 3VOAA 5EZ6B 5HTOA 1W88B 4JBIA 1SUIA 1WHSA 1Q7BA 4ZEOA 3E9EA 3EAFA 3PU6A 4HFRA 1QIKA 2Z2YA 1BRMA 2H4YA 1HQCA 1LLQA 3GDGA 3UANA 3DKKA 1JEYA 1MXFA 1QIEA 5DO9A 3BF7A 1EK0A 5IK2D 5MN5A 3NHYA 4HJRA 3MWJA 4FNAA 2DT8A 5C8ZA 2NYRA 1QPBA 2V7PA 5HQTA 3DMDA 5ILQA 1NQUA 2YS7A 3H5TA 3N0XA 1NLYA 3N2NA 3PFWO 1ZKMA 3M9LA 3EEIA 3EXAA 3K0HA 4O3FA 4Y3UA 3H05A 5ALTA 4DDTA 1EGVB 1XVIA 3WBFA 1C29B 1JQ5A 1OOEA 1WZUA 2C1XA 3A6KA 3B6ZA 2HWXA 3CSSA 2PS9A 4K46A 5D00A 4GZ3A 1VC2A 3WLLA 1ZUNA 3OZEA 5BORA 5HHTA 2IGTA 1FXWA 1H5QA 2DCUA 3ETNA 3BXPA 4GAEA 5H3LA 4BMYA 2DGDA 3DPSA 2ECOA 1T5HX 1E89A 1RWBA 3LH5A 4UM9B 1TM4E 1W5SA 1Y33E 4LOIA 1FFCA 1Y1QA 2QOEA 3BL8A 5K4AA 4V02A 3R7FA 1RWMA 4BNWA 5CXQA 1OU0A 2AF3C 3PGA1 4ZQGA 3NWPA 1XFDA 2ETVA 1FJ2A 5U4XA 4QT4A 2FR8C 3L1KA 5IKEA 2F1OA 2FW6A 3OQIA 1I4OA 4TYPA 2O8VA 3HPQA 1SUSA 2HSWA 2BGKA 1Z6QA 3RD5A 2GCIA 2JAPA 4NZNA 3STHA 1QNLA 3ZWAA 5ALRA 4EY8A 2WZDA 3PC7A 4UMFA 4UMEA 1RXWA 5K2MA 4LJ4A 2HLPA 4G56A 5U1PA 3EHDA 2K5UA 4B45A 4WRRA 2NNWB 4JD5A 5HG0A 2HA4A 1WY5A 2G71A 10MHA 1BROA 1N2GA 1XDSA 4EQ6A 1S1MA 3EXIB 2M9MA 5EEGA 4Y6LA 1TJ4A 4CRWB 2HUPA 3MXTA 2NVWA 2QVYX 4YCCA 2W6ID 1UFVA 4D44A 5A7FA 4EY4A 4OHPA 2MYPA 5BR4A 2HPAA 1JVBA 4AP9A 5EP1A 1QYDA 2IOHA 3QBEA 5B4VA 4BFVA 1H2ZA 1PR5A 4HS9A 4RM2A 4KR3A 4KE6A 4L8YA 1Z0IA 3PUVA 3ET5A 4L75A 4BO8A 1KH3A 3QKRA 1BDIA 3CW2A 1A7UA 2P2GA 3FHLA 2EG9A 1JDZA 3FPLA 2W2QA 1Z4PX 2VXYA 4G0QA 5GIPE 2EW8A 3F67A 3RSZA 2RCNA 3GBPA 1S3FA 4I5IA 2DVMA 1Z37A 3M49A 3IBGA 4OU4A 1MEJA 1W73A 5E9AA 2XV1A 5FYDA 3OECA 3SMVA 1Q1GA 3QUBA 1MAUA 2QRKA 1DKRA 1SO8A 1AMOA 5BQPA 4QFBA 2ST1A 4YAUA 1CUUA 1I80A 2CXHA 4OYLA 4EHAA 5FWAA 3D7NA 5EZSA 1Y8CA 4WY2A 2YYZA 2L42A 3H5AA 1V39A 4MIKA 1ZJJA 1YDFA 2VF5X 4MLDA 1GSAA 3I8OA 4K9SA 4DANA 5C8DA 1DRWA 1FLNA 4KO8A 2JG3A 4RFSB 1GAQA 2BFFB 2OBFA 3T54A 4RZ2A 3V9AA 3ANMA 5CFOA 1TUEA 1TF2A 2XNDA 4GE0A 2QN9A 4TXNA 1P5JA 1AUOA 3AFIA 3CPJB 3JQAD 3FNQA 1QFYA 3IDOA 4GZ5A 4ZOLA 5JATA 3NDRA 3RW9A 5EIFA 1UK7A 2WJPA 1TKCA 4PZZA 4OUKX 4U4AA 3RHZA 3SFTA 3FYHA 3ZE7A 4ENTA 1BWRA 1V4VA 4Q24A 4NZ9A 1SVUA 2C9YA 2PEZA 1MFPA 3FDIA 4GH5A 4Q0MA 1PT5A 2J6IA 2OXFA 3NYQA 4N39A 4PIMA 1C41A 1OBCA 4EA6A 1GUAA 2RFLA 2J0EA 1OY1A 1TTHA 2Y67A 3D3WB 1IBKB 1QV9A 4GOXA 4IIFA 1PWHA 3IOCA 3RU9A 1AD2A 2WT4A 3P0FA 2FLVA 4J2OA 4LZNA 4ZO9A 1IXYA 2AHOA 1ZRMA 2C42A 1DAHA 1RKUA 1VMEA 3RM3A 1D9ZA 2NU6A 4IHQA 4F3KA 4RW0A 3JQ8B 3ANSA 2ZROA 4KQWA 3NHFA 3RS7A 2BZSA 3TEJA 3QXCA 2YV5A 1RSZA 2IW1A 2UZ1A 3DG9A 4WLEA 3VVBA 5CFRA 1KEPA 3RJTA 4Q12A 2PX2A 1WF6A 3V6MA 3WXBA 4WZBB 5H5JA 5DHPA 4LFAB 2Y1KA 3WNDA 2JEOA 4FC7A 1UDAA 2M32A 3G68A 3OPYA 3TKLA 3E22A 3C5WP 4ARIA 5F64A 2XQKA 4CCWA 5IRCD 1OKKD 2NN3C 3DULA 1UPAA 1PVOA 2G83A 3V1UA 3JVDA 1ZIOA 1LA2A 1M7BA 1XXHE 3IO5A 3GLIA 2CHQA 1PFYA 1SVWA 3ISVA 4MGKR 4PZ0A 2JGLA 4YRIA 3SIXA 2VHVA 5C5CA 4NEGA 4JK3A 3GZJA 4ON9A 4RTSA 2G6BA 4TPKA 1NX6A 4D42A 1XP5A 4YN3A 1D0IA 3VC2A 3FNIA 1U04A 1UFOA 2E4VA 3DEYX 2JI6A 4PG8A 5JVDA 4O2BA 2GF9A 1QB8A 5IASA 2Z57A 4JT4A 3WGMA 2K7FA 2DUNA 3CZ5A 1J2RA 3FZYA 3MINB 4EPTA 4YUWA 3ETCA 2G07A 3K09C 2IH4A 4E5VA 4P3NA 1VKOA 3KYDB 3IBCA 4GXRA 3AVOA 2E4AA 1RYHA 4HQRA 5DGCA 1JYFA 4YREA 3UJ3X 2JI7A 1QYWA 2IHBA 1DBPA 1O95C 3DTTA 3TVDA 5IN4A 3FROA 3ABIA 2K87A 4I8DA 1QE3A 4LZAA 2Q2WA 3WIOA 4JXJA 4Z53A 4HNAB 1CRWG 2WWGA 3C43A 2H85A 3WMXA 5TQ2A 5L3QA 1UBJS 4L9WA 1RRPA 5JEDA 4LDPA 3AB7A 1X2EA 4US1R 3BD6A 3DJFA 1YE8A 2V54A 2W2PA 3EUEA 6REQB 3ZQ6A 4BLWA 1MD9A 1LPOA 1NFRA 3LFUA 4K6FA 3FOAA 3Q5DA 5C1BA 4BVGA 5JSHA 4QECA 3S81A 4HAYA 2VJKA 3KLOA 2E82A 2Z6VA 4KL8S 4YLYA 5CAEB 5CLQA 5KVVA 5IS2A 1XRQA 2XXAA 4OAQA 1L5OA 4CF3A 5SYNA 3RUEA 3O8QA 3QSGA 5GQSA 4IIDA 5IF9A 1RQXA 2QN2A 3BE4A 4PNEA 4RIFA 5IMSA 5IXYA 2YHAA 1ETUA 4H9GA 3JRNA 3LFTA 4P33A 3IV6A 3SEAA 3ROMA 1B6RA 1T9GS 3M6XA 3P4YA 1NNI1 4RK7A 5TVGA 1VMIA 3KO8A 4GLBA 4X1KB 1NGSA 3C15C 2RK4A 2EQBA 3NV7A 4FT2A 2GPNA 5EWMB 2FHSA 4MICA 4QU9A 4N49A 1H8ED 1XD8A 4ZDKA 2JANA 3EF0A 1C2TA 3FHJA 3H5VA 4UE3S 2ZB3A 2DFDA 3NTUA 2DR0A 2IPOA 3UEOA 3FCUB 2B3DA 1CY2A 2ZBPA 2WQ7A 5H4HA 5JMPA 1P72A 2X76A 1SRQA 1VG0B 1R0XA 3CEHA 4NCJA 2C0CA 1E3LA 1UQTA 3CKYA 1B6TA 3G2NA 2PTGA 3FDJA 3FMPB 5BWBA 4ETNA 3FTDA 3JWEA 4DS3A 4IL5A 1C0PA 1QC5B 2G7ZA 4HGPA 4NYMR 1YB2A 2VP2A 5K3DA 1CF2O 4KVFA 1VQ1A 4L22A 3SIRA 1YS9A 4KKVA 1Y9EA 2OV1A 2P79A 3S6JA 5IU6A 4IDHA 1PN3A 3I5AA 1I2DA 1TZCA 5DN6D 3CLUD 4MCAA 1GTRA 2EFYA 1FW6A 1JFFA 9MHTA 1RWPA 1YQUA 3ILXA 3PUIA 5EHGA 3T35A 3PEYA 3B9BA 4I46A 5HBRA 4BB5A 3O38A 5EJ7A 2O54A 4DBLC 3OCXA 3QVSA 2OUIA 3SNKA 1ZOLA 5IAKA 3VA7A 1Q7RA 4ZTUB 3WGIA 1E0KA 2NUTA 4J4TA 1WO8A 3RNOA 1RWKA 5DCLA 5ETJA 2BMEA 4P0TA 5FULA 1HZZA 2QAJA 1J0DA 1QFMA 5E6SA 4KX3A 4IV8A 4IZHA 4PCLA 1HT3A 2HV9A 5DOZA 4DNXA 4BUCA 3KSRA 1G5IA 3CISA 3M4NA 4CM5A 1SXJD 4OQQA 3ZI7A 4BLOA 3NHWA 4L5CA 3GJXC 1IJBA 1T2NA 3SX2A 3PIRA 3U7QA 1H5UA 3OX4A 4RFLA 3TLBA 4ND7A 2FWRA 1K7FB 1DO2A 1MB0A 3GZ4A 1TYAE 1U2GC 1DINA 4IYRA 4L4YA 4KXWA 5DISB 2XVAA 3J81k 2JHAA 3RUCA 2OBBA 4NBNA 1HQKA 1J56A 1C8LA 3OU2A 3PQDA 3KZNA 1RPAA 1R10A 1TYZA 1JBKA 4RZHA 4CKCB 3UUWA 2XB2A 1NLFA 2FVXA 3H2KA 3K32A 3W3AA 1GZ6A 2ECQA 1NHGA 2CE2X 2WWIA 3GFPA 3IUMA 1KZ7B 5FL7A 3RC2A 3GB9A 3AC0A 3K0EA 3R23A 4ILEA 3FPJA 2W42A 1PL8A 1XNQB 4EUHA 1NIJA 3VKFA 1W0JD 3MMZA 1JQEA 2YIMA 3QJ5A 1G0OA 4C6TB 1NN3A 3VU1A 3CMMA 5L53A 1RAAA 3MTQA 3EBOA 3ZGYA 2NTEA 2EYUA 1XZJA 2PS1A 3FTFA 3UTDA 5LB4A 2YWGA 4CDRA 1R64A 4CI0B 2VF4X 3U49A 3ZKWB 4EEXA 3LQFA 1R37A 4UXIA 1R00A 3LIIA 3FD8A 4LC1A 1XXHB 1YS7A 3I34X 3WLRA 1GL3A 4X3CA 2MU1A 3L6DA 4I08A 2PUGA 1P0QA 1VJ0A 3G5LA 5A3VA 1U0BB 2OO5C 1IDN1 1YCGA 1K8RA 1QV6A 3NWOA 1B8PA 1QFJA 3M1AA 4LBYA 3EQ9A 2PU5A 1NVUQ 3OFND 5I7HA 2AQHA 2Q2NA 4LMRA 3O2SB 3R1IA 4BNYA 3WS7A 4TYNA 2Q5HA 1CJVC 4CF7A 2YVUA 4J8PA 8OHMA 1UMKA 4CF5A 3OCWA 3GGCA 4XB2A 3QMVA 1QO7A 1Y7LA 4EJSB 1Q3KA 1XQ1A 1QMPA 3KEGA 1J8YF 3DDWA 1UWVA 5LOVA 1G7SA 3OKCA 2CL7X 1TYCA 1UM8A 5CJ2A 3LUBA 3TL2A 1A8SA 5LU8A 1U0LA 621PA 4RD4A 1QVVA 4CMBA 5LYJF 4WZAE 2PL1A 4PC6A 2WKRA 1WB9A 3D8UA 3TEMA 5BYKA 3BB4A 4J3JA 3Q3JB 2BLLA 4WGFA 4P32A 5LZ7A 1OLOA 1OWNA 4LFCB 4EPVA 1OB5A 4URZR 3R7NA 4QYTA 1STOA 3F7MA 1YB1A 4ZPJA 5JAPA 1UBTS 1E5XA 3T0FA 1EVZA 1W4ZA 1NNLA 4UNPA 3HV0A 4EMUA 2K4MA 2PRSA 4G1CA 5KO2A 1ZINA 4HEA1 4M1EA 2V9PA 3F3YA 4N8DA 3HK2A 1Y7IA 4IP0A 5AW8A 4DILA 1EE1A 1UBCA 4AJJA 5FFFA 4B31A 2JEYA 2Y6VA 3KUCA 1RHMA 1C50A 2IYFA 1PK8A 4X1IA 3VR6H 3EMVA 3H5WA 2AMFA 2PBFA 3G8CA 4QYIA 4WNIA 4XIGS 3MB8A 4UDYX 4DJTA 4EG8A 4EYSA 3DE0X 2VYFA 3O2NA 3PNOA 3L1IA 5JS8A 3AHGA 5KTOA 4CU2A 3WYGA 2QG9A 1GU7A 1FTQA 1II9A 3HO8A 3JW8A 1M2FA 1I3LA 3KEFA 1WMDA 4Y1RA 3VR0A 3WAJA 1QTQA 2WAXA 1GTZA 3G0DA 3INGA 4P7GA 3JYOA 3HBLA 4ECAA 1N2CA 2XMSA 3JTMA 4LCEA 2DLDA 4KNVA 1YI0A 5FNVA 4OI0A 1CKEA 1P9NA 3IMFA 3SC2A 2DKNA 1NKTA 3IAS6 3K1AA 2NQ8A 4H3VA 2DUUA 4I6JA 4N0MA 4QXQA 4ZAGA 4H77A 2R62A 2PY6A 1I3NA 4FGWA 4R1QA 1M34A 2IP2A 4M3NA 4WOJA 3BJIC 1F2TA 2D1FA 5AMXA 2D2EA 4DL9A 5C8YF 5FD8A 2VT6A 2WD8A 4M0DA 2WW8A 5EIXA 4DCTA 1YQEA 5T6MA 4B7ZA 3TFOA 4JLNA 3MS7A 2DHRA 4PRZA 5FTNA 5IM5A 5C32A 5LZ4A 4EMSA 4DCVA 1THZA 3OCJA 421PA 3UUEA 3AEZA 2HA5A 3REFA 4AKGA 4L08A 2AOWA 2EAUA 3C3PA 4F1JA 5K9ZA 4RIHA 4KR2A 5GONF 1N6HA 4O3MA 1W9HA 2QPOA 2UAGA 3I01A 4OGGA 3I9KA 2IY7A 4O8ZA 5EE5B 3CZQA 1O6FA 3KT8A 4PLGA 4BP9A 1FIUA 1H4TA 2A2ZA 1LUAA 2FW8A 3FSEA 2BWJA 2I54A 2KBEA 1QCZA 2E6UX 3QWHA 4XEHA 3UWSA 1NBIA 1X7WA 3DL0A 1VHJA 3W8RA 5JBQA 5KJ6A 1OPRA 1NYRA 3ZD8A 1CUHA 4FBLA 4URHA 2YH2A 2C4HA 2A7QA 4N40A 2CSXA 1WUJS 1AB6A 1XLWA 1WPRA 2GSDA 3KTOA 1WCV1 3RHSA 3DKIA 3TLGB 2ODPA 2EBFX 4WY8A 5BSMA 3L04A 2AFRA 4ZCTA 3N1UA 3OT4A 1HQDA 1HK7A 1RJ9A 1OJ7A 2X5KO 4C30A 1XQWA 4YBRA 4B35A 3MGKA 5E6SB 5NLLA 1SUAA 3T3EA 4COOA 4FE3A 5I7SA 2JJ2A 2PUAA 5JMOA 3HCPA 4ZVUA 3OPMA 5K7SA 2WVAA 1U4NA 5EJEA 1KI7A 3CA8A 3HZZA 3WBBA 4GC5A 3VNAA 2LR0A 5AHXA 4EY3A 2V97A 3PNYA 3RBZA 4NFYA 3EDMA 3RS8A 1UQRA 4UBIA 4IH1A 2H2HA 4UUBA 4RUKA 3N3BC 3SS7X 3WB1A 3X3HA 4Z0TA 4JXZA 4BNLA 1GAXA 4KJXA 1BXRA 1ZMTA 1HRKA 1LPMA 3B6KA 4DA0A 1WHTA 2H2DA 2J9XB 1MRSA 4PWZA 3E1KA 4LUCA 4BJ5A 1OLSA 4QGFA 4E5MA 5LQUA 4KHPB 4EYGA 1DRKA 1I4WA 2IVZA 3NCHA 4C3VA 4YJHB 3RVSA 1JXQA 2Q5QA 2PSSA 2J32A 5CA1B 1FNDA 1B1CA 4G84A 3Q7SA 4LRQA 2VK4A 4L7VA 4U6SA 3SYTA 2OBMA 2WI8A 2ZUBA 1DAFA 2CUZA 2J0VA 1J21A 2SHKA 4FMCF 1ZMRA 1XYVA 1Z7WA 1Z6XA 4FFNA 1OHHA 1M1XB 3EA4A 4JKOA 2FSIA 4KAAA 3WO1A 5C35A 3E9DA 2X9LA 1PGQA 2FK7A 2GPJA 2LVBA 4YI3A 4DM7A 1A96A 3U0VA 2ROQA 3OAAA 2DQSA 2ZT5A 4I4CA 2VKQA 4IGAA 2H31A 1FNBA 5KOJB 1P2BA 2BP7B 3I6QA 3OOYA 4XA8A 2KB0A 4XIIA 4EAAA 4NAUA 4C4YA 5IKXA 4WKOA 4LWPA 3H3XA 2INGX 1JWLA 3WWPA 2GUWA 4F85A 1VJDA 2ASVA 4JYPA 1AVTA 2VYND 4OHXA 4QOFA 5I01A 4BASA 5KWIA 2GSWA 1DKLA 3HSKA 1CUJA 1U1FA 1E3WA 1AXRA 5EJ5A 2BBSA 4BFWA 4LJKA 4TXLA 5E9QA 4YMHA 4ZAVA 3DNPA 4F84A 1PR0A 3A6EA 2EJWA 3E3NA 1F1BA 5I7FA 2I03A 1GRQA 1WQ4A 1CQJA 1FVHA 4JFRA 4BRWA 1YB6A 3EWIA 1KOGA 1G7CA 2AUTA 1Z5NA 3GPBA 1XX6A 2JCYA 4HB3A 4D9CA 5IABA 2IZ5A 1QOZA 3O21A 4O33A 5JJCA 3UAYA 4ZCIA 4E46A 2JDID 3AG6A 4E21A 5BSRA 1U3WA 4AFNA 1O6GA 4DMGA 4Q3EA 2NSLA 3L7DA 3HFRA 4L8GA 1RAEA 1UFRA 4MV4A 5G02A 4AP5A 2WWWA 1RWXA 1AM4D 4UUPA 3T1NA 3VYSB 5BN3A 2QHXA 3RT1A 3FOFC 2OKGA 3QBJA 1ZSVA 2D0OB 2RI6A 5LLTA 3THYA 1K5DA 2VAXA 4F11A 2E5WA 1QO0D 1E9CA 2XSZA 1MAAA 4X97A 2YV4A 4MI9A 4YLEA 5F4ZA 3UPDA 1N2CE 4X7PA 4I55A 4RA6A 4DIFA 4NC9A 5CX4A 4KYTA 1QU2A 2FOIA 1A8QA 2UU9B 2W2VA 4AUKA 4R7ZA 4EG3A 4XDZA 2H4WA 1QGZA 3FCOA 4JXXA 3GLHB 2W6CX 3DFKA 4TXMA 4D1YA 4MDFA 4DBLE 4K9KA 4XE5A 2XNSA 1QTRA 1SHTX 4U2KA 5J4YA 2V5AA 3OH8A 1ZD4A 2GK7A 3JPWA 3DFIA 2R1ZA 4Y2YA 3K6JA 1GADO 1FMTA 2HMYB 2XE4A 2ZT7A 2XTZA 2EKQA 2QTVB 3JD3A 2TMDA 1TTTA 3GIDA 2G5CA 3QEJA 2ADOA 5CVTA 1E79D 2HT1A 3OE4A 3SR4A 4CMKA 1HQYE 1R0WA 9ABPA 3MJSA 2O2JA 3TQSA 4D45A 3U3MA 5ABPA 2BEUB 2FE4A 5JFOA 5ITSA 4RPKA 5EINA 4AJPA 3A58B 4FOTA 3M3HA 1RBQA 2FV8A 3BWBA 1OWMA 2YV3A 1EJ6A 1EXNA 2O4UX 2B0JA 3KCNA 1V1JA 2WZCA 3KBOA 3HO6A 2I0FA 5L3VA 3RBAA 3EPPA 3QX3A 3U9SA 2ZSBA 3CX8A 4G0XA 5JECA 3QI2A 4IDOA 4MS4A 1PR3A 1K9VF 2ODQA 2JFOA 1Z7YA 2BI4A 2BMDA 4M9ZA 2AMJA 5DGDA 1AKEA 2XSZD 3LZCA 3WK5A 4UUAA 4CIVA 3FW1A 3U61B 2HLNA 3LC1O 4CEIA 3FTEA 1HUQA 2ZBRA 3ZY3A 3PKIA 3G79A 4B73A 1J09A 4L1KA 4K2AA 3BWCA 821PA 5JDIC 4FWIB 4U5QA 3MEQA 4RMJA 1HDIA 3OCYA 2DFKB 3BTVA 4X84A 3OIUA 3V7NA 4D9HA 1VJCA 1U3UA 1OREA 2V96A 3GRFA 1KFBB 1RXYA 1XRSB 4B3DA 1UXKA 1U90A 2N0SA 2FWAA 1N6LA 4TS9A 4YT8A 3QA3E 1E69A 2WWTA 1M0EA 4MAFA 3ACBA 3CKLA 2HYDA 1RADA 3FCYA 5KNCA 3KQTA 4QOSA 5HTKA 1YJAA 3WDMA 4KYUA 3WZ2A 4WY5A 4I50B 4QPDA 3ZDAA 1ORRA 4H17A 1KFKB 1SULA 2CXTA 4AG3A 1SOAA 2GVDC 4EUNA 2FVYA 3O4JA 1PK7A 5JMTA 1G291 3WB2A 1XEWY 4XTCS 1LSOA 1D3AA 2HCBA 3JAWA 4S04A 4E5KA 1EM8A 3X44A 2F90A 2GRAA 1PYGA 3AOGA 3FR7A 2GASA 1JQJC 1F2TB 1WMAA 3GV0A 5ESWA 3RHFA 3ZNOA 3E3AA 3NHUA 5C5EA 3IQFA 2PR2A 3NXSA 1I8TA 2WU4A 4MW1A 4D9GA 1WVMA 1E99A 2IT1A 4YCBA 2PMCA 1KYXA 4LJLA 3A4TA 3X1ZA 1WMEA 4RMIA 4AYTA 3MJRA 1ZO8A 4KGDA 2ZJ7A 3ZUPA 1KXZA 4B3IA 4OG2A 4AP6A 1FFWA 3OESA 5E7MA 3E23A 3LVRE 4A2PA 1X1RA 2VJLA 4W82A 3GLTA 2W2KA 3IHKA 3GC6A 1V6CA 4LCJA 1G8YA 3WYDA 3CZPA 2BJHA 3W6OA 4JJKA 4V2IA 4QA9A 4BFCA 1LC3A 4MTCA 3SDSA 5FH9A 1YSCA 5IAOA 2VC2B 2J5BA 4GEGA 2OFFA 3BXFA 3D7SA 2MYUA 4QTZA 4UCXA 1EUDB 2NGRA 3DL4A 3FMIA 3EWAA 3CW9A 1PJRA 3SHVA 1V9SA 2WUVA 4HTAA 5LOVF 4FONA 4MB6A 3F46A 4BCBA 1K06A 3WJAA 2PGIA 1ZH8A 3R24A 5B1IA 3IDFA 1Z33A 3EQZA 2OORC 3LIPA 4CL8A 3KZ1E 1AK9A 1ODTC 1TOAA 1FW8A 3WK4A 1DJPA 2ERYA 4IVQA 1C3XA 2ZQ5A 3Q7IA 4KP7A 3TECE 3DAYA 3JALB 3B1ZA 2JJ2D 3EC1A 1Z6AA 2G1KA 1L5QA 4RA9B 5A9SA 5JEEA 2WPNA 2DY0A 1GRNA 1FTSA 2H7CA 3FG9A 1WWKA 3NHLA 4UPDA 3WX0A 5CB4A 4DM3A 2WLTA 4QJBA 4PYKA 3COSA 3IV7A 4J7CA 2ZR0A 5JJ5A 2QSYA 2WG0A 1EESA 4KSBA 4CLRB 1EU1A 4M0KA 3BBPA 3N0RA 4ZHQF 3PFNA 5JLJA 2YJ6A 1TEZA 4PSUA 2A14A 3HNPA 3TXAA 3VSCA 2XDYA 2GXSA 2PGLA 2YBEA 3H2JA 1SPXA 1VA4A 3MBKA 2O23A 3QY0A 2FJUA 1C1DB 2XDWA 4B4OA 1WETA 5FWYA 1CP2A 1G8FA 4YCSA 4X71A 1GGVA 1JH8A 4LDJA 4YDRA 3OT1A 3I1YA 3FPAA 3K15A 4AF6A 4PLFA 5C46F 2IQ5A 4XIJA 4QJ4A 1BYIA 3E3MA 4QD3A 1Q15A 4AL4A 2RHDA 3W9UA 1AQUA 2R2GA 2VAVA 2QXTA 2QW1A 3ITEA 3DZHA 3LT4A 3NBMA 4FI3F 3UB2A 4AB1A 3BGVA 3WJ7A 5KNCH 1Y48E 4LV5B 3G5UA 3JD2A 3NKLA 5JD4A 4YRDA 1JMVA 1DZIA 2WFLB 3PRHA 2QX8A 2ET6A 1DEHA 4Y2RA 2JFYA 1OX4B 4BBAA 3C3YA 4NZZA 5H59A 3ND8A 4FOSA 5ED0A 1GPH1 1WDTA 2IS6A 1II8A 1USIA 1VL0A 1C3VA 1SXHA 3CLRD 2BFWA 3L7MA 4H4EA 1E4VA 2Q0XA 4NBWA 4Q3CA 5DYTA 1YJ8A 3P9XA 3STWA 4FGSA 2CV2A 5ERYA 1T8WA 1TPZA 1ZMXA 2YN0A 2PR7A 4GM1A 3GDWA 4P81A 3B6JA 4RXTA 4BMDA 5BNFA 1X1SA 2PGDA 4QOJA 3BD9A 1I7SB 3WGHA 1U4OA 1P18A 3ONVA 4MGYR 1AK2A 1R6UA 1Z5GA 1MVLA 3FKSD 3LW8A 4V0LA 4QBGB 1IHPA 1NW4A 2PQ6A 4IQ4A 3T1VA 2PL5A 3OHSX 1W88A 3S2ZA 5F5LA 4NK5A 3SE0A 3UAGA 5A2QA 2AN1A 3HXPA 4FYJA 4BLVA 4HGZA 4HNUA 1Z45A 3CR8A 3FVVA 1NV9A 3C39A 3GNSA 2FP3A 3NXKA 4XPIA 1M2GA 2Q3FA 4EDFA 2GGSA 4K81B 5FPPA 4KIFA 3HB5X 2OV3A 1YR6A 1IUPA 1VCHA 1NONA 4FUQA 4ND5A 1P0FA 5SYAA 2BM9A 4QOGA 3ITNA 4I1SA 4WGGA 4GKVA 4RD6A 5A4FS 4I1OA 4WJZA 1CQWA 3ETJA 3MWDA 3NGMA 1JFRA 2W58A 3CLKA 2Q2OA 4M9UA 2GK3A 2HA6A 3OTHA 1PR9A 3GRYA 3GROA 2BBWA 3JPYA 1U3VA 1PBNA 3DC7A 4FILA 1JDBB 3GCZA 3OSUA 4OHZA 2B2XA 1H0HA 1U9YA 5FQOA 1ZMOA 1SB8A 1ZYUA 5JQGF 4YRKA 4CM7A 4NV0A 1QMGA 4FFMA 1A88A 1QIIA 2FU5C 1PJSA 4DNOA 2QM3A 3RC1A 1LJLA 2HDOA 5KYTA 4P80A 4MRSA 2J7KA 3WYFA 5KYKA 1LZLA 3CMCO 4WK0B 2BFEA 4DG8A 1K8XB 5FPQA 4AJ4A 3OEED 2R00A 2OHVA 3FLAA 1MOQA 4HAUA 3DTVA 2VS1A 1XZPA 4WKCA 2KS6A 2IZ0A 5C7OO 2Q62A 5HWSA 3L9XA 3I45A 4MUXA 9ATCA 1Z5PA 5BR8B 1TTQB 1CQZA 2X8AA 1DBQA 4BRSA 2QL5A 3HCOA 4O2AA 3C8MA 3ZWXA 5IXJA 4ZOLF 3LP6A 2C2YA 2R6DA 3BHMA 4FFSA 1ZOOA 5KWEA 2BRUC 1X8JA 1F51E 2ES4A 3G2LA 4L4SA 4FB4A 1ZQ9A 4R1OA 2GEKA 1WQ1R 2GA9A 3C7DB 4LJ9A 2QT9A 4K0KB 2WSMA 2ETXA 2IIPA 3I05A 3IOMA 3VR2A 4R81A 5HS4A 3X1XA 1AHNA 4X6LA 3FLBA 4OHOA 3TOXA 3B12A 3KL2A 1L8QA 1QR2A 1RZRA 3AHEA 3FN4A 2F9FA 3LPDA 1LLCA 1TIKA 2E4ZA 3GJQA 3OJWA 3TR5A 1N34B 2D74A 4RH1A 2HO4A 2GJ4A 3FMVA 1JG2A 1LDBA 1PW7A 2R79A 3LUKA 3PXBA 1I7PA 1KZ9A 1N3BA 2OHXA 1JNXX 2ZRPA 4GI1A 1ZRNA 1NNUA 4QEZA 2WG1A 4UZSA 3QEBZ 4LF6B 1Y5RA 3DZGA 1W0JA 1GZ5A 4AJOA 2GFHA 2GJAA 3ZDXB 4HVLA 1I6MA 1M72A 4MQ5A 1XDZA 1WXDA 3VPAA 1W6UA 6ABPA 1COWD 1PT6A 4HNQA 1H6CA 5F51A 6Q21A 2WR8A 3LX8A 5FL7D 4AUMA 4MINA 3SX4A 1GNVA 2QDKA 3TSYA 1RE1A 2DP4E 3GGOA 1O08A 3W3AD 3MRTA 1G8SA 1G3UA 3A11A 4NFHA 4MV3A 3RU3A 1TB4A 2EZTA 1EEXB 1SWWA 4PO1A 1KI6A 1IB6A 3EDCA 5AI8A 3VO8A 3BMNA 2YS6A 4GSYA 4DARA 1NM5A 4KE7A 4NBRA 5H68A 3PLAE 5SZIA 3ABQB 5D3MA 5C2JB 4R1PA 3UGJA 2CLEB 2GO1A 2YHSA 1U98A 2G9UA 4ZVOA 2OBYA 4S1VA 3R6DA 3ND7A 3QLUC 1AK1A 3DLIA 1EUCA 3KX2A 3KUDA 3OIWA 4HDSA 3E15A 3ISTA 4YCAA 1AQYA 3ELWA 1DAKA 1HG1A 2W2OA 4G0WA 4BLRA 4EGQA 1NJ6A 1JDUA 4G5SA 1GPUA 4U0KA 2CFTA 2NUPA 3DCNA 3GUZA 1UJ2A 1X7HA 2HZBA 1FDIA 1S2LA 3JQ9C 1PFQA 4JZKA 1Q12A 4M0UA 4KRFA 4O0MA 4ZAFA 1QYXA 2NTJA 1OU4A 2VR1A 1CNMA 2W2XA 2QVCA 3EA0A 3PDCA 3DV2A 3CQ9A 4I55B 1Y6FA 4QG7A 3CNNA 2DPHA 3JAKA 4CKYA 1NATA 2PE5A 4ZT6A 4EBFA 3O7WA 4UFOA 2JHFA 1C3JA <