4RHV3

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 40
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rhv300
1VB2A 1AR73 1ND2C 4YVSC 1EAH3 4CDXC 1MEC1 1QJX2 5L7OC 1TMF1 4RR3A 1OOPA 1RHI1 1RUD1 4RR3B 1AR62 1VBC2 5J96B 4IV1A 1C8M3 4IV1B 4CEYA 3DPRA 1NCRC 1NG0A 1QJX1 2R072 4GH4C 4CDQC 4RFT0 1SMVA 4CEYB 1AYM1 3DPRB 4CDWA 1B35B 1WCDJ 1QJY2 1AR61 4CEWA 1VBC1 2HWB3 1POV0 4CEWB 1K5MC 2RS12 1QJZA 1VBE3 2R062 1NCQA 5BNNA 2R071 1ND3C 1NCQB 5BNNB 2Y26A 2HWE2 1QJY1 2PLV2 2TBVA 4RHV2 4FSJA 2R061 5C8CA 5ACA3 1RVF3 1W39A 2HWE1 4Q4V3 4Y4YA 1AR72 2PLV1 4RHV1 4CDUB 4LLFA 1EV11 1EAH2 1HQNA 4Q4Y3 5C4WA 1AR71 1F8VA 1EAH1 5AC92 5GKAC 5BNOC 4RS5C 3HAGA 2HWB2 1MEC3 1TMF3 1VBE2 5AC91 3ZFGC 3M8LA 1RUD3 3CJIC 1VAKA 2HWB1 1AYM3 1AL22 1VBE1 5ACA2 5CFDC 1R1A3 5D8AC 1VBC3 3J8F2 5L7OA 1OPOA 1Z7S2 4WM8C 5L7OB 1R092 4RQPA 4JGZC 1BBT2 4RQPB 4JGYC 3VBSA 1AL21 4AEDA 3ZFFC 5ACA1 4Q4Y2 4AEDB 1QJY3 4GH4A 4CDQA 3J8F1 1Z7S1 4NWVA 4GH4B 1E57A 1FPN2 4CDQB 1R091 3JD71 2R063 1CD3G 1BBT1 3TN92 1RUC2 1M06G 1K5MA 1NY72 1K5MB 1RB8G 4Q4Y1 1FPN1 2DF7A 4QPGC 1DDLA 1EV13 1H8TC 4GB33 3TN91 1RUC1 1NY71 2RMU3 3ZXAC 1RUD2 3LOBA 5A32A 5A32B 4GMP1 1AYM2 1RUJ2 3VBRA 1NOVA 1R1A2 3VBRB 1HRV3 5CFCC 5JZGC 1COV2 2XBO1 3FBMA 2HWC3 3ZFEC 4WM7C 1PVC3 5AC93 1D4M1 2WFF1 1RUJ1 1B35A 2HWD3 2GH8A 1R1A1 2ZZQA 5BNOA 1COV1 4RS5A 1RUI3 5BNOB 4RS5B 1ZBA2 4IV3A 3VBOC 4IV3B 1NA1C 1VBB2 3ZFGA 3ZFGB 3CJIA 1QQP3 4N53C 3CJIB 1AL23 1EV12 1ZBA1 3JBG2 4GB32 3VBUA 1IHMA 3VBUB 3J8F3 2RMU2 1Z7S3 2HWF3 1VBB1 1R093 3JD73 3VBHC 4CDUA 1FOD3 1BBT3 4WM8A 3NAPC 5ABJC 4WM8B 3JBG1 4N43C 4GB31 4JGZA 3JB4C 4YVWC 4JGZB 2RMU1 1FPN3 5C9AC 1HRV2 3VDDA 3TN93 1ZBE3 1RUC3 5DDJ2 2HWC2 3VDDB 5FMOL 1PGW2 1PVC2 1AR93 1OHFA 2WS92 1GFF2 2HWD2 2ZTNA 1ASJ2 1HRI3 1HRV1 1QJU3 1R082 5DDJ1 2HWC1 4RR3C 1RUI2 1OOPC 1PGW1 4GMP3 4QPGA 2FZ2A 1PVC1 4QPGB 2IZWA 2WS91 2BFUL 2XBO3 2HWD1 1ASJ1 4Q4W3 1ND2A 1R081 4CDWC 1D4M3 1QQP2 1RUI1 2WFF3 1ND2B 4YVSA 1RUJ3 4CEWC 1HXS2 4YVSB 4CDXA 4CDXB 2HWF2 1COV3 1NCQC 5BNNC 3JD72 5CFCA 1FOD2 5JZGA 2RS53 3ZFEA 1QQP1 5CFCB 5A33A 5JZGB 3ZFEB 4WM7A 1HXS1 1VBA3 5A33B 4WM7B 1NCRA 5LK7B 1NCRB 2HWF1 5C8CC 2BPA2 1ZBA3 1FOD1 1ZBE2 4Q4X2 1VBB3 1MQTC 1AR92 1ND3A 1POV3 3VBOA 1NA1A 1ND3B 3VBOB 1NA1B 3JBG3 1HRI2 5C4WC 1QJU2 1ZBE1 5J98B 1RUH2 5K0UC 4Q4X1 4N53B 1AR91 1X33A 1RMU3 4PDWC 2XBO2 1HRI1 4Q4W2 4FTEA 1QJU1 1AYN2 1D4M2 1RUH1 2WFF2 5ABJA 4N43A 5ABJB 4N43B 4YVWA 4YVWB 5DDJ3 5C9AB 4Q4W1 2GSYA 1AYN1 2RS52 2WS93 1PIV3 1VBA2 2R043 1VBD3 1ASJ3 1R083 2WWSA 2RS51 2MEV2 4FTBA 4RQPC 1VBA1 1OOPB 2XPJA 1BEV3 1V9U2 3VBSC 4AEDC 4NWWA 1TME2 1BMV2 4EJRA 1HXS3 2MEV1 4SBVA 4CDWB 5CFDA 2RM22 2WLPA 1V9U1 1POV1 4QPIC 1RMU2 2RR13 3IDEA 5D8AA 5CFDB 5D8AB 2BBVA 1BMV1 1TME1 1VRH3 1RUF3 1RUG2 1RUE2 5FOJB 3VBFC 4JGYA 3ZFFA 5BNPC 2X5IC 2RM21 4JGYB 1VB4A 1HX6A 2WZR3 1RMU1 3ZFFB 2RS11 5FMOS 1X36A 5C8CB 1RUG1 1RUE1 4Q4X3 2RS32 1PO13 1PIV2 1MQTA 2R042 1VBD2 1AR83 1MQTB 2ZAHA 3VBRC 1RUH3 1C8NA 1PO23 1PGL2 1H8TA 2RS31 1H8TB 2BFUS 4IV1C 5K0UA 5C4WB 4BCUA 1PIV1 1FMD3 5K0UB 4CEYC 1BEV2 1VBD1 2R041 3DPRC 1B35C 4PDWA 1C8M2 1AYN3 4PDWB 1PGL1 1BEV1 4IV3C 2RR12 4Y5Z0 1C8M1 3S6PA 1VRH2 1RHI3 1RUF2 3VBUC 1QJX3 2WZR2 2RR11 4Z92B 2MEV3 1VRH1 1RUF1 1CJDA 1AR63 2FZ1A 4CDUC 1RVF2 1PO12 1V9U3 4Q4V2 1AUYA 1AL0G 1F2NA 1TME3 2R073 3JB8A 1AR82 2WZR1 1A6CA 3VBSB 4N53A 1PO22 3VDDC 1RVF1 2RM23 1PO11 4Q4V1 2RS13 1FMD2 1AR81 4QPIA 1RUG3 1RUE3 3VBHA 2BUKA 4GMP0 4QPIB 3VBHB 4FTSA 3NAPA 1PO21 2HWE3 3NAPB 2PLV3 2QQPA 2VQ0A 4RHV3 3VBFA 1FMD1 3VBFB 5BNPA 2X5IA 1MEC2 5C9AA 5BNPB 2RS33 2X5IB 1TMF2 1RHI2
chains in the Genus database with same CATH superfamily
1VB2A 3SCGA 1AR73 5I8SA 1WMEA 5FO7B 5JXGA 2JDUA 3EBRA 1UYYA 3K3NA 4AVSA 4P9WA 5JOZA 3KLSA 2VO5A 2GNBA 5DZGA 5CKQA 3C7FA 4LE3A 4KH9A 4QHOA 4MGZE 5IUQA 4CTEA 5L7OC 1O8SA 1X50A 4XF1A 4KWKA 3KCXA 4XF4A 2D43A 3KZ4C 1UU6A 4A3XA 1QXPA 2NPIA 5FO9B 1OLMA 1Z0HA 3AZZA 4BMEA 1W8OA 1FI2A 3SMHA 3H3ZA 2FD8A 1W03A 4AFBA 3DPRA 3T30A 4CEYA 4OCTA 5K8SA 4CDWA 3OJBA 1PGSA 5FK8A 2V5YA 4DXTA 1QJY2 5I8YA 1QOSA 1F9KA 3T2PA 4AQSA 5EZWA 2J1EA 3I2IA 1OLRA 2GC2A 3Q8EA 4B7KA 4DPNA 1VBE3 1MACA 4MLOA 4CE8A 1GNHA 5HXMA 4QXCA 2NP0A 3ES4A 1NCQB 2JWPA 4HK9A 5DAWA 4B3NA 1PZ9A 2NM1A 3FHQA 1VPHA 1LULA 2B42B 4QDRA 1S2KA 2HWE2 5BPXA 3N9LA 3NJYA 4DNYA 1LB2A 1CZSA 4MG2A 3V65A 4OHVA 2R061 1N1VA 1VE0A 5ACA3 3NW4A 3O0XA 5FP4A 4ZY9A 4CP9A 4ZS2A 2YFZA 5KHJA 1JI6A 1RVF3 1VAVA 2PHUA 1SFYA 3B7MA 3ZMOA 1BK0A 2JE8A 3VZNA 2WNVC 1DYPA 2BZDA 5A3PA 4RHV1 5A70A 4LLFA 2EALA 2LRPA 1EAH2 3VD4A 1UZVA 1HQNA 3THDA 4OHYA 3WP6A 3LSEA 4BXFA 1I5PA 3RQ0A 3KSCA 5L19A 3EB7A 3A7QA 3ZYFA 2HBTA 4PF1A 3TB0A 1GV9A 2RG4A 3TRSB 2PAKA 3SKJE 1CAXB 1TZOA 1OUXA 2TNFA 3HPNA 1XJAA 1H30A 2XGXA 2XHKA 2XB6C 3A0KA 2Q8DA 3EQEA 4HOOA 2GC3A 2PYTA 4EZ4A 1JHNA 3NNFA 4S2HA 5GKAC 2D97A 2V09A 4BHPA 3RDIA 3UKVA 1GNZA 5IVBA 1XYOA 4RFRB 1HB3A 1YFWA 2OXBA 1VIWB 4PI2A 2C24A 3MLJA 5AC91 4BLIA 1DLLA 2C4XA 2J42A 3M8LA 2RDRA 4BIFA 1XB9A 1YI7A 3IWZA 2VUDA 4TN7A 1VAKA 1X7NA 4IEUA 2ZBJA 2AH2A 3GCWA 2VJXA 4E4HA 5FY4A 5CKNA 4XTPA 3Q8FA 1W6NB 4URTA 1R1A3 3J8F2 3AP4A 1Z7S2 3ITQA 3P1IA 4WM8C 3KV5A 4XOGA 4EN8B 4LBOA 4RQPA 3WCSA 1C28A 3MIFA 3M3IA 1CX1A 1X82A 4MO3M 1WD3A 4CCDA 1F4HA 4JGYC 1AL21 3CKHA 5F3IA 2DUQA 3PVEA 2LW8A 4AEDA 4DINB 4E2GA 5A80A 2E53A 5A3UA 2VW2A 1U5ZA 4CDQA 1ZRIA 4GH4B 1FPN2 3ZN5A 4CPBD 1JYNA 3JD71 1H8VA 1RJ8A 2R063 3FC0A 1LJ7A 1WW7A 2D5FA 3WNNA 2CSGA 3E6DA 4XDQA 2QCSB 3A23A 3ZIWA 4B1LA 5IVCA 1UKRA 1K5MB 4QPWA 1O91A 3DXUA 5DG2A 2A6VA 4XUPA 1A34A 3JCIA 3WT3A 1QDCA 2PHRA 5DAVA 2I07B 1ENQA 2WYSA 3B94A 4GB33 4XFFA 1RUC1 4R9DA 1NY71 1QDOA 2XVGA 2OZJA 3IMNA 2YU2A 3LEMA 4CUGA 4I3GA 2QJVA 2VNGA 2D3SA 3LOBA 5E6HA 1G9FA 1AX2A 3H1WA 3ZN6B 2P3KA 1CAUA 4NAOA 4YG0A 4AHXA 2QNKA 3LA7A 4HVQA 5A32A 2C0ZA 3LWCA 2DYCA 3K4ZA 3ZYJB 1JW6A 4JKLA 5FKBA 3VBRA 4BQWA 3PTYA 4OHWA 3NSTA 4ARXA 3RZKA 2FDFA 2V4VA 4CU9A 3OF1A 1UZZA 1E5HA 2J1AA 3B01A 4J6GA 3ON7A 4FQZA 4PHZA 3ZFEC 1OMIA 5JMOA 3BUCA 3K46A 2ZHNA 2OPWA 5AC93 4D7TA 4MGYE 1YQ6A 3O1UA 4MZUA 2WFF1 2OUJA 1VRBA 3AX4A 1OC1A 3DECA 5DABA 3I2OA 5F5AA 1JXNA 4M0HA 3QOPA 2UWAA 1OFNA 1V00A 2QKDA 1FNYA 1HB4A 1COV1 1BZWA 3NJXA 3MEPA 1RUI3 4INDA 4UI9L 5DXDA 4AI0A 4AVCA 2JB4A 3MW3A 1H9PA 2PTMA 3H7YA 1EP0A 1DGWX 1AX0A 1T6GC 1JU3A 3DYPA 2D6MA 4P9JA 3T0AA 4LBNA 4LIUA 5FJHA 1GWKA 4WVZA 1GQGA 1N1YA 1G7YA 3AP7A 1ULDA 1SZBA 5GM0A 4W8JA 3RVHA 3ZXLA 4LNVA 3N35A 4MXWB 2D5HA 1QQP3 2VUCA 3CJIB 1AL23 3JBG2 3MPBA 2YFUA 3BN6A 1K5JA 4NMIA 4Y22B 3WDWA 3ZM8A 4HKWA 2BBAA 2GNDA 3LFMA 4XFAA 4BOWA 2RMU2 2HWF3 1VBB1 4QGMA 3WDUA 4Z82A 2EIBA 3JD73 3VBHC 4CDUA 4MGQA 1JYCA 3V0BA 2WZ8A 5CKMA 2DURA 2J22A 1ULEA 2VZ1A 1NT0A 4K40A 4JGZA 1UPIA 1VLNA 1REEA 2XLAA 4ZPIA 5BV6A 2ET7A 2Y6GA 3C7GA 4I30A 2WC2A 2GAUA 2ZCWA 2IC1A 3FFZA 4Q0VA 2OUHA 2I74A 3F95A 3VDDA 4DZGA 1RUC3 3LA2A 5DDJ2 3J7NA 2LTNA 1ALYA 3TOJA 3O0WA 5JR7B 2J7MA 4AVVA 2AREA 1UY1A 2JDNA 3U37A 1XBFA 2V73A 4IQPA 2VCBA 5A3WA 1JZ8A 4QKNA 2NLRA 1HRI3 2E32A 4FPCA 5H9QA 3VN4A 1UY4A 1W3VA 2GC0A 1R082 4IEPA 5A1FA 2HWC1 4RR3C 2XG3A 3OBRA 5F5QA 3P6BA 3MIBA 4HN0A 3I2HA 4QPGA 4B29A 3VKNA 4CCOA 4AL9A 2WN2A 3DKWA 1W90A 3O5SA 4P9IA 3SITA 2WS91 2FDKA 2OIIA 3RZGA 4AZZA 2R16A 2QVSB 5FPZA 4HKOA 5CADA 1QF3A 3POFA 1ND2A 3RZHA 2ZX1A 2WFF3 1J84A 2H6BA 4XUTA 4CEWC 3SKVA 4CDXA 1BVVA 1JHJA 2YDEA 3IAQA 2E7TA 4RN5A 5C5UA 4BK4A 1COV3 3T0BA 4L2NA 2P6CA 4QD2A 1LEDA 2VZVA 1UQXA 5JZGA 5EV7A 2RS53 1GLHA 3TEYA 1S0IA 4WM7A 3H8RA 3B9IA 2A6YA 2JDAA 5A33B 3N7LA 3LEKA 4FXKB 3BI3A 3HBKA 1YFUA 1AHSA 1Q5OA 1C1LA 5FV3A 5JSOA 5LRSA 5CG8A 5IVJA 1WKYA 4META 1OFSA 2QZ2A 2PHLA 4XURA 5FZHA 5M0TA 2WA4A 3PHMA 4PF5A 2W1QA 3J4UH 4M3CF 4UBHA 4EWDA 1VBB3 1YWKA 1VALA 1OA4A 4G3YC 5FBJA 3ZSMA 2FHRA 1ND3A 2B45X 1G9AA 1LOFC 4H2AA 5KHKA 3VBOB 3MIHA 3LOIA 2DCYA 3DXTA 1CAWA 2RJKA 3PIJA 4XXAA 4AI3A 4XQDA 5C4WC 5F37A 1ZBE1 2PMWB 4QWNA 5J98B 3VDAA 5IYYA 4IERA 1QEXA 1AR91 5KXCA 4XF9A 5FMCA 1X33A 1UOGA 4XQ4A 4LO6B 3ZX7A 3OUJA 2YROA 1WCQA 5D21A 2IXJA 4DXRA 3I2FA 1UD1A 1MS4A 5GZGA 2VY0A 3WINE 2W1UA 1D4M2 2W9XA 1WLCA 2WNVB 4QX7A 5D1IA 1GOFA 1W9WA 3N36A 3PUSA 1YFYA 5ABJB 2ATFA 3B3QE 4NE9A 4N43B 4YVWA 2VECA 3IIIA 1FXZA 2E51A 4HSJA 3VKFC 4FO9A 3UJQA 2GMEA 4GWIA 5GALA 2ENRA 5KWRA 4Q4W1 3AJZA 2GSYA 2EIDA 5GZFA 2WS93 5FPBA 1HLCA 3OY8B 2PN5A 2C6SA 2GP5A 4MGKE 4YGCA 1WLDA 5FYVA 1NLRA 3AKQA 3AYCA 4PJYA 1H9WA 5LEKA 1HN0A 2WWSA 1N47A 1U12A 5I0SA 3AXDA 1OQEA 5L9VA 4W6YA 1W6MA 4S2FA 4CXXA 2ET1A 5A3OA 3C7OA 3HMYA 4FTBA 2VMDA 4LHSA 4XC9A 2I45A 4NHXA 4ZZ8A 4MUVA 5JSRA 2A73B 2Z5WA 4PQQA 1I6XA 1LTEA 1IS4A 4XIKA 1EUUA 2WZEA 4XFCA 4NPRA 5T5PA 2ZHKA 3S0MA 4D6QA 1W6PA 4SBVA 2C9KA 4IESA 4CDWB 2XKPA 2W52A 5CFDA 4A7YA 1LHUA 1V9U1 2CV6A 1RMU2 4P08A 2EAAA 1AXYA 4W6WA 1TME1 1VRH3 5DQ0A 1QJEA 5J1XA 3B93A 1T6BX 3OUHA 1Y9QA 3PURA 1QH6A 1HV0A 4A2UA 4JGYB 3BPSA 1HX6A 2WZR3 3HEIA 4B8EA 2QBXA 2DDUA 2PFWA 4UW6A 4A4AA 5FQ0A 5LEJA 5IVYA 1AXZA 4Q8LA 1RUE1 2RS32 4PLOA 2DUPA 2JIGA 4HXCA 3N7MA 4GWMA 5LBEA 4COYA 1W0NA 5F2WA 3OYWA 4DO0A 1YYNA 1MQTA 4LIVA 2ZGPA 1AR83 4CCJA 2R0FA 2BEOA 2W1SA 4CSWA 4YGBA 1H8TA 2W1WA 1V6MA 2YG0A 2E31A 3NV4A 2Z4FA 1UF2C 3POGA 2J1UA 3MIEA 5K0UA 1J58A 2VNRA 4OYUA 4QB2A 5HCBA 2Y38A 5A7NA 3RSJA 2R041 1VBD1 2EA7A 2VZ3A 4PLNA 5BNQA 1C8M2 1PMIA 5T54A 2DVAA 4PDWB 2DV9A 2VAUA 1H4HA 2YZ4A 4UWDA 4XCAA 4I2OA 1ZZ7A 2VCAA 3VV1A 3WP4A 4R52A 1N1SA 3KT4A 5TSWA 5F32A 2ERFA 3DYMA 1GYKA 3UYJA 3M4FA 1BEV1 1WWYA 4IV3C 1DQ0A 4R4XA 4A7KA 2RR12 4LKFA 4H55A 2QQUA 3FMGA 3S6PA 5FZOA 4GQ7A 5JVVA 1RUOA 3ORJA 3T4VA 2ZGKA 5A7WB 3C8XA 3LKJA 2OX0A 4PI0A 3RRDA 4AI8A 2GNTA 3BB6A 3PVNA 1JZ6A 4U2AA 3C7EA 1W2OA 3MFCA 2VR4A 2YC2A 2ZMKA 4NRQA 3VBUC 2XWJB 3O7OA 3NMBA 2A5ZA 2Y0IA 2Q1MA 4Z92B 4OUEA 2Y6FA 2G19A 4Y20A 1RUF1 3AYAA 1CJDA 3ZYRA 1CGPA 2FZ1A 3MIDA 5ANNA 1IZ3A 4XVHA 3AZVA 3IBMA 1PO12 1FAYA 1V9U3 1E5RA 4CP2A 4AEMA 4R9CA 4KWJA 1AL0G 4XJAA 3RYRA 3UJOA 5FZFA 1TME3 2WIIB 2VVDA 4XF0A 2BNOA 4CZSA 3AL5A 2JG8A 1C5HA 1LR5A 4N53A 5T5LA 3KF3A 2BVBA 3S7EA 3K4AA 5GZEA 1VMFA 3T08A 3MIGA 3O1OA 3DEMA 3FZ3A 1FMD2 2WZPP 2MPFA 1UOBA 1ENSA 5LB6A 3BOWA 4IGPA 1DGWA 5FYHA 2YBKA 1RUE3 4WVVA 4AE2A 1FX5A 4BIOA 2BUKA 4GMP0 3VBHB 4FTSA 5HV0A 1GWLA 1PO21 2HWE3 3OD4A 1A8MA 5FRAA 3HWJA 4LLOA 4XEZA 1JYVA 1JYXA 2XJQA 3LDBA 1REFA 4NUBA 4TYSA 2X5IA 1MEC2 3VBFB 5C9AA 1KDKA 3LA3A 3AXEA 2PQQA 4PLMA 1SLIA 2VXRA 4DQAA 4UT5A 2YXSA 3CF6E 1RHI2 2YBSA 5FP8A 3SCHA 1GZWB 4OFGA 4YVSC 1CPMA 2HBUA 2BQPA 4XJUA 1EAH3 2ZGMA 3FUOA 3JQWA 2ARXA 4HVRA 3VB9A 2CY6A 2BWCA 2PHFA 2DCZA 2NMOA 3KV9A 3OGJA 4OUMA 4COUA 1JTZX 2RJ2A 4H7LA 4RR3B 1AR62 1VBC2 5J96B 3C3VA 1WA4A 4TLGA 4URAA 3MO4A 5JIUA 1W0OA 2Z42A 3HNBM 1YXWA 4LR4A 4IV1B 2O8OA 5IFPA 1NCRC 1Q43A 1QJX1 1YLLA 3P3NA 4GH4C 4DS0A 1SMVA 3ZXDA 5FY5A 3WEZA 1H2MA 4DRRA 4HN1A 2IVIB 4HBNA 4Q0PA 4Y5SA 5E88A 5I91A 4CEWB 1K5MC 3NO8A 2RS12 1QJZA 1OT5A 2XHNA 2E7QA 4K6BA 3TEZA 5BNNA 2R071 1W6QA 4ASLA 3O1TA 5FZCA 4XAAA 3VL9A 2E63A 3OCPA 5FY0A 3EO6A 5LBBA 3KWVA 2PLV2 5GLWA 2CHHA 4LK7A 2TBVA 3K75B 3WDYA 4FAHA 4XILA 4RL7A 1PM4A 4DXZA 5C8CA 4FSJA 4AI2A 2R1DA 2IXLA 4QHZA 1XRUA 1ZVFA 3WNOA 1MS1A 3ES1A 4Y4YA 4GAZA 4ZZ5A 3NV1A 3SHRA 4YM1A 4YGEA 1IS3A 2G4IA 3K4DA 4P9GA 3GJAA 3WV6A 4CDUB 3V0BB 2VOKA 5LBFA 5JI9A 1TVGA 5JCTA 5T52A 5CG9A 4BB3A 3PUHA 3HNYM 3APBA 3LZZA 4FFGA 3ATGA 1H0BA 3U1XA 3W5NA 3D5OA 4HZFA 4AFDA 2EXHA 4MH0E 3U10A 1QH7A 1MPXA 1AR71 3IM0A 1WMDA 3C7HA 1F8VA 2D6NA 1OH3A 2ZACA 3ZXJA 2B9VA 5AFBA 3I2DA 4WVMB 2HEYF 1OKOA 4ES9A 1H2LA 3WW3A 3WQ1A 2SLIA 4C8DA 1KFXL 5A3LA 1UX7A 2B8MA 2UWCA 5FZMA 3UK9A 3BALA 1RITA 2PAMA 1CN1A 3HAGA 4BYYA 2X10A 5JR2A 5EWSA 1FT9A 4ATFA 2HWB2 4DB5A 1WBLA 1SCRA 3MLKA 1GQHA 5A7PA 2D6OX 1H1MA 3WF2A 2FDGA 2XQXA 5FLJA 3Q8BA 3CJIC 3Q8CA 5FWJA 4AW7A 1BCXA 4JQTA 4M4PA 1O4YA 2PXJA 3LQCA 4J1XA 4Y1VA 5FXZA 2XXZA 1YQCA 1L3JA 4K3UA 2UURA 3TYJA 1QNWA 5GLTA 4NAMA 3LDKA 1VBE1 3KGZA 1S0EA 1WLTA 4JTOA 3VD5A 1BJQA 4CU8A 5EIYB 4L9BA 5L7OA 2D93A 4G9SB 5CAZA 2JG9B 1FATA 1HQLA 1SG3A 3BKZA 1US2A 2ZOEB 4DOUA 4RGAA 1W6OA 1YHFA 3LAGA 5ACA1 4W4ZA 4BQYA 4Q4Y2 1PMHX 2XJRA 3DUIA 2B4KA 4PCRA 2RDQA 1ODNA 4AQ6A 5FKCA 3I7DA 4S2GA 3SEPA 2D6PA 1R091 1KJRA 1BBT1 5DAQA 3TN92 2TUNA 5JSPA 4LBQD 3USUB 1OVPA 4EN9B 5DZEA 4OMDA 3PIGA 1RB8G 1MZ6A 3U75A 1IS5A 4CCMA 4IGQA 4CUCA 1LOCA 2EAKA 4C90A 1QU0A 4YG6A 5B4NA 5CA6A 1ULPA 3SH3A 3POIA 2Q8CA 3IPVA 4YM2A 4LKEA 2GDFA 2HH9A 5JUVA 4JHZA 2Q8EA 2DVBA 1HW5A 1PM7A 2MNGA 2RMU3 2ZJCA 2WWUA 2ZKNA 4FP3A 5FREA 4IE5A 2BGPA 4YW2A 4UF0B 4LO5B 3WG1A 2F4PA 5FK7A 2XJUA 5G05L 1D0HA 2DU1A 2XH6A 3GYDA 3ZR5A 2A7AA 1AYM2 1RUJ2 2WNUB 3SH4A 3WX5A 2CGOA 3FFQA 3GZAA 3WDXA 4FFIA 3ST7A 1UNBA 4MHUA 2E9QA 2FMYA 2IWGB 1IPJA 1RXFA 3GHNA 2OT7A 2MHFA 1XOYA 4OULA 3AP9A 2AZ5A 3RNSA 1F15A 1D4M1 1EY2A 1U0AA 1UMZA 3U0ZA 4YRDA 1SEFA 4XPVA 3UT0A 1R1A1 2VD7A 5JOYA 2W5FA 2ZZQA 5FZGA 2A3XA 2W92A 5BNOB 2XLFA 4RS5B 1ZBA2 4IGOA 2VZOA 3WNLA 3POYA 4QX3A 5FZ8A 4D0QA 5FZ4A 2A6WA 2W2IA 3VBOC 3OBTA 1V6JA 3KS7A 4IV3B 4XETA 5F5CA 3P3PA 4NIGA 4AWDA 1CONA 1OURA 2QQVA 5L73A 3ZFGB 3WHUA 4AF9A 3FBYA 3OPZA 1CAVB 2JDHA 2ZKLA 2A6XA 3H42B 5C7GA 4I09A 3AFGA 2AYHA 2CDPA 2LALA 3I3BA 3VBUB 5LZ6A 2ZGRA 5F39A 4E4SA 3IIAA 3VZLA 1R093 2XUMA 1IQAA 4XMIA 1BBT3 4WM8A 2Y60A 3M3QA 5ABJC 2BNMA 5IJRA 5LCWL 3D4KA 4N43C 4GB31 1TNFA 3UKTA 4DY3A 2O14A 4X6RB 3RFRA 1HRV2 1LCLA 1NQDA 1LAJA 2YMZA 4FT8A 5FMOL 1PGW2 2BV4A 2VBDA 3O0VA 1PVC2 2WUHA 4V2VA 4UOJA 4DIQA 3DKQA 4JHTA 1S0CA 5JOWA 3AMQA 4P9XA 1O3SA 3P5BA 2VOWA 4LBQA 2HWD2 5IK8A 2QQOA 4I02A 1ASJ2 3U78A 1EUTA 4G4FA 5APAA 3R6SA 2JKBA 1JOJA 2D7FA 4XDOA 3EHKA 2FZ2A 1RJ7A 4QMAA 1GQPA 3ZYPA 4LBLA 4M3CB 5CNAA 2P4EA 4K1ZA 4XZUG 4Z1VA 1R1ZA 5FY7A 4MGTA 2BFUL 5JXIA 3HJRA 3MI8A 4FOVA 2E6VA 4N7IA 3POWA 4LKDA 4UFMA 1DZRA 1FYUA 3TNPB 3HR9A 3ZSLA 1WW4A 1SDDB 1UY0A 2V4AA 4CDWC 2HEWF 1D4M3 1RUI1 4GJYA 3BCWA 4CA9A 5KXDA 3D0SA 3H1MA 1HXS2 4YVSB 5C3QA 1LNSA 5EYYA 4XJWA 5A6QA 4IEQA 3SC7X 5FP9A 2ZHLA 1FOD2 1NYWA 1UN1A 4ES8A 1SPPA 2BGOA 3ZFEA 1QQP1 3AP5A 5CFCB 1JZ5A 3WP5A 5FZOB 4HPKB 1MS5A 1E5SA 2VC9A 4NHLA 3ZR6A 1WD4A 5F7UA 3O1MA 3OOXA 5LK7B 1ZA7A 1NCRB 2HLEA 2HWF1 4P5HA 3VD3A 1APNA 2RVAA 3I4IA 4QM8A 2ZGTA 3WCRA 3WNKA 4HONA 3WDTA 4QX5A 1GP5A 3ZXKA 5I8TA 4Q0QA 4NROA 4WZCA 3BTYA 2HYKA 2JDZA 4UFKA 5K4LA 2VVFA 1UIKA 3V0AB 1KFUL 2HEVF 3N9NA 2VW1A 4Q4X2 1V6IA 5EJZB 3RZLA 1POV3 2FDJA 5DG1A 3SQOA 1NA1B 5KHGA 2ARBA 4Y3OA 1XPWA 2VUAA 1QJU2 5G04L 1SFNA 5FZ9A 4ZKTB 3RS6A 3G6JB 2ZGLA 1RUH2 5F3EA 5IK5A 1PZ7A 4ISQA 4N53B 1YFXA 2WO3A 4QKDA 4HFSA 5JMCA 1RMU3 1XE7A 4PDWC 3VKLA 4MGIE 5T3NA 2RDSA 2Q1ZB 5H9SA 4D94A 1JZ2A 1HRI1 5A7SA 4DMIA 4F3JA 1EPWA 2VOTA 1OBNA 3MLLA 3AC0A 2RDNA 3TNQA 4M4RA 2C9AA 1W06A 3PLQA 2XJTA 2ORXA 2DVDA 1DGLA 3SLIA 1YQ2A 2LROA 2VZQA 3AYEA 2VW0A 3L2HA 5C9AB 1OA2A 4KL1A 4LO4B 1AYN1 5AVAA 5FZ7A 1J1TA 1CVNA 4HETA 1CESA 1VBA2 3NQHA 3BU7A 4XJ9A 3N4MA 2DCKA 2FDIA 1QXRA 3KV6A 2EICA 3BIEA 4V2WA 1GSLA 1J83A 1X9PA 4XF3A 4I01A 3WW1A 3MV01 2ARAA 4FPFA 1S0DA 2RS51 1W8UA 4RQPC 3WP3A 2P17A 1R64A 5IK4A 1D0GA 4OHXA 2F4LA 2EVXA 3FLPA 4R8HA 3HNMA 5JIAA 2UY8A 4AEDC 2GP3A 4FOWA 4I0WB 4XW3A 2GN7A 2XONA 5I0UA 4NWWA 4E2QA 1BMV2 5FYYA 1C4RA 4J1WA 2CWSA 5FPXA 1AF9A 2MEV1 4D69A 3MICA 3WUDA 4XFGA 5J7MA 1NKGA 4X8PA 4BQ1A 2RM22 3NNJA 3AP6A 5FPUA 1HDKA 3GZUC 5D8AA 3IDEA 2RR13 4Y1ZA 3HBZA 2K0GA 3W58A 3ENRA 3GF6A 2EIEA 1T2XA 2VTXA 2XDVA 3WY6A 1RUNA 2O8QA 1KGYA 4FCAA 3WF4A 3WXPA 5C3PA 3VBFC 1O59A 5J36A 4WV8A 2VMEA 3ZFFA 2F6BA 2GN3A 3ILFA 4YW3A 2PA7A 3S30A 5C71A 4GULA 1E5IA 2RS11 4NIHA 2CGNA 1ODMA 1ACCA 2FQPA 1PK6B 1X36A 2ZGQA 2Q8OA 4CXWA 5C8CB 1ENRA 2VL4A 1RUG1 2W0XA 4IEYA 2JXAA 3I54A 2SBAA 4CPBA 3TEWA 1PO13 3HVDA 1PIV2 2FCUA 1SFPA 4LOTA 2Y64A 2ZAHA 2QQIA 1LOFA 2DCTA 4MXVA 4LITA 5IW0A 3VBRC 3MFAA 3VZKA 1PGL2 3KV4A 4EYUA 1WGPA 2QUOA 4ASKA 1KDMA 1WW6A 3MPPG 3WQ7A 4IV1C 3GALA 2ORZA 1DF0A 1FMD3 2GU9A 3CU7A 1WCKA 4QAWA 4UW3A 4XZPA 4YZ2A 3QD6A 1N1TA 3LFIA 2BNNA 1AYN3 1J3PA 4BZ4A 5KXEA 1Q56A 1UOJA 4FI9A 1JZ7A 2PELA 1AXKA 1UIJA 2IUWA 4CP1A 1QOTA 2VG9A 4FVVA 4YSFA 1ZRDA 3PUIA 2W91A 2ES3A 1H4GA 1VMHA 2J1SA 4Q1PA 3J7LA 3HOBA 2VMIA 3BIWE 1XYPA 3JXSA 1RHI3 3HT2A 4JZRA 5KHHA 4LO7A 5HPOA 5FPLA 1LRHA 3IDCB 1S55A 1MR5A 2EF6A 2WO1A 3HD8B 4A6OA 1S2BA 4ZONA 1ULOA 1WCSA 2J1VA 3RMXA 2ZHMA 5EYXA 2MEV3 1VRH1 3AL6A 3W59A 4TTGA 1AR63 4CDUC 3MUY1 3I59B 1S2EA 5SV8A 1RVF2 3OB8A 3RWKX 1BVP1 1RL3A 3O1VA 3MF6A 2CAUA 3PDQA 3HN1A 1ZX5A 5K9YA 3JB8A 2WZR1 2CAVA 3VGIA 1C3HA 1BXHA 1SBFA 2GC1A 3CZUA 2BWAA 4OLLA 4D8MA 4IEOA 1F5FA 3VDDC 3PVOA 4AVAA 1FNZA 3L9JT 3KHBA 4JAAA 4LK6A 4Q4V1 5A3TA 2RS13 1LGBA 5KXBA 1NQJA 1W99A 1SLBA 2RHPA 4J25A 3BU0A 1AR81 2YPJA 3CEWA 5FXXA 1RUG3 4YW6A 4BWOA 2P1BA 5JXHA 1JYTA 1O3TA 4QPIB 2UWBA 1H1IA 1LENA 3NAPA 1N3PA 4KU8A 3NJVA 4TXWA 4QQHA 1G6NA 2PLV3 3FLRA 4UYBA 4ET7A 2VQ0A 1UYPA 4IEWA 3CQOA 3KB5A 4E4DX 3LEIA 2EXJA 5GZCA 2BOIA 4YLZA 2QQMA 5F6KA 5BNPB 3LPGA 4KBZA 5DN2A 5CZKA 1WZXA 2IFRA 1GKBA 1OD5A 2JKXA 1ND2C 3GNEA 2VMFA 1ST8A 1LOAA 1UOFA 5LK5A 1A8DA 4FP2A 4H3WA 4UFHA 5F3CA 5DAPA 3KVBA 2OQ7A 5SV5A 4CDXC 3ZVXA 4QQOA 2AC1A 3HQRA 3L2YA 5IFTA 3ZXEA 4QKBA 5DAXA 1TMF1 4BXSV 2WFPA 5F5IA 4BH9A 4AG4A 1ZRFA 1OOPA 2JG9C 1JBCA 3E5XA 2IXHA 3OD0A 4EROA 2JE9A 4NRPA 2CU5A 1VP6A 1DYOA 1MZEA 1XNDA 3W9AA 4DY5A 3LSDA 4Z2WA 3I3EA 1SBEA 5GJ6A 2UY9A 1AYM1 3DPRB 4CEYB 3PU3A 2D3PA 4XBLA 1OSGA 1WCDJ 3I8TA 4UW5A 2HWB3 1NXD1 1HQWA 4B1MA 4CVUA 1W8FA 2RV9A 5LW9A 3NKTA 3BTZA 2HKXA 2R062 3WQBA 1IOAA 1D4VB 1NCQA 4N8MA 3OUIA 4FBFA 3PUQA 1ND3C 4GWJA 2Y26A 5FZLA 1IG3A 1GANA 4ISRA 4W6XA 5J09A 1QJY1 3ZOIA 1Q8VA 4RHV2 4HKLA 4AEJA 4D7YA 4FPLA 4K8FA 4PIXA 5IAVA 1SHWB 1KQRA 2KR2A 3M70A 3OGVA 3MGUA 5FUPA 4CP9B 4LO8A 2VQAA 2HWE1 4Q4V3 5CIRA 4HK8A 5A3MA 1CZVA 2WNUC 1TQ5A 4XUOA 2FDHA 2WLQA 1IPSA 1GOGA 3PUAA 4DUVA 5C6CA 5I0RA 4Q4Y3 4RD7A 1DBNA 2JD9A 1YUDA 3WUCA 3SXWA 1SDWA 2XKOA 4TZDA 4QGLA 1ZNPA 4K8RB 1UKGA 5A3NA 1CAXA 2AR6A 3E6CC 2WRAA 4Y26A 2XVLA 1O3QA 1EAH1 1NAEA 3CNAA 2X8KA 4GZ9A 3AZXA 5AC92 1I1EA 1S1AA 2XJPA 4KWLA 4R9BA 2XJSA 2DFCA 5BNOC 4RS5C 2ILMA 2JDKA 3OTFA 3I97A 4PIYA 4BQ3A 1K12A 2ZEYA 3MV11 4M3CE 1F35A 3QBQA 1W05A 3PL0A 4QU2A 3WVJA 3WF3A 4BLJA 2QQJA 4P02B 4Q5OA 5A6YA 1TMF3 1LOGA 2ADEA 3M2MA 3ZFGC 4BA6A 3D0JA 2VULA 4SLIA 2ZGNA 5I93A 2WQZC 4XJ8A 4JTNA 1JOPA 1XSRA 2JENA 2R7EB 3T4HB 5ANQA 1KITA 2VU9A 3BOPA 4CUAA 4L97A 1W6NA 2J1TA 1LEMA 1AYM3 1AL22 2FBEA 5H9PA 5CFDC 3M7AA 1JH5A 4C0BA 2BTVC 2W46A 2Y33A 4AQTA 5HCAA 4IETA 4YW1A 5ERLA 4MADA 3R05A 2A71A 4K20A 2BVVA 1NZIA 4KU7A 1GZ9A 4RQPB 3M1HA 3CIHA 3J9SA 4IEVA 3VBSA 4E9KA 3KVAA 3FJSA 3K77A 4DUWA 2YYOA 4AEDB 1QJY3 4DFSA 4GH4A 1TNRA 2JIJA 3N9PA 3J8F1 5FYBA 2P34A 1Z7S1 4NWVA 1E57A 2BRTA 2FCVA 4CDQB 1W9TA 4COWA 4AQ2A 2LUWA 1CD3G 2H0VA 4JKMA 2WBKA 1DP0A 1RUC2 2NN8A 4FFHA 2W68A 1K5MA 1NY72 1YNAA 3VLBB 3HQXA 3BPZA 1VR3A 3IKWA 3TAYA 3MYXA 3ETPA 1FPN1 4QQLA 3ZIXA 4BQ2A 1DDLA 5FOBB 5J3UA 1H8TC 4CU7A 2WO2A 3H3UA 3SEEA 5A7QA 3O1SA 3AKSA 1ZA4A 5FCCA 5FPAA 4OI2A 3V64A 1XC6A 1QJFA 3ZXAC 5BXXA 3ZN6A 4JVAA 2AACA 1RUD2 3PMSA 5CU1A 1XSQA 5CBLA 1WMFA 2X05A 4QQ2A 5EFUA 5EXOA 3OSDA 1CAUB 1KD7A 4Q26A 2VBPA 4XQWA 3BYWA 5A32B 3T2TA 2ZGUA 3PVBB 2RE9A 1Y9GA 2ZA9A 4UBGA 1HRV3 3NV3A 3VBRB 5CFCC 2BYVE 1LHNA 1COV2 3FBMA 1CIYA 2DCJA 5JPNB 2DVGA 1PVC3 2E33A 4CXYA 4NHKA 4FPYA 2A1XA 2BERA 1ZZBA 1B35A 4LHKA 4LJHA 1Y7BA 2WAAA 3INAA 2HWD3 3E97A 1W9FA 2GH8A 2GZWA 4O9EA 2B5HA 1XNAA 2D40A 4CRQA 5FYSA 4RA0A 1JU4A 5FWEA 1HB2A 1GBGA 4FPHA 1NA1C 1VBB2 5L36A 5DUXA 1GICA 4JV4A 4MXWA 4C91A 5FZBA 1GR3A 2XOMA 3CJIA 1Q3EA 4N53C 3IDAA 4Y22A 3ZKUA 4BK5A 1EV12 3DCQA 4KI5M 4Q1RA 5FR3A 1L7RA 4OZXA 4MYEA 1WLWA 1CQ9A 1W9YA 2KD7A 2VXJA 3H3LA 4AI9A 1W04A 4CYDA 1IHMA 1UXZA 3J8F3 4NIAA 1Z7S3 3LEGA 4BQXA 5EHDA 2XVKA 5FYIA 3K51A 3ZXGA 2Y34A 1FOD3 3CDZB 5FZ0A 4BQ4A 3H9AA 3JBG1 1I3HA 5BY5A 4GALA 3RYPA 1XU2A 3JB4C 4YFZA 2DFBA 4JGZB 1K42A 2K2SA 1D2QA 2DBIA 2QDRA 2RMU1 1FPN3 1WW5A 3M3OA 4H7MA 4JCKA 4KG0A 1SQ4A 4Y1UA 5C9AC 1G9DA 3ZSJA 4AGGA 2NMNA 3ZKYA 1W28A 1REDA 2HWC2 2P2KA 3VDDB 2WSVA 1Q8PA 2BP6A 4CCNA 5GLZA 1QNYA 1OHFA 3KD4A 4YZ5A 3ZYIB 3MW2A 2WS92 3FX3A 1HN1A 3FHIB 4LBMA 1CPNA 3SCFA 4EWAA 5I0DA 4B7EA 1QJU3 3WG2A 4CCCA 5DDJ1 4IXLA 1BKZA 5IK7A 5A6ZA 3UGHA 5T50A 3T2OA 3UNPA 3MHZA 4QPGB 2IZWA 2WAOA 3SH5A 4O61A 1W2NA 4QX1A 1OH4A 3VDBA 2BOJA 1N3OA 5FYZA 2D6KA 1O4ZA 2Y6HA 3PNAA 1GP6A 1R081 1H2KA 2XQRA 1LGCA 4FAGA 1ND2B 1WMXA 5E8AA 3U4SA 3B00A 1NZCA 3LGRA 4JQRA 4LA2A 3W5MA 1PNGA 2PAEA 4CDXB 5T5OA 4DEVA 5HCHA 3WHTA 1RTVA 2W39A 1VJ2A 5BNNC 3K2OA 2E26A 1XQNA 4XUQA 5D2AA 4A42A 3VUOA 4Q0UA 4LPLA 2JX9A 2YPDA 5A33A 5JZGB 2YGMA 4Y5TA 5F3GA 1W9SA 2WT2A 1VBA3 2DTWA 4CCKA 1Y3TA 4WM7B 4EN6B 4QX0A 1PK6C 2C5DA 3ZLIA 5C8CC 1W2TA 4XBNA 4QXHA 4AR2A 1XE8A 4MV2A 1ZBE2 3HQUA 3RZJA 4FPKA 2ZMLA 4I0AA 1AR92 4D6RA 1S0GA 3VKOA 1O5UA 3VBOA 4E8CA 4R9AA 1ND3B 2YGLA 2D98A 3ZYBA 3JBG3 5FAXA 5KC5A 3AJYA 4FFFA 4RSUA 1CAWB 3KT1A 4LXLA 2W3JA 4IE7A 4IDZA 4E2SA 1SCSA 5F1RA 2WDBA 3WOGA 2GH2A 1RXGA 1YQ5A 2WT1A 4K9SA 4A6SA 1W0PA 2VQUA 2XLGA 2O1QA 2QQNA 2W95A 1ZRCA 1N3QA 2XBO2 1RYYA 2PHDA 3NRUA 1DFQA 3E1F1 4I3PA 4KNCA 4Q4W2 4UAPA 4HT1T 2WNVA 4AGRA 1YIPA 2W08A 5E89A 5FTTC 5FZEA 4XAEA 2H6CA 2Y6LA 5ABJA 1OVSA 3R4UA 3TWIA 4N43A 4XE9A 5K7PA 3I3MA 4WVWA 4MGSA 1LHWA 3NNMA 4MHRA 4YVWB 2JECA 5DDJ3 3U07A 1UMHA 1U5IA 3H0OA 4Q2FA 3FUQA 1W2AX 4Z2AA 4P00B 1XNKA 4CUBA 2R0HA 3OY8A 4U36A 4HLTA 1PIV3 4YZ3A 4COVA 2EXIA 1DHKB 4AGVA 2ZX3A 2VBBA 1J1LA 3RZZA 3ZSKA 2B9UA 1IG0A 1R083 4A45A 2G1MA 5KHIA 3JQXA 4I0BA 2ZGOA 1POQA 5DMYA 1OLME 3FWEA 4XACA 1UWWA 3IZOA 1W6MB 2CWMA 3BGAA 2ZXQA 2VNOA 4XFHA 4Y33A 4K21A 5GLVA 3ACIA 1A78A 1OOPB 3AB0A 5IVEA 4GA9A 2XPJA 3I49A 1V9U2 4BU2A 4P14A 2YBPA 3KCCA 3H50A 3NNLA 1O4TA 1KEXA 1TME2 1OLQA 2QQKA 3OBZA 3RI8A 4AVBA 4EWEA 3O12A 2WT0A 4A7ZA 3PMEA 3VDCA 1H6XA 1W6PB 3E5QA 1UY2A 1AZDA 3B5LB 5FZKA 1AX1A 3NV2A 3ZN4A 1XNBA 4Y1XA 1POV1 4QPIC 5CFDB 4LHLA 1KS5A 2PHTA 3WNMA 3ZYGA 5JDBA 1S0JA 2KA3A 1Y43B 1SLTA 1IGOA 4QHBA 4OQ9A 1RUE2 1MS8A 1QOOA 1OD3A 2WSUA 2AENA 5F6LB 4JGYA 5J48A 1CWPA 5F8PA 3C2UA 4E4ZA 2TEPA 5BNPC 2CTVA 1VB4A 1RMU1 4OUSA 1CIWA 1LGNA 2B46X 4JX0A 4XTMA 5FQ0B 2OW4A 2VTFA 5JI7A 1JUHA 3EJKA 1CR7A 2IXKA 1NLSA 1H1AA 2LM3A 1URXA 4W65A 1W8TA 1IQDC 1F4AA 4UW4A 2R042 1VBD2 3OYWB 1MQTB 1GZTA 3POBA 5L9RA 1DG6A 2ADDA 4H14A 1V6NA 1G9CA 5HI0A 2C1FA 5LA0A 2RS31 1H8TB 1V6OA 1UU4A 2H0BA 4BCUA 1YIFA 5K0UB 3MF9A 4CEYC 1BEV2 3DPRC 4FPOB 2QZ3A 4PDWA 1JN2P 3JU9A 1DGRA 4MSVA 2WNOA 4XIOA 4A41A 4UFLA 4M01A 1Y9MA 3RMYA 5B2GB 5HCFA 2VOVA 4IEZA 3DYOA 3UKNA 1ZYBA 1ULCA 4JRLA 3VZMA 4C0HA 2A6ZA 3KCYA 1DU3D 3V56A 5LY1A 1LKNA 1PNFA 2BDRA 3ILRA 2YC4A 5ISLA 1SLAA 1MZ5A 4Y5Z0 4XCBA 4NHYA 1C8M1 3VD7A 1V70A 5A7WA 2B39A 1RUF2 2ZEXA 4BM8A 5C3OA 1SACA 5FZAA 4ZXKA 5CVRA 1OXCA 4AFMA 1MZFA 2WJSA 4IL7A 2DVFA 2ZABA 1QMJA 3KQ4B 5JPMB 5JOXA 2RR11 4N9IA 3PJQA 1PX3A 4GJZA 2D3RA 1EPZA 2XUEA 3H8OA 5FYMA 4Y20B 3I2KA 5CYYA 3W21A 2R1BA 3MUZ1 4D6SA 4NOTA 4NR1A 4L0PA 2WL1A 1TE1B 4RGGA 4ZHNA 1AUYA 1L7QA 4QB1A 3RWNA 4IE0A 5IHRA 5FZ1A 3AK0A 5B4XA 3RPQA 3WQ0A 2WO7A 3VBSB 4KMQA 1PO22 4YYOA 2JG8B 2GALA 4GKYA 5DUUA 3VL8A 2XR4A 2O0OA 3N9OA 1PO11 3ZO0B 3QACA 2ZX0A 2R49A 4KBBA 4AAXA 3LIHA 4P9LA 4ZU5A 3THTA 5FMDA 3VBHA 2WWJA 4IE4A 1LHVA 5FYTA 2UYAA 2JJ6A 4K1YA 5EP9A 3I2GA 1I5ZA 3J26N 4V1PA 5JZGC 4QQPA 2QQPA 1AVBA 2WQ4A 3GBGA 4RHV3 1JZ3A 3J7MA 2DTYA 2P37A 3VBFA 1FMD1 1YRZA 1LU2A 3VZOA 2AGSA 4EQVA 5LA9A 2YY1A 3LE0A 2RS33 2X5IB 3CLPA 4MVTA 2XWBB 4EV0A 1W2UA 2BU9A 1GZWA 2VCCA 2OS2A 2WKKA 5FP7A 5FUNA 2PHWA 3OBAA 4XMAA 1LHOA 5LY2A 1MEC1 4LORA 1DIWA 1QJX2 1OF4A 1QGLA 1MVQA 3AVRA 3FHAA 4WBBA 1WCUA 3IAPA 1UX6A 1S0BA 4PIZA 1V6KA 4AI1A 4DUXA 4OI0A 4RR3A 4AXOA 2Z79A 1RHI1 3LF7A 1RUD1 4OMCA 3FL7A 3UGGA 3MBWA 3T2QA 3GBWA 2HJIA 3EMRA 3ILNA 3GBFA 4YW5A 4IV1A 1SLCA 1KS4A 1NXMA 1C8M3 1UXXX 1UZWA 2B7YA 2P6HA 4LE4A 3ECQA 2P3YA 1YI9A 2R072 1NG0A 2VZPA 3ALQA 3BODA 4NRMA 4RFT0 4YG3A 2IVJA 4CDQC 4L11A 3A0NA 2D44A 2JE7A 3ETQA 2QTWB 3PJYA 3WF0A 1JS9A 1B35B 4JRAA 4AAPA 3FLTA 3FE5A 4DEQA 1AR61 1NUKA 1VBC1 4HL0A 1POV0 4CEWA 4ITCA 4ARYA 1F31A 1NE6A 2P3IA 3H8UA 3KF5A 5AVPA 2E7AA 2ID4A 5FZ3A 4BJ0A 1UCXA 5F2SA 3GGLA 5HXVA 3R4SA 4ASMB 3Q8AA 1M4WA 3O1PA 1OQDA 2Z69A 1YEWA 5BNNB 1W6QB 5IVVA 3S57A 4FQ4A 3NL1A 4L8QA 4OVEA 4XUNA 4LOSA 1QWRA 3AZWA 5FMBA 3WG3A 2JD4A 4N9HA 3UETA 2VQTA 2W87A 5JXJA 1Z78A 4LUMA 2ARCA 2P5BA 3R4DB 1W39A 2ZEZA 1LESA 4BDVB 1C1FA 1AR72 1MS9A 2PLV1 3LIGA 5CB7A 3IDBB 2VZUA 4QXKA 2Y0OA 1EV11 1DQ6A 3CO2A 3WR0A 4AOCA 4F83A 5J37A 1IS6A 1ZRRA 4CCEA 5C4WA 1JYIA 4AFAA 4YM3A 1Y4WA 3MZHA 3OEBA 3VZJA 3OPTA 1WBFA 3AKTA 4WVMA 1QHDA 2X29A 3BTAA 3B02A 4OQ8A 1DQ2A 5FY1A 2NYYA 3ZYHA 3CJXA 1UO9A 2VMHA 3NWKA 5KBFA 4L92A 5T5JA 5T55A 1ULGA 4EN7B 1XE0A 2P3JA 1QKQA 3KM5A 3WSOA 4QB6A 3U11A 2VZRA 1MEC3 5JLVA 4GWNA 5FJKA 3VHPA 1OF3A 1VBE2 4WZFA 2QQLA 1QY4A 2ETEA 1DGRN 1RUD3 3N7JA 4QGNA 3UV9A 4HG6B 5IT6A 5E1RA 2OZ6A 2XL7A 3HT1A 2CYFA 2HWB1 1FV2A 2XJVA 3ZMNA 4YWAA 1MS3A 1PZ8A 2IXIA 2WA3A 3QLQA 3T1LA 5ACA2 2ZGSA 3RJRA 4QT6A 5D8AC 3IN9A 1JUIA 1VBC3 4QU1A 1OPOA 4YW4A 2Q30A 4QKFA 5L7OB 4QDSA 4Y1YA 2OKXA 1R092 2JG9A 4JGZC 2UYBA 4YZ1A 1XXNA 1BBT2 2OYZA 2PQSA 5IWFA 3VHOA 1OI6A 2V5DA 2YU1A 3KGLA 1HB1A 3AVSA 3ZFFC 4NPLA 1W6OB 4XFIA 2EXKA 1HJGA 1LOEA 3GDBA 3T3YA 5EQUA 2JDMA 3H7JA 3ASIA 3N9MA 3AKPA 4M0NA 4TWTA 1UY3A 4Q27A 3KT7A 3USUA 1M06G 3HN3A 2RJLA 4A44A 5FY9A 5LWBA 2AEZA 4NO4A 4UFJA 4Q4Y1 3NKGA 4S2DA 3GCXA 3WLUA 4B4RA 1QIQA 2DF7A 4QPGC 1EV13 3GHMA 2JICA 2WYFA 3GZTB 5C5TA 3RYKA 1UYXA 3TN91 1UZ0A 4K7JA 3IPVB 1H6YA 3USSA 4W50A 4E27A 3ZPYA 1UMIA 3U4XA 4AYUA 4FPGA 3CBNA 4UF0A 3MDPA 1J3QA 2D6LX 1YCIA 3UGFA 2WQ8A 4JKKA 1FV3A 2V72A 4O9GA 3IMMA 4BPZA 2WR9A 3GM8A 3RI9A 3X29B 2WNUA 5HBAA 1JODA 3K3OA 5BYNA 2CNAA 4GMP1 3LCPA 1GWMA 4LEJA 2G9FA 4C1WA 1NOVA 1R1A2 3JUUA 4PBOA 5EJ3A 1LODA 2FCTA 2IXCA 4KGGA 2XBO1 2ZZJA 2VOXA 2GMPA 2HWC3 1D2SA 2VMCA 1H2NA 4LBKA 3VKMA 3S7IA 4WM7C 4Z8BA 1STMA 4AEKA 1K3IA 1LOBA 3B9CA 4LT5A 3ACLA 1RUJ1 3SISA 4COZA 1U5XA 4FOYA 5C3SA 3ACGA 2NZ9A 5DUWA 5E16A 3S5AA 1C5IA 1W8NA 4UXAA 5BNOA 4RS5A 4JDMA 1AJKA 1X9TA 2YC0A 1GZCA 2ZPXA 4FXGB 4XXPA 1Q8OA 3OEAA 4YW7A 2BGCA 5AFEA 4IE6A 4IV3A 4TSVA 1V0AA 1O5LA 5LRRA 2Z2SB 3ZPOA 4ATEA 5FDBA 5DUVA 3ZFGA 4IW3A 3W20A 1CAVA 5FUIA 3AMMA 3D82A 3WNXA 4DRVA 1O3RA 1ZZ8A 3G7DA 2JDPA 3DN7A 1L7LA 4GXLA 1DZQA 3T0DA 1ZBA1 2UU8A 2CDOA 1VMJA 3N3HA 4GB32 4X6QB 3VBUA 5C8WA 4FOQA 3WG4A 2J1RA 4Q0SA 1SBDA 3WNPA 1ZM1A 2QE3A 4BQ5A 2DWRA 3AM2A 1UU5A 5A6XA 3NAPC 4Q29A 4WM8B 3RJ2X 2Q1FA 3LDRA 5FYCA 4YVWC 5GLUA 3H8XA 4LKSA 1BLZA 1OPMA 4HVOA 4XBQA 3A4UA 3CHXA 5L9BA 2ZEWA 5DZFA 5IAXA 3TN93 1ZBE3 1DYKA 5C3RA 2VH9A 2KXLA 2W94A 5C70A 2VPVA 2HYXA 1AR93 4A3ZA 4BISA 4YZ4A 1RC6A 3DF0A 4O7XA 1GFF2 4D7SA 2I2SA 3FN9A 2VGDA 2ZTNA 4HSLA 1HRV1 3KQRA 4LBQB 2NQYA 5FXVA 5I0TA 1YQ8A 5A1AA 1RUI2 1OOPC 1PGW1 4GMP3 4M3CA 4CCLA 1PVC1 2WABA 2QFEA 1W8HA 4R4ZA 4LUKA 4CU6A 1G9BA 5GZDA 4XHXA 1O8PA 1US3A 2BW8A 2XBO3 1W3XA 3Q9OA 4LA3A 2HWD1 1ASJ1 2WNEA 4Q4W3 1VAMA 2R30A 2ZX2A 4PBPA 1QQP2 4IUGA 1G8WA 4YVSA 1GMMA 3T1MA 1RUJ3 3ZDSA 1IKQA 1TG7A 1DLCA 3IT8A 1WUVA 2HWF2 1NCQC 5LBCA 3JD72 1GNYA 3SNMA 2JB8A 5CFCA 3POSA 4YNIA 5FYUA 4RYDA 3PTRB 1BK1A 3DGTA 1YJKA 4HPKA 4QM9A 1SPPB 1HKDA 2AEYA 5FZDA 1HXS1 3ZFEB 4NIDA 4QPYA 4O65A 3LB9A 1NCRA 4ZS3A 1ZREA 4QX2A 4B4PA 3O1RA 2BPA2 1ZBA3 5EJ1B 1FOD1 4CP0A 4KQ7A 4ONUA 4AHZA 2QQWA 4KWUA 5EPAA 1K45A 1UAIA 2JEMA 3UESA 3ZSEA 3V0AA 4OZOA 1MQTC 2GNMA 1EYBA 4XHBA 2VE1A 1RIRA 5CEHA 3ZDVA 1G86A 2A75A 2VVEA 1S0FA 4M00A 3LPFA 1NA1A 4UFIA 4AHYA 5H9RA 3S5QA 1JZ4A 1HRI2 3LD8A 2YV8A 1J59A 2QDNA 5JAXA 1BQPA 1YJLA 2YUEA 2Q4SA 1XYNA 3AKRA 3THPA 3VHNA 5K0UC 4JC1A 2JDYA 4Q4X1 3OGSA 3VHRA 1B09A 1V6LA 5KR7A 3AFKA 2VTXJ 1Q8QA 4P5YA 3A21A 1TEIA 3EXUA 1GP4A 4D3WA 2PHXA 2VZTA 4EZHA 3UL2A 5DPNA 4FTEA 1QJU1 5FO8B 1AYN2 1RUH1 1S4CA 2OPKA 2WFF2 2WN3A 3J7HA 1MVEA 1IPKA 3AMPA 2G9GA 1HIXA 2EIGA 3B69A 4LBJA 5A1LA 3K48A 3HIFA 1P8JA 3D6EA 1JOBA 1GU3A 2BJSA 2VUJA 3IB3A 5LATA 2VMGA 1NE4A 2A70A 2RS52 1D7PM 3URFA 4NN0A 4EN0A 4YM0A 2CGPA 3WD5A 4NHMA 2R043 1VBD3 2R32A 4QX8A 3AMNA 1ASJ3 2YB7A 1CJPA 2F17A 3RGBA 4GIQA 1YO8A 3QH7A 5FLIA 2ZX4A 3ME2A 5JWPA 3OPWA 2MEV2 3M3EA 1XU1A 4PT6A 1UW8A 1VBA1 2VZSA 1BEV3 4L99A 5FPVA 1ULFA 3VBSC 3ACFA 3WW2A 1PX4A 2G9ZA 2JG8C 2ZS6B 2DUOA 4NJ4A 2YHJA 5BUVA 2VCMA 3F2ZA 4EJRA 2Q5TA 1DQ4A 1HXS3 1JMUB 4YFWA 4QXBA 4YPJA 4LHNA 2GMMA 1O6UA 2R6QA 1HJFA 2WLPA 4N90A 4PQ9A 4JDNA 4XABA 4B4QA 4DXSA 5D8AB 2A3WA 4KGQA 3RG0A 1JYWA 2BBVA 2LS6A 1BMV1 3I3QA 1RUF3 1RUG2 4Q8KA 2L9LA 1NX9A 5FOJB 1UYZA 4F8AA 4HANA 1RGSA 3POEA 3VD9A 5FLHA 2X5IC 1PHMA 2RM21 3CMGA 3POJA 1W8WA 3D8CA 3ZFFB 4AFCA 1PK6A 2W47A 3BTXA 2IFWA 4AK3A 4QDQA 5FMOS 5IVFA 2AUYA 2C26A 3JZVA 3N7KA 5FXWA 1J3RA 4Q4X3 1SLLA 2FMDA 1BYHA 3DL3A 2ZMNA 3TEXA 1X8EA 4JDOA 4C1XA 2VM9A 3AZYA 3PU8A 1ZZ6A 3ROUA 4OI1A 1Q8SA 1KRIA 4OHZA 3QH6A 3ZXFA 1ONAA 1U5YA 1RUH3 1C8NA 1PO23 4GD4A 2OA2A 2K9ZA 3D3AA 3WF1A 5KC6A 4TLFA 3DV8A 5CISA 2BFUS 1MS0A 2X53S 5C4WB 1UPSA 1PIV1 2DU0A 4EE2A 1C57A 4LTAA 2VNVA 4MOAA 1O7FA 3ABZA 3NNGA 1B35C 1X8MA 1GOHA 4HMZA 4Y24A 1DQ5A 5FZIA 5LA2A 1PGL1 3WZ1A 4AHWA 3H1YA 4Z07A 4E8DA 1KJLA 1ENXA 4BE3A 3OG2A 1DZTA 1ZZ9A 1A3KA 2Y6KA 2XL9A 2N7GA 2DBNA 4YARA 3NVCA 4NIIA 2KM2A 1NLQA 1LECA 3GXUA 1YC61 4XYXA 1RINA 4MX3A 1LU1A 1QXJA 1OA3A 1VRH2 3CZJA 3N9QA 5C33A 4XJZA 4ZXEA 3TBDA 5F9TA 4RGKA 5LASA 4ZU7A 4LMFA 1DCSA 1UL9A 4LULA 2XMLA 1AJOA 1QJX3 5FBZA 2WZR2 1F5JA 3OGGA 3CL1A 5LA1A 3THCA 1XNCA 1GUIA 3BVCA 3I59A 1OUSA 4KG8A 4BMBA 5IATA 4OI4A 4N7UA 4NVPA 4Q4V2 4XDPA 1F2NA 2CL2A 3I3DA 1HV1A 1UZYA 5FP3A 5FY8A 2R073 3EYPA 3NJZA 1AR82 1W8ZA 3M3CA 1A6CA 5HV4A 3QCWA 3KMHA 2K46A 4Y4RA 1DQ1A 3MW4A 2Q0AA 4FPJA 1XNTA 4IEXA 1RVF1 2RM23 3WW4A 3WDVA 4X8NA 3RZMA 1IKPA 2Y6JA 2ZAAA 1PVXA 1I9RA 3ACHA 4QPIA 1WA6X 3R0RA 5FFOC 3I2JA 3OGRA 3A22A 3U14A 3ELNA 4P9YA 1KXGA 4NPMA 3NAPB 3E5UA 2OVUA 2WINB 1PMJX 2A3YA 2Y8KA 4ORFA 4YGDA 5FIXA 4FPEA 2OQ6A 1CX4A 4GKXA 3E6BA 3GJBA 5BNPA 1ZZCA 3AYDA 5FZ6A 5A7OA 4AVTA 3KHCA 3AMHA 2X09A 1TMF2 3GZEA 1CZTA 1OKQA 3O14A 4LQRA 4XFBA 4ZU4A 1BHGA 4F7ZA 3T09A 1OQ1A
chains in the Genus database with same CATH topology
1VB2A 3SCGA 1AR73 5I8SA 1WMEA 5FO7B 3EBRA 4AVSA 5JOZA 4P9WA 3KLSA 2GNBA 5DZGA 4LE3A 4KH9A 5IUQA 4MGZE 4CTEA 5L7OC 4DQAA 1X50A 4XF1A 4KWKA 3KCXA 4XF4A 2D43A 3KZ4C 1UU6A 4A3XA 1QXPA 2NPIA 5FO9B 3AZZA 1Z0HA 4BMEA 1FI2A 3SMHA 3H3ZA 4AFBA 3DPRA 4CEYA 5K8SA 4CDWA 3OJBA 1PGSA 2V5YA 1QJY2 1QOSA 1F9KA 4AQSA 5EZWA 4B7KA 1OLRA 2GC2A 4DPNA 1VBE3 1MACA 4MLOA 1GNHA 2NP0A 3ES4A 1NCQB 4HK9A 4B3NA 1PZ9A 2NM1A 1LULA 2B42B 1S2KA 2HWE2 5BPXA 4DNYA 1LB2A 3V65A 4OHVA 2R061 1N1VA 5ACA3 3NW4A 3O0XA 5KHJA 1RVF3 1VAVA 2PHUA 1SFYA 3B7MA 3ZMOA 3VZNA 2WNVC 1DYPA 4RHV1 4LLFA 2EALA 1EAH2 1HQNA 4OHYA 3WP6A 3LSEA 3RQ0A 3KSCA 5L19A 3TB0A 1GV9A 3TRSB 2PAKA 1CAXB 2TNFA 1H30A 2XGXA 2XHKA 2XB6C 3A0KA 3EQEA 2GC3A 2PYTA 1JHNA 4S2HA 5GKAC 2D97A 2V09A 4BHPA 3RDIA 3UKVA 1GNZA 1XYOA 1YFWA 1VIWB 3MLJA 5AC91 4BLIA 1DLLA 3M8LA 4BIFA 1YI7A 3IWZA 1VAKA 1X7NA 4IEUA 2ZBJA 2AH2A 4XTPA 1W6NB 4URTA 1R1A3 3J8F2 3AP4A 1Z7S2 4WM8C 4XOGA 4EN8B 4LBOA 4RQPA 3WCSA 1C28A 3MIFA 3M3IA 1X82A 1WD3A 4JGYC 4E2GA 1AL21 4DINB 4AEDA 2DUQA 3PVEA 2E53A 2VW2A 1U5ZA 4CDQA 4GH4B 1FPN2 3ZN5A 3JD71 1H8VA 1RJ8A 2R063 3FC0A 1LJ7A 1WW7A 2D5FA 3E6DA 4XDQA 2QCSB 3ZIWA 1UKRA 1K5MB 1O91A 5DG2A 2A6VA 3JCIA 3WT3A 1QDCA 2PHRA 2I07B 1ENQA 3B94A 4GB33 4XFFA 1RUC1 4R9DA 1NY71 1QDOA 2XVGA 2OZJA 3IMNA 4I3GA 2QJVA 2VNGA 2D3SA 3LOBA 1G9FA 1AX2A 3H1WA 3ZN6B 2P3KA 1CAUA 4YG0A 4AHXA 2QNKA 3LA7A 4HVQA 5A32A 2C0ZA 3LWCA 2DYCA 3ZYJB 1JW6A 3VBRA 3PTYA 4OHWA 3NSTA 3OF1A 1UZZA 3B01A 4J6GA 4FQZA 3ZFEC 1OMIA 2ZHNA 5AC93 4D7TA 4MGYE 4MZUA 2WFF1 2OUJA 3AX4A 1JXNA 4M0HA 3QOPA 2UWAA 1OFNA 1V00A 2QKDA 1FNYA 1COV1 1BZWA 3MEPA 1RUI3 4INDA 5DXDA 4AI0A 4AVCA 3MW3A 1H9PA 2PTMA 3H7YA 1EP0A 1DGWX 1AX0A 1T6GC 4P9JA 2D6MA 4LBNA 4WVZA 1GQGA 1N1YA 1G7YA 3AP7A 1ULDA 5GM0A 3ZXLA 4LNVA 3N35A 4MXWB 2D5HA 1QQP3 3CJIB 1AL23 3JBG2 3MPBA 3WDWA 4Y22B 4HKWA 4BOWA 2GNDA 4XFAA 2RMU2 2HWF3 1VBB1 4QGMA 3WDUA 4Z82A 3JD73 3VBHC 4CDUA 1JYCA 3V0BA 2DURA 1ULEA 4K40A 4JGZA 1UPIA 1VLNA 1REEA 2XLAA 5BV6A 2ET7A 4I30A 2WC2A 2GAUA 2ZCWA 2IC1A 3FFZA 4Q0VA 2OUHA 2I74A 3VDDA 4DZGA 1RUC3 3LA2A 5DDJ2 2LTNA 1ALYA 3TOJA 3O0WA 5JR7B 4AVVA 2AREA 2V73A 4IQPA 2NLRA 1HRI3 4FPCA 5H9QA 3VN4A 2GC0A 1R082 4IEPA 2HWC1 4RR3C 2XG3A 3OBRA 5F5QA 4HN0A 3MIBA 4QPGA 4B29A 3VKNA 3DKWA 3O5SA 4P9IA 3SITA 2WS91 2OIIA 2R16A 2QVSB 5FPZA 4HKOA 5CADA 1QF3A 1ND2A 2ZX1A 2WFF3 2H6BA 4CEWC 4CDXA 1BVVA 2YDEA 2E7TA 1COV3 4L2NA 4QD2A 1LEDA 5JZGA 5EV7A 2RS53 1GLHA 1S0IA 4WM7A 3B9IA 2A6YA 5A33B 3N7LA 4FXKB 1YFUA 1AHSA 1Q5OA 1C1LA 5JSOA 5LRSA 5CG8A 4META 1OFSA 2QZ2A 2PHLA 2WA4A 3PHMA 4PF5A 3J4UH 4M3CF 4UBHA 4EWDA 1VBB3 1YWKA 1VALA 1OA4A 4G3YC 3ZSMA 2FHRA 1ND3A 2B45X 1G9AA 1LOFC 5KHKA 3VBOB 3MIHA 3LOIA 2DCYA 4XXAA 1CAWA 2RJKA 4AI3A 4XQDA 5C4WC 1ZBE1 5J98B 4IERA 1AR91 5KXCA 4XF9A 1X33A 4XQ4A 4LO6B 3ZX7A 2YROA 2IXJA 1UD1A 1MS4A 5GZGA 2VY0A 3WINE 1D4M2 1WLCA 2WNVB 5D1IA 3N36A 1YFYA 5ABJB 2ATFA 3B3QE 4N43B 4YVWA 2VECA 1FXZA 2E51A 4HSJA 3VKFC 4FO9A 3UJQA 2GMEA 5GALA 2ENRA 5KWRA 4Q4W1 3AJZA 2GSYA 5GZFA 2WS93 1HLCA 3OY8B 2PN5A 4MGKE 4YGCA 1WLDA 1NLRA 3AKQA 3AYCA 4PJYA 1H9WA 5LEKA 2WWSA 1N47A 1U12A 5I0SA 3AXDA 1OQEA 4W6YA 1W6MA 4S2FA 2ET1A 3HMYA 4FTBA 2I45A 4MUVA 5JSRA 2A73B 2Z5WA 1I6XA 1LTEA 1IS4A 4XIKA 4XFCA 4NPRA 5T5PA 2ZHKA 3S0MA 1W6PA 4SBVA 4IESA 4CDWB 2XKPA 2W52A 5CFDA 4A7YA 1LHUA 1V9U1 2CV6A 1RMU2 2EAAA 1AXYA 4W6WA 1TME1 1VRH3 3B93A 1Y9QA 1QH6A 1HV0A 4A2UA 4JGYB 1HX6A 2WZR3 4B8EA 5FQ0A 2PFWA 4UW6A 5LEJA 1AXZA 4Q8LA 1RUE1 2RS32 4PLOA 2DUPA 3N7MA 4GWMA 4COYA 3OYWA 1YYNA 1MQTA 2ZGPA 1AR83 2R0FA 2BEOA 4YGBA 1H8TA 1V6MA 3NV4A 1UF2C 3MIEA 5K0UA 1J58A 2VNRA 5HCBA 2Y38A 3RSJA 2R041 1VBD1 2EA7A 4PLNA 5BNQA 1C8M2 1PMIA 5T54A 2DVAA 4PDWB 2DV9A 2YZ4A 1H4HA 4I2OA 1ZZ7A 3VV1A 3WP4A 4R52A 1N1SA 3KT4A 5TSWA 2ERFA 1GYKA 3M4FA 1BEV1 4IV3C 1DQ0A 4R4XA 4A7KA 2RR12 4H55A 3FMGA 3S6PA 1RUOA 4GQ7A 5JVVA 2ZGKA 3LKJA 3RRDA 4AI8A 2GNTA 3BB6A 3PVNA 4U2AA 3MFCA 2ZMKA 3VBUC 2XWJB 3O7OA 2A5ZA 2Y0IA 2Q1MA 4Z92B 4Y20A 1RUF1 3AYAA 1CJDA 3ZYRA 1CGPA 2FZ1A 3MIDA 1IZ3A 3AZVA 3IBMA 1PO12 1FAYA 1V9U3 4CP2A 4AEMA 4R9CA 4KWJA 1AL0G 4XJAA 3RYRA 3UJOA 1TME3 2WIIB 2VVDA 4XF0A 2BNOA 4CZSA 2JG8A 1C5HA 1LR5A 4N53A 5T5LA 2BVBA 3S7EA 5GZEA 3MIGA 3FZ3A 1FMD2 2WZPP 2MPFA 1ENSA 3BOWA 1DGWA 1RUE3 4WVVA 4AE2A 1FX5A 4BIOA 2BUKA 4GMP0 3VBHB 4FTSA 1PO21 2HWE3 3OD4A 1A8MA 5FRAA 3HWJA 4LLOA 4XEZA 2XJQA 1REFA 4TYSA 3VBFB 2X5IA 1MEC2 5C9AA 1KDKA 3LA3A 3AXEA 2PQQA 4PLMA 1SLIA 2VXRA 1OQ1A 2YXSA 3CF6E 1RHI2 3SCHA 1GZWB 4OFGA 4YVSC 1CPMA 2BQPA 4XJUA 1EAH3 2ZGMA 3FUOA 3JQWA 2ARXA 4HVRA 2CY6A 2BWCA 2PHFA 2DCZA 2NMOA 3OGJA 4OUMA 4COUA 1JTZX 4H7LA 4RR3B 1AR62 1VBC2 5J96B 3C3VA 1WA4A 5JIUA 1W0OA 2Z42A 1YXWA 4LR4A 4IV1B 2O8OA 1NCRC 1Q43A 1QJX1 1YLLA 3P3NA 4GH4C 4DS0A 1SMVA 3ZXDA 4DRRA 1H2MA 4HN1A 4HBNA 4Q0PA 5E88A 5I91A 4CEWB 1K5MC 3NO8A 2RS12 1QJZA 2E7QA 4K6BA 5BNNA 2R071 1W6QA 4ASLA 3VL9A 2E63A 3OCPA 3EO6A 2PLV2 5GLWA 2TBVA 3WDYA 4FAHA 4XILA 4RL7A 4DXZA 5C8CA 4FSJA 4AI2A 2R1DA 2IXLA 1XRUA 1ZVFA 1MS1A 3ES1A 4Y4YA 3NV1A 3SHRA 4YM1A 4YGEA 1IS3A 2G4IA 4P9GA 4CDUB 3WV6A 3V0BB 2VOKA 5JI9A 5JCTA 5T52A 5CG9A 3APBA 3LZZA 3ATGA 1H0BA 3D5OA 4HZFA 4AFDA 2EXHA 4MH0E 3U10A 1QH7A 1AR71 3IM0A 1WMDA 1F8VA 2D6NA 2ZACA 3ZXJA 5AFBA 3I2DA 4WVMB 2HEYF 4ES9A 1H2LA 3WW3A 3WQ1A 2SLIA 1KFXL 5A3LA 2B8MA 2UWCA 3UK9A 3BALA 1RITA 2PAMA 1CN1A 3HAGA 5EWSA 1FT9A 4ATFA 2HWB2 4DB5A 1WBLA 1SCRA 3MLKA 1GQHA 2D6OX 1H1MA 5FLJA 3CJIC 4AW7A 1BCXA 1O4YA 4J1XA 3UKTA 4Y1VA 4K3UA 1L3JA 2UURA 3TYJA 1QNWA 5GLTA 1VBE1 3KGZA 1S0EA 1WLTA 4JTOA 1BJQA 4L9BA 5L7OA 2D93A 4G9SB 5CAZA 2JG9B 1FATA 1HQLA 2ZOEB 4DOUA 4RGAA 1W6OA 1YHFA 3LAGA 5ACA1 4Q4Y2 2XJRA 3DUIA 4PCRA 4AQ6A 3I7DA 4S2GA 2D6PA 1R091 1KJRA 1BBT1 3TN92 2TUNA 5JSPA 4LBQD 3USUB 4EN9B 5DZEA 1RB8G 1MZ6A 1IS5A 1LOCA 2EAKA 4C90A 1QU0A 4YG6A 5CA6A 3SH3A 3IPVA 4YM2A 2GDFA 2DVBA 1HW5A 1PM7A 2MNGA 2RMU3 2ZJCA 2ZKNA 4FP3A 5FREA 4YW2A 4LO5B 3WG1A 2F4PA 2XJUA 1D0HA 2DU1A 2XH6A 3GYDA 2A7AA 1AYM2 1RUJ2 2WNUB 3SH4A 3WX5A 2CGOA 3FFQA 3GZAA 3WDXA 3ST7A 2E9QA 2FMYA 2IWGB 1IPJA 3GHNA 2MHFA 4OULA 3AP9A 2AZ5A 3RNSA 1D4M1 1EY2A 1U0AA 1UMZA 3U0ZA 4YRDA 1SEFA 4XPVA 1R1A1 5JOYA 2ZZQA 2A3XA 5BNOB 2XLFA 4RS5B 1ZBA2 3POYA 2A6WA 3VBOC 3OBTA 1V6JA 3KS7A 4IV3B 4XETA 3P3PA 4AWDA 1CONA 5L73A 3ZFGB 3WHUA 4AF9A 3FBYA 3OPZA 1CAVB 2ZKLA 2A6XA 4I09A 3AFGA 2AYHA 2LALA 3VBUB 2ZGRA 4E4SA 3IIAA 3VZLA 1R093 2XUMA 1IQAA 4XMIA 1BBT3 4WM8A 3M3QA 5ABJC 2BNMA 3D4KA 4N43C 4GB31 1TNFA 4DY3A 4X6RB 1HRV2 1LCLA 1NQDA 2YMZA 4FT8A 5FMOL 1PGW2 3O0VA 1PVC2 1S0CA 5JOWA 3AMQA 4P9XA 1O3SA 2VOWA 4LBQA 2HWD2 5IK8A 4I02A 1ASJ2 4G4FA 3R6SA 2JKBA 1JOJA 2D7FA 3EHKA 2FZ2A 1RJ7A 4QMAA 3ZYPA 4LBLA 4M3CB 5CNAA 4K1ZA 4Z1VA 1R1ZA 2BFUL 3MI8A 4FOVA 2E6VA 4N7IA 3POWA 3ZSLA 3TNPB 1DZRA 1FYUA 3HR9A 1WW4A 4CDWC 1D4M3 1RUI1 2HEWF 5KXDA 3BCWA 3D0SA 3H1MA 1HXS2 4YVSB 5EYYA 4XJWA 4IEQA 2ZHLA 1FOD2 1NYWA 1UN1A 4ES8A 3ZFEA 1QQP1 3AP5A 5CFCB 3WP5A 4HPKB 1MS5A 4NHLA 1WD4A 5LK7B 1NCRB 2HWF1 4P5HA 1APNA 3I4IA 4QM8A 3WCRA 2ZGTA 3WDTA 4QX5A 3ZXKA 5I8TA 4Q0QA 4WZCA 2HYKA 2JDZA 2VVFA 1UIKA 3V0AB 1KFUL 2HEVF 4Q4X2 2VW1A 1V6IA 1POV3 5DG1A 1NA1B 5KHGA 2ARBA 2VUAA 1QJU2 1SFNA 4ZKTB 5IK5A 3RS6A 3G6JB 2ZGLA 1RUH2 1PZ7A 4ISQA 4N53B 1YFXA 5JMCA 4HFSA 1RMU3 1XE7A 4PDWC 3VKLA 4MGIE 5T3NA 2Q1ZB 5H9SA 4D94A 1HRI1 4DMIA 4F3JA 1EPWA 3MLLA 3TNQA 2C9AA 3PLQA 2XJTA 2DVDA 1DGLA 3SLIA 3L2HA 3AYEA 2VW0A 5C9AB 1OA2A 4KL1A 4LO4B 1AYN1 5AVAA 1J1TA 1CVNA 4HETA 1CESA 1VBA2 3BU7A 4XJ9A 3N4MA 2DCKA 1QXRA 1GSLA 4XF3A 4I01A 3WW1A 4FPFA 1S0DA 2RS51 4RQPC 3WP3A 2P17A 5IK4A 1D0GA 4OHXA 2EVXA 3FLPA 4R8HA 5JIAA 2UY8A 4AEDC 4I0WB 4FOWA 4XW3A 2GN7A 5I0UA 4E2QA 4NWWA 1BMV2 1C4RA 4J1WA 2CWSA 5FPXA 1AF9A 2MEV1 4D69A 3MICA 3WUDA 4XFGA 5J7MA 4BQ1A 4X8PA 2RM22 3AP6A 1HDKA 3GZUC 5D8AA 3IDEA 2RR13 4Y1ZA 3HBZA 2K0GA 3W58A 3ENRA 3GF6A 1RUNA 3WY6A 2O8QA 4FCAA 3WXPA 3VBFC 5J36A 4WV8A 3ZFFA 2F6BA 2GN3A 3ILFA 4YW3A 2PA7A 3S30A 4GULA 2RS11 2CGNA 2ZGQA 2FQPA 2Q8OA 1PK6B 1X36A 5C8CB 1ENRA 1RUG1 2W0XA 4IEYA 2JXAA 3I54A 2SBAA 1PO13 1PIV2 2ZAHA 1LOFA 2DCTA 4MXVA 3VBRC 3MFAA 3VZKA 1PGL2 1WGPA 2QUOA 1KDMA 1WW6A 3MPPG 3WQ7A 4IV1C 3GALA 1DF0A 1FMD3 2GU9A 3CU7A 1WCKA 4UW3A 4XZPA 4YZ2A 3QD6A 1N1TA 2BNNA 1AYN3 1J3PA 4BZ4A 5KXEA 1Q56A 2PELA 1AXKA 1UIJA 4CP1A 1QOTA 2VG9A 4FVVA 4YSFA 1ZRDA 2ES3A 1H4GA 4Q1PA 2VMIA 3BIWE 1XYPA 1RHI3 3HT2A 5KHHA 4LO7A 1LRHA 3IDCB 1S55A 1MR5A 2EF6A 3HD8B 1S2BA 1WCSA 3RMXA 2ZHMA 5EYXA 2MEV3 1VRH1 3W59A 1AR63 4CDUC 5SV8A 3I59B 1RVF2 1BVP1 1RL3A 3MF6A 2CAUA 3HN1A 1ZX5A 5K9YA 3JB8A 2WZR1 2CAVA 3VGIA 1C3HA 1BXHA 1SBFA 2GC1A 2BWAA 4OLLA 4IEOA 1F5FA 3VDDC 3PVOA 4AVAA 1FNZA 3L9JT 4JAAA 4Q4V1 2RS13 1LGBA 5KXBA 1NQJA 1SLBA 2RHPA 1AR81 2YPJA 3CEWA 4BWOA 1RUG3 1O3TA 4QPIB 2UWBA 1H1IA 1LENA 3NAPA 1N3PA 4KU8A 4QQHA 1G6NA 2PLV3 3FLRA 2VQ0A 4IEWA 3KB5A 4E4DX 2EXJA 5GZCA 4YLZA 5F6KA 5BNPB 2IFRA 1GKBA 1OD5A 3GNEA 1ND2C 5LK5A 1LOAA 1A8DA 4FP2A 4H3WA 5SV5A 4CDXC 3ZVXA 4QQOA 3L2YA 3ZXEA 1TMF1 2WFPA 4BH9A 1ZRFA 4AG4A 1OOPA 2JG9C 1JBCA 3E5XA 2IXHA 3OD0A 4EROA 2JE9A 1VP6A 1MZEA 1XNDA 3W9AA 4DY5A 3LSDA 4Z2WA 1SBEA 5GJ6A 2UY9A 1AYM1 3DPRB 4CEYB 2D3PA 4XBLA 1OSGA 1WCDJ 3I8TA 4UW5A 2HWB3 1NXD1 1HQWA 3NKTA 2HKXA 2R062 4FBFA 1IOAA 1D4VB 1NCQA 1ND3C 2Y26A 1GANA 4ISRA 4W6XA 5J09A 1QJY1 1Q8VA 4RHV2 4HKLA 4AEJA 4D7YA 4FPLA 4K8FA 4PIXA 1KQRA 3M70A 3MGUA 4LO8A 2VQAA 2HWE1 4Q4V3 5CIRA 4HK8A 5A3MA 2WNUC 1TQ5A 2WLQA 5C6CA 5I0RA 4Q4Y3 4RD7A 1DBNA 1YUDA 3WUCA 3SXWA 1SDWA 2XKOA 4TZDA 4QGLA 1ZNPA 1UKGA 1CAXA 2AR6A 3E6CC 4Y26A 2XVLA 1O3QA 1EAH1 3CNAA 2X8KA 5AC92 3AZXA 1I1EA 1S1AA 2XJPA 4KWLA 4R9BA 2XJSA 2DFCA 5BNOC 4RS5C 2ILMA 3OTFA 4PIYA 4M3CE 3QBQA 4QU2A 4BLJA 3WVJA 1TMF3 1LOGA 3M2MA 3ZFGC 4BA6A 3D0JA 2VULA 4SLIA 2ZGNA 5I93A 2WQZC 4XJ8A 4JTNA 2JENA 1KITA 2VU9A 3BOPA 4L97A 1W6NA 1LEMA 1AYM3 1AL22 2FBEA 5H9PA 5CFDC 3M7AA 1JH5A 4C0BA 2BTVC 4AQTA 5HCAA 4IETA 4YW1A 3R05A 2A71A 4K20A 2BVVA 4RQPB 4KU7A 1GZ9A 3M1HA 3J9SA 4IEVA 3VBSA 4E9KA 3FJSA 2YYOA 4AEDB 1QJY3 4DFSA 4GH4A 1TNRA 3J8F1 2P34A 1Z7S1 4NWVA 1E57A 4CDQB 4COWA 4AQ2A 2LUWA 1CD3G 2H0VA 1RUC2 2NN8A 3VLBB 2W68A 1K5MA 1NY72 1YNAA 3HQXA 3BPZA 1VR3A 3IKWA 3TAYA 3MYXA 1FPN1 4QQLA 3ZIXA 1DDLA 5FOBB 5J3UA 1H8TC 3H3UA 3AKSA 1ZA4A 5FCCA 4OI2A 3V64A 3ZXAC 5BXXA 3ZN6A 4JVAA 3PMSA 1RUD2 5CU1A 5CBLA 1WMFA 4QQ2A 5EFUA 5EXOA 1CAUB 1KD7A 4Q26A 4XQWA 5A32B 2ZGUA 3PVBB 2RE9A 2ZA9A 4UBGA 1HRV3 3NV3A 3VBRB 5CFCC 2BYVE 1LHNA 1COV2 3FBMA 2