4RHEA

Crystal structure of ubix, an aromatic acid decarboxylase from the colwellia psychrerythraea 34h
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
202
structure length
202
Chain Sequence
DFNGKITLAITGASGASYAMRLIECLIAANYQLYILCSSAGRIVLDTEVGVKIPSSPDAASKFLTEKYQAKDQQITVFGKEQWFSPVASGSSAPKQMVVCPCSTGTMAAICHGMSDNLIERAADVVIKERGQLILMVRETPFSTLHLQNMLSLSQQGVTIMPASPGFYHKVETIEDLIDFMVGRVLDHLGIEQDIMPRWGYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of UbiX, an aromatic acid decarboxylase from the psychrophilic bacterium Colwellia psychrerythraea that undergoes FMN-induced conformational changes.
pubmed doi rcsb
source organism Colwellia psychrerythraea 34h
molecule tags Lyase
molecule keywords 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
total genus 67
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.-:
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 4rheA00
4RHEA 4ZAWA 4ZAYA 2EJBA 4ZAVA 1P3Y1 3WISA 3LQKA 1MVNA 4ZAGA 3MCUA 1SBZA 4ZAZA 4ZALA 4RHFA 4MWGA 1G5QA 1QZUA 1G63A 1E20A 3QJGA 4ZANA 1MVLA 4ZAXA 4ZAFA 3ZQUA
chains in the Genus database with same CATH superfamily
4YRQA 5HTOA 2AKYA 4N5MA 4IUBS 2I66A 1EQ2A 1T6ZA 4R7GA 4WSOA 2FMFA 5HFJA 4L02A 1T0UA 3W3AA 3ZHSA 2B2XA 1H2RS 1EFHA 1USWA 3HSKA 3JQGB 1DFGA 4E09A 1I6LA 1ADCA 1TDJA 3PYMA 3OJEA 2Q5CA 4B4UA 1TECE 5CPFA 3ZHVA 2ONZA 4DNOA 1SXJE 2FFBA 1HFWA 3BXPA 1YI8A 2RGGA 1NJGA 3D6UA 4YVFA 4DNQA 4F4FA 2BM0A 1OAAA 1Q1BA 4AP9A 4RMNA 1XZPA 4KQGA 2WWIA 4MPTA 3JD3A 4R5MA 5A4FS 4L27A 5B36A 2GLTA 5F9FA 3D3JA 1YV9A 2C7BA 3KDPA 4FFPA 4Y1FA 5CLGA 3GJ8A 4XE5A 2H4HA 3UT5B 1RKVA 1XMSA 3PL1A 3IQFA 3NQ41 1RRFA 3BZBA 3KT6A 1KK2A 3DW1X 3GWGA 5AK0A 1TYEB 1W48A 2Y9PB 5SICE 1H23A 1NA5A 4QFBA 4DRXB 2JJMA 2OGTA 5LD2C 2IHBA 3M9XA 1EBUA 2M1ZA 5AOVA 3BB1A 4YJHB 2Z6VA 4LJRA 4OA5A 2P5UA 2QROA 3I42A 3MM4A 4GOKA 4IFEA 5DYIA 3WR5A 4B8ZA 4F21A 5MN4A 3D3EA 3K0CC 5IVIA 4E2ZA 3J7AC 4II3A 2C5SA 2NO0A 3S8MA 2PUVA 1A71A 3B5EA 3OT1A 2RAVA 4GC5A 3DGEC 3NXSA 4IIJA 2DOKA 4P81A 5TDHA 1GYQA 3EZYA 1G1MA 3IE2A 2ZBGA 1GLVA 4HUQA 4URZR 3LC1O 1P2TA 1Y1RA 1CDEA 3L4SO 3QYAA 4IIDA 5I4CA 2APJA 2XMZA 1DB3A 5FTWA 3DWIA 1XTVA 1H0SA 2D7JA 2IF0A 2XGSA 3PITA 2MWMA 2JFZA 3C7KA 4BQRA 4CR6A 16PKA 1GPJA 3ONDA 3EWSA 3F46A 5TPWA 1DOHA 2QRQA 2VHYA 1IM8A 1FDRA 1FRVA 1GXSA 3IBSA 2KWIA 3RIXA 1BOOA 2W5UA 1GPBA 2CJFA 4Y2HA 3GXOA 4EY3A 4PZPA 3KFVA 1H3NA 2CUTA 4IH9A 3HHPA 2WHPB 2X14A 3MJFA 2YWDA 2RGNA 4CTKA 3MWJA 2GZ2A 2PZJA 4RY0A 2OCAA 4F97A 3A4LA 4E0BA 3FWKA 4RHCA 4XOUA 3TZLA 2ZIXA 1U8ZA 2OAGA 2AG8A 1MO6A 2HRBA 3AHHA 3VI3B 3O8CA 1IY1A 1XIVA 3O1IC 3NGXA 1KHHA 3OQ1A 1A9PA 1R8JA 2CWWA 5BVHB 2J0QA 3G6WA 2EW2A 4QGAA 2JGMA 3ILSA 1WM1A 1I5RA 1YO6A 2PUJA 2ROQA 1ETUA 1ZN2A 3LCMA 1B1CA 2N42A 1BVUA 2YVQA 3KHKA 1NNSA 4O1MA 2WSLA 3UJPA 1KVQA 1S4QA 2W2LA 5CXSA 3T34A 1MB4A 1UJMA 1Z7GA 3FE2A 3RCBA 3K8ZA 4GSKA 2QT0A 3CLRD 4LHXA 2DG2A 4HQ6A 2YW2A 1QHNA 1N3BA 4MDHA 2QTFA 2IU6A 1X7XB 2IY8A 1LVUA 2HY7A 3T41A 3TTVA 4HUJA 3JRNA 3WV4A 5ECYA 1D04A 1YCHA 3BQ9A 3DE0X 1KQGA 1XXHE 3HACA 2BHLA 2HZ7A 1IQ0A 1TVCA 3DKRA 4GLFA 2N46A 1ZIPA 5E1MA 3ZTTA 5KWSA 5FFNA 3QH4A 1A5AB 2Z8YA 1IOZA 2G7ZA 3N2IA 4KI7A 4MHSA 4OHPA 1DQPA 3LDFA 4PRKA 1W36D 5K0CA 1E7MA 4KX3A 1XEAA 1RRKA 4OI2A 2YHAA 4PXSA 5HF8A 3F4BA 4ESVA 1TYBE 1Z08A 2XE8A 1TUEA 4LHSA 4A8JC 5IULC 1HE3A 1CW2B 1PT7A 3BIJA 5IK2A 5BN5A 5CCBA 2KJQA 2VJNA 3BDVA 1CWUA 1MOQA 3A6HA 1P1RA 2X1LA 7MHTA 1O9GA 3I37X 4RKFA 3KSZO 3NHBA 2B92A 1QFSA 3A28A 1PZEA 2DTDA 2ZB8A 1N6OA 3W1VA 4BUCA 1EGVB 2OZLB 5TS3A 1GL7A 1WBJB 3JVUA 1RYEA 5F3RA 3LF2A 4DTCA 1MB9A 3RANA 1IJBA 4IYJA 4OX9B 2PUTA 3QLUC 4RJJA 4RUKA 4E1VA 1MT0A 1DIGA 4M6WA 3WGQA 1WBDA 1WW3A 4ZFNA 2P2NA 3UCXA 4NPAA 2PANA 3V3TA 3E70C 3VISA 1JHDA 1NW8A 5KU1A 2W6PA 4HO1X 4XYLA 1FDOA 1T4DA 4XPIA 1XA3A 3GJQA 3KQSA 4C4PA 1QXSA 3WWYA 1NFFA 3DB1A 3MQFA 4JOCA 3NX4A 4TT3D 2DFDA 3AUKA 4Z4EA 2QSZA 4U2EA 3PGLA 3GQBB 2GUGA 3VAZA 1HE1C 3PFGA 4JGBA 3GPBA 3VC2A 1ISJA 4RPIA 3LSTA 4BFCA 1HDYA 5JS2A 5ANRB 3CLVA 1U0SY 2GBLC 2X0NA 4N7BA 2PD6A 2XLBA 3QLJA 2BF4A 2JFGA 4Z3OA 4UOQA 1X14A 4CM4A 2VHQA 3ER8A 2XZLA 1VMAA 1OD6A 2I2XB 2Z5GA 3V1LA 4DOMA 4AJ4A 1PEAA 1WXHA 2D74A 5D5QA 4E6PA 1CULC 1NVWQ 2QW0X 1UC9A 2HPAA 4C2TA 1TJYA 2ZIXB 3GJ5A 2C97A 3LDHA 1IBMB 5IN5A 3K0FB 3K9LA 4HGZA 5G0TA 1TMOA 3TUJC 2F8SA 3HXKA 4Q7MB 3PDWA 2EJWA 5G41A 2WSSA 4H60A 5COBA 4G8JA 2PWAA 4BB6A 2IP2A 2G07A 4NBKA 3QX7A 3FYHA 4KUHA 5DNWA 4EEZA 4PXYA 2BF7A 4NDNE 4B44A 1U7PA 2J59A 4GKAA 3EFEA 1DT3A 4JK3A 4YT4A 2EDAA 2HK8A 2J7PD 1UM9A 5LUAA 3U7HB 4OBWA 5D51S 3NKLA 2H8KA 5ALNA 1ZK0A 2NZ2A 3USCS 5KZMB 2R7NA 3F67A 4GKJB 2VYNA 1B0AA 1N5LA 3R6DA 2Q9UA 1U3CA 4MQ4A 5D6OA 2GN8A 4WN3A 5ECGC 1MD9A 3LXXA 3WRVA 2PGIA 3CRW1 3H11B 2QN2A 3II6X 1H1DA 1KI2A 1RAEA 4WT7A 3RVSA 1Y3AA 3FWZA 3TQHA 5BN1A 5I7VA 1G21B 4MQEB 5IT0A 3ZLTA 3PXGA 1L7DA 1K68A 3X1MA 3FW1A 5IBRA 3MT7A 4P4NA 3R6WA 2WNSA 2KSQA 2R8XA 1U4NA 2WKPA 2GBPA 4E2XA 1PGNA 4ESHA 1UC4B 6Q21A 5KOIA 4HV4A 3VR5D 3PEFA 3W04A 4LCEA 3CONA 4O5OA 4P98A 4Q1VA 3WWDA 5JH7F 3V2UA 3ZWKA 4HLQB 4MZXA 4YDSA 1ORVA 2I1VB 2F3PA 3H1AA 2ZZMA 1OWPA 2QN6A 4EGQA 2WTUA 2IY7A 4HF7A 4RSMA 3BXZA 3KHSA 3WQRA 1WU7A 1XRJA 2HHJA 3FMFA 1YL6A 2O4CA 3QZUA 5TSDA 4CMEC 1K6EA 3B1JA 3DEYX 4Q9HA 1EQAA 4UUAA 2XCTB 3NHFA 2IZ6A 4K40A 3G2QA 4NESA 1NIPA 1DEAA 1THZA 1V5FA 2OILA 3HA2A 1XE3A 4JEIA 4WA8A 3A6JA 3FKJA 3T61A 1RM5A 1VC2A 1L6IA 1OFGA 3TLXA 3WG9A 4BTLA 3MINB 3WOHA 2J7PA 1O5OA 2WKSA 1TM5E 4RQUA 1M33A 3ZZMA 4DIEA 3I2GA 4EUSA 1OH6A 2C83A 1PJCA 2WMYA 3L7LA 5JDIA 3L8GA 1FMJA 1M8FA 2CLOB 2HSWA 5EE3A 3PJRA 5BOSA 6ABPA 1LRKA 1YIAA 1H0HA 6AT1A 3VDNB 2HA4A 1U3TA 1IFXA 2ZYHA 2BFEA 1DRUA 4HAXA 4IJUA 4M1SA 4PAOA 3THWA 3F3KA 4O3MA 1BX3A 2Q7DA 2WPDD 2BM8A 3C8DA 3C1AA 1IATA 3PKZA 1YULA 3DLIA 3FNHA 2VF5X 3K9WA 1J2YA 3EC1A 2I1WA 7YASA 4RZIA 2O8EB 1L4MA 1REQB 1J8DA 3HYCA 4C1NA 2ODTX 4M8NE 1MEOA 3UQZA 2IVZA 5CXQA 3L77A 2GAIA 2QLLA 4HWTA 4WMLA 3SM3A 1I7DA 3IULA 4XDHA 5HQJA 2X5JO 1QYDA 1DC4A 2XNKA 2O0JA 3K8QA 3PQ6A 4WUVA 5DN9A 4FFOA 4NZNA 3EOAI 4CF7A 2YWHA 4L6CA 4MB0A 1Z2AA 4YLGA 4E14A 3N07A 2BT4A 4K88A 4PLZA 2I3AA 4RA6A 1GN9A 1JX6A 1NI5A 3DMGA 4QATA 3UGTA 1N1DA 3CB4A 2VDWB 3LQ1A 4ZI7B 1XZQA 2VYQA 1UQRA 2H0QA 3TQRA 1QO0A 3D02A 4BBAA 1Q74A 1O97C 5KKCA 4MEBA 1W94A 4CG2A 3V4SA 2C42A 1Z83A 2WM2A 3ECCA 1VIVA 2QD2A 2WMNB 1XU7A 2QUKA 3AZPA 3KEFA 2A5YB 3NNDA 3DTVA 4GX2A 4IEEA 2QVLA 4JLBA 2XMPA 3BMCB 1LDYA 1AKEA 4N0DA 4BLPA 1EYZA 2QXTA 1J0EA 1WBBA 2OO5C 4GZ6A 1PAUA 1BXRB 1SQSA 3HGQA 3PQEA 3SHTA 3TFQA 4CDMA 3U60B 1M72A 3LQYA 5J40A 4FTWA 3RSGA 5INTA 1AMNA 4O4IF 2W0SA 1SCIA 3EXHA 3HA7A 1P4AA 3DV0B 3QBTA 3SZLA 1T3ZA 2ZT5A 3VYVA 1IJFA 5J23A 1EIWA 1JPNA 4OB7A 2JCVA 3AV3A 4MS4A 5DLYA 2JJ1A 1J0CA 2QTVB 2JL1A 2VL7A 3L0ZA 2XD4A 3QW4B 4EFLA 5CDFE 4WDRA 1EE1A 4MUAA 4CMCA 4Q3DA 4CLEA 3RFUA 4EY5A 2RAUA 4C0QC 4FW9A 5C7OO 4O6VA 4YRTA 3AFHA 1HUQA 2GCOB 4RAQA 1JDNA 1FUYB 1ZMBA 2I33A 2PT7A 2CW5A 3PR1A 4HKTA 4KEAA 1VE1A 4OAPA 5DZSA 3TPFA 1Q0LA 3O0TA 3E0XA 3LRTA 4URYR 1YUBA 1GZDA 1EVQA 1KEPA 3LGXA 5H68A 1SURA 2CJYA 3ZD8A 4IUYA 5F5XA 3F96A 2PY6A 5BWNA 1HYQA 5K03A 1E8DA 3AU8A 2GZ1A 2SKEA 2W4MA 3H4VA 3I1JA 5DM60 3R3JA 5C8DA 3MJ4A 4DARA 1RAFA 1YZVA 4ZQFA 3FWNA 4G65A 4B3DA 3C8ZA 3P1JA 3E8MA 2ADMA 2B9EA 4YALA 4DQ0A 2Q0SA 3LDGA 3O73A 3TL6A 4CIVA 5BXYA 3VDMA 3D7RA 1ZHHA 2WUEA 4TT8A 1DJNA 1NJ2A 3RTBA 4N0MA 2X1HA 3BXHA 1DWPA 3MGAA 3SG0A 4K3UA 3N2YA 3X1ZA 1VG0B 4MUNA 3SWWA 4DB2A 1FUEA 3LO5A 3AI1A 3CPHA 1TA4A 2F48A 2IBMA 5I9MA 2Y2UA 2AZXA 2YCBA 2OK7A 3HJTA 5JD3A 5TC4A 1VG8A 4WVFA 1N9GB 4Q47A 2IXTA 4MQLA 1W75A 5EE1A 4IGKA 1E2UA 2DHRA 2AQ8A 4B46A 5KYNA 4HDKA 3NHAA 3ZOKA 3OT5A 4DGQA 2ISSD 2CD9A 1YS4A 2AJTA 3FBGA 4Y0NA 3RTAA 1J0XO 1ZVMA 3I6YA 4JL8A 2XW6A 4AKGA 1DKOA 3O91A 4WRRA 5T4BA 3L1IA 4MPPA 2VPWA 1U0TA 2JLCA 1ZKMA 4E03A 5EIEA 3FY4A 2QT9A 2J7KA 5K3FB 1GJRA 2VUHB 3BFXA 3JRWA 3NO4A 3NAQA 3ZZNA 1R4NB 4Q1FA 1YGYA 3F2VA 5TGDA 2CXHA 3EGCA 2M6LA 4DLYA 1YVRA 2X86A 4X5OA 1EUZA 1QTNA 3D4IA 5K0FA 1ZR4A 1WIWA 2N1BA 1ORRA 2FFHA 4MB6A 1AN9A 3VPHA 3KQKA 3CZAA 4E2YA 1CVRA 2VBIA 2YOGA 3IEVA 3CS3A 4Z1MD 2YC4C 5ICGA 2BDEA 1GZ3A 3R5JA 1D1TA 1ENPA 1Z29A 2A0UA 4FYHA 3ZCRA 1T9BA 1TO2E 1UAGA 1JECA 2HOQA 3PG5A 2XSZA 3A2LA 4GAEA 2IUEA 4W6ZA 4UNIA 5FUYA 5CDGA 3WDMA 1E2HA 3R09A 2B9VA 2QX9A 2VBFA 1BD4A 1R0CA 3PDIB 2AR9A 4P4TA 5B3LA 1W8IA 4H1HA 3HY4A 5C34B 5CLLA 2Q29A 3EXEA 3JZMA 4IFBA 2H4XA 2JCGA 3GDHA 3PR3A 5A1JA 1XDSA 2QAGA 1QX4A 2ZK7A 1I0IA 1PHPA 1C3XA 1PD1A 2XBLA 3IEKA 1FQKA 4HDSB 2Q8PA 1P75A 1SQ6A 4P1ZA 4M98A 3UWPA 4YRMA 1WB9A 1E5VA 4NG5A 2V59A 2HBQA 4TRRA 1T5LA 1G42A 1KI6A 4R01A 1IRXA 2Q62A 3MWLA 4RL6A 1ZIDA 3W3ZB 5J58A 3UBMA 1ISPA 4PLPA 3VRHA 1E2DA 2HYIC 1I2MA 5ITSA 1M1XB 1MIOB 4OYLA 1SMKA 3EGXA 3NRCA 3QHPA 2N9UA 4JD5A 1PZHA 3QXHA 5CR9A 5KVVA 3A1TA 3K71B 1CDZA 2R5NA 3V2HA 1ZCAA 1AKRA 4MR8B 3EH2A 1TEXA 1K6JA 1WVGA 2ZSEA 1CY4A 1EJBA 3H4IA 4G5FA 4P5DA 3E5RA 5I7AA 4K9QA 3K8YA 4JOSA 2PGAA 3WQBA 1XRMA 3OESA 4NARA 4GR9A 4H6XA 1QRAA 1UPUA 3ILYA 4KZKA 2MTBA 2GQ0A 2C4VA 3GJ7A 5DTRA 3FPEA 3B6JA 2MMGA 2NU9B 3VU1A 3ZOZA 4D9IA 4XAQA 1D2CA 1EE2A 3NPAA 3B85A 1BN6A 2UZ4A 1A4IA 3R6LA 2OGWA 2P11A 2QOEA 2R5WA 2VAVA 2WJWA 5A4AA 5DGIA 4H1TA 2NUPB 5HOQA 1N7HA 4AZ0B 5EMJA 1T2DA 1FXWA 2VQSA 2JG3A 4BXOB 4BASA 4IJMA 1TRHA 4ITRC 4KQKA 3TKLA 3VYWA 2GOYA 3PUWA 3X1KA 3ZGYA 5AXBA 3P9ZA 5FTLA 5C5CA 5HKLA 1BEZA 4HH0A 2NUAA 1ZWKA 4L51A 4K28A 3SIPA 3P9PA 4LKOA 3RRJA 5JSFA 3GBVA 1XQ1A 5G1OA 3AKCA 4OQZA 5KTKA 3DPUA 3FWYA 2FSSA 2PFGA 2AR7A 3IAM6 4KXYA 3RUDA 4G25A 3RQIA 4DFDA 4JBYA 1JUDA 4YHHB 4EHHA 1PKXA 3PCTA 1AY0A 2IPOA 3FJYA 5ER9A 3TN7A 3VNQA 4F4DA 2B30A 2OR3A 2E2WA 3IAAA 1NJ5A 1WA5A 2QMZA 3G2OA 3PC3A 4O4IA 4QUHA 1Y80A 5EXPA 1Q15A 3PPIA 2J5KA 2PMDA 2Q9CA 1JT9A 1U7UA 1TTPB 1X9GA 4NCAA 3IALA 3MYYA 2NAPA 4QO8A 4V0OA 4RD6A 1N34B 2O2XA 5CX1A 4DW8A 1A5SB 2R1TB 1Y9JA 1Z6AA 2B4RO 1OPRA 3DBLA 1LWOA 1SC9A 5A6VA 3O4VA 1R66A 3R0JA 3CLSD 1UJ5A 4Q4HA 1XQYA 4AROA 4RZSA 3E5NA 1GA6A 4Q93A 3DBLB 4DC1A 5TIIA 3K70D 1ZFNA 3F6RA 4HAVA 5J9FA 2F64A 1VHLA 3G5TA 4M3NA 4XFJA 2FQWA 4ZQHA 3TUZC 3VDXA 3U17A 4FUTA 3KXDA 3GRRA 5FHQA 2I54A 2VTBB 1X8KA 5EIXA 2W0MA 3R7AA 1LLQA 3WHLA 2XNJA 2RJNA 1C2YA 3K1YA 3HCNA 2Y92A 3OLCX 4NAVA 4XQEA 2F1KA 1EXVA 2ENWA 1T25A 4RHFA 3D6MA 3TJRA 4I9HA 4V2IA 1V7CA 3K6SB 4KO1S 2XE4A 3HSYA 5B2FA 2JHGA 3IMGA 4M0KA 2A92A 1M2EA 3SOZA 2QLJA 3E2IA 3GRYA 4REOA 1HOXA 1A72A 1XD2A 3FHLA 2FPGA 5C8VA 1BOFA 3NORA 1BJRE 1EWTA 4LW8A 5KWEA 1EUYA 1QGED 2VBCA 4JCOA 1ZGCA 2Q46A 3SSNA 4BAUA 2UUCB 1RT9A 2H63A 1UJCA 4PCAA 4CE6A 1Z7EA 3E58A 1NXSA 4HEA1 1E3TA 3BKWA 2YV4A 4G9EA 3CRVA 3B6EA 4MUMA 2VYVA 1BC5A 1ZJYA 4AURA 3IPRA 1Z8DA 1BSVA 4L57A 1E79D 1SBQA 1IBSA 3B2QA 4EQ6A 5A3RA 3L6RA 2JIMA 1QH1B 2D2XA 2VSQA 2GBLA 2WUVA 2X0IA 2C2ZA 2VDMB 3OTHA 2A30A 5KTTA 2ZUCA 1VL5A 4JP5A 5CTJA 1TGYA 2DHQA 3G49A 4XYEA 2Q5HA 1RWKA 4GDFA 3GO4A 2Z2YA 3C5WP 4NNPA 4WXEA 3MSXA 5LQAA 4NYIQ 3AEQA 4RHTA 5REQB 2BMEA 3MK31 4R51A 4Q66C 3VTKA 4M0LA 1RWQA 3GVXA 4YI3A 3SIWA 1BQEA 1TE2A 2VHUA 4Q7KA 1XYVA 5J2TA 1Q1AA 2E4WA 3UHFA 3JPYA 3ZKAA 2VYND 1OGJA 2YJ6A 3FNFA 3ITEA 4U5QA 4OMCA 3KVOA 2IPNA 3LLUA 521PA 3PLAE 2P91A 1OZ0A 3ABQB 2FMTA 2HF9A 4IS3A 3KRTA 1LS1A 2ZJ5A 5CM8B 4BRSA 2QXUA 4IDQA 4ZZ3A 2E18A 2VA8A 2ZUBA 3JQCA 3JYPA 4N8EA 1ADYA 3RTDA 3V8NA 4D02A 1E9EA 4JT9A 1EE9A 2NT4A 2X6RA 2XB8A 2D0OB 4GYWA 4HUQB 1GPH1 3QIVA 4UCQA 2O14A 2BFCA 2ONCA 1U3FA 3BFJA 4B33A 1W87A 3AI3A 3BH0A 1G41A 3BJMA 3I9KA 5DYNA 2FJ0A 3CNQS 5L9AA 2R86A 3IOMA 4IDNA 2VOJA 1QCYA 4K6KA 2VPIA 4QDOA 4XD7A 1E8NA 1B3BA 4KV7A 4YPFA 3TAUA 1M10A 4RFLA 1JXAA 3F8TA 4NBUA 4OYHA 2J3KA 4PAGA 4WZ6A 4XWAA 4HS4A 3ME5A 3D54D 1NBAA 3MC1A 4EENA 4DA4A 4C4TA 4S1TA 1UBHS 2QJTA 4G2NA 4MJ3A 2WLSA 3KT8A 3R3HA 1XCGB 1ZH8A 2VJMA 1Q44A 2X58A 2AR0A 3IXQA 3TMAA 5FOUA 1Z15A 4XPIB 2R8RA 1EP9A 4BUZA 1UXKA 1CIVA 2ZIUB 2LDXA 4DZTA 5C3MA 5HK8A 2XPCA 1NX6A 4LOLA 7ADHA 1UBKS 3JQAB 4WASA 3QLTA 2R6AA 4L72A 2MCFA 3GRFA 2QQ5A 3WKEA 2ZZNA 1DQRA 3LY5A 4G1EB 3EF1A 1XLVA 4BFYA 2PUEA 3OJFA 1COWD 3N2LA 1KE1A 4G26A 2M98A 4X61A 1ZMTA 1D0SA 2FB9A 2QSUA 3NKFA 4RAOA 3PC7A 2GD0A 1FMCA 3E61A 5L3SA 3MTDA 3OZAA 2VK8A 1S89A 1JA1A 1VGVA 2XT0A 4KMSA 3IUJA 2HNKA 5CP8A 1V1RA 4Z7OB 4ARZA 4B3RB 1CEYA 4RORA 5DHTA 1YI1A 3SK0A 3UJ7A 2QTMA 3ZWCA 4ZOCA 4W5TA 3CX8A 3C6QA 2WINI 4FQ7A 4XB2A 3RVBA 1L4GA 2BHRA 2IUTA 3EF3A 3U4MA 2PBZA 2GEUA 3HGTA 5BR1A 1L1QA 2YRWA 1W0KA 2AOXA 2F1HA 1KSJA 1QHFA 1OXXK 3IPCA 3CV3A 2IU0A 5LP6B 4WBXC 4NBRA 3L0SA 4ASUA 3I6BA 5BSUA 4E13A 4RKEA 5A5EA 2L0XA 5BMVF 3O8DA 5GINE 4EBBA 2Y4NA 2GZMA 1GZ6A 2DP4E 1XDGA 2XB4A 4QJ4A 3W34A 1B26A 1SBHA 3SOPA 4GKKB 1A9RA 2IXAA 2VDOB 1VYHA 3P0EA 2YWBA 1TF5A 1LC0A 3BRQA 2QP4A 4MNTA 2G4CA 4UVIA 3RKRA 3WQQA 1WCIA 1NJFA 3BMOA 1XLTA 5IABA 1FTQA 1G64A 4UBMA 3W8EA 3Q8XB 1POWA 3VO2A 5C4MA 1T8WA 1S01A 2WD9A 2WSMA 1QIFA 1G21A 2E4UA 3FPGA 2GTHA 4NQZA 3QSYA 2O8BB 4RZQA 2VPYA 4ETIA 4RH1A 2O5RA 5FV7A 2E5LB 4BUJA 4OLBA 1CV2A 2HLPA 3RHZA 4C4XA 4ZC1A 5HUHA 3AU9A 5JZSA 3SC2B 3B3GA 1KVSA 4LISA 4Z3DA 2XEXA 3CY6A 3KKQA 5LYJA 4ZEVA 4M60A 4C5AA 1PFVA 1BHQ1 2BEWA 3BHIA 2GF2A 2R9VA 3ZE2B 4PZAA 1NF3A 4PNPA 2IPXA 3RF6A 2ZRCA 2I7CA 1AURA 1I4WA 2JA2A 3B5JA 5E6RA 3GFPA 4JX9A 2AD1A 1EGAA 5B4VA 1GFZA 1G3MA 2PMBA 1XTRA 1FTSA 3G5AA 4PZEA 4ZGGA 3F7TA 3BM5A 3FPKA 2OV2A 3ZCPA 1T0PA 1Z4OA 2QGFA 1I5EA 5KHAA 3VR6H 1QG0A 4HFRA 4K81B 4OY3A 4LECA 4F60A 5L95A 4H7IA 4PZCA 2YXDA 4FHZA 2BBSA 2WICA 2R2AA 3BL8A 4JHLA 5FORA 1RPTA 1VJCA 2P9JA 2H8GA 4UAVA 2VUIB 1XV5A 3R0ZA 4C7MA 3HMQA 1QUFA 2A1UB 3D8UA 1A5ZA 4ZT2A 2HN9A 4TXHA 4KIJA 2ATXA 3BGOS 2Q41A 1Z18A 3CEHA 2ID9A 5THKA 3ZK8A 2A0WA 4P34A 4ZOLA 2ZYSA 3EISA 3T9EA 1RFGE 1LNZA 3CH6A 4YLYA 1LV8A 1P4JA 2XOXA 5FPHA 3DBOB 2I2BA 4F2PA 1EK0A 2SBTA 2VDVE 1WB5A 3I4LA 2H4JA 3K5WA 1PT8A 4OSOA 5HFAA 4HNAA 2ZTHA 4LMBA 3W1EA 5I7FA 3DTNA 3W4IA 1C1DB 4FOOA 1MZPA 3DKKA 1CZUA 3WAKA 2H59A 3UJ8A 3U44A 5COQA 4KUGA 4QJBA 4RMIA 1FJXA 5G2OA 1DIAA 1N0WA 3SQDA 2XKJE 4ARUA 1FTYA 2PMCA 2P4EA 3STTA 1CLEA 3OKFA 1J7JA 1QLHA 4K5QA 2I71A 3ZLUA 5DP1A 5I7HA 1ZCZA 3AIMA 1SQGA 4ENPA 1W5FA 3FRHA 4M1ZA 4LPKA 4QT4A 4YMLA 1DV1A 1WU8A 4JYZA 2AG6A 3TW6A 2PR2A 1SEVA 4CM3A 5FJIA 2IUYA 2CYBA 2V7UA 3E8SA 3MS2A 3AP3A 1JHYA 3QVGB 4FOLA 1PDWA 1GEEA 1VI5A 4CEHB 1ECBA 1X8JA 3TRIA 1AQJA 3UMMA 4GU5A 4TMYA 3L8FA 4O4JA 4B4WA 2ZI6A 2EZTA 4B3IA 2VH5R 1QNLA 4JI7B 4BFWA 2OKCA 4XVCA 3GPIA 3DAGA 1JSZA 3NHUA 5JYBA 2B1JA 3QUTA 2D7CA 4NJOA 4R7ZA 1E1NA 1JN0A 1FXUA 1RXIA 1MLDA 1N5IA 3DBHB 3H9QA 4RHEA 2XIJA 4WCFB 5H83A 4CN9A 4RTNA 3D8HA 1SKYB 3LQFA 4L16A 1JXQA 5HBRA 5FLYA 2FLVA 1JEJA 1Y0BA 4PAMA 2YVUA 5HG0A 5C1BA 4Z4QA 1NUAA 3IMFA 3AEXA 4PFQA 5BP7A 4P83A 4IP0A 4URWR 3GLGA 1CQWA 1EEHA 1GT91 2P1ZA 3IQEA 3MGBA 4G0NA 3V1MA 1UCFA 4AZWA 4DM7A 4YUXA 4O4LB 2JHPA 3Q8LA 2IZ5A 2C03A 4RLFA 1JR6A 3KQNA 2ZBFA 2V9ZA 3KEGA 4G4SO 4TV9B 2J4DA 4C88A 2BY4A 3DD5A 1D6MA 1R16A 2NX2A 3VKFA 1YR9A 2GXAA 2GHQA 1WD5A 3OFNA 1XK6A 4M22A 5CT4A 1LB1B 4H4CA 4BGIA 5A3QA 3A36A 2HMUA 3KKOA 3SXPA 1KMHB 3MS4A 1TM4E 5I8PA 1ZSYA 2P9QA 3I6ZA 3GBPA 2X2PA 1OE0A 1EFRA 2XUIA 4WW0A 3REGA 3TQIA 4RVHA 1SVMA 2C9BA 4NFLA 1RVV1 4C7KA 4Z5XA 2PU5A 1D4FA 2GK3A 3L0IB 4GI5A 9ABPA 5SYNA 3FCYA 4KYUA 5CT8A 4BVLA 3OECA 1V5GA 1NV8A 1TQ6A 3RQSA 5K3FA 3OY7A 4TLBA 4CZ2A 1W46A 1DKRA 1ZKDA 2QENA 3OE7A 2QRVB 3OOYA 3RIHA 5K6TA 3QPUA 4MVJD 4YRRA 1W9HA 2H4YA 4Q9KA 2Q2VA 1KA9H 1QLJA 3OD1A 1FU7A 2QUAA 3SF0A 5HIKA 3S2YA 2XBUA 3CPEA 1L2TA 4PIPA 2IIBA 4ZVLA 2ODWA 4KWCA 5JWOA 4LF7B 3HI4A 1WMSA 4IRXA 4NZ9A 5IAEA 4D9FA 5KNBD 1CQXA 2OGUA 4LV6A 4LBWA 1USKA 1FLNA 3COZA 4Z4FA 3O4JA 2DCMA 5EP4A 4DHWA 3QV2A 1XDWA 2ZYVX 4GPIB 1LI7A 4HG2A 4IBOA 3MILA 1YWGO 2LGJA 3UPUA 2CVPA 1BQ3A 5HRUA 2HQ1A 1KYVA 1AMUA 4DUYB 1A97A 4TVOA 5FA8A 1HR0B 2XECA 2ZI7A 4FDLA 3UYKA 2ZATA 3OEED 3E81A 4PN7A 2WSYB 2RGYA 3AM4A 1NOJA 3MUEA 5C4GB 2KLHA 1NY6A 1TKRA 2ZI3A 2ZSDA 3C3JA 4IDEA 2WYWA 2WJPA 2W70A 1ZBDA 3I9NA 1OB2A 3K2QA 3BMNA 3G8CA 3NTRA 3HGMA 4MMXB 2R7AA 4BNJA 1JAZA 4TTPA 3DBVO 1HQYE 2ZE8A 2JD0A 1LW6E 3WMWA 2PKCA 2HXGA 2P6PA 2WP8J 4ETMA 5BW8A 2CKMA 1YZQA 3HDYA 5AHWA 4V0LA 3CVWA 4TYWA 3S2SA 1LLCA 1SOMA 1U7ZA 4A03A 4DM4A 4DMFA 4J43A 2QG4A 4JLWA 2CE7A 2GCOA 4W6QA 4UQPA 1VCHA 2UVQA 1I3NA 2B1GA 5D85A 3IEPA 5CB4A 2WYOA 2CMKA 2EXXA 5EGNA 1KRWA 1G17A 5T4HA 1ESNA 1QZUA 1EM8A 1M2HA 3GLUA 4UCWA 4GW3A 3F49S 3ETLA 3IC5A 3E9ZA 1H0RA 4O2AA 5E7QA 3CLHA 1NULA 1E7RA 1PDVA 1R12A 1TJ4A 3JTMA 5E6RB 1HKHA 1T9KA 4J9VA 2IHNA 4HN2A 1ZAYA 3DLHA 1BTOA 2P1RA 3TGWA 1YVPA 1XWFA 5DCUA 1QQ7A 1RJEA 4MLPA 4Y2XA 1MMFB 2FWMX 3SDSA 2XJ9A 4RLSA 3FDFA 3WGOA 5CFQA 3NJ8A 1WY5A 4K9SA 4EJSB 5L40A 1OYYA 4JLMA 4QHYA 4I5EA 2EOAA 3C3AA 3GL9A 2IGTA 4EKNB 4DTIA 4ZGBA 2OL4A 3TCKA 1SBIA 3EODA 3AR8A 2HMYB 1C9DB 4R7TA 4RK4A 3HV2A 1HH4A 4PQRA 1ESMA 4N9WA 1M75A 2GJSA 1RZUA 2Z08A 3DJFA 2H2WA 4E1BA 4YDQA 2LTAA 1JG2A 5LXTF 3NYIA 1U7TA 2MIIA 3IEMA 4MP8A 2CDRA 5CDYA 1RYNA 1CEQA 3GA5A 4KX5A 4EO9A 2BL4A 3C6YA 4WN9B 3LCVB 3D4OA 3TFOA 3BB3A 3VSCA 3UAVA 4AY6A 1SCQA 3KJHA 3CHYA 1U9CA 3LY9A 5CVVA 3L8YA 4MGHA 1ZJ5A 3PF9A 3AF5A 3AY7A 2JS7A 5FUMA 3QEAZ 1JXMA 4EEKA 4E6EA 4LE2A 3TRDA 3FUTA 5FI0B 5LP6A 1R4NA 3CZRA 5BVHA 4EZEA 3OOEA 4IXMA 3RS2A 4N48A 4I1IA 2P9TA 2R6FA 4NBSA 5B3KA 4GVXA 1ZA2A 4ZZ1A 4I4NA 2BGIA 2JFYA 3AB3A 1FJGB 2SCUB 2XA1A 4NK4A 1U4SA 1RHQA 3IQGX 5G0SA 4WACA 2CKDA 3HCOA 3DDSA 5C8YF 4OQLA 1K5GA 3L02A 1DE0A 1LPMA 3NNSA 4BNVA 2BTOA 2X42A 3EMVA 2C58A 5JTUA 4OQPA 3QVGA 4O4JF 4TRNA 1UPBA 3MGKA 1V37A 4HS9A 2ZS9A 3DEIA 3BEOA 4BC1A 4BO3A 5AVYA 3AERA 3N70A 2JH3A 1FFGA 1S6YA 2Q7OE 4MROA 1JQDA 3LP8A 5FLXA 3G8BA 2ZT7A 2FWJA 2P2SA 5CCXA 3DO5A 4V2UA 1WULS 3NTXA 3KB8A 1MX1A 2FPIA 3T52A 5BN4A 3NBFA 1PLLA 2ZVPX 3KT3A 2XHZA 3QPWA 2FPXA 2PX8A 2ZRJA 3M4NA 3A9RA 4EZBA 2Q1UA 2WAAA 3EDQA 4BLSA 3CNBA 4Q9NA 4AKTA 3U31A 2YZNA 3CZ9A 3HUUA 4IQ0A 1LTHR 2IP1A 1M5TA 1QUEA 2F3TA 5JUWA 3ENVA 4C0JA 2A5JA 1JBKA 2FR0A 3WOVA 4RTJA 2CJWB 3GWZA 2BSAA 4P84A 3AR4A 1JHXA 3CEMA 6PFKA 8ADHA 5FOSA 1FDIA 3GJYA 4XGIA 5DCLA 3PQ8A 4W9NC 3VZPA 3W0LB 4F92B 3BGSA 1GG2A 3EGDB 1IBKB 1Y6RA 4UVEA 4DLPA 5BV1A 4LWQA 3VGJA 2XWBF 2DH5A 2RE8A 1JAYA 1HX7A 2YIMA 5E38A 4B6QA 2Y3IA 3I9V6 1IN4A 4DILA 1DWQA 1EFUA 1X6VA 2POQX 4IINA 1ZM9A 3TH5A 2QS9A 1LQUA 1G18A 4FZVA 4RM3A 5J43A 3QWHA 4MV5A 2CZCA 1KH3A 3DE7X 3N6VA 1J49A 4HXGA 1GL3A 1CSEE 3P27A 6REQA 2HHCA 1MX9A 4DVGA 2HNBA 2Q1XA 1ID1A 2OBNA 3GW8A 4L4UA 3S2ZA 5I4IA 2OV3A 1B43A 2Q3BA 3HP7A 2BFEB 3BAZA 3Q7IA 3AONB 4JUFA 3ELBA 2C8JA 3NTLA 5KTPA 1X7HA 2JFNA 3LWDA 1T29A 3BXGA 4TKMA 5DTJA 4C4YA 4JU9A 2QQ0A 4YACA 2CLLB 5ALDA 1ZWLA 1IWBB 3PUHA 1Z5ZA 2Y0DA 3LYUA 1ODJA 4QAJA 3CGGA 4MS3A 1JLSA 1XDZA 4BNHA 1R64A 4K0RA 4FR5A 1SXGA 2Y8EA 1VMKA 3WQSB 2H7XA 4UULA 4WXPA 1QHEA 1SU6A 4OXYA 4X62B 1CERA 3R8CA 1YZ3A 5FAXA 4BO1A 2J6HA 3L0DA 5FRDA 1KWGA 1QVWA 4XWYA 4TM7A 1B23P 1NX9A 1E1CB 3DFUA 3IDAA 4AMUA 3W77A 2H7YA 5T4EA 2X0JA 4LCBA 3EGWA 5A03A 4HN4B 3RU2A 4J0EA 4RQBA 2C3MA 3R7SA 1UXOA 4IDPA 5I7OA 4ASUD 3KKLA 1ORWA 2GRJA 3ICVA 3ZHQA 3LI2A 2JGNA 3CUSA 2KB0A 4B6EA 2HSDA 4B76A 4R2HA 2H4FA 4AUNA 4FYXA 4KO8A 3ZIUA 2XE7A 2V96A 2GKSA 4TN1A 1XZJA 4PG4A 3CRRA 4PAQA 3JD2A 3T3PB 2Z3ZA 3N2NA 4YV0A 2IV3A 2B5VA 1XU9A 2R6R1 3V5NA 2CJPA 2PKEA 1GG8A 3DZGA 3L5KA 1QVZA 4ZMSA 4JJ8A 4TLCA 2PO5A 3D3NA 3OURA 4BB5A 3DPSA 3WYCA 1NBIA 2FRDC 4Y9UA 3UWOA 4HPXB 5IDXA 2OZEA 1YU6A 3GLGB 3ZGZA 1O0SA 4KQEA 3TD9A 5DH9A 4HNHA 4OSEA 4Y2GA 4YEDA 3S0JA 5EHXA 1R18A 3I8XA 3RYCA 3KXPA 4O2BF 4ZGWA 2OD9A 2ZBVA 3K2BA 2ZWIA 1V4BA 5BQXA 2H3EA 4RY8A 4BTVA 2XVXA 5KNLA 3HC7A 3LFHA 4BGDA 4LV5B 1YCDA 4KE9A 3O8OA 3LKBA 4G0ZA 5CEJA 4DLAA 5JVDB 1SBTA 4N5HX 3PHGA 5DASA 2JZOA 1P1HA 1O5IA 1V5WA 4MGIR 3ZI7A 5CFRA 2YHIA 5BR7A 2PH1A 1LF0A 3KD3A 2OTCA 5FI1B 5EJEA 4JL6A 2NXWA 2WA1A 2R85A 3KAPA 3DBRA 2XUFA 1H05A 1Q0PA 4Y6RA 4AY3A 5CK5A 1SRRA 2I3ZA 3IKMB 5HQ3A 3RVPA 1BNCA 4PYJA 5A62A 1YF3A 1W36C 3AIKA 3PDCA 3TD6A 4EX6A 2R1ZA 4G1VA 4M49A 5FWDA 3BXEA 1DS6A 4G0WA 4ZO7A 5HKOA 1P7ZA 4AULA 4V0KA 5KWJA 3U1TA 4XUGB 3Q7SA 2A9KA 3JD0A 3S5UA 2PK3A 2C5EA 3NP7A 2O50A 2QQFA 2XMRA 1X42A 1IHXA 1QVRA 1D1QA 2FEWB 2ILVA 4NEHB 2OQVA 2YUTA 2C0CA 1ULTA 3N3AC 1KI4A 4FIZA 4CCYB 3GD7A 3T5PA 2FHSA 4H7EA 1RYDA 3H9GA 2GM4A 3VC7A 1IUKA 1MV8A 4IX1A 2ZITA 5C8YA 1XJ5A 4G81A 3FA2A 1PJ4A 5E4JA 5EXDA 2WWHA 4Q34A 3T06B 1ZIOA 3OQIA 5EYPA 1LRLA 1CS0B 1Y6JA 4W63A 4OP2A 1RQ2A 4JC4A 4LYDA 5E2IA 5IUKC 3VHQA 3THYA 2CN1A 2ENUA 3FPBA 4YBZA 3U1VA 2W2TA 3LYLA 4D56A 5EPEA 2O20A 3K94A 5AJZA 3GLGE 1ZM4A 1QIKA 2G09A 4O25A 3A3YA 4S12A 3ZTYA 1FXSA 4BWFB 5LP6C 1XCOA 1K7XB 3H2HA 2CWDA 4HXYA 4IICA 4LOKA 2BMJA 3WMEA 3ZXXA 4C7VA 9MHTA 2J3HA 3AEQB 4XJVA 1PJZA 1UPTA 1Z36A 2Y0BA 4IQ4A 4K9KA 5K4AA 4C6TA 4GS5A 4MUKA 1QH9A 1YZTA 3BRWD 4AF6A 1H65A 1N1EA 3DDNA 4UE2A 3E7FA 2Q28A 2DPLA 7MDHA 5IUJC 4LQ4A 2NM0A 3ZK9A 5E4FA 1GTRA 3IR5A 3DZIA 1SR8A 5L3QB 3MJCA 1CZHA 1P45A 4LY6A 3AR2A 1D9XA 3MWEA 5TPWB 3ERCA 3SC6A 2CB9A 2BGWA 1GGEA 1LJLA 1PFGA 4G85A 1GPUA 1XBTA 3B20A 3UEOA 1JFTA 3IBTA 4IKEA 5CAEB 1ZK3A 1HE5A 2IY9A 2F7SA 3VUFA 4J0GA 3COPA 4RTRA 1NP3A 3QU4A 1M34A 3J80A 2COEA 2V7VA 1CUXA 4MW1A 2DR3A 4HMPA 4IILA 2RGBA 1ULHA 2ZRKA 4PBSA 1II0A 1JVSA 3CPJB 4PHGA 1Q1QA 2EERA 3GQBA 3TSZA 2O8VA 2A3NA 2Y67A 3PIIA 4QC2A 4ZI5A 2UXBB 1GCUA 1Z4NA 3FIUA 3JW8A 2RGWA 2EDCA 2OP0A 2WU3A 1X1RA 1VYUA 3IJPA 3BD9A 2VYFA 3HCRA 5CW2A 4BV3A 3DLCA 2OM6A 3BTSA 5AXCA 1W5AA 2XOKA 4YRSA 3ICOA 1EFLA 3ILXA 3OZEA 1YT5A 2B82A 1PQYA 5H81A 2IZZA 5K8CA 1DINA 1E6LA 2ZKLA 3DL2A 3TNYA 4NEGA 3DF9A 3W3AH 4UM7A 1E2EA 2C7QA 4L75A 2XCIA 1XZDA 3BB4A 3PQFA 3QTBA 2PUFA 3O8RA 2DCUA 3PC8A 3STUA 2VJQA 1KK3A 4F4HA 5CG1A 1D0IA 3FR7A 5MHTA 4UQOA 3B60A 1LDBA 1Z39A 3MWKA 3KU4A 2IOYA 1G59A 3GLKA 1DTWB 2RGEA 2CVHA 1TTHA 1SK8A 3I5AA 3DAYA 4L5CA 3GCXA 4Q05A 4R54A 1ZGZA 2QSJA 4F71A 5LQKA 2FEAA 5E9AA 2GVNA 3P4YA 3Q2KA 4FFWA 1E89A 4XTRA 5KYWB 4GT1A 2JI7A 1K4YA 1ZNXA 2F43B 4U7WA 3MT9A 4R0NA 4HLUC 4RPHA 5JCOC 4BOYA 4NOJA 3VVLA 1G20B 1LQTA 2IHZA 3VR1A 1R6TA 1R4MA 4X20A 4AMGA 2JIZD 2AOUA 4B6FA 4UMDA 2V7QA 3HMKA 1I1OA 3BWDD 4QGHA 3W8DA 2OUIA 5CRIA 1L0BA 3RVOA 3AUAA 3K16A 5AXAA 3MIIA 1O08A 1SVLA 1DAOA 3ED1A 3F3YA 3GRUA 2IYSA 4YAFA 2PCJA 1HTBA 4Z8XA 1MPXA 3AUSA 1PNRA 3GJ6A 2RHDA 5AOBA 5IAOA 2HNAA 2R4TA 5F1YA 3EWIA 5DHFA 1P73A 1JR3E 2QZPA 3MAJA 2F55A 3N0RA 1C0KA 4DBVO 4QBIA 1ABEA 2UV8A 2YH2A 2ZBRA 3T9DA 3WGJA 1JIVA 2JAHA 3L49A 3LLMA 4MQFA 2FW9A 2R79A 3O1LA 3E3OA 4RADA 4XGRA 3WJ7A 3F73A 3GA0A 4FB4A 5SYMA 3W6UA 4R1MA 5CA0A 3ELUA 1T4BA 2CY0A 1A2KC 4CU5A 1WXQA 2HYDA 4NE2A 5LDDC 5EHQA 2AEMA 3PK0A 3C14C 1NVVR 3QK7A 4LZOA 3NMUF 1IH8A 4DG5A 1AXGA 4AU1A 2LP4Y 4F6RA 2XUKA 2YHIB 2YHSA 1EK1A 3GK3A 5KQSA 1WPRA 5DIFA 4DIOA 1YC5A 3MINA 1U1CA 3AW9A 3I9OA 2Z5LA 4FC6A 3K6KA 1TM7E 1XWIA 3OLYA 5ALQA 4R9UC 3SKYA 2V6JA 4YJ3F 5EIOA 4IGIA 1WD7A 4XDYA 1RE0A 2A84A 5IT9A 3OZGA 4TS1A 4QTZA 4DUGD 5D3QA 2P68A 1GZHB 1QP8A 4NHEA 1YDFA 3T9AA 4DWVA 3CVOA 2QTBA 4INZA 1C1DA 2ZRIA 3N2ZB 5EQTA 2QIOA 5ED0A 4GICA 4HAZA 1E5QA 3DDUA 1U9JA 5DULA 5DM70 1MENA 1RHJA 2R1VB 4F4CA 3H6HA 3KQQA 4FLMA 2VDWA 2W7TA 2QQEA 4WTOA 1QE0A 1IAVA 1E66A 1YJCA 4PPGA 2Y93A 1I30A 4FFBA 4IEFB 2FK8A 2JI6A 4MUXA 4TTAA 3EUAA 4E51A 2HI0A 2J46A 3T4PA 2PKRA 4IZHA 5LFAA 2F1IA 1ZS9A 3QVXA 2P69A 2YWXA 4HFJA 2ZYAA 2QRKA 4L15A 1E0JA 4YJHA 1JP7A 5FL7A 1TCUA 4JYBA 2XNDA 3QENA 1DCFA 4PZUA 4RD1A 5CDTA 1BYIA 2B1QA 1J1IA 1M5UA 2P9YA 3ABOB 3E9NA 1WXWA 2BEVB 2CT8A 5GP1A 4R16A 3D6FA 5JNVA 1K66A 5FEMA 5GADl 4UAUA 1L5MA 1UBEA 3BA1A 4CKYA 4WKNA 3BN3A 2PD4A 3ND9A 3PQ2A 3M4YA 3FNGA 4M7OA 5HIMA 4BO7A 4F4IA 2WYIA 4CKWA 3TRJA 5ADWA 1T3LA 2ZSIA 1WMBA 1TAGA 2FG6C 4HB2A 3WA6A 5H3CA 3IBCA 1NNUA 4NOKA 4OI4A 4B85A 4AG6A 2J87A 3C2QA 1W34A 3D7MA 3E1SA 4GMXA 4TLEA 2FN3A 1LLFA 1B6RA 1HL7A 1KI7A 1D1SA 2NWQA 3C8MA 2OQRA 2OT3B 3AILA 3S7TA 3N28A 4RESA 5JS7A 1HLDA 2BHTA 2QD1A 3BF7A 4GMGA 3K1JA 4F3TA 5HK9A 3D9QX 1SOVA 3IUNA 2FFJA 4IIGA 4RK0A 4S2EA 3GARA 3CX7A 3WNQA 3OKPA 5L3RA 4D9MA 1RYFA 1AKTA 5CXUA 5JAUA 1C1XB 1ENYA 1MXHA 1LDMA 3CEAA 3DP7A 4JC8A 4KPFC 4TWRA 5KNDH 1TGVA 4MYTA 1SKBA 3A7DA 1RLMA 4WERA 4EK9A 5IWCA 4WQMA 3ZS9A 1FTWA 2HF7A 4ZREA 5FBVB 2ZT6A 2O8CB 3T9CA 5EI5A 5TQ0B 1IHYA 4U9HS 4B3TB 5IW8A 2V6IA 4A6DA 2ZUUA 2O3SA 2JLWA 3EZ2A 1LSJA 3U7EB 1RBYA 4UHDA 5ARCA 4PLGA 2R47A 2QRUA 3AV0B 1H22A 1KORA 4PFJA 4ENWA 3VPDA 1DDGA 1NM5C 1KZ9A 5ALYA 3MCVA 3P2MA 4EL5A 2MSCB 1YDHA 4MO9A 1O3YA 5TEWA 4N76A 2B36A 1ZLYA 4RIGA 5IBPA 3USZA 3PGVA 2KS6A 2ZPAA 4EUKA 5CVUA 1LPPA 1FNCA 3PE6A 4YB8A 1U65A 2H51A 4R2KA 2G82A 2XOEA 4A8JA 5K4HA 1GGVA 1MXFA 2VRWA 4DABA 2BKEA 4CLDA 4ZI3A 4NV3A 1DDOA 1I36A 3N2GA 2B3TA 4DIKA 2GYVA 4I7EA 3WB9A 4RFSA 3RVMA 2P9HA 4OQYA 5CEEA 5LZ7A 2IL1A 1Q6ZA 3IERA 4YAKA 2AT1A 4GLOA 4UM9D 5EA2A 3ZXUB 3ENZA 2I87A 4YP7A 1Z5NA 4GNRA 4GP6A 2PUGA 4I5DA 2PKWA 1KIMA 1M0SA 4JY7A 1YA4A 1Z5PA 3D4NA 2YKGA 4K3VA 3PWSA 1XX6A 3TFWA 1N32B 1NJ6A 2HWUA 4NFHA 4H4EA 5KU7A 2X4LA 2R6DA 1QH0A 3GZJA 1ADBA 3RRXA 2FW1A 1PSZA 1WUIS 1JMKC 2NU7A 2VEDA 3CF0A 3EDRA 1ZUD1 3F7MA 3HDGA 3K2EA 5JBQA 5C52B 3GJ0A 3CO5A 4FHFA 3C7DB 5IJ0B 4C1BA 3MBIA 4CLHA 2C95A 4NDAA 3EGDA 3PQ5A 3AKEA 2J3JA 3PVZA 1IPFA 5GONA 3PX7A 3NT2A 1X8LA 2BRUC 4JYMA 4B3JA 3RG2A 5A4DA 1SUDA 1GTZA 3R23A 4ZVTA 3CWCA 5I7UA 2ADOA 2I6FA 1CJBA 3UJ3X 4LXGA 1KXJA 2AFHE 2RHBA 3STVA 1R15A 3P9NA 2O54A 4QUJA 3KDSE 5AWFC 1XUOA 1CHNA 4I99A 3CTPA 1JEQB 3HLTA 1CRZA 2DQKA 2HCBA 2VF8A 3FCCA 3P0FA 1GKYA 4M89A 5FUWA 5SZIA 3V4LA 3IUBA 3VPSA 4MAFA 1KMNA 2SHKA 1NW7A 1M2VA 3BHJA 2BELA 4FS3A 5TNXA 4ER6A 2O48X 3WGKA 3ZHUA 2GWRA 4FWTA 3ZD6A 4BGEA 1BHO1 3D43A 4ABYA 1G19A 3B2NA 5DKFA 3ZDFA 1RHMA 1IK4A 2FMIA 1CE8B 4TMXA 1PJTA 1K4MA 1LPAB 4PV7A 4C9BA 3SBDA 5HKKA 2ZUFA 3PJFA 4DSOA 1CNMA 3HWWA 3THOA 3ROMA 4C7XA 1PQPA 4HWPA 5L3QA 1AMOA 5EJ8A 3BWYA 1B6TA 1H2FA 1YK1A 2YCLA 4PC2A 5E4YA 3WLRA 1CF4A 3HRKA 1MAVA 4LMAA 1GRNA 3UG6A 1Y89A 4WX2B 1VJGA 5JC8A 3OLWA 1Y8RA 2XCUA 1N6RA 4EF4A 4INOA 3QMVA 3PR2B 2ZJ1A 3OO1A 3UVEA 2WJYA 4E08A 3A6GA 4OGFA 4GOJA 4JQSA 5IM4A 2FH5B 2E4XA 1T34A 4MR8A 2PZLA 2B3DA 5AW5A 5J2TB 2JFQA 4R3NA 3S40A 1T43A 1DQNA 3ETJA 1T6YA 4BU1A 3AEZA 4NLLA 1AUOA 1RXSA 1NYRA 2C4MA 3FMOB 1O94D 3PPYA 4BS9A 4TS3A 4OJNA 1BHJA 1QX3A 2X5OA 1F3OA 1PJ2A 2ZRQA 3DVRX 4JXZA 4C4RA 5H3LA 4RPLA 2D0IA 1SPXA 3UK0A 1XTBA 5IASA 5AVUA 1Q95A 1UJ4A 4JP1A 4RS3A 2HXYA 5K3SA 421PA 2DB3A 3KVRA 4A6XA 4B87A 2F9FA 4RLQA 1NMXA 1RWNA 3HPQA 3WHIA 1UBGA 3RNOA 1QMPA 3WYNA 4N5NA 4D45A 4CI9A 3AUYA 3B48A 4F72A 1M6WA 1QZZA 3ETDA 5D7NA 2IYZA 4DL9A 4CYMA 1A9YA 3TTTA 3TSCA 2QX8A 1NGSA 5GY7A 3LPCA 1U1FA 1WOMA 5FWYB 2X6QA 3FF1A 3ROPA 1CY7A 1EFCA 2OUKA 3OD5A 3OUUA 4BATA 1L5RA 3KKMA 5B5SA 3MTEA 1YKSA 2H4WA 4RW0A 5EJFA 4J07A 3B3JA 4P8RA 5HVNA 3DGFC 1D09A 4F86A 1UBRS 4C29A 1YKFA 2PIAA 5TJ9A 1KFKB 1T24A 1C7FA 1YZUA 2LXNA 3C7TA 4RACA 3QX8A 3EPJA 3B1YA 4G5QA 1JDBB 5BW6B 5DXAA 1SEPA 2QYTA 2Y1DA 4IRMA 4JH0A 3UAGA 1STOA 1RC8A 1GM5A 3C5HA 1COZA 1UBFA 2HEIA 4DV0B 3VYRB 5DLPA 1OBFO 3NU1A 4RANA 1KKMA 4PO8A 4YC7A 2CXRA 3I34X 4RZUA 4Z4CA 2GEDA 3DVAB 2H2FA 3FM9A 2P9ZA 2XQIA 5GVRA 2P79A 1JQ5A 1RXYA 4HL6A 4BX8A 1P17A 1H1LA 3M6LA 5EQFA 4AXXA 2AH5A 2XHEA 1S2IA 1XLTC 4MPJA 2GCNA 3AFMA 4DA9A 5C37A 5T7BA 1ICIA 2G4LA 1M1YE 4IIFA 4ZU1X 1KO8A 4FHEA 2QDXA 4I50B 1Q0QA 1VE6A 4PGAA 4PQFA 2PD3A 4WCFC 3ZGOA 3W6OA 4PG7A 3CF4G 2CK3A 2BGKA 1Q83A 4B0OA 5LBIA 4FZRA 1FVXA 1E9CA 3LOUA 2MSWA 4WUTA 3W4KA 2GTPA 2WVGA 1WG8A 1WXGA 3DM5A 3LGSA 1VSQA 3GCDA 1E9SA 1Z0FA 2WPNA 3EQ7A 3I04M 4IDBA 4PX3A 1HQDA 3GNSA 4ID9A 2GAJA 4KGVA 2PNJA 3TLZA 3TLEA 5JNWA 4BLTA 2C9YA 3DAFA 1HTWA 2WHRA 3K31A 2F3SA 2O8DA 2QW8A 1KDOA 5IYZF 1P8JA 3MOGA 1OTYA 3AETB 3BA6A 4KPGA 2RDMA 2BW0A 4M2LA 1Z0JA 4DZZA 1ST2A 1PTJC 2RJOA 4NX2A 1SK9A 4EG3A 3N86A 1KI3A 2YHUA 4JZKA 4MIEA 2QD5A 5IBCA 1NI4B 2QRHA 3CH5A 3O2JA 3GP5A 1KIAA 3FYUA 2YN4A 2XIQA 2A4MA 4H3HB 4OM8A 3P71T 3KR9A 2YHBA 4YJGA 4MS4B 5F7XA 5CB4B 3DYBA 2WR8A 2JD2A 4K6OA 2QN8A 3K0FA 1X0XA 3GLFE 4BFLA 3JCZA 4GLBA 1Q7EA 2I2DA 1PYDA 1P0MA 1IG3A 2D2VA 3SXUB 3NYQA 5A04A 3R7FA 3T1OA 2PUDA 5GQSA 1GGJA 4HZUA 1ZI8A 1QZ3A 1V96A 3HJAA 4MSUA 1DMSA 2G9ZA 3GHYA 4FZ3A 4YRAA 4XVQA 2VIIA 3L82B 4JODA 2FZLA 4GBMA 1DCMA 2C0QA 1L1EA 4ZVSA 2M6SA 2O52A 3B7WA 1BDHA 2AL7A 2A9JA 3QEJA 1UDBA 4RMGA 3FDZA 3GEPA 5TMPA 2WU4A 2XRFA 4LHEA 3F7OA 4A23A 4YUWA 5JVDF 3WFZA 1WJGA 4G5GA 5KQGA 1QRSA 5HX7A 2AW5A 3OZCA 4A1FA 2C7OA 3PKJA 2B99A 3IDQA 4O8ZA 1X94A 4ZAGA 4PLYA 3DAPA 2O57A 1I2DA 4FFDA 2DFPA 3DBHA 1SUCA 1ZNWA 3WP0A 3PUJA 5JT1A 1V26A 3RWMB 3EMKA 3QEMA 3QWBA 2EP8A 4OF4A 2QGNA 4DDMA 4DSNA 1C3OA 3WK8A 2AMFA 3AKZA 4IIBA 4TX1A 4CHGA 1ZMOA 3K6SA 4LAFA 3E9QA 3CF2A 1BX1A 1OZHA 4MUYA 2VQDA 4TMZA 4C0LA 3WL3A 3QPAA 4KXMA 4YYZA 1OLUB 3M6XA 1YFKA 4YP9A 4XARA 2XTMA 5JSYA 2ZRMA 3HYNA 4KE6A 1Z26A 2V1UA 5AW9A 1RS0A 4J16C 4MCHA 5MDHA 3W5JA 1LFAA 1NBHA 3TOCA 1HA3A 3GYBA 5EOVA 2ST1A 3K5HA 1NP6A 4A10A 3D1JA 3OEWA 4BEJA 3OHPA 3QA3E 3FCAA 3JYHA 1KY4A 1K5DA 3SSMA 4KQJA 5J4KA 2PYZA 2RIPA 4BAGA 4EQ6B 1S1CA 3S2EA 2XUZA 1ZSVA 3U9SA 1NL3A 4IIVA 3OM8A 1W52X 2ZDHA 5T5QA 1SZJG 4Y1GA 4CIWA 2DX7A 4XSVA 1FSPA 2G5GX 2YZKA 2O6LA 3CRQA 3RJMA 4LTNA 1UFVA 3ZW8A 4D4KA 2JARA 1K5HA 4Q1CA 1A1SA 1G6KA 1QIGA 2Y6VA 2ZYUX 3LM8A 4PX9A 3S2GA 4Y6PA 1WCIB 3L6UA 5EL0A 3T6KA 4KPUB 1APBA 4XRGA 3T1TA 2QUIA 4MV8A 1N2GA 4MW9A 4C30A 3T7SA 1GGFA 3VR4A 3THXB 3K0EA 4J1SA 1AO0A 3WV5A 3ZE7A 1W581 1EBFA 2P3SA 1NW5A 4BO5A 1YB4A 2Q1YA 2ZWMA 4C21A 1THGA 2ZPUA 1T36B 1PFQA 4U7FA 5H70A 3AQ4A 3TR6A 1ZUNB 2Z83A 1J39A 1F60A 1S3GA 2H1HA 3X2EA 5HPYB 2BFCB 3R5FA 2J6BA 3MHPA 3FLAA 3DR3A 3PHJA 2IYYA 3CFYA 3EF0A 5JXWA 4ZPJA 5E7JA 3T9FA 3WRWA 2FV8A 5EWLB 1UBNA 2WYHA 2G77B 1BW9B 1J7KA 2GBGA 3LQQA 4NCXA 3UAOA 1VI2A 1NDQA 3KZNA 2W2OA 1N2HA 3GELA 3GDFA 4DA6A 2I2CA 2LPMA 3ER6A 2V03A 1V35A 3RT1A 4MA5A 2DGDA 1T2FA 2DR0A 3RRYA 2YYSA 4BZQA 2YOHA 2GBFA 1P1JA 2JLBA 3KSUA 2B8NA 1E2MA 3EIEA 4QVKA 2PV7A 4HQLA 4U7HA 4CMAA 4KHZA 3WO0A 2CDAA 3UB2A 1PUIA 3VJKA 4OGWA 4WOCA 2HAEA 3WSTA 1YA8A 2BP7A 1S3SA 4OQMA 3HKBA 3NBXX 1WABA 1XZGA 3CLTC 4BYGA 1SBCA 2W2QA 3NGMA 4EB6B 1PSDA 1Y3DE 3EWNA 3IVRA 4YJ3B 1NQUA 1KU6A 5CU7A 1R1DA 1YR7A 1YJXA 3ESBA 4IMRA 5E0KB 3C3BA 3H5OA 5F9MA 1RJFA 5FFFA 5CFNA 2QTAA 4CIAA 1WF6A 4H0FA 4DR5B 1GPNA 4MWSA 3GPDG 2J4CA 4PG6A 4QQRA 3PFWO 1J8YF 4RMHA 3MSCA 1OVMA 1FDWA 1P2DA 2VATA 1IZ8A 4G0OA 5D6NA 4CL0A 2VJMB 1XCJA 4PGGA 4UMVA 1CTQA 4M53A 4W1RA 4GE0A 3STHA 4ZJUA 5AI8A 5DE3A 1O6FA 2BFWA 5FUVA 3TVTA 9LDTA 1KRHA 3HKDB 1GEGA 3A1WA 3RODA 3UJHA 2OFPA 1JDUA 3CNHA 4EKYA 2GCGA 2O8NA 3C7CB 3PEVA 4JJIA 4H7DA 1Y37A 2MINA 3E9MA 3I1YA 4LHVA 4Y30A 3TMKA 3TX6A 4F3NA 4FYIA 5AM5A 3SQWA 4ER5A 5KDDA 1GUDA 2J67A 1UFKA 2R8ZA 5DW3A 1TC2A 4FMCF 1C3JA 5ABPA 4IDFA 4QOJA 2OO7A 4KO2S 4MX8A 4KLCA 3DDWA 4QYMA 1TCVA 2E85A 3AI2A 3OQHA 4UDXX 4N5DA 1VPTA 1Z5VA 2D0PB 4RZ2A 4Y2QA 3THRA 4UTOA 1TD9A 2GM5A 1SCBA 2Q5EA 3WLSA 3DC2A 3RWOA 5K9ZA 1MVNA 3I2JA 1Z12A 2CYCA 4ILEA 5KVCA 3ZU2A 3DLBA 1A77A 1IZZA 1L7VC 2QL9A 3UKOA 5AK4A 3VOTA 4EJSA 1FCJA 2NIPA 1L1RA 4PCLA 4ZTZB 3MUFA 3P9SA 4GKVA 5L45A 3V4PB 3HYTA 4Q4HB 4ZT7A 1YRHA 4LZZA 5TV2A 4UEKA 1FUKA 2ZRHA 3FKQA 2TRSB 2ZB3A 3HBFA 4H59A 4ZAXA 4B6OA 4LBVA 4M37A 5KUTA 3INTA 5CX1B 1FDTA 2HLDA 4MKRA 2B7CA 5CD9A 2IS1A 4FYWA 5TJHA 4YI5A 4RTQA 1C4WA 1USIA 4JJZA 1R5OA 1TI7A 4MEJA 5AKLA 3KJGA 5JSKA 1L5LA 4B47A 5T64A 1QS0A 1XK7A 3PF8A 1ACJA 4CEJB 4QRIA 4C4SA 1XLWA 1TO1E 3JZAA 2ZIAA 4HFMA 1FX0A 3BSYA 3UW1A 2ZVQX 3KNZA 2Q1SA 1S8FA 2NV0A 2VYCA 5IKPA 1KHTA 4BFTA 1JR4A 3MXOA 4BV8A 1QNFA 2EX0A 4RELA 4JI1B 4HPJB 3CZQA 1QIDA 5D3MB 2HDNB 3I3OA 3KXKA 3O26A 1TD1A 1F8FA 1FSFA 2G9UA 1CZOA 1CX9B 2J8ZA 2DFKB 4YCAA 2VEOA 5TF0A 1N5KA 1UT8A 5U9CA 1BH2A 2XNCA 1JHQA 2COKA 5FKJA 2Y1OA 3ECAA 4Y2VA 4YROA 4K8RB 3NM6B 3R24A 1YXMA 1IIRA 4HH3C 4MGZR 1ZH0A 4P22A 3TTSA 3ZW9A 1PW7A 4P86A 4BKUA 1TQ2A 3TINA 3DOUA 2AKAB 2B6HA 5CHEA 2XLCA 1GUFA 3SZUA 3SHWA 1PV2A 3QWIA 1NKVA 2JI4A 3VR5H 3KZCA 3OX4A 3ZYZA 2EYUA 3DLPX 3L1KA 3OIVA 4ZO9A 5DYWA 4UXHA 4XCVA 4K6MA 5LOVA 5CA0B 1HNNA 3FWPA 1JKIA 5JD5A 3KEMA 1Q7CA 4XZ3A 3SBXA 2AUMA 2R25B 2ZE7A 4PIMA 1NSFA 3T4EA 2G6BA 1P74A 4RKWA 4ZOAA 3R5KA 1DC7A 4D42A 4ALMA 3O83A 5DT2A 1BEUB 2XSZD 3T94A 1J25A 3M2TA 2IDZA 1QHSA 2OV8A 1PFKA 2GUWA 5FAKA 3DQPA 2Q4DA 5ICMA 2QZZA 1S5PA 1NVMB 4KXVA 5B3AA 3A4YA 4LSZA 4HQFA 4LQDA 5AW1A 4ZVKA 1VKNA 1RPJA 2QORA 4G1UC 3DMTC 3GEEA 3TE6A 3CWZA 2ASVA 4WL0A 4DXHA 1ZINA 5CH8A 2Y1WA 1MAWA 3A3KA 1HDZA 1G20E 1JSLA 5AKZA 3H9EO 3R7DA 1AB5A 1UOOA 3NR2A 3TECE 1BJKA 1NVGA 4QPPA 4MIKA 2RARA 4MW0A 1T15A 4X8LA 4G5YA 2R1VA 4BIMA 1V8FA 4D79A 3IT2A 3OX2A 5KC9A 2UXCB 4KRXA 4FKMA 3AOEA 3VR0A 3FDZB 2HQBA 4N82A 5DT9A 4ZAWA 4FYJA 2ZE5A 4F1WA 4GBJA 2IYNA 3OTGA 4KN5A 2BKAA 1AZSC 1N2JA 5FA5A 4BVEA 3RW9A 3Q3IA 4INPA 1PHRA 1RYBA 2A5DA 4JUIA 4Q7LA 3W5BA 2IT1A 1RNLA 3B6MA 2UDPA 5M29A 4HEQA 4O63O 2Q3FA 1FX1A 1H4QA 4YP1A 4JJFA 3MBKA 3U37A 3NC1C 4LBZA 2PLAA 2F3QA 2GPSA 2HFJA 4FZJA 5JQWA 1GPKA 2ZJ0A 1ZONA 4EOGA 1MB0A 3KM0A 3KTDA 2R8EA 1K2VN 2KX7A 2YS7A 3VZSA 4DA0A 4G1BA 2G4VA 2ZJ3A 5B1EA 4XOIA 3HE3A 2V58A 4TYYA 4RTSA 2Q5JA 1H69A 3STWA 3HY3A 4I5GA 4ZOQI 1NNLA 1TK2A 3MA0A 1L9XA 3OZFA 3HNOA 1X1CA 1DBPA 2QV0A 2INGX 1HURA 1Z47A 4O4IB 2IYAA 2EG5A 3DEJA 3SS8A 4Y7DA 4RF3A 4I1OA 2CFSA 3UJNA 4JV5B 2ANBA 2K2QB 3BJRA 2QUHA 2QM7A 3QLEA 3BH7A 4A9AA 3SBEA 3FTDA 2EFEB 4RSRA 4ND5A 3B70A 4ME6A 3OTWA 4MKZA 3ZJVA 1GTMA 1C3OB 1S0UA 3ORRA 3TXAA 2XAUA 3WGNA 3KSAC 2OCIA 4GX1A 1C9YA 3E5HA 3ONNA 3OOWA 4TV9A 5JIBA 2YJNA 1Z6GA 3LL7A 4FYKA 1B0ZA 3ZX4A 4NZPA 1P6UA 2HDHA 4QDZA 3JQ6A 3J81k 1IWPB 5EE5B 4CM8B 3WSWA 3U6KA 1NJ8A 2HPVA 4NYMR 4MVWA 4IM7A 5SYAA 4KE8A 3Q9NA 2IHVA 4D3DA 1S1MA 4R2XA 5AOAA 3AM1A 1H2YA 2FUG6 1UBUS 3QG1A 4YMSA 2C4TA 1IBCA 1ODKA 5DEOA 5DNYB 2AMVA 5FPTA 5TY0A 1GCAA 1TZJA 3DOJA 1ML3A 1WSAA 2PJZA 3Q5EA 2MSEB 2QR5A 3S1AB 4C0SA 1UDXA 3QFTA 2CLCX 4GHWA 5E6SA 3CW2A 1ENOA 4FYYA 3TLBA 4D9KA 1OH8A 1EFAA 5JV5A 2HMSA 5AVZA 3NVKI 1HK7A 2P30A 3Q9SA 1YTLA 2B35A 3K0KA 3DHEA 4CKCB 4YDHB 3JWPA 5HBGA 2PS3A 1KAHA 3ESDA 1UWCA 2ODNA 3GJTA 3MYRA 3VV2A 4DEXA 1UMBB 3RC8A 1U02A 3ZPXA 3A10A 3GU3A 3LGAA 4M9ZA 4N4AA 3GPCA 1AT1A 1M8KA 4I19A 5KSYA 4TTVA 3RSLA 2OVBA 3K9CA 2J9GA 3P0JA 3TSYA 5JQGA 5EXTA 2ZEJA 1FB5A 3DS8A 1Z5GA 5EWLA 3DFZA 3P9YA 4M9SA 2G5PA 3PNKA 5DFAA 1FMLA 3RFFA 1YB5A 4DCJA 2NGRA 3T7RA 3UK6A 4HDSA 3D7NA 3IUEA 1A2OA 2LD4A 1JJBA 1R74A 1SBNE 2P9BA 1RLIA 1ZUNA 1ISMA 4R1PA 3FX2A 2I78A 1GN8A 2FEPA 1XP8A 1GSIA 1MOZA 2VTVA 1M2JA 1IOVA 1UBJS 4XEHA 5AI9A 3WB1A 1C2TA 4YXFA 4O2AF 2QVZX 1QBGA 3WNVA 5ALOA 1VP3A 1QKKA 4S1NA 5ESDA 3RK4A 3EH1A 1ZM7A 2AA3A 5IMBA 5JROA 4GI7A 4ZO4A 4C7OA 4QFDA 2ZS7A 3HM9A 1YQTA 3H2YA 4M9UA 3SX0A 3OZXA 4MYDA 3EUEA 4BRUA 2O0HA 1DFIA 1PNTA 1Z35A 3AYZB 1X7DA 5JZ9A 1UXJA 3TZQA 3NWBA 4UFPA 1SVOA 4TYNA 1NRXA 3QFHA 3HY6A 1QYXA 4OIMA 1M8GA 4KBGA 5FTNA 4FDMA 1VQ1A 2RAFA 2ZJ6A 4KGZA 4KBYA 2C04A 3I30X 3LT1A 2EZUA 4OU4A 3T7JA 4GNKA 1PLJA 3NHKA 5KVAA 1YZHA 1C0PA 2A9VA 5JY1A 2HRQA 5AK6A 3BBLA 4J6FA 2FPPA 5TE9A 3ZDCA 4OHOA 3F3SA 3B5IA 3RUEA 5CW1A 1JQBA 2XYVA 3WFIA 5C1OA 2R4UA 3KG2A 4MIOA 3U5TA 3FOAA 1EK6A 2FVYA 4YH1A 5ELMA 3ZNPA 5IJ9B 2PX2A 2HA6A 2IZ1A 3OPMA 5HRCA 2D5IA 1Q1EA 2JKYA 1M8PA 5EZYF 4LSWA 3VHXA 1ZZEA 1SM4A 2QVXX 4M1WA 4AWXA 3DPIA 3P2OA 4H0NA 2ORYA 4HVAA 5KSPA 4TRMA 2C3YA 4DCNA 1ZOPA 3MJEA 4OBEA 3IBYA 3ICPA 1RAGA 1C8KA 4HDMB 4OYYA 4E5MA 2YJ5A 5JATA 4KSYA 2CSXA 1J2TA 3B82A 2C3OA 1OU4A 3AOEC 5JCXA 1WHTB 1O89A 5A05A 3R7NA 5J4YA 2UZIR 1XEWY 3AX6A 4TLAA 1I7LA 4AIRA 2KMLA 3N53A 1MEEA 4PWZA 3K9GA 1HE4A 2EEZA 1P81A 3HA5A 4KGDA 4UM8B 4GM4A 4RIEA 1BFUA 4EJMA 1JYSA 4MYUA 3OM9A 2O1XA 5L7TA 3R7WA 2NZJA 4XQCA 3OFSA 1XZHA 3DZFA 5C1DA 2IW3A 2PXHA 4FNMA 4MW2A 1NE7A 3ZJYA 4AB1A 1HV8A 2Z8XA 3CXUA 2XQKA 3E1KA 4HNGA 1YIOA 4W99A 2CCKA 5FFMA 1QIHA 1QOPB 4HMOA 4BQEA 5IC6A 5FPKA 1X77A 3U4GA 3R7WB 1OX6A 4EKEA 1E2IA 3DCJA 4DJ5X 2BVNA 3QJYA 4I1UA 1VB5A 2CDBA 5L4NA 1HNWB 3BIFA 4F9EA 2B8JA 3MJDA 9GPBA 3LY8A 3ZN2A 4ZAYA 2CNWD 4KYVA 4JA0A 1U0JA 3H1GA 2VPTA 3SF8A 4E94A 2OZLA 3D6HA 4KQHA 4X00A 1CYEA 1P1BA 1N77A 1NPYA 2VDLB 3KIPA 3QKSB 3IOCA 2ZIZA 4QODA 3QNWA 3UK2A 3A7EA 1R4AA 2M6RA 3CB2A 5EMMA 3UMRA 2D00A 4MW7A 4AWAA 1JEAA 1YKGA 3IPLA 4HAUA 3CKLA 4ZYXA 5KNBH 3LC0A 4QPZA 3MWFA 3CZMA 6REQB 5LZ2A 1ZNYA 1N2CA 4G0MA 5H02A 1J9GA 2VP4A 1MIOA 2MU1A 2W71A 2OENG 3IDZA 4RIIA 5C7LO 2AI2A 4OOEA 1GDHA 3T12A 2H1RA 3VTAA 3W6PA 1TIBA 1K7SN 2A9QA 3FB4A 4UZFA 2DJ5A 2ZP1A 4WKBA 1DQSA 5HIIA 3WY9A 4E5PA 1PQWA 1T1EA 4BO6A 2J3DA 3HCCA 1X74A 4ZOLB 3QKWA 4G36A 3EQZA 4JLUA 1Z45A 1JR3D 2Z4SA 3O2SB 2WHQA 3KR0A 2VNSA 1PNOA 5HWSA 1Z2NX 4TMFA 1ZNQO 2KHZA 3RYHB 1XZAA 2OP1A 1QR2A 3OZUA 4N03A 5JW6A 4QBTA 2ECOA 4JKYA 4G63A 4R1NA 3OPYI 1QBKC 1D8AA 3F9CA 5CVEA 4D6XA 5KVQA 4B7CA 3HR7A 1IHDA 2NG1A 4HLUA 4JELA 4AD8A 4BO4A 1Z8NA 4JUAA 2ATEA 4OQNA 4MUEA 3HZHA 2PMEA 5LQMA 5LWQA 2JVJA 5BY2A 2A1UA 2CVQA 1R6BX 2W6ID 4MV4A 1RVDA 2A14A 1VXRA 1FXWF 4XIJA 1EVIA 4EG5A 3DCIA 5CTAA 1OAOC 3H7AA 4TL8A 5KS2A 1T9GS 2WABA 4OLFA 1QK4A 5KQMA 4AVYA 1SCUB 1K8ZB 1CR1A 1G9XA 2X5NA 3C16C 3EXHB 3GMSA 3JVIA 2HSZA 2W6JD 1LZKA 4BVBA 4C0XA 1R3DA 1DZ3A 2FWAA 3HB1A 2Q1WA 4XLLA 3TIGA 3U4DA 5JZBA 2F9MA 4FINA 5DYYA 3QA9A 4K2HA 1I0ZA 5EINA 4L4RA 4LRXA 1E1KA 3AYXB 3JWIA 4U2BA 1NF9A 1CQIB 2RAPA 3GUYA 4KQWA 3O4FA 2IEIA 3JQ9A 4NBLA 3EZLA 5DGDA 4D9CA 1I2AA 1CUHA 2EFCB 3QMWA 4JIMA 3NETA 5G40A 1NQXA 1YJ8A 2Y2VA 3OIDA 2PSDA 4OU5A 2AFIA 1PG5A 4UJ3A 4FX5A 1VL1A 1Y5NA 4ZHQA 5KNCH 5IC5A 2W6MA 3SJZA 2XNSA 4FOTA 1DSSG 2GZHA 4AJIA 5EZ5A 3LLCA 4PX5A 1RKXA 5ALLA 1NLUA 3J7TA 2RC6A 3MB8A 1YL7A 4AYTA 1XL1A 2A88A 1U7OA 1OXVA 5IG2A 2BGNA 1KSFX 2R66A 4WLVA 4EUFA 4IWYA 2SICE 4OVKA 4Q4JA 2BKVA 3MWDA 2ODAA 4WAUA 3O4HA 5EFZA 1U2ZA 1Z2PX 2RHCA 3UAWA 4BBJA 4EVQA 4F38A 5CB8A 3P4UA 3PUVA 2O4UX 2HQSA 1R4ZA 10MHA 3RS4A 2C2XA 2HIMA 2RH9B 4AZTA 4AT1A 3UGKA 2A3RA 3QUQA 4D57A 1KC3A 1N2CB 1WY7A 1H6CA 1ZCJA 2QTRA 1DV2A 1Y3BE 2QUBA 2V54A 3AJAA 3CR7A 2C2WA 1FNNA 2VZLA 4IAOA 3ROEA 3WJ2A 3AL3A 3V97A 3OQMA 3O8QB 4I9UA 3G2JA 3LUBA 3A2NA 1XTKA 1JZSA 4GOMD 2IXGA 2BFBB 2Q50A 3CNLA 1FYEA 4HB0A 4Y6OA 4ZQBA 3MCAA 1EGQA 4MPDA 1M1NB 1ZK1A 1Z63A 1NBMD 2H5JA 2O7SA 1VIDA 2B21A 1L9KA 1QO7A 5F2OA 3UAXA 4UHEA 1V1RB 1FUUA 5CYOA 1EWYA 1L5FA 3DHYA 3ENNA 1LPBB 3E48A 1EUCA 2IPMA 4QD3A 3HJGA 4RJ2A 3GVIA 2XUOA 5FYDA 1M1NA 1E2GA 5K09A 4HAWA 3IRVA 5L3SB 4X9XA 1X19A 3KOZA 2YNMC 1NUHA 3OQBA 4IQ8A 1IQRA 5AK3A 4YRDA 2J3EA 1E3QA 2P7IA 3EXG2 1MVOA 2BUBA 3HBNA 1GAWA 1GKLA 3KX2A 4EWLA 3AO0B 2VCYA 3MCTA 2JJ2D 5DEIA 3WL8A 1O95A 3OCXA 4N7JA 1A04A 2YIVX 5JCJA 3TLGB 4LNHA 4C0KA 4DLVA 1EP2B 1LBIA 3G82C 2EKDA 1KYWA 4OB8A 5ALRA 1I4TD 4CMGA 4EFNA 1NVAA 2XNHA 1ZI6A 5H5JA 1I13A 3O2NA 1KP3A 4LXIA 5AI0A 5EZ6B 3VKGA 3SZ3A 2J5QA 1ZVKA 5BQ5A 3LT4A 4RVDA 4AFNA 2ZM5A 3SNKA 2X5KO 3P5SA 1LI5A 2ARKA 3R9WA 4H7PA 4LYAA 3R3UA 1D7OA 5AESA 3ETEA 1P4SA 3CF6R 2QR2A 1KAQA 3CUUA 1Q57A 2IYOA 3K4HA 3ABZA 4QL3A 2EF1A 4CJXA 4DA8A 4L95C 3FSGD 1WTAA 3A0RB 3HDVA 3PTLA 4ETWA 3F97A 2P6OA 2AN5A 2WZDA 3CRZA 1UBOS 1HLGA 1N0HA 3LIIA 4ZIRB 2Q0XA 2QK4A 3S28A 4AKIA 1QIMA 1OXTA 1I6WA 3C5CA 4GBGA 4NZYA 4AS1A 3VZQA 1E98A 3KK0A 3D7SA 3KP1A 4H3KB 3U3ZA 3WB0A 1HETA 3VR4H 5EN4A 1U3GA 2UXDB 1WXIA 3P9KA 4NFYA 4KJZA 4X8MA 1M1ZA 4NYJR 5FPYA 2LNDA 2PL3A 1GNLA 2HWYA 3G89A 1XF9A 1I3OA 3QEBZ 2GCEA 2JAWA 4RXUA 5LZ4A 2BEWB 3VJRA 4ENQA 3A6EA 1TCAA 1PYGA 4P7KA 4GP9A 1EVZA 3ELWA 3GNQA 4NFSA 2DBZA 4AJ2A 2W8ZA 1IY0A 4IXWA 2NU8A 5BNZA 4QEZA 4WXMA 3MBOA 4YRJA 4P54A 3UAZA 1W30A 1XZNA 5JR3A 2IS2A 1U2GA 4MQ5A 2IHJA 3KZMA 2HA5A 3L18A 4H31A 4LTMA 2E87A 1O4WA 3JSAA 3ESQA 4R2IA 2VZEA 5FOVA 3AB8A 3F8WA 4BGVA 3HB4X 3DL0A 3Q7EA 3P4XA 4PO9A 1Q20A 3LPMA 1AZTA 3ZCSA 3OH8A 1DDIA 1P72A 1MJHA 3L5OA 4O2LA 3AEKB 3MJRA 3KZ1E 3ZDXB 1A7JA 3B9BA 3K8OE 3Q6MA 4WA7A 4LV8B 3HCAA 3QXCA 1Z17A 4JIGA 2MSKA 3SR4A 4PN3A 2CFIA 13PKA 5CEFA 4X1IA 1IPEA 2EFGA 3RRMA 3IQXA 3LX5A 3FLBA 1QB8A 1Y3HA 4KITB 1N5JA 1O94C 1T1GA 2FPOA 2NVOA 3PI7A 1ZMXA 5BQ3A 2G0AA 3QOXA 2QRZA 3IMCA 4AF8A 3K30A 3NC4A 1JDJA 3ZJ4A 1ZD4A 4ZVPA 3SFVA 3ANYB 3VOSA 1ZGJA 3ZVMA 1Q11A 3NBQA 4BNWA 2DBRA 3A70A 4JGIA 2ETXA 2VTKA 3LP5A 3ZGLA 4B9EA 2E4ZA 3EZGA 3UMCA 4CQJA 1VGQA 3IKVA 1GSOA 5CITA 4AY2A 1PJAA 2G1PA 3UCEA 1NUUA 4QNRA 2PZEA 4M0FA 2OFFA 1PWXA 3R0XA 4RH3A 4HNTA 5JLJA 2FG7C 3HL0A 4PSKA 4GO1A 3O8OB 1QGDA 1JF8A 1WUHS 1B0PA 4CT4B 3A6DA 5BPFA 5HQTA 1NMSA 1SQFA 1RWPA 2G1KA 2C7GA 3LDAA 1V41E 4QBGB 2FMUA 1KP9A 2QNBA 3TLAA 3OQNA 4N3BA 4XB1A 1ZD5A 1L7OA 1JU3A 1TIKA 1RJGA 5CLJA 3H0CA 4I9NA 1Y1PA 2FW0A 5LQSA 4E3WA 3RIMA 1AS2A 2XYGA 3LUJA 4OK3A 3NGLA 4HRYA 3QELB 1O95D 4NHOA 3N8KA 5DNUA 1E3DA 4KAXA 1TXGA 2G36A 4PXAA 1Y82A 3T1HB 2ESRA 1DHRA 1Z74A 1HL3A 1W4BA 2BSXA 3HBJA 3QEMB 4L3OA 5JXGA 2OXTA 3TSOA 4P3OA 4X91A 4E32A 3L8HA 3VI4B 1T3GA 1R0BA 1X80B 4K1LA 3ZDEA 5F77A 2OAEA 1V8OA 4ZK6A 4QLAA 4B6PA 3WA7A 4QGBA 1TIPA 3UHOA 3F71A 2R8PA 2YWCA 1G3RA 1KPIA 2JGDA 2X9GA 3VMFA 4AX4A 1AQLA 3D8RA 1KFJB 4M0EA 2UYGA 3H7IA 3LYHA 1UK6A 1YB2A 4QVIA 1K63A 3P20A 1S2OA 1U7HA 1R0WA 1PU2A 3GY0A 2GARA 3UWDA 3VU3A 3EVFA 4ARCA 3MN1A 1TMYA 3FTCA 1F4LA 1WSBA 1MFPA 4XIGS 2PX3A 5DVZA 5G0VA 2HF2A 4PICA 4WGGA 4UMEA 4PSVA 4LNUB 3RI3A 3UANA 1JZQA 4X7PA 3AY3A 4Q21A 1K6IA 3LKVA 2AWNA 1P9WA 3DBRB 3OIGA 4KZPA 5IEBA 4CI0B 2BTQB 2JJ8A 3EEYA 1U2DC 1H2EA 1UEIA 1U0OC 1UH5A 1WQ3A 3SR3A 4WINA 2O8DB 4PE5B 4TWBA 1DP4A 4IKOA 2EBWA 3QSGA 3KFXA 2VO1A 3AUUA 1C8BA 721PA 4DCTA 4N8DA 2J3MA 2BTQA 2BJWA 3K53A 3CIOA 1MDBA 3JQQA 2C07A 1G6OA 3KXIA 5GZ3A 1T0IA <