4RHMA

Crystal structure of t. brucei arginase-like protein quadruple mutant s149d/r151h/s153d/s226d
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
b'SHMFSKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDFFLQSPRDCDHYAELTIHDKGPIECPPETVMFMPVLNCGQMLDEAAGTETPTSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFPSDDIVIVHFDAHPDVSDPRSPLRVLLDKGLLKGVVSVGNRQVSSEDRKVRKLHKMFYMDMHAIYSKGLFCIRDIRNDYPVFISIDADVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDVYRKDNVGLTAIALSKIIKEGILKAYSISTHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase
publication title Crystal Structure of an Arginase-like Protein from Trypanosoma brucei That Evolved without a Binuclear Manganese Cluster.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Unknown function
total genus 109
structure length 308
sequence length 308
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4rhmA00
3CEVA 2PHAA 3MFVA 1HQHA 1D3VA 1T4TA 3MJLA 3PZLA 3F80A 4GWCA 4I06A 1CEVA 1P8MA 1WOIA 3THEA 4MYNA 2EF5A 4Q3TA 3KV2A 5HJ9A 3TH7A 3LP4A 1TBHA 1T4RA 1GQ7A 4Q3RC 1XFKA 4HWWA 3E6VA 1T4SA 1HQXA 4IU5A 3SL0A 4IU1A 4IU4A 4FCKA 5HJAA 2ZAVA 1P8RA 1R1OA 1P8PA 1T4PA 1P8NA 3LP7A 4GSMA 1TBLA 3TF3A 3GN0A 1HQGA 4RHLA 3THHA 4Q3VA 1WVAA 2PLLA 4RHMA 1P8QA 2EIVA 4IE3A 4Q3SA 4GSZA 1GQ6A 1HQFA 3E8ZA 1PQ3A 2CEVA 4CEVA 3RLAA 4DZ4A 3M1RA 1TA1A 1WVBA 1P8SA 4IE1A 5RLAA 4IE2A 1T5FA 3SKKA 4HZEA 4GWDA 1ZPEA 1RLAA 4RLAA 2EF4A 1ZPGA 4MYKA 1HQ5A 3GMZA 4ITYA 4Q42A 3NIQA 4RHQA 1T5GA 4Q3PA 3MFWA 1WOHA 2A0MA 4Q41A 3SL1A 4G3HA 4MYLA 3E9BA 4Q3RA 4GSVA 3THJA 1TBJA 4Q3QA 3E8QA 4RHKA 2RLAA 3DJ8A 2PHOA 4RHIA 5CEVA 4HXQA 3E6KA 4RHJA 3NIOA 3SJTA 4IXVA 4Q3UA 1P8OA 1WOGA 4MYFA 4MXRA 4FCIA 2AEBA 4IU0A 3NIPA 3MMRA 4IXUA 4Q40A 3LHLA
chains in the Genus database with same CATH superfamily
3CEVA 2PHAA 3MFVA 1HQHA 5EFBD 1D3VA 1T4TA 4LXZA 5THVA 3MJLA 1C3SA 3PZLA 3F80A 4GWCA 2VQVA 4I06A 2V5WA 1CEVA 1P8MA 5G10A 3SFFA 1WOIA 4RN2A 3THEA 4MYNA 2EF5A 4Q3TA 2VQMA 3KV2A 4BZ5A 4QA3A 5HJ9A 3TH7A 3LP4A 1TBHA 4CBYA 1T4RA 1GQ7A 5D1BA 4Q3RC 1XFKA 4HWWA 3E6VA 5IX0A 3MZ7A 1T4SA 1HQXA 4QA7A 4QA0A 4IU5A 3SL0A 5EEIA 4IU1A 4IU4A 5EFGA 4FCKA 5HJAA 2ZAVA 4ZUPA 1P8RA 1R1OA 1P8PA 1T4PA 3F06A 1P8NA 3LP7A 1C3PA 1T69A 4GSMA 2VQQA 1TBLA 2VQOA 1ZZ3A 4QA4A 3GN0A 3TF3A 1HQGA 4RHLA 3THHA 4RN1A 5G12A 5BWZA 3MAXA 4Q3VA 1WVAA 3EWFA 2PLLA 4RHMA 3ZNRA 4BZ7A 1P8QA 2EIVA 3MENA 4IE3A 4Q3SA 5FUEA 5G3WA 4GSZA 2VQWG 1ZZ0A 5THSA 4QA6A 1GQ6A 4RN0A 1HQFA 3E8ZA 1PQ3A 2CEVA 4LY1A 2GH6A 4A69A 4CEVA 3RLAA 4DZ4A 3M1RA 3Q9EA 3EW8A 1TA1A 3SFHA 3C10A 3EZPA 1WVBA 4ZUOA 1P8SA 3F07A 4IE1A 5RLAA 4IE2A 1T5FA 3MZ4A 3SKKA 4HZEA 4GWDA 1ZPEA 5EFJD 1RLAA 3C0ZA 4RLAA 5EFNA 5G17A 2EF4A 5EENA 1ZPGA 4MYKA 5DC7A 5EEKA 1HQ5A 4BKXB 2V5XA 5G0XA 3GMZA 4ITYA 5D1CA 1T64A 4Q42A 5DC5A 3NIQA 4RHQA 4CQFA 5DC6A 1T5GA 4Q3PA 3MZ3A 5EEMA 5LI3A 4QA1A 5EF7A 3MFWA 1WOHA 4QA5A 5EFHA 5G0JA 2A0MA 5G0YA 4Q41A 3SL1A 4G3HA 4CBTA 5G13A 4MYLA 5EF8A 3C0YA 3E9BA 4Q3RA 4GSVA 5G1CA 4ZUMA 5G0IA 5IWGA 1VKGA 3THJA 1TBJA 1ZZ1A 3Q9CA 3E8QA 4Q3QA 4BZ8A 4RHKA 4BZ6A 2RLAA 3DJ8A 2VCGA 4ZURA 5CEVA 5EEFA 4ZUQA 5A2SA 5DC8A 4BZ9A 2PHOA 4RHIA 1T67A 5THUA 2VQJA 3E6KA 4HXQA 3NIOA 4RHJA 5D1DA 4ZUNA 3SJTA 1W22A 3EZTA 4IXVA 3Q9BA 4Q3UA 1P8OA 5G1BA 1C3RA 5THTA 5EFKB 1WOGA 4MYFA 3RQDA 5ICNB 4MXRA 4FCIA 4QA2A 3ZNSA 5G0HA 5G11A 2AEBA 4IU0A 3NIPA 3F0RA 3MMRA 5G1AA 5G0GA 3Q9FA 4IXUA 5FCWA 3MZ6A 4Q40A 5JI5A 3LHLA
chains in the Genus database with same CATH topology
3CEVA 2PHAA 3MFVA 1HQHA 1D3VA 1T4TA 3MJLA 3PZLA 3F80A 4GWCA 4I06A 1CEVA 1P8MA 1WOIA 3THEA 4MYNA 2EF5A 4Q3TA 3KV2A 5HJ9A 3TH7A 3LP4A 1TBHA 1T4RA 1GQ7A 4Q3RC 1XFKA 4HWWA 3E6VA 1T4SA 1HQXA 4IU5A 3SL0A 4IU1A 4IU4A 4FCKA 5HJAA 2ZAVA 1P8RA 1R1OA 1P8PA 1T4PA 1P8NA 3LP7A 4GSMA 1TBLA 3TF3A 3GN0A 1HQGA 4RHLA 3THHA 4Q3VA 1WVAA 2PLLA 4RHMA 1P8QA 2EIVA 4IE3A 4Q3SA 4GSZA 1GQ6A 1HQFA 3E8ZA 1PQ3A 2CEVA 4CEVA 3RLAA 4DZ4A 3M1RA 1TA1A 1WVBA 1P8SA 4IE1A 5RLAA 4IE2A 1T5FA 3SKKA 4HZEA 4GWDA 1ZPEA 1RLAA 4RLAA 2EF4A 1ZPGA 4MYKA 1HQ5A 3GMZA 4ITYA 4Q42A 3NIQA 4RHQA 1T5GA 4Q3PA 3MFWA 1WOHA 2A0MA 4Q41A 3SL1A 4G3HA 4MYLA 3E9BA 4Q3RA 4GSVA 3THJA 1TBJA 4Q3QA 3E8QA 4RHKA 2RLAA 3DJ8A 2PHOA 4RHIA 5CEVA 4HXQA 3E6KA 4RHJA 3NIOA 3SJTA 4IXVA 4Q3UA 1P8OA 1WOGA 4MYFA 4MXRA 4FCIA 2AEBA 4IU0A 3NIPA 3MMRA 4IXUA 4Q40A 3LHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEV A;  2PHA A;  3MFV A;  1HQH A;  1D3V A;  1T4T A;  3MJL A;  3PZL A;  3F80 A;  4GWC A;  4I06 A;  1CEV A;  1P8M A;  1WOI A;  3THE A;  4MYN A;  2EF5 A;  4Q3T A;  3KV2 A;  5HJ9 A;  3TH7 A;  3LP4 A;  1TBH A;  1T4R A;  1GQ7 A;  4Q3R C;  1XFK A;  4HWW A;  3E6V A;  1T4S A;  1HQX A;  4IU5 A;  3SL0 A;  4IU1 A;  4IU4 A;  4FCK A;  5HJA A;  2ZAV A;  1P8R A;  1R1O A;  1P8P A;  1T4P A;  1P8N A;  3LP7 A;  4GSM A;  1TBL A;  3TF3 A;  3GN0 A;  1HQG A;  4RHL A;  3THH A;  4Q3V A;  1WVA A;  2PLL A;  4RHM A;  1P8Q A;  2EIV A;  4IE3 A;  4Q3S A;  4GSZ A;  1GQ6 A;  1HQF A;  3E8Z A;  1PQ3 A;  2CEV A;  4CEV A;  3RLA A;  4DZ4 A;  3M1R A;  1TA1 A;  1WVB A;  1P8S A;  4IE1 A;  5RLA A;  4IE2 A;  1T5F A;  3SKK A;  4HZE A;  4GWD A;  1ZPE A;  1RLA A;  4RLA A;  2EF4 A;  1ZPG A;  4MYK A;  1HQ5 A;  3GMZ A;  4ITY A;  4Q42 A;  3NIQ A;  4RHQ A;  1T5G A;  4Q3P A;  3MFW A;  1WOH A;  2A0M A;  4Q41 A;  3SL1 A;  4G3H A;  4MYL A;  3E9B A;  4Q3R A;  4GSV A;  3THJ A;  1TBJ A;  4Q3Q A;  3E8Q A;  4RHK A;  2RLA A;  3DJ8 A;  2PHO A;  4RHI A;  5CEV A;  4HXQ A;  3E6K A;  4RHJ A;  3NIO A;  3SJT A;  4IXV A;  4Q3U A;  1P8O A;  1WOG A;  4MYF A;  4MXR A;  4FCI A;  2AEB A;  4IU0 A;  3NIP A;  3MMR A;  4IXU A;  4Q40 A;  3LHL A; 
#chains in the Genus database with same CATH topology
 3CEV A;  2PHA A;  3MFV A;  1HQH A;  5EFB D;  1D3V A;  1T4T A;  4LXZ A;  5THV A;  3MJL A;  1C3S A;  3PZL A;  3F80 A;  4GWC A;  2VQV A;  4I06 A;  2V5W A;  1CEV A;  1P8M A;  5G10 A;  3SFF A;  1WOI A;  4RN2 A;  3THE A;  4MYN A;  2EF5 A;  4Q3T A;  2VQM A;  3KV2 A;  4BZ5 A;  4QA3 A;  5HJ9 A;  3TH7 A;  3LP4 A;  1TBH A;  4CBY A;  1T4R A;  1GQ7 A;  5D1B A;  4Q3R C;  1XFK A;  4HWW A;  3E6V A;  5IX0 A;  3MZ7 A;  1T4S A;  1HQX A;  4QA7 A;  4QA0 A;  4IU5 A;  3SL0 A;  5EEI A;  4IU1 A;  4IU4 A;  5EFG A;  4FCK A;  5HJA A;  2ZAV A;  4ZUP A;  1P8R A;  1R1O A;  1P8P A;  1T4P A;  3F06 A;  1P8N A;  3LP7 A;  1C3P A;  1T69 A;  4GSM A;  2VQQ A;  1TBL A;  2VQO A;  1ZZ3 A;  4QA4 A;  3GN0 A;  3TF3 A;  1HQG A;  4RHL A;  3THH A;  4RN1 A;  5G12 A;  5BWZ A;  3MAX A;  4Q3V A;  1WVA A;  3EWF A;  2PLL A;  4RHM A;  3ZNR A;  4BZ7 A;  1P8Q A;  2EIV A;  3MEN A;  4IE3 A;  4Q3S A;  5FUE A;  5G3W A;  4GSZ A;  2VQW G;  1ZZ0 A;  5THS A;  4QA6 A;  1GQ6 A;  4RN0 A;  1HQF A;  3E8Z A;  1PQ3 A;  2CEV A;  4LY1 A;  2GH6 A;  4A69 A;  4CEV A;  3RLA A;  4DZ4 A;  3M1R A;  3Q9E A;  3EW8 A;  1TA1 A;  3SFH A;  3C10 A;  3EZP A;  1WVB A;  4ZUO A;  1P8S A;  3F07 A;  4IE1 A;  5RLA A;  4IE2 A;  1T5F A;  3MZ4 A;  3SKK A;  4HZE A;  4GWD A;  1ZPE A;  5EFJ D;  1RLA A;  3C0Z A;  4RLA A;  5EFN A;  5G17 A;  2EF4 A;  5EEN A;  1ZPG A;  4MYK A;  5DC7 A;  5EEK A;  1HQ5 A;  4BKX B;  2V5X A;  5G0X A;  3GMZ A;  4ITY A;  5D1C A;  1T64 A;  4Q42 A;  5DC5 A;  3NIQ A;  4RHQ A;  4CQF A;  5DC6 A;  1T5G A;  4Q3P A;  3MZ3 A;  5EEM A;  5LI3 A;  4QA1 A;  5EF7 A;  3MFW A;  1WOH A;  4QA5 A;  5EFH A;  5G0J A;  2A0M A;  5G0Y A;  4Q41 A;  3SL1 A;  4G3H A;  4CBT A;  5G13 A;  4MYL A;  5EF8 A;  3C0Y A;  3E9B A;  4Q3R A;  4GSV A;  5G1C A;  4ZUM A;  5G0I A;  5IWG A;  1VKG A;  3THJ A;  1TBJ A;  1ZZ1 A;  3Q9C A;  3E8Q A;  4Q3Q A;  4BZ8 A;  4RHK A;  4BZ6 A;  2RLA A;  3DJ8 A;  2VCG A;  4ZUR A;  5CEV A;  5EEF A;  4ZUQ A;  5A2S A;  5DC8 A;  4BZ9 A;  2PHO A;  4RHI A;  1T67 A;  5THU A;  2VQJ A;  3E6K A;  4HXQ A;  3NIO A;  4RHJ A;  5D1D A;  4ZUN A;  3SJT A;  1W22 A;  3EZT A;  4IXV A;  3Q9B A;  4Q3U A;  1P8O A;  5G1B A;  1C3R A;  5THT A;  5EFK B;  1WOG A;  4MYF A;  3RQD A;  5ICN B;  4MXR A;  4FCI A;  4QA2 A;  3ZNS A;  5G0H A;  5G11 A;  2AEB A;  4IU0 A;  3NIP A;  3F0R A;  3MMR A;  5G1A A;  5G0G A;  3Q9F A;  4IXU A;  5FCW A;  3MZ6 A;  4Q40 A;  5JI5 A;  3LHL A; 
#chains in the Genus database with same CATH homology
 3CEV A;  2PHA A;  3MFV A;  1HQH A;  1D3V A;  1T4T A;  3MJL A;  3PZL A;  3F80 A;  4GWC A;  4I06 A;  1CEV A;  1P8M A;  1WOI A;  3THE A;  4MYN A;  2EF5 A;  4Q3T A;  3KV2 A;  5HJ9 A;  3TH7 A;  3LP4 A;  1TBH A;  1T4R A;  1GQ7 A;  4Q3R C;  1XFK A;  4HWW A;  3E6V A;  1T4S A;  1HQX A;  4IU5 A;  3SL0 A;  4IU1 A;  4IU4 A;  4FCK A;  5HJA A;  2ZAV A;  1P8R A;  1R1O A;  1P8P A;  1T4P A;  1P8N A;  3LP7 A;  4GSM A;  1TBL A;  3TF3 A;  3GN0 A;  1HQG A;  4RHL A;  3THH A;  4Q3V A;  1WVA A;  2PLL A;  4RHM A;  1P8Q A;  2EIV A;  4IE3 A;  4Q3S A;  4GSZ A;  1GQ6 A;  1HQF A;  3E8Z A;  1PQ3 A;  2CEV A;  4CEV A;  3RLA A;  4DZ4 A;  3M1R A;  1TA1 A;  1WVB A;  1P8S A;  4IE1 A;  5RLA A;  4IE2 A;  1T5F A;  3SKK A;  4HZE A;  4GWD A;  1ZPE A;  1RLA A;  4RLA A;  2EF4 A;  1ZPG A;  4MYK A;  1HQ5 A;  3GMZ A;  4ITY A;  4Q42 A;  3NIQ A;  4RHQ A;  1T5G A;  4Q3P A;  3MFW A;  1WOH A;  2A0M A;  4Q41 A;  3SL1 A;  4G3H A;  4MYL A;  3E9B A;  4Q3R A;  4GSV A;  3THJ A;  1TBJ A;  4Q3Q A;  3E8Q A;  4RHK A;  2RLA A;  3DJ8 A;  2PHO A;  4RHI A;  5CEV A;  4HXQ A;  3E6K A;  4RHJ A;  3NIO A;  3SJT A;  4IXV A;  4Q3U A;  1P8O A;  1WOG A;  4MYF A;  4MXR A;  4FCI A;  2AEB A;  4IU0 A;  3NIP A;  3MMR A;  4IXU A;  4Q40 A;  3LHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...