4RHEA

Crystal structure of ubix, an aromatic acid decarboxylase from the colwellia psychrerythraea 34h
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
202
structure length
202
Chain Sequence
DFNGKITLAITGASGASYAMRLIECLIAANYQLYILCSSAGRIVLDTEVGVKIPSSPDAASKFLTEKYQAKDQQITVFGKEQWFSPVASGSSAPKQMVVCPCSTGTMAAICHGMSDNLIERAADVVIKERGQLILMVRETPFSTLHLQNMLSLSQQGVTIMPASPGFYHKVETIEDLIDFMVGRVLDHLGIEQDIMPRWGYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of UbiX, an aromatic acid decarboxylase from the psychrophilic bacterium Colwellia psychrerythraea that undergoes FMN-induced conformational changes.
pubmed doi rcsb
molecule keywords 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
source organism Colwellia psychrerythraea 34h
molecule tags Lyase
total genus 67
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.1.-:
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 4rheA00
4ZAYA 1E20A 1P3Y1 4ZAZA 4ZAGA 4RHFA 4ZALA 2EJBA 1G5QA 4ZAFA 3WISA 1QZUA 4RHEA 3LQKA 4ZAXA 3ZQUA 1SBZA 1G63A 4ZANA 4ZAWA 1MVLA 1MVNA 4MWGA 4ZAVA 3QJGA 3MCUA
chains in the Genus database with same CATH superfamily
3EX7C 2P1RA 1SVMA 4KXNA 3TKYA 1KRHA 3I9MA 4BZPA 2FG5A 5K0SA 4R8MA 2AL7A 3AH8A 4JP8A 5L7YA 5C8ZA 4JQZA 4N65A 1H2XA 4HSEA 4XX0B 3CNLA 2PUJA 1U0EA 3CRVA 5TGZA 3WGLA 5LDGA 3AFMA 4Q3OA 1LK0A 1JKFA 1GILA 2QMOA 1D04A 3PKIA 1IL0A 4NU5A 2CVZA 1ZOIA 4PYRA 2IWRA 1UBRS 2KBEA 3T5TA 2F1HA 2ZRBA 2J9ZB 1NV8A 3I64A 2WSIA 2QHXA 4UBMA 1CS4C 1PLJA 4IHJB 1B43A 4LHZA 4RNDB 1FYEA 4J4TA 1NNEA 1PL7A 2FWBA 2PKYX 1SC3A 3QA9A 4QXMA 3TDNA 3MMZA 4MZXA 1QZ3A 3NUGA 3OZIA 3VYVA 4EGJA 1H6BA 1I2ZA 4K40A 1W94A 1JA9A 2QR3A 5D51S 3TRJA 1HNXB 1YJXA 3EIEA 2H3HA 3KQMA 1W9MA 3QIVA 5ECYA 3TIVA 1YVRA 2PV0A 4OHYA 1ZA2A 1Z6PA 3R4CA 4A73A 5LDHA 1SHJA 1SZJG 2E6UX 1MH9A 3GT3A 3RODA 1D6NA 1VSVA 3WLAA 2BFPA 5JNVA 5E3IA 1DKLA 1WMAA 2VJLA 4E21A 1EP9A 1SO8A 3PKJA 1F6WA 3FH0A 3ZHBA 4DQVA 1KMCA 5DB4A 1F1JA 1VCIA 1XCLA 2GZHA 2ZAOA 3FVWA 4RXMA 4FKMA 4KPUB 4JQYA 4WXPA 2BEJA 3GWGA 5FV4A 1CHDA 1E2GA 4B2IA 1VPWA 5ECGC 3FPFA 1IZ8A 1F9EA 4OGWA 3WL3A 4F3KA 4YUXA 4AMBA 2C04A 3NG1A 2BPOA 1DRVA 1RI5A 2XTZA 3B12A 4KXMA 1EBFA 3HM9A 1JNXX 1S7CA 2YZNA 1ZN2A 4FCCA 3G68A 2FJUA 2FW0A 4XIGS 4FFWA 4OOFA 5E2IA 4F91B 1LNSA 4K81B 4LUCA 3JAKB 1UBCA 1XPJA 2MIIA 4TLMB 4F6CA 5LZ2A 1XEXB 2RCNA 2I3ZA 1ICIA 1QOQB 2XMRA 3FDZA 3CS3A 2WWXA 5BMVB 3BFXA 2JHFA 1MC5A 3JASA 3AU9A 3T9BA 5E4FA 2PKRA 5G40A 1AX9A 4M0PA 2Z1NA 3KFXA 3CNEA 4A8JB 1NURA 5JOQA 3CZPA 5ERXA 2H7XA 1X92A 1GL3A 4BFWA 1Z4NA 2NUPB 4XAQA 2OBBA 3TW0A 3OZDA 1VMIA 2AZDA 1YBMA 1A0OA 4O4HF 1JHQA 4GRAA 1O8BA 1PDVA 2EU8A 2FZCA 2HPHA 4GZ6A 1ZI9A 1AKTA 2FJPA 3VO9A 3EXIA 5H82A 2VL7A 3Q6NA 4D46A 4D5EA 2O2ZA 1I3OA 4CLEA 3MTAA 2QLBA 2W6MA 2QRMA 2YY7A 1OLXA 3EGEA 3BZBA 3OQNA 3LC7O 3C5HA 4O29A 2FP3A 3OO1A 3ZCPA 3UO8B 4E2XA 3WAJA 1N2OA 1JW9B 2UZ3A 2QD5A 1ZZGA 4UEQA 1C1XB 4IOMA 4BV9A 3C3EA 2EZ9A 5LWHA 2OA0A 3TUIC 3EBPA 3ACDA 3Q5DA 4HMOA 3WWOA 3CR3C 3MWYW 1YR1A 1I3MA 3UTCA 1PX0A 4ARBA 4DN6A 3EPRA 1UM9B 3OOYA 4RK6A 3EK2A 5FPQA 2WTUA 2CUKA 3OWHA 4OKSA 1F5NA 4BNZA 1F8YA 4MKIA 3CF0A 3KOYA 4LYAA 3PGMA 4C2TA 2KMLA 3LSYA 3QE3A 1VJ5A 4MWSA 1BE0A 9ABPA 5I4KA 3FPCA 4NC9A 1QVRA 2XXAA 2ZU6A 2C2GA 3X1WA 1WXDA 3HLTA 4CM9A 1WMDA 1HLPA 1NR1A 1ZD2P 5THKA 1K7SN 4UBNA 4EVRA 5KINB 3LDHA 1H5NA 1T9AA 1YDEA 2WVHA 1UFKA 4RD4A 3F3MA 4YCLA 1KAHA 1OE0A 2W8BB 3PD7A 1GCGA 1UMCB 1XDSA 2D1RA 1FU4A 3PICA 2I4NA 2AFRA 4L7VA 4HLCA 5AJUA 5AKIA 3A9RA 3STTA 3TLBA 1Y6RA 1VMDA 3HLKA 4TYNA 3K15A 1YMUA 4YDHB 4E14A 2O5CA 3DYBA 1AXGA 2QNRA 1AMOA 1QGOA 1H8ED 3ZWDA 4B3SB 4I6EA 4IHQA 1WABA 4S2UA 1VRWA 5FBKA 4PX5A 4POAA 1QHFA 1BS2A 4PTZA 3R9KA 5EJ8A 5L9AA 1DXYA 1XZPA 4RNCA 4BRWA 2DFVA 2X6QA 3RRZA 1YB6A 3UUWA 3FCSB 4E08A 5JPCA 5CW1A 4XJSA 1J8QA 1TXGA 2P9CA 1GUYA 2OHXA 4RQBA 2ZKIA 1EIWA 2D0DA 3ILVA 1E9CA 4ZVSA 4NMXB 1YUNA 2OILA 2HRCA 1JT2A 2W11A 1TLLA 3OZTA 4MR9A 4CKEB 4LJLA 5ALWA 3B6EA 4PYJA 4OI1A 3CVUA 4IFEA 2I1WA 1NY6A 3W4JA 2WTEA 5TMBA 3PQ6A 1W4BA 2IPXA 2WKWA 2R3SA 3CW2A 4NSNA 4CI9A 2Q5EA 4OMUA 4YHBA 5K8UA 1N1MA 3TQSA 5JHGB 3G0HA 1XTSA 3NVDA 4CZ2A 5IVPA 3L1VA 4MJLA 5EZYA 1BMQA 4HPXB 1KYWA 4B71A 2IXFA 4WA7A 4PS1A 4KN9S 8ABPA 3GEMA 5FLKA 1OTYA 3KM0A 3KJFA 4JC8A 2GI4A 1O6GA 3B60A 1UT8A 2YJ6A 1XLWA 3D4NA 1RM5A 3L0CA 4WKCA 1E62A 3RWMB 2DPGA 1LDEA 3G2OA 4REMA 2OV2A 4CETA 2SNIE 3QPVA 1ADJA 4EVIA 3Q3GE 1UL1X 3VSAA 3WNVA 1PS8A 4DJFC 3GFVA 1CR2A 2LDXA 5LQRA 3A6LA 1ZVJA 3L07A 1Y1TA 2EP8A 2JANA 3E5RA 3EZXA 1G9TA 4UZEA 1W4RA 1X3LA 4MCHA 2PQ2A 4U2CA 5ETJA 3WLPA 3ZUPA 3KALA 4Q93A 1Y5MA 1AC5A 1UPCA 2YW2A 3ABZA 1CZRA 1RP7A 2TECE 1MVNA 1VKOA 4Q7EA 3UCFA 2B4AA 3G0OA 1PLLA 4X8HA 5F1OA 3CXUA 3O9ZA 1ZVKA 2E3JA 2VNAA 3C74A 3B6KA 5B55A 1Y5RA 3LBFA 2PUEA 1E3SA 4LCBA 4D4GA 1USWA 2J0UA 1NZDA 4FYKA 3O9MA 2XQFA 1DDIA 5CMLA 3M3DA 1KK1A 3W3AD 2ZITA 4MWDA 3ZUGA 1RTTA 2A8YA 1L7PA 1FY2A 3EJWA 4EYSA 3I4FA 2ZJYA 1BWPA 1TCCA 4PFQA 3EZGA 1OYOA 2W2XA 4HYTA 1DMRA 1DX9A 1RZRD 4H2DA 3MOSA 2B34A 3H1TA 3HDGA 3JZFA 2I54A 5DH9A 4PAQA 4QG3A 1WZIA 3UAOA 4CKCB 2BJHA 3TQQA 1QH8B 1YZTA 4PRYA 4EYOA 2CB9A 3PHLA 1MBZA 1OMOA 2C0QA 3IE2A 1HYQA 5C4GB 4DA0A 1YONA 3IUPA 3QK7A 4IVQA 3G88A 4MP8A 1HDGO 1SH7A 1C3OA 1ZNWA 4QAQA 3V4VB 5ALOA 1DPGA 3W2TA 5LIRA 1N3BA 1KEEB 2Z30A 1GNPA 4C4SA 4MV5A 4EUEA 4WWHA 1N32B 4KU4A 3IRVA 4H31A 4FE4A 3OT4A 4Q3BA 3UMJA 2GWRA 3ZIAD 2ZTMA 3WGYA 4IL5A 3SJUA 1XXHA 3HQ4O 4AROA 4NAVA 3D8RA 3HN2A 4DLAA 3ISVA 3TTVA 1V3UA 1SD2A 4J7CA 1YS4A 3SN6A 5LDDC 2OWEA 4PZAA 2F17A 2JFGA 2BY4A 2GPSA 4Q05A 5YASA 4WBNA 5C8YB 2AVNA 4HGZA 4I55B 4UNSA 3SZUA 4R6WA 3JYNA 3WKEA 4HDCA 5G0WA 1E3IA 3ETHA 4ID9A 3VR6D 3ZQ6A 3V7UA 1E3TA 3AESB 3HB1A 1SU7A 3UAZA 2WDPA 1JXAA 5J40A 3KR9A 5KSOA 1P77A 3BX1A 1S2LA 4N3NA 4XPIA 3VNBA 1MLDA 1E94E 2PRSA 5CIQA 3D59A 4TKZA 4F06A 3ZWWA 1Y6FA 1TYBE 3IAHA 3WISA 1KI4A 2HK7A 4F2HA 3E9ZA 3ZY2A 1ZQ9A 3NTQA 1GTMA 4UHCA 4UTNA 1WCYA 4RY8A 1N36B 3AK4A 4GI5A 1H0HA 1HE5A 2ODNA 5BP7A 5E1BA 2IPLA 5GVSA 3L06A 5F1PA 3TVDA 4P0QB 1WCV1 1SKYB 1YT5A 1ZGHA 1GNQA 3BBLA 1G55A 1SG0A 3FA2A 4LQLA 5DHFA 5DYYA 2NADA 3F8TA 3RDPA 4S2EA 3WL4A 1Y9ZA 3JQ8B 2CBXA 4KQMA 4ZZ1A 1VCOA 2OSVA 5C5DA 3MJDA 1VPVA 2BMVA 1KSJA 1XKTA 2JFNA 3A6KA 3H19A 4P84A 4UJ5A 3RVOA 2VTBB 3E9QA 1E98A 3DCNA 3LHIA 1II8B 1NYTA 3SHOA 3F6CA 3HCNA 3QF7A 2JATA 4YMSA 5KTPA 3TJRA 3W04A 3DV2A 3QUTA 3UK0A 2C9MA 2VF4X 1VE7A 3EUWA 5GAJA 3IFSA 2ZETA 1JDTA 3EFHA 5TEVA 1ESDA 1HLFA 2E85A 2J3HA 2XMPA 3GRKA 1QZXA 2ATVA 3C6YA 3FDXA 3GZJA 3M5DA 4ZOAA 3TAXA 2VQDA 2LNDA 1A1VA 1B15A 1E5TA 2HBYA 1QH0A 3JALB 2VWQA 1J8YF 4PGFA 2O0HA 2OV1A 4FIDA 1WPRA 3B1VA 3ZE6A 3M6WA 1XI2A 1G6HA 1GQSA 2QTLA 2AUMA 1NIPA 3LQ2A 4V02A 3AWIA 4GEGA 1ZVQA 2EJUA 3G89A 1DV2A 2GCGA 1HG1A 2FGKA 4HDSB 3NP7A 4QUIA 4Y2YA 3HFJA 2IHTA 5GM2A 3VKWA 4FR0A 1VYHA 2RB5A 4Y2UA 3RYCB 3GJ7A 1A9SA 4YJ2B 1QRTA 3TL6A 4YP5A 2OCDA 5LA6B 2V3VA 1WRBA 1LPNA 3CA8A 4AMYA 4YXWD 1PAUA 2C3PA 4IR7A 3VU9B 5T8KA 3AYZB 2E7ZA 3PWSA 1IOLA 3RTCA 1KI1A 3Q3HA 3HR7A 1AIPA 3ESRA 4G0ZA 4JL8A 5K7SA 4YJHA 2R97A 5JTTA 3BHNA 1GZVA 3DZJA 3PJEA 4GBGA 4OMCA 5CDGA 2VNIA 2M6LA 1A2OA 4WZBE 2W8ZA 4KKVA 4A0GA 4BB9A 3QLEA 2VP3A 3ZE0B 3OD1A 4GGOA 2PS3A 2AR7A 4K5QA 1KTIA 2HJWA 3B52X 3TW8A 1W2WB 4GI3A 5SYMA 4OMDA 5TS2A 1JHXA 3P2KA 4Y6PA 4IILA 5K8TA 5IK2A 2YRFA 3HL4A 2A9JA 2BZ0A 2IA5A 3I30X 2V9ZA 4O4JA 1RZRA 2YX1A 4UMFA 4LDRA 2DPYA 1CY7A 3K5IA 1T3HA 1PJTA 1S6YA 3DZCA 3G9XA 3Q8MA 2P91A 1SMKA 2VXOA 1THMA 4TM8A 3CJRA 4JWKA 2IYQA 4XTRA 4GR4A 5CT8A 4X62B 2NUBA 4MVYA 1M6NA 2BM9A 4RA6B 4O33A 1KZ7B 3M4YA 3LXMA 4M9QA 2GPAA 4PHCA 5BSTA 4D25A 4EA9A 3BE5A 5FPHA 4BWFB 3CCCA 5BOSB 1QFZA 1M74A 2HUNA 2VYVA 2ZYHA 4L0DA 4Q48A 3PPIA 1C50A 1DBVO 2QPOA 2X42A 1QQTA 1IY9A 1FLAA 1PW7A 2ILVA 3GVXA 1E3WA 1N0HA 2WAMA 4FM9A 3HUFA 5J5AA 5D6NA 2FK8A 3FYCA 1GAEO 5FLYA 2DOKA 3MRSA 2R00C 5D3QA 1A9RA 3TINA 2G7MC 3RU9A 1JA0A 1C30B 4ZJUA 3CPJB 1T6XA 1P0FA 2JBHA 4HUQB 4BO6A 4Z4EA 5L3QB 4PO3X 2F2TA 1L1FA 2AK3A 3D8SA 2VNSA 3GRVA 3HI4A 4RSGA 4RKRA 5EJMA 4D43A 3EPJA 3GW8A 1EWQA 2BFBA 1AXRA 2V4MA 2RI6A 2YWEA 1EFPB 3C8HA 1W52X 3PEUA 4QGGA 3RI3A 4B6RA 3NAQA 2AW3A 3WRVA 1M6VB 1JMYA 1SB9A 4MW7A 3LPDA 3QVUA 5B2ZA 2BELA 4IPTA 5IM5A 2GPWA 3OQJA 5CFZA 2AR0A 4FJ1A 4V1CA 1ZNQO 3UPTA 1BFKA 3AVTA 4PBSA 1AQJA 1XLTC 4JYCA 3JQQA 2KB0A 4MGKR 5F5NA 5KWSA 5H8WA 3RCBA 5HQ3B 2PSJA 1C0EA 3KOOA 1Z8DA 3AIMA 3HL0A 4UUOA 2R87A 4OQZA 2QNBA 4TWJA 1XLVA 2QF7A 3DLIA 1QE3A 4R1PA 4YJDA 3AEZA 1GP2A 2FX5A 3K4PA 1GPWB 4IMIB 3RU7A 3GVPA 3UB3A 1KZHA 3V4ZA 4HAZA 1EK1A 4IGFA 2FMHA 3TCNA 4TVSA 5GINE 2VSFA 2J5QA 3WLIA 1G60A 4YMVA 4OHCA 2ZI7A 1FQKA 2I22A 5EIWA 2OSBA 3C3AA 2J9RA 2ZDGA 2IUYA 3DLTA 4Q7QA 1XU9A 2B82A 1OXMA 2BFFA 121PA 1UZUA 2AH5A 5K3FB 4FEYA 1IVSA 3W8RA 4MUMA 2IP4A 2QV7A 3DDUA 5IEBA 2ZJFA 3MYRA 1IBMB 4TL7A 3QBVA 1DO0A 4B4DA 3Q1KA 5HRAA 3D1LA 1LW7A 1NP3A 2C5SA 3BE6A 1PT9A 2P4HX 2UUCB 5EKDA 2NU6B 2FMFA 2JKYA 3NOXA 1IWOA 4KBGA 2XHZA 1JH9A 4G0OA 4JKOA 4HNQA 3RK0A 1Q1BA 4TN5A 1Y6JA 3CR7A 1AZSC 3HH8A 3MAJA 4QUKA 2Y0EA 3G7NA 3KOZA 5FNVA 2OQ2A 1E5VA 1OLOA 1EUCA 1RJGA 4B48A 4GYKA 5DIFA 1OBOA 4B3RB 2VPPA 2H31A 2WMYA 4FXOA 4CU2A 1RWPA 4RGVA 3GQVA 3EXG1 4DZRA 3LUKA 4OJMX 3T7JA 1DL5A 1C8KA 4Q9JA 5LIPA 4V0QA 4REQA 1C7FA 5I7WA 1MC1A 1H5UA 1VM6A 3JQCA 1FXUA 3KOUA 4CHTA 4P2GA 1F8FA 2IEGA 2DUJA 3TTSA 4F1JA 1IN5A 3NATA 2C7RA 1CIJA 3VKVA 5HF5A 4IQ8A 4D3SA 4J8PA 1GDTA 1L5LA 3D4OA 3K0SA 3NTUA 4L57A 4MPTA 3RT1A 2ZQYA 2IW3A 2RH8A 4RMHA 1OKKA 3EAQA 2OFXA 3ZWCA 5EJ2A 2GOYA 2J85A 1SFRA 2QMZA 2Q6OA 3CJTA 3KR0A 4PAGA 4REOA 3IE1A 4KQHA 2Z3WA 3ED5A 3HP1A 1LNQA 4L27A 4EQZA 2DQYA 4DEYA 2O23A 3QKSA 3T7DA 3FFXA 2YVKA 3GQBA 3ROEA 2SKDA 1WF6A 5A71A 1T24A 3G0CA 4HWTA 1DRWA 1FS4A 3V3TA 3NU1A 4KL8S 2A94A 3EIUA 4UM5A 5SICE 5KQPA 3BK7A 1BA2A 1TA9A 4FI3C 1AJEA 3EYWA 2JGNA 3AF3A 1TEHA 5MN4A 2X8JA 1SURA 2YH2A 3BGWA 2JFOA 1ZXBA 1QZZA 3X1JA 1OAOA 2OMKA 5BN5A 3DMGA 4CR7A 4KGXA 2DEUA 5HM8A 5M7EA 3WK6A 5KHLB 3QX8A 2FPIA 1W46A 2YWRA 1XAGA 3DE6X 1NOJA 3FCAA 3QUQA 3ZX5A 3L0DA 2D1QA 1AKNA 2IGBA 3AR6A 4ZRMA 3UMYA 1E3MA 1KSGA 1J07A 2G0AA 1F0NA 4HRYA 3MLAA 4MROA 4YTEA 5KAPA 1WU7A 4BVAA 3UH0A 4HQFA 5ECDA 5H80A 3PFHA 4JOQA 4Z4FA 1OQAA 2P69A 3IIJA 2PGAA 1U04A 3GIWA 3PXDA 4I9FA 4QXAA 4WOJA 3LBHA 4HDNA 4J7AA 3A3PA 2SKEA 5DOVA 4F4JA 4LIPD 5B30A 4YAOA 5FNZA 3GJ6A 3TX2A 4F9GA 4BECA 4ZQGA 5PGMA 4H15A 2B94A 5FEUA 1WPGA 2FA9A 5JZVA 2CXXA 3FSRA 2XQIA 1E9DA 3PNMA 5ALNA 1N0VC 1M2GA 3Q7QA 4B6PA 4QDKA 4P36A 2HU2A 2YYSA 3QW2A 3QLVA 5GQSA 2CFRA 1H1LA 3QPBA 2NSYA 1UP4A 4Q1BA 2GN2A 1U0SY 1ANKA 2ZAMA 4KH1A 2IPNA 4LF7B 1XU7A 4DDWA 3Q7EA 1RQXA 3PUWA 4RD1A 1V48A 1AS0A 2Q3CA 1BGVA 4MUGA 4W5WA 3MUNA 4BNGA 2GETA 3CLKA 3ASZA 1PFVA 3O94A 4LG1A 4JH0A 1GPJA 3ANTA 1S2IA 4UUAA 4D9IA 4UU1A 5FTJA 3CG0A 2CNNA 1VTKA 3TCKA 4DDVA 5JXJA 1TT5B 4XW2A 2B7LA 1XNQB 4I19A 4FT2A 2WJVA 2WQZA 1KC3A 3SIXA 1TU0A 3B5EA 3QVSA 3AF0A 2RKWA 1Y8QB 2XT0A 4Q4HA 4G5QA 3LCUA 2X15A 2ZJ8A 1G5FA 3KLMX 4KOEC 3ROQA 4X3PA 1JKJB 2ZTSA 3W2GA 1SOVA 1M2KA 1JFLA 5IVKA 4FYPA 3PFCA 4ZEWA 4BYGA 2PFKA 2ORIA 2YWBA 3RSCA 3TDKA 3AKEA 3QJ5A 5KWEA 3KUCA 1PQ4A 4AZ3A 4XH9B 1XQ6A 1SU8A 3WHKA 3N70A 3OIYA 2QIOA 3I1JA 5FL7D 5GJVC 3TPFA 2UZ0A 2QB5A 3DEIA 3UK2A 4E7PA 2GHIA 4ZU3A 3IEKA 4D02A 2E21A 2MYUA 4FN5A 2A9FA 4BKMA 3SIWA 1P4RA 3KYDB 1D03A 1ECCA 4GOOD 4PC3A 4D3DA 1I4OA 3JATB 4EZBA 4K1LA 5J1TB 1U9IA 1T3GA 3NWOA 1IULA 3EULA 5CURA 9GPBA 4F3TA 5AICA 3V4OA 4X9XA 1K8ZB 4XWTA 2CF5A 3DLPX 3IP8A 1KP2A 2Z09A 3DOHA 4XXHA 2CLMB 4DG9A 1NVUQ 2BHTA 3KQYA 1HO3A 2V58A 5AW4A 4F8EA 4KLAA 2QLFA 2IH4A 5NULA 1BE1A 1I14A 1C3VA 3GARA 3OJWA 2FI1A 2D8MA 4KIJA 3SD7A 1ACMA 3ZLTA 4BAGA 2TMYA 5I7VA 3B53X 1TUEA 2FTKE 2YINC 2N75A 3AJ9A 1OXXK 1QTRA 2IDMA 2PYDA 4X6LA 1EH5A 1U2RA 1Z28A 4UQLA 2NV0A 4OA8A 5AXDA 4PZLA 1WBBA 4JNKA 1Q20A 1EDOA 3RUEA 2BGJA 3KXDA 3U2QA 1YA8A 4KR6A 4D9NA 2XB6A 3IVCA 3IPRA 3UCEA 2WWWA 4XVHA 2BW0A 1Z4OA 3AP1A 1T1JA 2J0VA 3A04A 2A33A 3V8VA 3VOSA 4IKEA 4YO8A 5GONF 1P2FA 5KAMA 2FP4B 2GF2A 1F0YA 4KO3S 4YRPA 5HZGA 4E88A 1JRLA 2YHBA 5DP2A 2XIQA 1CJBA 1GSIA 2G72A 1IJFA 1UCFA 2G9VA 3N2YA 3QXHA 4XGNA 1NRXA 4JJZA 3D2LA 1EVKA 2UZ4A 1C1DB 1SHZA 1ZEJA 2KYRA 2I1QA 1GCIA 2EGUA 4FGLA 4KWCA 1Z6XA 3QKRA 3G5LA 5AOCA 3WB9A 4IDOA 2O2CA 5ALLA 2GO7A 3S2ZA 3PQDA 5HZHA 3N7AA 1GFZA 4CN9A 1IDN1 1H1TA 1LY1A 5FUMA 3PK0A 2FPSA 4UNQA 3BFVA 2NTJA 4XJXA 1IN6A 4MVJE 1NATA 4L4UA 4AT1A 3OEED 1K7EB 3HVIA 3IS3A 3C3JA 4O8ZA 1RLIA 1Z25A 4BV3A 2HU8A 2QL5A 4W6ZA 5JAQA 3B2EA 3JASB 5HJ2A 1V4BA 4TV9A 3L8GA 2YN2A 4BVEA 4M9XA 1RXSA 2CCKA 4JI8B 1JG4A 1YC5A 2BZGA 4EIWA 3A14A 1D2GA 5JH7F 3E3MA 4PX9A 3SP1A 2GVZC 4KQ1A 2W4MA 2JJ2D 2OXRA 4NBNA 1W93A 3LUFA 4GQBA 4CMHA 4EITA 4GT1A 3EXIB 2JCGA 3IOBA 1ENOA 2BZSA 4OREX 4IJMA 3D3KA 4E4YA 1QBKC 1ESMA 4G1BA 2CC2A 2XRFA 4DDHA 1T0HB 5TMEA 4OXIA 2V45A 1SUSA 1OLXB 2IY8A 1M67A 4KODA 1KSHA 4YR7A 3RAEC 2PTHA 4G5HA 5E3JA 1U1GA 5CAEB 3NC1C 2JZNA 1JU9A 1PR5A 3UNXA 1OFIA 4YASA 1Z0AA 3OKAA 3PQ2A 4ILKA 4BO5A 2QLMA 1NVGA 1DAHA 2FMIA 3B3AA 4PGMA 1FNNA 1Y5LA 1MENA 1XP8A 1Z34A 4P31A 1KFJB 2WWFA 4F60A 2AE2A 3RYIA 1OF1A 1Z62A 3U3OA 4IQGA 3UWOA 3HU5A 3QVLA 2CD9A 2P9HA 2FEKA 3RRYA 3OJ0A 4FW8A 3KZMA 1W30A 1GT91 1Z2AA 3KPYA 4G6ZA 1SC6A 1U9YA 2PKCA 3C1UA 1AT1A 3PDUA 5BRNA 1J21A 1XMIA 3P94A 5BSHA 3EYAA 5BV8A 4ABYA 1BE8A 3I28A 4LGMA 3C3CA 3HY6A 3SDSA 3RS7A 2XXAB 4YAWA 4RS4A 2PV7A 4JEMA 3BL6A 4DR5B 1A95A 4CF3A 2O2JA 3AWDA 1PBTA 2QEQA 3F4BA 4E5SA 4CE6A 5FL7A 5JNUA 1PF7E 3H5VA 2DFLA 2O2EA 4Q3LA 5D00A 5K3OA 1AUOA 3ADOA 4DCNA 3R5SA 1VBFA 1XCPA 2P78A 1V7ZA 1PYOA 2X2OA 1JU3A 1U94A 2R6HA 3B5JA 2VOJA 3H5AA 2DTDA 3H7AA 2A30A 2AN5A 3AETA 5B7QA 2NPOA 4MVJH 2IU4A 2IX3A 2FETA 1OZFA 1KYYA 4RENA 1LTQA 1Q0HA 3C1OA 2P0AA 2XY4A 4C04A 2ZRLA 4AC9A 3FPAA 3ITDA 2MSNA 3SMQA 2F4VB 3DOIA 3DMTA 4LJ5A 4RHEA 5H5JA 4ZHQF 3OLWA 2AA3A 1UMDA 3IESA 4TQAA 2CVPA 1EGQA 1MVLA 1QDUA 2JS7A 1T1RA 2OEPA 1Y4DE 3M1IA 4JCCA 2JCYA 3UXYA 2ZJ5A 2BSQA 4RIGA 2W43A 4YS6A 1ULTA 3IAM6 4DMLA 5EJ7A 3WA6A 2CV0A 3U4HA 2WAYA 4LX8A 3IO5A 1ZYUA 1U8FO 1NVEA 3K31A 3WLTA 2WU0A 5ICCA 5FOXA 4GI7A 3FETA 5A3JA 5CGQB 2QGZA 1ONOA 1RPJA 3RTAA 4K26A 3WDSA 2ZYSA 1E8DA 2ZBGA 3L8YA 5EZYB 2OCPA 2QQ5A 4F97A 2G9NA 2WUGA 4CL2A 3HEAA 3LWBA 2VPIA 4YV7A 3B38A 3O2JA 1M8FA 3B9RA 1A50B 1KMHA 1TM1E 2V7TA 3H17A 3LGAA 2B4QA 4RELA 3HXLA 3IELA 3KB8A 5SZJA 2O2SA 5IAEA 4DIEA 3GR6A 3N6XA 1U7DA 1DIAA 5GV7A 3RYTC 2LCFA 4G65A 2XNJA 3W7AA 4WBSA 1DXQA 3QUBA 3LPAA 4ER7A 2B4KA 1Z0DA 5HHTA 3O21A 1C4KA 2VDWB 1BXGA 1HSZA 3EC7A 1NVAA 3WC4A 1CLEA 3H0EA 4X71A 3DXFA 2FSFA 1FDWA 1Z18A 2PLWA 4N6GA 1S2MA 4J49A 2C2ZA 1T8PA 4G24A 1U2ZA 2PD3A 1F20A 2X19A 4ZVQA 2JAWA 3DWFA 1NLFA 4O4HA 2A92A 1J9ZA 2AEEA 1M83A 4HLUC 1Q2XA 2I2XB 1NBWB 2XOKD 4HQ6A 1JL3A 4G0VA 5I7RA 1U0RA 1ZJ6A 2J0UB 3CRW1 4A2WA 2VJQA 4IDDA 3ETJA 4EM6A 1HDCA 5EQJB 2XVAA 1K92A 1NBIA 1E1RA 1E69A 4ZQBA 3M4ZA 1TAQA 4ETIA 3RHTA 1G2OA 4CNQA 4D45A 2JJ2A 2QBYA 3UOGA 2WIBA 5HOQA 1ZWLA 4ZOBA 1GOTA 3S44A 2CT8A 3LF1A 4AG6A 2XE8A 4HDRA 1JHOA 1PWYE 3B9BA 3AL3A 2P7HA 3FOWA 4AJLA 4Q9DA 4OXQA 3FJYA 4KDFA 1C3OB 3K72B 1SXHA 1ZH8A 2W93A 4G9EA 2B37A 5MN5A 3WSVA 4LGCA 4XKJA 4BGEA 1CDDA 1IXSB 1X8LA 2ANCA 3VXKA 4F6RA 1ZZEA 1JS1X 3GGOA 3RTEA 5C1PA 3SBDA 2GBGA 1U7WA 2QI9F 1XXHB 2ZJBA 2ONJA 3LHKA 2X0FA 4HDAA 4XQEA 3QLUA 3ROZA 4L75A 5JD4A 4LQ4A 4OHMA 5DE3A 1EHIA 3S27A 3CEHA 4YRIA 1W76A 3DT9A 1Z6QA 1I7NA 3FAZA 4I8XA 4WBNB 2CZGA 4HQ0A 1Y48E 4WRRA 5JR3A 1NVTA 3FWYA 3H1FA 3O84A 1G20B 5KHAA 3ABQB 13PKA 1FX0A 3D0KA 5KSPA 5MN6A 4D9MA 3LFUA 4MLPA 2IIQA 1NNUA 3FTFA 7ABPA 2J5KA 5EHQA 3KQTA 5JSHA 1ZCFA 4NCNA 1IHOA 4CNBA 1I4DD 3H8SA 4X90A 1F4VA 4XPIB 2PGXA 2Z3ZA 3OOJA 2VA8A 3AUFA 3BUSA 3RWOA 4JZKA 3TFQA 2CN1A 4WLUA 5EE5B 1X1QA 1V47A 1XL0A 4EY7A 1ZUNA 3E7XA 1PR9A 1AKRA 1W5TA 4EGFA 1N1DA 1MA3A 1LVHA 2FEAA 2HSDA 5CIWA 2VHXA 2HDHA 3G17A 5BV7A 1NJ1A 1RMTA 4PZUA 3REFA 3QP9A 1UUFA 1NN0A 3HZHA 4BLUA 1FNBA 1E6CA 1MO4A 1FFDA 1ZGAA 2JI4A 2V54A 3EH2A 2BWJA 4GRDA 4MRAA 5I3ZA 3CE6A 3GLIE 1SVSA 2GLXA 4PONA 3OAAD 1IVYA 1XQYA 2V5UA 2JCVA 3JQRA 4OTZA 4ZO8A 3M3PA 3TI7A 4TZ6A 4NATA 3QBTA 5H3LA 2YIJA 1BCSA 4RMGA 2CCJA 3AM4A 1JG1A 3ED1A 4Q4CA 1YJ8A 1GQQA 2Q8QA 2BTQA 4PHTA 3QMPA 4D4HA 2QT9A 5ILGA 1EYZA 2P2LA 3H9QA 2XWPA 4KTVE 3DEHA 3Q8XB 2WE8A 4WZZA 3BKXA 2C2MA 3ZY5A 3K6KA 5AM4A 1K3TA 4MWEA 4URWR 2ZZKA 3CCFA 4KVFA 4B4VA 1VJ1A 1W9HA 1KO8A 1T8TA 4EF6A 4ZJPA 6REQB 821PA 1G8YA 3MIIA 2HT6A 1G8FA 2YCBA 2YZKA 3DHNA 2O6HA 3PXAA 4WZBA 5EUQB 4I9NA 2PY6A 2HREA 2O4CA 3BWVA 3C15C 4LJSA 1K98A 5IZCA 3GFGA 4J94A 3DE3X 2ANBA 1QZTA 3T38A 1Y1QA 1N5MA 3W8EA 1E2IA 3T3DA 3ZCSA 2EFGA 1OI3A 4LJ8A 4DW8A 1MQAA 1MGOA 3I6YA 5KYYB 4PCVA 3KC2A 4AKSA 4JP2A 1JDSA 1JP7A 3A4NA 2EFDB 2FZGA 2W6ID 2ON6A 3FGOA 2PD4A 3IUEA 3LWNA 1OD6A 2DBQA 1Q7CA 3DLAA 3H0KA 2HMWA 2IE8A 4NENA 4RANA 4TPKA 3LF2A 5MFZA 4L8GA 2JLZA 2W6QA 1LDNA 1XYVA 3LECA 2GWHA 4DE5A 2QDXA 2G6TA 1GGVA 3UK6A 3W6UA 5EZQA 1VI2A 2YVAA 3UAWA 4D0NA 1DARA 5JNTA 2ZSEA 2WFLA 1L7DA 4D42A 1TQ4A 3G5MA 3N2NA 3N74A 5K6TA 2IBTA 1NW9B 1VYUA 4YJHB 3S1LA 1R12A 1U8TA 1M2WA 2XOKA 1T2FA 4DKXA 2V0NA 2XVZA 1IE3A 3AR2A 3GDHA 2LP4Y 4TXLA 4YAIA 4R16A 1XFDA 2QN2A 2FSIA 3TTWA 2OHHA 1A5BB 1G0OA 2HNKA 3C16C 3WYBA 1OA1A 4IS3A 4QELA 1RR6A 1CT9A 1UDWA 2XUDA 3K8OE 4IMPA 4JLWA 3TW8B 4EGSA 2FF7A 1Z5UA 2DTXA 3PQ5A 3D7RA 3WGHA 3HXQA 1IAQA 2ZOSA 3HJFA 2JEOA 2CNBA 2O5VA 2RK6A 4KQ6A 4O4JB 2XODA 1NKVA 1FLVA 4DMFA 3EAGA 4Q03A 1IATA 3P9PA 3T1OA 1MVOA 1P91A 1R88A 3FTNA 1Q0TA 3L7LA 3BCUA 3R4VA 4O0LA 3SY8A 3HWWA 4QICA 1DIBA 3GP3A 4ALJA 5BYJA 2A78A 3QG5A 3Q3EA 4QDJA 4QJ4A 5M3BA 3IDOA 4UPVA 4N1AA 4M6WB 3ZI7A 3K2IA 1LS6A 2E4UA 3IC5A 3SHFA 4RJTA 4B8YA 2DHDA 1SC9A 2D74A 3AM3A 1EINA 2HX1A 1KC1A 2OAP1 3GJ0A 2ZIWB 5ITWA 3U40A 1FC0A 2R8YA 3BWXA 3DDOA 3SS7X 1DKUA 1E3WB 5IABA 1N9GA 1WOYA 1CW2B 4BMOB 3G23A 1LX6A 1YL7A 1QYRA 4YONB 2GLTA 3U4AA 1J5XA 2X13A 1A9OA 1V5GA 2H2AA 3DV0A 4MVJG 4OGGA 4P3KA 1B6RA 2Q9UA 5IAJA 2OFFA 3UK7A 5FKJA 4JJKA 5FI0B 4MYUA 1FYVA 3LQRA 4OI2A 2P75A 2WEKA 4J1SA 5K1ZA 5ICFA 3BMOA 4JGGA 1RADA 1UWVA 3GNLA 4UE2A 4Z0NA 4CV3A 2BFBB 5I9NA 4NZOA 1ESNA 3NWEA 5H81A 5B1HA 2BI4A 4UULA 5NLLA 4L4YA 2NTVA 1D2EA 5EHIA 3AONB 2Z1DA 2KWIA 5K3CA 3ONVA 4DCOA 2WBLC 3QKTA 3LWDA 1ONSA 4LSZA 5F7JA 3BXEA 3QEKA 4WA8A 1QLJA 4K9OA 1GY8A 1NX9A 5ALTA 5FX2A 5JS7A 4EL5A 2HF9A 2HU7A 3X1YA 3O2NA 1T2DA 3N0XA 4MLCA 3S1AA 2ZEJA 3BJEA 3IEVA 1N9ZA 2QAGA 1YL6A 3CH4B 2GK4A 2IYVA 2G82A 3DS8A 4YWHA 1EE2A 3NOOA 2JAQA 4K3UA 3DOEA 4N5LA 1HK7A 2GJ4A 4A2CA 5LQKA 2L18A 4RPGA 1QTQA 3M83A 5DHAA 3BZUA 2FPXA 3ITKA 3TLEA 1OAOC 1NC3A 4B3CA 4P92A 4IJVA 4XGQA 3V4RA 4WXRA 4NBWA 5KYGA 5AHOA 1KY3A 3HDJA 1MXFA 4RTRA 3B8EA 2BFFB 3OCYA 3O74A 4P80A 3HP4A 3WLSA 1G3IA 4AB1A 3OOHA 4IXTA 2BGTA 3CWCA 2CWWA 4MPJA 1TF5A 3A3NA 3PC7A 1VG1A 2ZRFA 3AR5A 4RBNA 3UEOA 3MWKA 4ER5A 1QWOA 2WOJA 4N8DA 3HMQA 4L9SA 1YZGA 1O58A 4FKBA 4PZCA 4DPLA 1PDOA 3CY6A 5CHYA 3G2KA 1F6BA 2AG0A 3HJAA 4G26A 1WAMA 2YW9A 2YBEA 1OZAA 2CK3D 2ZSBA 4IDEA 4KE7A 3FJ1A 4O4IF 3K0HA 4UM7A 4S05A 2ZVQX 3EZFA 2YOGA 3VAAA 5I7EA 5JNRA 3MGKA 1XTQA 2W6IA 1YU9A 4HWRA 3FMGA 2HJVA 3W5SA 1KY4A 2ENUA 3SYTA 4MUNA 1EUCB 4N3BA 4B7CA 4BCDA 4EB8A 2HMVA 4DTIA 1BQEA 1RFGE 2GDZA 3C43A 3FPSA 3IKTA 2X9VA 3NPAA 4RGBA 1G2IA 3JYQA 4X66B 5H68A 1E5DA 3DTVA 1TCUA 2Q1WA 3GX1A 2OOKA 1EFHA 1LI7A 2OFOA 4FSDA 5TE9A 4NNPA 5J2TF 3C3DA 4REQB 3QLVC 3T7AA 2H7VA 2C7BA 3JARA 5EGNA 2B83A 1D1QA 4ZOLA 1OT3A 2JZCA 2ZYWX 5FIUA 4RZSA 5AW9A 4Q4AA 1TO1E 4BUJA 4AECA 3GLUA 3I4CA 5BQ3A 5LQDA 3RRMA 3T0GA 1ZGJA 3ITEA 2QLTA 4L8LA 3WICA 3M6AA 2QRLA 4BNXA 2ZVDA 2NX2A 3DPIA 4MVJD 4NG5A 2B4YA 3LXUX 1NMZA 3MIZA 2JLYA 2AMJA 2ZVPX 4EKEA 3NHKA 3VPGA 3QPAA 3QKSB 2PUTA 5KOJA 4LVNA 4FNMA 3GQBB 2GZAA 2HF2A 3DDZX 2DKFA 2D3TA 4L6IA 1UZLA 3TG8A 1LGYA 2AX3A 8ADHA 1TPZA 2CDAA 2PXCA 4B9EA 1RWOA 2FPWA 2JLBA 3FCEA 3IPXA 1SUWA 3QVWA 2VZ9A 4YJ3A 3IPCA 5DBEX 1WDLA 4IVRA 3ZWYA 3ZIUA 5IJWA 1G2QA 2NZYA 1CF9A 2GQ0A 4JUCA 2X8JB 4US0R 4JR1A 4CR6A 3L4EA 4PEVA 4EGQA 2I55A 2B99A 2DHQA 4QQNA 2WB4A 3PQCA 3HXTA 2H6EA 1E96A 3I2FA 4XCQA 5BN5B 2OYCA 3ET5A 1N2BA 2BHRA 1BQ3A 2AYXA 3KZ1E 1RRCA 1XNRB 3ESZA 3KZVA 2FPIB 3SHQA 4CCSA 5AJXA 5BUCA 1JEJA 4QM7A 1KK2A 3RV3A 4H7IA 3OC0A 2QD4A 4U7TB 1DEHA 2CE2X 4QYXA 4DNPA 2Q1TA 1PJ3A 5JW6A 3K0BA 2AC7A 3C6MA 3P4UA 3ZY3A 1USGA 3ORHA 3ZCVA 4EHIA 4NFSA 1U02A 3KXKA 5JXIA 4Y1GA 2HIMA 2VHWA 3H2JA 1NPTO 5KYYA 3ZK9A 4FMDF 2UKDA 5AW5A 3PPWA 1DSSG 4B73A 1Y1PA 1KORA 3QY0A 4OXKA 1QG6A 3B9QA 3FFTA 3VV3A 2LIPA 2J8ZA 4HY3A 5B6PA 3LUAA 2RJ3A 2DQZA 2UZIR 4JC4A 4HDNB 2EX0A 3TRFA 4DDTA 4Z3DA 4B8WA 4BIIA 2XBUA 4B47A 4HNTA 1DQRA 1C0KA 3F7TA 1TM4E 1MB3A 4Y2QA 1ZIXA 3ZZNA 4WK4B 3UFXA 2BYTA 1RRGA 1WVIA 1W96A 3FLMA 1OWPA 3GMDA 1NWCA 4ZK6A 4R9VA 4HEA6 4RORA 5F35A 1E2EA 1K6EA 3M9WA 4JJ7A 1H1LB 5CYOA 4ZAYA 3ETNA 4INAA 2Q6TA 2ZPUA 2NSJA 3SMVA 3CZ5A 3KB1A 4IG9A 3IEMA 1WLYA 4K03A 1E5QA 3RNLA 5CVEA 1C8VB 2NSDA 2JGDA 1CRQA 1WJGA 3U56A 1FFSA 5FB3A 1DAMA 3WIVA 2AMLA 3E84A 1DHTA 4D8UA 3RT9A 2XAUA 2PIDA 2YN0A 3U49A 5DM70 1RWXA 2AF4C 3GGJA 2FFBA 4K46A 4MQBA 1GFIA 4QGHA 4UJ3A 3IDSA 3OJEA 4BX3A 5B2EA 4KUGA 1Z2OX 4IIGA 1ZUIA 3OIFA 1HFEL 3NKFA 5C18A 2IF2A 2GTPA 2VXYA 1AKQA 1K5GA 1RHKA 1ZI6A 2P8SA 4IDPA 4Q4HB 2XVXA 3SSOA 1PZEA 1YB5A 2JARA 3P0FA 1U5CA 3L6UA 4HADA 5TVGA 3WGGA 3W6NA 2XKAA 4KIUA 4KXYA 1O57A 5C7IO 2CYCA 4QHYA 3T34A 3PB3A 1P4GA 1OXKB 2DG2A 3FI9A 1WCWA 2OUIA 1L5RA 3F5FA 1ADBA 3P9QA 2TMGA 4HX2A 4NDZA 4AZ3B 5IULC 5KMGA 1YH3A 4WZAB 1WXQA 4AJ9A 1Z5NA 3N8DA 3RABA 2CK3A 4UDXX 3DLHA 1BROA 1XUOA 2BRUA 4GLJA 1ZRNA 2VDVE 4CEIA 1Z0JA 2EFEB 4I9HA 3VH4A 5A5EA 1C2TA 1L3BA 5CCEA 1JEEA 2IUEA 4FEAA 2AN3A 3TBKA 3AHFA 3GBVA 2IHUA 3ASVA 2P5SA 1R8YA 4QHTA 3NFYA 4C7BA 5CVTA 4LFAB 4GKAA 4NPCA 4I5IA 2DU8A 1IJEA 3RW9A 1T5TA 1XD9A 3FRHA 3AGQA 5IW8A 3SX0A 1AUXA 4YQFA 4AJEA 1G3UA 1C29B 1RXCA 1UDCA 4EBBA 3TN7A 1LPOA 4OJKA 2JLSA 4MHSA 3KZXA 2GN6A 1LWOA 2CKDA 3DYIA 3T4UA 2GN8A 4EI8A 5EWLA 3RAJA 1PL8A 1QIHA 1CUJA 1ZRSA 2BDTA 2XCOA 3PENA 3TW6A 2AOTA 1J39A 1XQXA 1LLDA 2VDKB 3IPYA 1ETUA 1HORA 3STHA 4DLNA 4WLOA 4MVJA 3PA6A 5BW6B 4EL0A 2FSPA 1QRUA 4UEOA 4D74A 3AG5A 1T1EA 2QDKA 4PZYA 1I2DA 4WGFA 2WUWE 3GEDA 3HA7A 1T36A 4IBOA 1G8KA 1K75A 2YXNA 3AEXA 5IAGA 3NGLA 4DRXB 1JNYA 1P2GA 2IKSA 3VPSA 2JGJA 1H2FA 3ZV7A 4DIKA 2WSSA 3L79A 2E4WA 3DPSA 2VT3A 3F2VA 1F06A 2C8JA 4AL4A 1B6SA 3MW8A 2IH5A 3IH5A 4DILA 3HXMA 3PQFA 3UB4A 1FLNA 3WHLA 3LMKA 1SZPA 1MOZA 1JIIA 3N0WA 1IEWA 4BO8A 1BDHA 4KYVA 4RH0A 5G2OA 5A1TA 1CUBA 2DT5A 1DOAA 3HO6A 3ND9A 3QKRB 1A04A 4HEJA 1WXEA 3WLLA 2WIJA 1EP1B 3V8QA 1D7OA 2EQ5A 3P2MA 2PH5A 5T4HA 2BDUA 2YVQA 3F8WA 1XJQA 4K6GA 4RV5A 4D5GA 1KSFX 1VXRA 4K6OA 3W1VA 4U1RA 5JCOA 2IV2X 4LYEA 5FBZA 3NHWA 4RULA 4J2OA 4G5XA 1PUJA 4E5UA 3R3SA 2XVMA 4X6YA 1F2TA 3KLBA 1AG9A 2FWAA 3TVTA 5FWYA 1ATZA 1NNLA 3QU5A 4TV9B 4JT4A 4NXMB 1X1AA 1Q1GA 2ZTLA 1AGNA 4TRMA 4E1AA 5DM1A 2AKEA 5B3KA 3UJDA 4MHTA 2PWYA 2UXBB 1E4EA 4I46A 1JN0A 2MSLA 1PGJA 1J99A 3F96A 4I2VA 3EWAA 1T0JB 3O90A 4JA0A 4U6QA 4DOMA 3FFWA 3OQVA 1LDGA 1HFWA 1SHUX 5DM0A 2IZ7A 1Z4LA 5DGXA 2DB3A 5IDYA 3VTFA 3GCGA 1S8AA 3DMRA 3P4XA 3ZWOA 4Q7LA 4ITRC 4KFTA 3TOSA 5ALPA 2ZUCA 2GRUA 2BFNA 2AYZA 4FCTA 5AI9A 1T3LA 2YZ7A 4G8JA 1OXVA 2AJLI 2DLNA 4ZQEA 5K3BA 3SXPA 3T3PB 3L4KA 1OWMA 4AKHA 3N86A 5J2UF 1XCMA 1RYBA 5TQ2A 4K6FA 2Y3IA 1DIGA 1RHUA 1S89A 2GCOA 2WF5A 3TLKA 1JFFA 1H4SA 5IYZF 4NJMA 3A7DA 2XI4A 4WPGA 5AVWA 3GFQA 3RYIB 1RE0A 3BMXA 3DO8A 3GA5A 4RDHA 1T9GR 3ZS9A 2KJQA 3S55A 4QOJA 3L7OA 1PNQA 4LWOA 3GJ3A 4PRZA 4Z8XA 3THWA 1POXA 2AJBA 3BM5A 1PP4A 2DQ4A 2FEOA 3EPPA 1XZCA 2GN1A 1XZ8A 2H65A 2HM7A 4XJVA 1P9RA 5CPFA 3WJAA 1P45A 4C5AA 3F7NA 1WR8A 4AUKA 2FPGA 3AOEA 4Z5XA 1PU2A 3SZLA 1E2UA 4E6EA 4QNMA 3FMFA 2XX3A 1YKSA 2AKAB 3A32A 1CNFA 1U4SA 4LE0A 3RUIA 4CR8A 4F1WA 5KB3A 4GUAA 5K6RA 1AHPA 1HEYA 1UJBA 1MJNA 3AUYA 1E0KA 3KNZA 2QMQA 1MNQA 3FYUA 2VN8A 4ZVVA 3O93A 4RTOA 4PCAA 5JHHB 1P7YA 4FFBA 4J0JA 5B1EA 4I1OA 2WP8J 2XF2A 2RIRA 5DGCA 4CF5A 4FWIB 3ROGA 4JUFA 1TRHA 5K8VA 4E09A 3NBAA 3FWNA 1U3WA 2A88A 2P68A 4JASB 2JA2A 4F3CA 2WG0A 1IIRA 4AS3A 5IKXA 4QD3A 3MWFA 5DKFA 4PO1A 1WVGA 4QT4A 3VJRA 3EGVA 4BB6A 2XCSB 2GR9A 1E1NA 2ZSAA 1BX1A 3GLFE 2Q1YA 2X5NA 3PUHA 3SE7A 3WTBA 1CUHA 2PQMA 5ELXA 3RFXA 4BKOA 1GUDA 1XVIA 5CIYA 1UMDB 4UU0A 3PNYA 1OYVA 4HAWA 3B8HA 2BH2A 4C78A 4ADSG 1F8XA 2VJYA 2N46A 3AQ4A 1R3DA 3ILHA 4ZYTA 4G2NA 1GG2A 1JI3A 1GKLA 1WHTA 2DKOA 2FOXA 2WM8A 2XQKA 4EWLA 1RRMA 2JLQA 2E48A 3H97A 3NFRA 3ECCA 2FHPA 4OGLA 4D0SA 3QLUC 4GZLA 5CT4A 3ZV4A 2JLRA 5HIJA 1J9EA 1ETHA 4U2GA 2CNWD 5DCLA 1ZHHA 1RWMA 2PRIA 3WKCA 1DG9A 4RKQA 4LVUA 1DQNA 1UBMS 4MV1A 4LOHA 4YUZA 2BBTA 5IVDA 2NU9A 1KMHB 3A1VA 2O7RA 1RYDA 2QLLA 3BXGA 1R6DA 2PS9A 2W6CX 3CFYA 4JHLA 5D85A 1WP4A 3U7QA 4ENWA 3U3XA 5L3SA 1FXSA 3IVMA 5JBNA 1D0SA 1PJSA 2OL4A 2ECQA 4DGSA 1FOEB 3U7EB 1HNZB 2WKPA 4KDRA 3UGJA 4RX1A 4Q34A 4XYGA 1HG0A 4Y2RA 5KX5A 4U2BA 1FP1D 3JWIA 5JC8A 2FWNA 1BXGB 1XT6A 1W5BA 2JRLA 3K9CA 3OIDA 4L8FA 1DX6A 2F55A 1GV1A 4MPDA 3ZU2A 3EG5A 2H4XA 5K3AA 1G5HA 1LCIA 1NI3A 1H6AA 1UAYA 1WEKA 4M1KA 1ZAKA 4CQMD 4XUDA 4DV1B 1ZD3A 4MV9A 1X42A 1AD2A 3BG5A 1CEQA 4IAOA 4O4HB 3ADPA 4IXNA 1GO2A 4DL9A 2WUDA 3MYYA 1BKYA 4NQZA 3ZKWA 1P1HA 3M5WA 2V98A 2G1UA 1ZJWA 3M6IA 1E6EA 4ALLA 4ICIA 1I36A 5JS2A 4BNMA 1OB5A 3LHSA 5TY0A 2GS9A 3DTTA 4YCJA 4KNVA 3I05A 1KQFA 3L7BA 3UMVA 3ADCA 1EXVA 3FUXA 2HWXA 1YFKA 1UC5B 2QYSA 3I58A 4UFNA 3RFCA 4LBWA 3WLOA 3L1KA 4HXFB 1Y8ZA 2I7VA 1I3KA 4KR7A 1FP6A 4E51A 3GFPA 1E2QA 2B9EA 5EIOA 1ATIA 1I2MA 1B73A 3O1JC 1EVQA 1HETA 3EODA 3FCXA 1QP0A 1A5TA 5EFZA 4A27A 1TIBA 1TLTA 4ETWA 3AVUA 3TYXA 4X92A 5J5CA 1YBAA 1QUFA 4D97A 3BH7A 3UAVA 3D6AA 2PT9A 3KWFA 4B3IA 4F4FA 5IZCC 1EXWA 2C0PA 4TROA 2VOEA 1JIJA 4LDPA 3H1BA 3RUDA 2VUTA 1T9KA 2NO4A 4D7AA 3K1AA 2WTBA 4DLXA 2OMEA 4B4OA 4YQYA 4F6RB 3LBYA 3EZ2A 1YDGA 4MW2A 4RA9A 4HS9A 2Q6LA 5DNEA 3ZOZA 2HLHA 5A02A 3U6KA 4ZJZA 4D8XA 2R1UA 1SIUA 2HN9A 3ICVA 3GLIA 2B8WA 3H42B 4EB0A 3LX8A 2AD1A 1FNMA 1QO0D 1H6CA 1AK1A 2Q5LA 4JWTA 2VT2A 5HMLA 3V7NA 1YBHA 3NTLA 2PKQP 3HKBA 1NPYA 2FR1A 5AVQA 1WUYA 3HBLA 4YI5A 1G16A 1XNGA 1HT2E 1K7YA 1MV8A 1SJ9A 1W88A 2IGTA 1FX0B 2FUG6 3E27A 3ND7A 3OX4A 1SKBA 4M46A 4NCXA 5HWSA 3QEJA 3FB1A 3JRWA 3OURA 1LSJA 1W0JD 2G67A 3DKPA 3GAAA 4GPAA 2QU8A 3FPKA 4RFLA 3KR1A 3BXPA 4B4WA 3WYFA 5AVXA 4N7MA 4ZZ2A 5IG2A 4QSMA 3A2KA 3E7DA 1WMSA 1IWBB 1CJSA 1KAGA 4GPIB 1V5FA 2NT4A 3CH5A 3HVKA 1PFWA 4LRUA 1ZUNB 3DL2A 4GR9A 5HNKA 1FS6A 5G3YA 3R76A 2CYAA 2Z0MA 2ZGVA 2CFSA 2HIGA 5FF9A 2VKQA 3WGVA 3EIHA 5LP6A 3O8RA 4HCJA 5J4KA 1ML3A 1UBGA 1I30A 4KWTA 2XNDA 5MGBA 4CU5A 4MDFA 1PJ8A 4ZO4A 1T9DA 1ZCAA 4KN8A 2YV3A 4DLBA 1EXMA 4OSPA 1V16B 4MVWA 1XN1A 1CJTC 4Z7OB 1G6Q1 4GSYA 1I2AA 3R3HA 2XB8A 3T7TA 3LP8A 8OHMA 3WWPA 1HTWA 1P1KA 1FRZA 3LVRE 1D4FA 2RHDA 1O9GA 3HR4A 3Q10A 4G07A 1BCSB 4MYDA 4M9SA 4QRIA 4OY3A 4RWZA 3OZXA 1NSFA 2BTQB 2FEWB 2ODTX 1RVV1 3K96A 3A8TA 3WYEA 4YVFA 5E7JA 1Q0UA 4JELA 3DBIA 2GXSA 4MS3A 1JFSA 5HVNA 4BE9A 3EZLA 2AB0A 3LLUA 2C88A 1QYDA 1Y7PA 3DEFA 4B87A 3GO4A 3IALA 1PR3A 3R7WA 1DCMA 2VH1A 5ALUA 2CNWA 4WZBB 1S1MA 3BYZA 4XZ3A 3DOUA 1HT3A 1R0RE 1K2WA 1VOTA 3VHLB 5EHGA 4LDQA 1DOHA 2G9QA 4IRXA 3KJQA 3ZJUA 1LPAB 4AYWA 3WMXA 1DNPA 3G2NA 2HKIA 2JGKA 3BMQA 3IE0A 4I1SA 2BP7A 3BGIA 1VL2A 3ZVNA 3KKQA 3L2OB 3N28A 1GL7A 4NENB 3LO8A 2OQIA 3FNEA 3DZBA 4BFLA 1RWNA 4HGNA 1JEOA 1K2VN 3OTIA 2VK4A 2L82A 1EDZA 1JB9A 1US8A 6YASA 2GCNA 4ND4A 2BKEA 2BT4A 4OQMA 3EAFA 3V42A 1SD1A 2O05A 3G5TA 1PSDA 1YZYA 3UGKA 1TAGA 2RGRA 5E4JA 5EWMA 1RQ7A 3VJMA 4MKHA 1U1EA 1XMPA 1P3DA 4N12A 2ZI4A 4HGRA 1QF9A 2QAGC 4Q3NA 1A5AB 5BYKA 2NZJA 4LSMA 4IV5A 2WI8A 3L0ZA 2VNKA 1ZR4A 1DEAA 5AT1A 4LJRA 1CWUA 2DULA 3TNFA 3DVQX 3S81A 1PJQA 1I6WA 5L51A 4HOYA 1RBMA 2CMKA 1IONA 1GPDG 2E4YA 2XDQA 2AIRA 3D8TA 3GLQA 3OIVA 2IYOA 2ZRHA 4MEJA 3RBAA 1TGYA 2P9JA 3MPOA 5FT9A 5ITVA 4RD6A 4QM6A 4ZK2A 2WU1A 5A7GA 1L4YA 4RD3A 4TT8A 2IPAB 4H35A 4BGUA 1P44A 4LWPA 1N4DA 1SUIA 4IQFA 1II0A 4J2HA 2RGBA 2VP6A 4RKYA 4PFJA 3KJNA 5A5GA 4GX2A 1OW3B 4LRWA 4U63A 1JA1A 4LYGA 5DEIA 1EX7A 3LHFA 4UTZA 3R75A 1P8JA 1NXSA 3K5PA 4K9LA 3ZXXA 3DM5A 4DMGA 2R1TB 2OLKA 3FWZA 3ISJA 4QKQA 4URZR 3CBGA 3WV4A 4EA7A 2VWHA 3UOAB 2RC6A 3SYKA 5H9VA 2VVTA 4BNJA 1SRQA 2AKYA 2PO7A 2XTAA 4O4LA 1IXRC 3CNNA 4MMXB 1N9GB 1NVMB 2A9VA 3P0HA 4O02B 5DX1A 3EIOA 4B0OA 1NAHA 2WIKA 4XARA 5FPKA 2NZ8A 2QZZA 4JNCA 2VG8A 3DV0B 3ENNA 1THZA 2HHLA 1J90A 1V9SA 2VTBA 1EIZA 3OM1A 2QRUA 4JD5A 2C2YA 2O3SA 2OECA 2QTFA 5D3MA 4YMTA 2YICA 5E0KB 1PTKA 3GYBA 3GZTB 3ICOA 2ZJOA 2QW0X 4F4IA 3BMOB 4UM8B 3OQMA 1SKMA 4AYXA 3HXOA 1WZEA 3A37A 3X1XA 1TM5E 2JAOA 4RL4A 2C4KA 1TM7E 2EV9A 1GTL1 1SCIA 2RH5A 4LPSA 2BGKA 3CH6A 3L77A 5JLAA 1YD7A 1PWZA 3VH3A 2ONKA 4KR3A 2D0OB 1M1NA 4DM3A 3DZIA 2PX3A 5A5FA 1S8NA 2G76A 3WYGA 3R6LA 4WSOA 2NN3C 4ZU6X 4GXRA 5ADUS 2W9XA 3EW9A 1SQ5A 3SICE 3SNHA 5KSWB 5U1PA 2I29A 4F7WA 6PFKA 3DAYA 3OFND 4KR9A 4BLWA 2JC3A 4BN5A 2INGX 1M1XB 3IB3A 4G97A 1YJQA 1GKUB 1XZAA 1V35A 3HBFA 5F23A 1AZWA 2QAGB 1I7PA 3SC3A 1KI2A 3MTGA 4PSCA 4BE7B 2ECKA 5JMTA 4E46A 5FWAA 3QEAZ 1QPZA 1KKMA 4H7HA 2QAJA 5K99A 2J3QA 3MJ4A 3NCTA 3QFFA 5AK5A 2ZBFA 1GN9A 4J9UE 4HNSA 3OFSA 3RG2A 2O3QA 5ILOA 4TYYA 1R4ZA 2AXNA 2IQIA 5EMLA 3T5GA 4K8OA 3JU3A 3KSDO 1JSXA 3PRKE 2HTEA 2R7MA 1V8BA 2P9QA 3MSCA 1L4LA 1KDRA 2EDCA 2CMFA 3ILYA 3P2JA 3RNOA 5LKRA 3HK2A 5HBRA 2ZIVB 1YQTA 5F1KA 3ZGYA 3DP9A 2V7QA 1DINA 2DUMA 2WK1A 1ODFA 3IQGX 4MJXA 3BTSA 3WWCA 2GTIA 2RIPA 1FDVA 1T5LA 1B26A 1LF5A 1ZM4A 5IJAA 4KK4A 2FMTA 3GGCA 3FIUA 4WCFB 5JE8A 4HB0A 2N47A 5FUVA 2DLDA 2I9KA 3ELDA 2F1JA 3D8HA 5CVVA 4IIJF 3WGQA 4UFOA 4E5YA 1GNTA 3CF2A 1FBTA 4CF4A 5JDIC 3I8SA 4NRDA 3BK1A 3GNTA 1W5EA 1ZD5A 3EY4A 1E1MA 2BKLA 3LL4A 1WZ2A 1N2SA 2WINI 2PDAA 2Q0HA 4TLLB 1ISHA 4G4SO 4ZVTA 2J0EA 3U44B 3DTVB 3D6UA 1FP4A 4JVLA 3KWJA 2W2LA 2OAEA 4XDGA 1JT9A 5TT1A 1RVDA 1N8SA 3PGA1 1OHHA 2IEZA 3T95A 3X3HA 5B4UA 2Q41A 4ZOLB 3MERA 4MQEA 2FZ5A 2BBWA 3K9HA 1N6NA 3MGCA 4DLRA 4RACA 4Q4AB 4BQRA 3DAFA 3A0UA 1F4PA 3ABSB 3H4TA 2PCJA 1MIHA 1SXJA 1Z15A 2FLWA 5BPHA 2IYZA 3EGOA 5I7FA 1E2HA 5IT9A 5IBPA 4HMPA 4J0QA 3ZY4A 2XUQA 3EQ6A 2B7BA 4IP0A 2JKZA 4A0SA 1R5NA 3ICPA 2PZGA 3E0QA 3Q7SA 3W0LB 2H57A 4DUZB 1NQWA 3JR3A 3HV2A 3OX1A 2IXDA 4Y67A 5L6LB 1GZ7A 3E8XA 3EMDA 3P9RA 2AOUA 3L8CA 3E7PA 3PEVA 4Q16A 4X1KA 3ILXA 4CLHA 4ZCIA 2YWDA 2HMUA 4R41A 2Z6AA 1GTJ1 1QMGA 3GT4A 3R3VA 1K27A 4JBGA 4YJ3B 2PZAA 4KVGA 1NJ6A 5G3ZA 4P93A 4NU0A 3T6KA 2ZKLA 4AQ7A 1PIWA 4UTPA 1GCOA 1QKIA 1W4LA 1YQDA 2ABWA 1UJ5A 1VLHA 2J9XB 3VKUA 3I45A 2VSNA 3PNSA 1GLVA 3R0IA 4YRTA 1XTTA 3ZDRA 5HSGA 1Q1AA 1KYQA 3EF3A 4IF4A 1YFLA 3H99A 1N7GA 3FBWA 3OQOA 4MJ3A 5FFNA 1C80A 3D2AA 4W99A 3X2SA 2A9OA 3DMYA 2BRUC 4M7OA 1W1WA 1LZKA 1TUIA 4BFSA 2CLDX 4WNAA 3N58A 3AF5A 4LDJA 1UBJS 5CBPA 5KKNB 1XZQA 4S1PA 3K35A 4XGRA 3ZEIA 5KU7A 3DA8A 5DSTA 2YIDA 4YFYA 3OEHD 2IYYA 2H1LA 3I2GA 3T4XA 4CQJA 1S5PA 5KVQA 3OTOB 4KXWA 3C70A 3H4MA 5CU7A 1SUBA 1ZUWA 2G40A 3BCSA 3T12A 2G80A 4ZFNA 1Y81A 1JMVA 5C35A 3EA5A 3GT7A 4ATNA 2AZXA 3MILA 2IYPA 1QU3A 1VA5A 1G66A 3LYLA 3BBPA 1Y3CE 4JSRA 3U3KA 4TKUB 5J9FA 2XUZA 2CCGA 1R9NA 3G3EA 3AEUA 3W2IA 3DAHA 2D5AA 1P6UA 2I3GA 3PNVA 4WHMA 3NETA 4CWAA 1PK9A 3UFXB 5BW8A 3AI7A 5IM4F 2XZOA 3L18A 4N6NA 1CUWA 1QRSA 4YECA 1G5TA 2YDXA 3CUUA 2WNIA 5T6MA 2CL7X 3N2LA 4PG4A 4D82A 3GRUA 3I5AA 1P60A 3P2YA 3RIGA 4DR6B 1AB6A 6CHYA 1FDUA 3OFNA 1YC2A 4DIDA 1RKVA 1JG2A 1FVHA 1LI4A 1V2GA 2GRJA 4IWNA 4KQGA 4F9FA 5ADHA 4GPBA 4ZANA 1WNFA 4F86A 2MINA 3ZNPA 4W5RA 4XWAA 3I76A 4KXUA 2GA9A 4KYTA 2J3IA 1H1DA 1A2BA 4OFZA 1EG7A 3R8CA 2QQEA 2QX6A 3PQEA 4HGPA 2R79A 5COBA 1T91A 5ENDA 4EA6A 4EJFA 1D07A 3LZCA 3GROA 3THYA 1SUCA 4QUHA 1L6RA 4QUGA 3C8ZA 1U7UA 5DI9A 1R00A 4TL8A 4UOQA 2B8TA 1M0WA 1SVKA 2BLLA 3P4YA 4TLDA 2ZJ4A 1LPPA 4JOSA 1UMKA 5A9SB 1QK4A 2J1LA 3AC0A 5EG5A 1A7UA 1EESA 1CNMA 5B6JA 3KCQA 5J3JA 2NP7A 1YR2A 5JCOC 4WFIA 1JJVA 2I0FA 2QJFA 3K1TA 2F3TA 3OU7A 2HLNA 3PUKA 1GCUA 1FFGA 4LQDA 3CX8A 1NBHA 3TAHA 2PEYA 4EYKA 1ORDA 1XZFA 2VZ0A 2ZTUA 1NXWA 4JVSB 4Y0AA 4G5SA 4XX1A 4ZCPA 2IVZA 3BZWA 1TU4A 3UA4A 2ZZNA 2DPHA 1ILEA 1X87A 5ECWA 3H3FA 1YZUA 5FRDA 4EMTA 1T9CA 3ZGVA 4P3XA 1QB8A 3QENA 1XNJA 4LY0A 1A5SB 2F1RA 4MW0A 3O8OB 3UICA 2IOFA 2WFAA 4LX0A 4K6HA 4PFSA 4HB3A 3ZGNA 2MSDB 4I9UA 4UTVA 2XUPA 1S96A 3COPA 2JLVA 3KJGA 1CJUC 4GDMA 3DAGA 1Z26A 4P3PA 2EW2A 5EY5B 5IF3A 2I8LA 3MOIA 2V0GA 3A70A 3PC8C 5C8VA 4LYJA 2MU1A 2NW6A 3R1IA 1UFQA 1W4ZA 2MHCA 4TXMA 2CFCA 3H9CA 5K2MA 2VZLA 3G59A 2MCFA 4F3NA 1UK8A 3KYIB 3QVOA 1EP2B 3EZYA 5B4VA 4DLYA 4DLKA 5D1HA 1SQGA 3VR5H 2A5GA 1MOQA 1DIOB 2NUAA 4RZUA 3ZVLA 4LBYA 5FA8A 3EOZA 3GELA 4BCBA 5IHPA 1OI4A 3EQ2A 2JFVA 2YJGA 1NLZA 1HSOA 3MFYA 1J2EA 2FJ0A 1T36B 4OEHA 2R6AA 5G0UA 1MO3A 1Y6QA 4JT2A 1GRCA 3AR8A 1AUVA 5AH0A 1WS6A 4J75A 1T5HX 1N6LA 1BXRA 1QCYA 3OKCA 3AOEC 3G6WA 4GX0A 3WRWA 1OCEA 3MJHA 1KBOA 4BVLA 1E61A 4QDTA 4MULA 1QFJA 1R2QA 1YQEA 1Q50A 1OXTA 1XRSB 1N6RA 3IODA 3JQBA 4GBJA 1E5LA 3PPVA 2CXQA 4DFDA 3GLKA 1YZLA 4YT5A 1L0BA 2ZJ7A 3FYUC 4YBZA 2H06A 4ZOCA 4E7OA 1W36C 2QSUA 3DTNA 2XTMA 3T1NA 1KIAA 2VT7A 5GV8A 1OI7A 5BT8A 4YLEA 4W82A 2IOFK 1WKBA 2JFHA 3E35A 2V5AA 4HX9A 2RK4A 4WK6A 3VR3D 1LFDB 2GM3A 1R9MA 4IM7A 4IJ6A 2PPVA 5BV1A 4JV5B 3JTEA 4FZ5A 2X14A 2XMSA 4LXQA 3FMPB 1QFMA 3VPDA 1A76A 1PG5A 2E37A 1JXQA 2H2FA 1XMJA 2G4VA 1X39A 1QP7A 5HCUA 2I65A 3X1MA 3EHDA 3LM8A 1HXHA 1F2TB 2A57A 1KOJA 1YAJA 221PA 1U2PA 4LDAA 5FWYB 5DYNA 3KSRA 1QS0B 5GOTA 3RYHA 4ENPA 3K09A 3KJZA 1HT0A 1K1EA 3ZHXA 1PTJC 4YXFA 1DPFA 3Q2KA 1E4EB 4FYJA 3EBLA 1MTZA 4HP8A 4X41A 3SZMA 1F0PA 5D01A 4AURA 1IG0A 4KQKA 1RLTA 5F3RA 3PUXA 5AKKA 4DC9A 4PQRA 5K01A 1ZCJA 1M2JA 2Y1KA 1UK6A 3UKOA 2LE0A 4F84A 3AKZA 3G2PA 2NYAA 2YHAA 1Z63A 2IHBA 4DV3B 3UUGA 5DBIA 1Z5PA 1YHNA 2QJOA 3Q0TA 4MDYA 4OXNA 4BNVA 621PA 3X2EA 3NRCA 3IUYA 3C24A 2GZ1A 1TVCA 2ZE5A 4WLEA 2Q3DA 4E5VA 3V8PA 3ADBA 4BDSA 5CBKA 1MAVA 2QD1A 1Q14A 2HRZA 5J23A 5TQ2B 2I2BA 4P98A 4KJZA 4CIXA 2GCOB 3M81A 3ORSA 1JFFB 3CN9A 5EE9A 4BE4A 1J24A 4NJMB 3MCWA 1W6UA 1K6XA 2F3PA 3CUEF 4UREA 4YRQA 3UWDA 4DT1A 3WGOA 3FXAA 4ZQIA 1U63A 3MOGA 4BLPA 1F6DA 1YR7A 1K3FA 2OFWA 4D98A 3LIPA 2KLHA 1MQ9A 2EZ4A 2YHIA 1ZJJA 4LHXA 3THWB 4JLNA 4FYHA 2ZIGA 2ZWMA 4A0QA 4BU1A 4QU8A 3GCZA 3TOCA 4J7XA 1YRHA 1CR1A 1E92A 4IYJA 1NXPA 3T61A 4F7DA 2FPGB 2R44A 1FU7A 1GFSA 1Y3DE 2ZREA 1E9EA 1RZUA 4QGAA 1H5QA 2D00A 3DEZA 3QNUA 4GX1A 3TFWA 4D3FA 2V7XA 1IEQA 5LOVA 3H18A 3KWMA 3CO5A 4ZAWA 1SBNE 3L93A 4KGZA 1XTVA 5AW6A 1XZIA 1ORTA 3FYUB 4U7JA 4H1TA 1TMKA 3U0BA 3TTTA 2H52A 2G77B 1AS3A 1T1IA 1YKGA 1ZMRA 3OD5A 3FLEA 2OM6A 4LXUA 3CBQA 3EY9A 1N6KA 2CVOA 2OCIA 2NIPA 3R3ZA 5DNWA 1M2OA 2A5FA 1MG5A 5C2JB 1MQSA 4AO6A 3L40A 4ZARA 2BHNA 1S01A 5EIEA 4S1TA 3VKGA 4V0MA 1KI6B 2C31A 1DAPA 3BIXA 4TZKA 5IU6A 4FMCF 2AVDA 3IOCA 4IY1A 1O2DA 1XTRA 1C1YA 1ZUHA 4YC7A 1YL5A 2QW1A 4BXOA 1VL8A 2UYCA 3EUEA 3L8FA 1QHNA 2WF8A 4RKEA 5AW0A 4K28A 3QE0A 1YDHA 2OCBA 3OBBA 2PZFA 2JCXA 2X1MA 3I2IA 2B69A 1M73E 1WHTB 4LPKA 1VMEA 2C61A 4Q82A 2Q8NA 4BMCA 1ESEA 1QBGA 1U9ZA 2BSAA 1NUTA 2IXGA 2P35A 2NV2B 3I2YX 3LFHA 3VR2A 4D41A 4WKNA 3T4EA 4DJEC 1SUPA 3DFMA 3G2LA 5A3SA 2B3TA 4Y1FA 2WWHA 2CDBA 2ZB8A 1JAHA 4UDNA 2G17A 5C3MA 2VAVA 4H7PA 2O8DA 1UFOA 4XCVA 4FS3A 3EPLA 3COYA 3H16A 4J4HA 2NU9B 3U16A 4MR7A 5K8IA 3AHCA 2IS6A 3U7QB 5JRJA 1E1LA 1O95D 1JTVA 1ZU5A 2FFHA 2I2DA 2QW8A 4DDMA 5BSFA 1D6JA 1I0ZA 1HDRA 1KQ3A 5L3SB 1PJAA 1QFYA 1KEWA 1EFVA 1NSYA 1UAAA 2QGFA 3CIOA 2Y2UA 1KBZA 2ZT5A 1MT3A 4TS4A 1FUYB 3DKKA 3E5HA 1IEXA 1A97A 3BFPA 3D81A 4W1RA 3TLCA 1HE8B 1WB9A 3VR3A 2C7OA 1ZC3A 4HYQA 2NU7A 3N2GA 4P4SA 3RVRA 4DC0A 1T1SA 3ANSA 3IKJA 3UV6A 3JD0A 1YGYA 1KEUA 2RG7A 3ZKWB 1FSGA 3M4NA 4NYJR 4WE3A 2PWPA 4NZ9A 2V9CA 3TRDA 2II6A 3LCJA 3TWOA 5DBGA 2IELA 1CR0A 4FCVA 4MUIA 4FWBA 4I1VA 4WERA 2PVPA 2I62A 2X40A 1P33A 2BFWA 1KMNA 2P6PA 3OCXA 1B2LA 1IHDA 2VBGA 1SWVA 4XSVA 4DWVA 1P0IA 1KE2A 2OV4A 2K7FA 1WOMA 2GCIA 1QX4A 3Q5GA 4RYLA 3BD8A 1KVRA 3O5AA 3PE4A 1VFPA 5LQUA 2HV8A 2OXIA 1NPDA 3RT7A 3WGIA 3BILA 3OICA 3QV2A 5KOHA 4OXRA 4C0BA 5F9FA 2D2VA 2XUKA 3MJVA 1KOFA 4KXVA 5DYGA 4AZWA 5DIZA 1UPFA 3ZG6A 4EG7A 3LYAA 2XUGA 4B7ZA 3IP3A 5CX1A 3DQPA 4DWWA 3ROFA 5PNTA 4X44A 1F7UA 1LDMA 3I2JA 1QHYA 1PQYA 2K6GA 3QX9A 2MSKA 2JFXA 1XAJA 2QGNA 4M38A 1YS1X 3TKAA 4RA9B 4L4ZA 5ALGA 3AHDA 4BWYA 4ZJYA 5ALKA 3GLIB 2Q2WA 1Q77A 1UFVA 2R6FA 1L4FA 1RKUA 1Z06A 2MTBA 3G7SA 1I7DA 1MG0A 4PC2A 1A2QA 1VDMA 4I66A 4L73A 3I3OA 4M8LA 1Z83A 2QUZA 3WYNA 3U6BA 3HKBB 1BC5A 4BNTA 4EUFA 3VNVA 1IUKA 4HAVA 1PT6A 1WVMA 2AK2A 2XW6A 4GG1A 1W88B 4HDQB 2IV7A 5LQJA 2B21A 2ZJ2A 4AX4A 4RW0A 2JGMA 2FX2A 4B3GA 3PR3A 1DUVG 2EARA 4I5GA 4X93A 5HE8A 1JEQA 5JYEA 2ZCJA 3GBPA 4JL5A 4TT3D 5BWBA 5JSYA 1K7CA 4BJ6A 4CCAA 1HE3A 2P27A 2ZI5A 2V7VA 4P2BA 4ND8B 3GNQA 3OY7A 3DJFA 5ADWA 2I71A 2J7KA 2FNAA 4DQ0A 3H9JA 5FWDA 3WS7A 3ZOKA 2VXCA 2GBPA 4X6XA 5LP6B 1R6UA 2G07A 2R66A 4KI0A 3ZDEA 4WZ6A 4FFRA 4MCJA 1J23A 2O8FA 1O8CA 3R3UA 1IG3A 4LI3X 1SQFA 3HI6A 4WXHA 5EJ5A 5JWHA 2RG1A 3TEJA 4EO7A 3KJIA 1MC8A 3DE7X 3P2EA 3ZHUA 2OORC 1EAYA 1U0LA 2C9OA 1NI4A 3RSZA 2I4RA 1LV8A 1QU2A 4ZAFA 3NUZA 3GP5A 3P9NA 1Y8CA 1ID1A 2F1OA 3L7KA 3MUOA 2WY2D 3ZIAA 1K06A 3ZXYA 2OAQ1 5I51A 3H2SA 5K6AA 5KPJA 5IT0A 3NM5A 3QTLA 1XU4A 4DARA 2E82A 3GG2A 1I3LA 2ZCUA 3BWDD 3O95A 5TV2A 4ED9A 5B58C 5CLHA 5FA5A 4MS3B 2N1BA 1RT9A 4C5CA 4Y9TA 4BVBA 1NTOA 4DJDC 1DBIA 4Y2XA 1SKYE 4X0EA 4OU4A 3E8SA 1IVNA 4PRKA 3TI9A 1OXSC 5CK4A 1XCOA 2YMQA 1YTUA 1X0VA 3O8DA 1GPBA 2PTGA 4ECAA 1Y8AA 1Y5NA 3D6MA 1QOZA 5CM8B 1JG3A 5JG7A 4JYPA 4CL3A 1E79A 2VDNB 1BMDA 4RJJA 1L1EA 3UW3A 2VT6A 1NT4A 3WL6A 4I81A 1HX7A 2PL1A 1UM8A 2BP7B 4OHPA 1P4HA 4UPEA 4MXDA 1CK4A 3NHLA 3W9SA 5BXQC 3QSYA 4BKRA 3RUFA 4DRZA 2C2OA 2GD1O 2WHXA 5LQNA 3Q5EA 4MQ6A 2Y1FA 1IHPA 4OFWA 5T7BA 4RVNA 1N0IA 4QVKA 3VZPA 1ZSYA 5IH3A 4D9HA 4P3YA 3V8BA 2EG5A 5A7HA 3CPEA 4OU5A 1FQJA 5CXXA 5HTKA 3TEFA 1RHMA 4JVOA 4S12A 4RJIA 4EJMA 5EWMB 4L15A 3EEBA 2QRZA 1QHHB 1U2DA 1YUMA 1O0CA 1G7RA 3JXEA 1RM4A 4BNDA 3HE3A 2P0YA 5LZ8A 2A0FA 4BFCA 4EG8A 1CF4A 4AWBA 1NVWQ 1X7GA 2CLIB 2OK7A 2VA9A 3L5OA 3HDVA 2RH9B 3T1TA 2J4FA 4EUSA 3QWFA 2XDQB 3ZDZB 1CC1S 3DGEC 4QGBA 3GFRA 4X8LA 2J9FA 1R4MA 1FSSA 1E4OA 2HCRA 4GC5A 4IRUB 3ORFA 2Y77A 4CM3A 4YMGA 1SULA 3HMKA 3L92A 4ROTA 4PG8A 2CNOA 2L2QA 4FILA 1JR3A 3WRXC 5FLXA 1Z3CA 1C7RA 2C2HA 5CVUA 4CODB 2DHCA 1K6MA 1PWHA 5I4CA 3EUAA 3FUCA 1XEFA 2DLCX 5DCYA 3C8MA 1IB6A 2IVFA 3X2FA 3WK9A 4G4IA 5F9MA 4ZI7F 2ZM6B 5DTJA 3IJPA 1QQ5A 5EYPA 2QVBA 4ZVNA 5ALYA 2GKOA 3S7TA 3C3YA 4MAMA 1PKEA 2C42A 2CLSA 2CHFA 3GHYA 5ALRA 5F7ZA 3VR5D 1JI0A 4D99A 4DJJA 1GZUA 3OF5A 2GM5A 2PNJA 2BONA 2EX4A 4JU8A 3R7AA 3NVKI 4LHYA 1F0KA 3SLRA 3R6WA 1NXTA 1BCRA 3UMSA 3EMKA 1Y3FE 1M6YA 1SY7A 2Z2JA 5AD1A 3ACBA 3PA8A 3O3NB 5JDCA 1AA6A 2C5BA 3B78A 4GSLA 1XDDA 5D3MB 4BS9A 3ES9A 3UG7A 4ALKA 4QPJC 3VU3A 3L0BA 3QFSA 1WXGA 5JPDA 4HBZA 5AFSA 1DBPA 2R8ZA 3MF4A 4RSMA 4RY2A 1H2WA 4Z0PA 1GVHA 4TT3A 3MRTA 4N03A 1J0DA 1MP0A 3HP7A 1PS9A 1USIA 4BNNA 2PD6A 3AF2A 2NMVA 3QI7A 4BKPA 3O6VA 4CV1A 3WDLA 2X6RA 4GQAA 1D2HA 4P7FA 3FF4A 2WJJA 1M1NB 5AWFC 3RRNA 1W5AA 1P5ZB 3JQ6A 3N0RA 4JUIA 1NYQA 4NKRA 4NCAA 5EINA 1RYEA 1FFXA 2GFQA 1PLKA 4RPJA 5AKLA 4Z54A 1RMQA 2GEJA 3L05A 1VSTA 3W2FA 4LW8A 5I4BA 2HJGA 5HFAA 1AO3A 3WK8A 4GPD1 2HHCA 4RK0A 7REQA 4WY2A 2R68A 2VPWA 3ZBUA 3I5XA 2O52A 1JLSA 2QRVA 1VL6A 5EP1A 1PRYA 3M6VA 4AJKA 2BM1A 2Z9DA 3IR7A 1WXHA 3PHBE 1QFSA 9LDTA 2I76A 4PSUA 2VSQA 6ADHA 4KR0A 3RIMA 2NXWA 2DXIA 3AUTA 4I4TF 4PYKA 5COAA 4D3ZA 4HV4A 4M0KA 4P7JA 2BKVA 2CGEA 4UC0A 4EP1A 1N6HA 3CXRA 1L1RA 1CSEE 4L50A 4DSNA 2FXIA 2KI5A 1JE0A 5CNMA 4Q39A 4TLAA 3RQSA 5DCWA 1S3IA 2F4NA 3ME5A 4LY3A 4Q9NA 4MQLA 2ZB4A 5E38A 5CLGA 5AUQA 4GOXA 4GP7A 4PTLA 5DEOA 3CN7A 4CV2A 2I91A 4EARA 1W8IA 3EE6A 4NNJA 4C7VA 3TQHA 1XE3A 4BY9E 3HCCA 2FEPA 4R1QA 3MS2A 1VSBA 2FN9A 4PANA 5KJ1A 4ZKDA 3LUBA 4JKIA 2GK3A 1TQHA 4YROA 5JYCA 3VM6A 1B74A 4XRRA 2AMFA 2ZJZA 3EXHC 1XKQA 4RAQA 1CJVC 2X58A 2H5LA 3LT5A 1VHJA 3BXOA 4AY6A 4X91A 3L4BA 2PBFA 4URHA 1RYYA 3T3EA 3AKCA 4NV1A 4DMRA 1E4VA 1U0JA 1M1UA 3QPDA 2A84A 1QTNA 1HQYE 1FP4B 1GR1A 3DWEX 4ME6A 1TUGA 1GTG1 1OGJA 3M9XA 4LEIA 3NR2A 3G2IA 2QZSA 3SLKA 1Z73A 3URMA 1UF9A 2WSBA 2P3QA 1AQIA 3I1YA 4MQEB 1XDWA 3C3KA 1F8UA 4G5GA 2OLJA 4BO7A 3GJ4A 4F56A 2VPXA 1DOZA 5J4HA 2COKA 1JEYB 4MAFA 1Y8RA 4M0CA 1OT5A 4UCQA 1SXJB 2PN1A 2XQJA 1SBYA 4OHOA 4KACA 4OX9Y 4M1MA 3KO8A 3AX6A 3K9QO 2YV5A 4N49A 2CVQA 2AOVA 4Z49A 4L72A 4S1WA 3ZWVA 1GJRA 2Q21A 2LKCA 1D2MA 4BTEA 3QRWA 2PMKA 4KZKA 3WAGA 1J8DA 3G1WA 2WJGA 5H3CA 3SX4A 1C9NA 1L1QA 4X1KB 1XWWA 3O9VA 2PL3A 4FE3A 1WV1A 5B57C 5F51A 1U98A 3M6MD 3TW4A 2IDKA 1IYZA 2HD4A 3G9ZA 2E49A 2XYPA 1GGFA 3IHTA 2WJWA 5LYJF 2NVWA 1ESZA 3D3NA 2H2WA 5ALJA 5LCXA 1UKZA 3JPWA 3ZHTA 3HB0A 1G42A 3WB1A 3CRNA 4B2YA 1FYXA 4DREA 1U7PA 4M49A 4FEGA 4I4LA 2VJOA 3TQRA 3VR5A 3G82C 4CIAA 2IUTA 1EVYA 2HJRA 5EQFA 3WNQA 5CEJA 2EL7A 5IJ0B 3PXCX 4WNAB 4XLTA 2J87A 2O57A 4RIHA 3U37A 1UK7A 1V3QE 3LIIA 4RTQA 3G1TA 3L4SO 2VCEA 2Y0CA 5CBPB 5CG1A 1RABA 1H05A 2BVNA 2G9RA 3TBFA 3K1ZA 4JUBA 2H4WA 2G9UA 4UKDA 5FBWB 3GJYA 3PLAE 1W0CA 1Y34E 2HMSA 2ZI3A 4AQYB 4F4HA 2WFMA 4TKLA 5JAPA 1P3Y1 3PBKA 4NLLA 1N1GA 1T9ZA 2WDZA 2ZE7A 3GMTA 2ZJ6A 4ZAGA 3TTYA 3HVHA 3ND8A 4J0IA 3D7LA 3DWIA 1AH2A 1V6SA 1RI1A 4HQLA 4MUFA 4POOA 4PWYA 1LX7A 2DFDA 2XKJE 3W8FA 4X7RA 1G5RA 3UW1A 1M75A 2RHOA 3AEUB 4PQFA 2AOWA 5DHTA 3ZV3A 1SC1A 5KNDH 3GPCA 2PUCA 2A5DA 3N1UA 1OTXA 2VJDA 5LKAA 2G5GX 2A58A 4DLUA