4RHJA

Crystal structure of wild-type t. brucei arginase-like protein in a reduced form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
289
Chain Sequence
SHMFSKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDFFLQSPRDCDHYAELTIHDKGPIECPPETVMFMPVLNCGQMLDEAAGTETPTSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFPSDDIVIVHFSARPSVSDPRSPLRVLLDKGLLKGVVSVGNRQVSSEDRKVRKLHKMFYMDMRDIRNDYPVFISIDASVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDVYRKDNVGLTAIALSKIIKEGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase
publication title Crystal Structure of an Arginase-like Protein from Trypanosoma brucei That Evolved without a Binuclear Manganese Cluster.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Unknown function
total genus 82
structure length 289
sequence length 300
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4rhjA00
4G3HA 3MFWA 4GSMA 1GQ6A 1TA1A 4Q3RC 2EIVA 2PHAA 1PQ3A 4Q3RA 4Q3TA 1WOGA 1RLAA 4MXRA 2PHOA 4Q3PA 1D3VA 1XFKA 4IXUA 4Q40A 4IXVA 3GMZA 5HJAA 3SKKA 3E6KA 1HQ5A 3NIPA 4ITYA 4RHIA 3CEVA 4FCIA 4GSVA 1HQFA 1R1OA 4MYNA 1HQGA 3NIQA 3GN0A 1WOHA 1TBHA 2CEVA 3DJ8A 3THJA 4RHKA 5CEVA 2AEBA 3PZLA 1P8MA 4GWCA 2ZAVA 4RHJA 1T5FA 4DZ4A 4IU0A 3THHA 4HZEA 4MYKA 4Q3SA 1P8RA 3E6VA 2EF5A 4Q42A 5RLAA 1WOIA 4IU5A 1T4PA 3E9BA 3SJTA 3F80A 4IU1A 4Q3VA 4CEVA 4Q3QA 1ZPEA 1P8SA 1HQHA 1ZPGA 4Q3UA 1CEVA 4MYFA 4Q41A 3KV2A 5HJ9A 1TBJA 3NIOA 3SL0A 3SL1A 3TF3A 4MYLA 3LP4A 4IE3A 1P8PA 3E8QA 4I06A 3MJLA 1TBLA 3MMRA 2A0MA 3TH7A 4RHMA 4IE1A 4HXQA 3THEA 3E8ZA 2PLLA 3M1RA 1T5GA 2EF4A 2RLAA 3LHLA 1GQ7A 3MFVA 1P8QA 4IU4A 4GSZA 1T4TA 4RHQA 1HQXA 4IE2A 3RLAA 1WVAA 4HWWA 1T4RA 4FCKA 1T4SA 3LP7A 1WVBA 1P8OA 1P8NA 4RHLA 4RLAA 4GWDA
chains in the Genus database with same CATH superfamily
4G3HA 4QA1A 3MFWA 4GSMA 2V5XA 4BZ5A 5EF8A 1GQ6A 4QA4A 1TA1A 5G0GA 4BKXB 4Q3RC 2EIVA 2PHAA 1PQ3A 4Q3RA 4Q3TA 1WOGA 1RLAA 5EFGA 4MXRA 3MZ4A 5G10A 3ZNSA 2PHOA 3MENA 4Q3PA 1D3VA 5G12A 1XFKA 4ZUPA 1VKGA 4IXUA 4Q40A 4IXVA 5G1CA 3GMZA 5HJAA 3SKKA 3SFFA 5JI5A 3E6KA 1HQ5A 3NIPA 4ITYA 5G1BA 4RHIA 3CEVA 5EEFA 4RN0A 5D1CA 3EZPA 4QA2A 4FCIA 5G0IA 4BZ8A 4GSVA 2V5WA 5G1AA 4QA5A 1HQFA 1R1OA 3C0YA 4MYNA 1HQGA 3NIQA 3GN0A 4CQFA 4QA3A 1WOHA 1TBHA 2VCGA 5G0HA 2CEVA 3DJ8A 3THJA 4RHKA 5CEVA 2AEBA 2GH6A 2VQJA 4ZURA 3PZLA 1P8MA 4GWCA 4RN2A 2ZAVA 5G0JA 4RHJA 1T5FA 3F06A 4IU0A 3EWFA 3THHA 4DZ4A 5ICNB 4HZEA 3Q9CA 1ZZ3A 3C0ZA 4MYKA 4Q3SA 1P8RA 5G0XA 3E6VA 4CBYA 2EF5A 5EENA 4CBTA 4Q42A 5RLAA 3MZ7A 4QA6A 5FUEA 5D1BA 1WOIA 4IU5A 1T4PA 5EFKB 5G0YA 3E9BA 3SJTA 5IWGA 3Q9BA 3F80A 4IU1A 3ZNRA 3MZ6A 4Q3VA 5EEKA 4CEVA 4Q3QA 5DC5A 1ZPEA 5LI3A 2VQOA 4ZUOA 1P8SA 1HQHA 4ZUNA 2VQMA 4LXZA 1ZPGA 5G17A 4Q3UA 5DC6A 4LY1A 5THUA 5THTA 4BZ7A 1CEVA 4MYFA 4Q41A 3KV2A 5G13A 5HJ9A 1TBJA 1W22A 3NIOA 3SL0A 5IX0A 3EZTA 3SL1A 3TF3A 4BZ9A 4QA0A 4A69A 4MYLA 3LP4A 1T69A 1C3RA 3Q9FA 5FCWA 4ZUQA 4IE3A 1P8PA 3E8QA 4ZUMA 5EFHA 3F07A 1T67A 3MJLA 4I06A 1TBLA 3MMRA 2A0MA 1C3SA 4RN1A 1ZZ0A 5THVA 3MZ3A 1ZZ1A 2VQVA 5EEIA 3TH7A 5DC8A 5EFBD 3SFHA 4RHMA 5EEMA 4IE1A 3EW8A 5EFJD 4HXQA 3C10A 5EFNA 3THEA 1C3PA 3E8ZA 2PLLA 2VQQA 3M1RA 1T5GA 2EF4A 2RLAA 3LHLA 1GQ7A 3MFVA 3RQDA 5THSA 5D1DA 1P8QA 4IU4A 5BWZA 4GSZA 1T4TA 4RHQA 1HQXA 4IE2A 3RLAA 1WVAA 4HWWA 1T4RA 2VQWG 4FCKA 5G11A 4BZ6A 5DC7A 3F0RA 1T4SA 1T64A 3MAXA 5EF7A 4QA7A 3LP7A 5G3WA 1WVBA 1P8OA 1P8NA 3Q9EA 4RHLA 5A2SA 4RLAA 4GWDA
chains in the Genus database with same CATH topology
4G3HA 3MFWA 4GSMA 1GQ6A 1TA1A 4Q3RC 2EIVA 2PHAA 1PQ3A 4Q3RA 4Q3TA 1WOGA 1RLAA 4MXRA 2PHOA 4Q3PA 1D3VA 1XFKA 4IXUA 4Q40A 4IXVA 3GMZA 5HJAA 3SKKA 3E6KA 1HQ5A 3NIPA 4ITYA 4RHIA 3CEVA 4FCIA 4GSVA 1HQFA 1R1OA 4MYNA 1HQGA 3NIQA 3GN0A 1WOHA 1TBHA 2CEVA 3DJ8A 3THJA 4RHKA 5CEVA 2AEBA 3PZLA 1P8MA 4GWCA 2ZAVA 4RHJA 1T5FA 4DZ4A 4IU0A 3THHA 4HZEA 4MYKA 4Q3SA 1P8RA 3E6VA 2EF5A 4Q42A 5RLAA 1WOIA 4IU5A 1T4PA 3E9BA 3SJTA 3F80A 4IU1A 4Q3VA 4CEVA 4Q3QA 1ZPEA 1P8SA 1HQHA 1ZPGA 4Q3UA 1CEVA 4MYFA 4Q41A 3KV2A 5HJ9A 1TBJA 3NIOA 3SL0A 3SL1A 3TF3A 4MYLA 3LP4A 4IE3A 1P8PA 3E8QA 4I06A 3MJLA 1TBLA 3MMRA 2A0MA 3TH7A 4RHMA 4IE1A 4HXQA 3THEA 3E8ZA 2PLLA 3M1RA 1T5GA 2EF4A 2RLAA 3LHLA 1GQ7A 3MFVA 1P8QA 4IU4A 4GSZA 1T4TA 4RHQA 1HQXA 4IE2A 3RLAA 1WVAA 4HWWA 1T4RA 4FCKA 1T4SA 3LP7A 1WVBA 1P8OA 1P8NA 4RHLA 4RLAA 4GWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G3H A;  3MFW A;  4GSM A;  1GQ6 A;  1TA1 A;  4Q3R C;  2EIV A;  2PHA A;  1PQ3 A;  4Q3R A;  4Q3T A;  1WOG A;  1RLA A;  4MXR A;  2PHO A;  4Q3P A;  1D3V A;  1XFK A;  4IXU A;  4Q40 A;  4IXV A;  3GMZ A;  5HJA A;  3SKK A;  3E6K A;  1HQ5 A;  3NIP A;  4ITY A;  4RHI A;  3CEV A;  4FCI A;  4GSV A;  1HQF A;  1R1O A;  4MYN A;  1HQG A;  3NIQ A;  3GN0 A;  1WOH A;  1TBH A;  2CEV A;  3DJ8 A;  3THJ A;  4RHK A;  5CEV A;  2AEB A;  3PZL A;  1P8M A;  4GWC A;  2ZAV A;  4RHJ A;  1T5F A;  4DZ4 A;  4IU0 A;  3THH A;  4HZE A;  4MYK A;  4Q3S A;  1P8R A;  3E6V A;  2EF5 A;  4Q42 A;  5RLA A;  1WOI A;  4IU5 A;  1T4P A;  3E9B A;  3SJT A;  3F80 A;  4IU1 A;  4Q3V A;  4CEV A;  4Q3Q A;  1ZPE A;  1P8S A;  1HQH A;  1ZPG A;  4Q3U A;  1CEV A;  4MYF A;  4Q41 A;  3KV2 A;  5HJ9 A;  1TBJ A;  3NIO A;  3SL0 A;  3SL1 A;  3TF3 A;  4MYL A;  3LP4 A;  4IE3 A;  1P8P A;  3E8Q A;  4I06 A;  3MJL A;  1TBL A;  3MMR A;  2A0M A;  3TH7 A;  4RHM A;  4IE1 A;  4HXQ A;  3THE A;  3E8Z A;  2PLL A;  3M1R A;  1T5G A;  2EF4 A;  2RLA A;  3LHL A;  1GQ7 A;  3MFV A;  1P8Q A;  4IU4 A;  4GSZ A;  1T4T A;  4RHQ A;  1HQX A;  4IE2 A;  3RLA A;  1WVA A;  4HWW A;  1T4R A;  4FCK A;  1T4S A;  3LP7 A;  1WVB A;  1P8O A;  1P8N A;  4RHL A;  4RLA A;  4GWD A; 
#chains in the Genus database with same CATH topology
 4G3H A;  4QA1 A;  3MFW A;  4GSM A;  2V5X A;  4BZ5 A;  5EF8 A;  1GQ6 A;  4QA4 A;  1TA1 A;  5G0G A;  4BKX B;  4Q3R C;  2EIV A;  2PHA A;  1PQ3 A;  4Q3R A;  4Q3T A;  1WOG A;  1RLA A;  5EFG A;  4MXR A;  3MZ4 A;  5G10 A;  3ZNS A;  2PHO A;  3MEN A;  4Q3P A;  1D3V A;  5G12 A;  1XFK A;  4ZUP A;  1VKG A;  4IXU A;  4Q40 A;  4IXV A;  5G1C A;  3GMZ A;  5HJA A;  3SKK A;  3SFF A;  5JI5 A;  3E6K A;  1HQ5 A;  3NIP A;  4ITY A;  5G1B A;  4RHI A;  3CEV A;  5EEF A;  4RN0 A;  5D1C A;  3EZP A;  4QA2 A;  4FCI A;  5G0I A;  4BZ8 A;  4GSV A;  2V5W A;  5G1A A;  4QA5 A;  1HQF A;  1R1O A;  3C0Y A;  4MYN A;  1HQG A;  3NIQ A;  3GN0 A;  4CQF A;  4QA3 A;  1WOH A;  1TBH A;  2VCG A;  5G0H A;  2CEV A;  3DJ8 A;  3THJ A;  4RHK A;  5CEV A;  2AEB A;  2GH6 A;  2VQJ A;  4ZUR A;  3PZL A;  1P8M A;  4GWC A;  4RN2 A;  2ZAV A;  5G0J A;  4RHJ A;  1T5F A;  3F06 A;  4IU0 A;  3EWF A;  3THH A;  4DZ4 A;  5ICN B;  4HZE A;  3Q9C A;  1ZZ3 A;  3C0Z A;  4MYK A;  4Q3S A;  1P8R A;  5G0X A;  3E6V A;  4CBY A;  2EF5 A;  5EEN A;  4CBT A;  4Q42 A;  5RLA A;  3MZ7 A;  4QA6 A;  5FUE A;  5D1B A;  1WOI A;  4IU5 A;  1T4P A;  5EFK B;  5G0Y A;  3E9B A;  3SJT A;  5IWG A;  3Q9B A;  3F80 A;  4IU1 A;  3ZNR A;  3MZ6 A;  4Q3V A;  5EEK A;  4CEV A;  4Q3Q A;  5DC5 A;  1ZPE A;  5LI3 A;  2VQO A;  4ZUO A;  1P8S A;  1HQH A;  4ZUN A;  2VQM A;  4LXZ A;  1ZPG A;  5G17 A;  4Q3U A;  5DC6 A;  4LY1 A;  5THU A;  5THT A;  4BZ7 A;  1CEV A;  4MYF A;  4Q41 A;  3KV2 A;  5G13 A;  5HJ9 A;  1TBJ A;  1W22 A;  3NIO A;  3SL0 A;  5IX0 A;  3EZT A;  3SL1 A;  3TF3 A;  4BZ9 A;  4QA0 A;  4A69 A;  4MYL A;  3LP4 A;  1T69 A;  1C3R A;  3Q9F A;  5FCW A;  4ZUQ A;  4IE3 A;  1P8P A;  3E8Q A;  4ZUM A;  5EFH A;  3F07 A;  1T67 A;  3MJL A;  4I06 A;  1TBL A;  3MMR A;  2A0M A;  1C3S A;  4RN1 A;  1ZZ0 A;  5THV A;  3MZ3 A;  1ZZ1 A;  2VQV A;  5EEI A;  3TH7 A;  5DC8 A;  5EFB D;  3SFH A;  4RHM A;  5EEM A;  4IE1 A;  3EW8 A;  5EFJ D;  4HXQ A;  3C10 A;  5EFN A;  3THE A;  1C3P A;  3E8Z A;  2PLL A;  2VQQ A;  3M1R A;  1T5G A;  2EF4 A;  2RLA A;  3LHL A;  1GQ7 A;  3MFV A;  3RQD A;  5THS A;  5D1D A;  1P8Q A;  4IU4 A;  5BWZ A;  4GSZ A;  1T4T A;  4RHQ A;  1HQX A;  4IE2 A;  3RLA A;  1WVA A;  4HWW A;  1T4R A;  2VQW G;  4FCK A;  5G11 A;  4BZ6 A;  5DC7 A;  3F0R A;  1T4S A;  1T64 A;  3MAX A;  5EF7 A;  4QA7 A;  3LP7 A;  5G3W A;  1WVB A;  1P8O A;  1P8N A;  3Q9E A;  4RHL A;  5A2S A;  4RLA A;  4GWD A; 
#chains in the Genus database with same CATH homology
 4G3H A;  3MFW A;  4GSM A;  1GQ6 A;  1TA1 A;  4Q3R C;  2EIV A;  2PHA A;  1PQ3 A;  4Q3R A;  4Q3T A;  1WOG A;  1RLA A;  4MXR A;  2PHO A;  4Q3P A;  1D3V A;  1XFK A;  4IXU A;  4Q40 A;  4IXV A;  3GMZ A;  5HJA A;  3SKK A;  3E6K A;  1HQ5 A;  3NIP A;  4ITY A;  4RHI A;  3CEV A;  4FCI A;  4GSV A;  1HQF A;  1R1O A;  4MYN A;  1HQG A;  3NIQ A;  3GN0 A;  1WOH A;  1TBH A;  2CEV A;  3DJ8 A;  3THJ A;  4RHK A;  5CEV A;  2AEB A;  3PZL A;  1P8M A;  4GWC A;  2ZAV A;  4RHJ A;  1T5F A;  4DZ4 A;  4IU0 A;  3THH A;  4HZE A;  4MYK A;  4Q3S A;  1P8R A;  3E6V A;  2EF5 A;  4Q42 A;  5RLA A;  1WOI A;  4IU5 A;  1T4P A;  3E9B A;  3SJT A;  3F80 A;  4IU1 A;  4Q3V A;  4CEV A;  4Q3Q A;  1ZPE A;  1P8S A;  1HQH A;  1ZPG A;  4Q3U A;  1CEV A;  4MYF A;  4Q41 A;  3KV2 A;  5HJ9 A;  1TBJ A;  3NIO A;  3SL0 A;  3SL1 A;  3TF3 A;  4MYL A;  3LP4 A;  4IE3 A;  1P8P A;  3E8Q A;  4I06 A;  3MJL A;  1TBL A;  3MMR A;  2A0M A;  3TH7 A;  4RHM A;  4IE1 A;  4HXQ A;  3THE A;  3E8Z A;  2PLL A;  3M1R A;  1T5G A;  2EF4 A;  2RLA A;  3LHL A;  1GQ7 A;  3MFV A;  1P8Q A;  4IU4 A;  4GSZ A;  1T4T A;  4RHQ A;  1HQX A;  4IE2 A;  3RLA A;  1WVA A;  4HWW A;  1T4R A;  4FCK A;  1T4S A;  3LP7 A;  1WVB A;  1P8O A;  1P8N A;  4RHL A;  4RLA A;  4GWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...