4RHV3

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 40
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4rhv300
1SMVA 4WM7B 1VBE2 4Q4V3 1BEV2 1C8NA 1QJU1 5JZGA 4CDQC 1Z7S1 4RHV2 1FMD3 1ZBA3 2MEV3 2R071 2ZZQA 1RUH2 4RR3A 2RMU3 3NAPC 1RUJ2 4GB33 3S6PA 2BPA2 4GH4B 4Q4V1 4WM8C 1TME2 1IHMA 2RM23 2XBO3 1QQP2 1ASJ3 3VDDA 4CEYC 1BBT3 3VBFA 1K5MA 1FOD3 3VBSB 1FMD1 1ZBA1 2MEV1 5ACA3 5C9AC 2HWD1 1VB2A 4GB31 1AR72 4JGZB 1EV13 1H8TA 5JZGC 5AC92 3DPRA 2RM21 2XBO1 4FTEA 1ASJ1 1RHI3 1BBT1 2WFF2 4NWWA 4QPGA 1NA1A 5FMOL 5ACA1 5L7OB 1RMU3 1ND2B 1V9U3 3ZFEB 1EV11 1VRH2 2HWB3 4GMP3 3VBUC 1HXS2 4SBVA 2ZTNA 4CDUC 1RHI1 3VBFC 4FTBA 3VBRB 2X5IC 4JGYA 1VBD2 1RMU1 5DDJ3 4CEWB 1V9U1 4N53B 1PO23 5C8CB 4QPIC 1R083 2HWB1 4GMP1 2Y26A 1PVC3 1TMF3 3ZFFA 1ND3B 1PGW1 3TN93 4CDXA 4RQPC 1X36A 3JBG1 1RUG3 1PIV2 1NA1C 1RUF2 4RFT0 2RS33 5K0UB 2BBVA 4AEDB 1NY71 2HWE2 1R093 1EAH3 2PLV2 1NCQA 3J8F3 1FPN2 5DDJ1 1PO21 1OOPB 2WWSA 5C4WB 1R081 3IDEA 2FZ1A 3ZXAC 1PVC1 1TMF1 3TN91 2XPJA 2ZAHA 1HRI1 4N43A 2R042 3VBOA 1AYN3 1RUG1 5CFDC 5BNNA 2RS31 1R091 3J8F1 1EAH1 2R072 1D4M3 1VBB3 3HAGA 3NAPB 4Q4X3 2WZR3 4EJRA 1ZBE3 5D8AA 1VBA1 4CEYB 1FMD2 1NCQC 1PO13 2MEV2 1AL23 1D4M1 2RMU2 1VBB1 5BNPC 1RVF3 1AR82 5C4WC 5C9AB 4NWVA 2RS13 1F2NA 4Q4X1 2WZR1 1ZBE1 1RUE3 2R062 4IV3A 4N43C 5JZGB 3VBOC 1ASJ2 1BBT2 1VAKA 1FOD2 4Q4W2 1HRV3 1NG0A 1PO11 1AL21 1PGL2 1RVF1 4RR3B 2HWD3 4YVSC 2RS11 5D8AC 1RUE1 4CDWC 1RUI2 3VBUB 2FZ2A 4CDUB 1AYM2 3VBFB 1HRV1 1POV3 3JB8A 2X5IB 1QJY2 4YVWA 1NCRA 1VBC2 4QPIB 1A6CA 1HX6A 1R1A3 4IV3C 2QQPA 1VBE3 3DPRB 1AUYA 1BEV3 4RQPB 3ZFGA 1C8M3 4QPGB 5J96B 1NA1B 4RR3C 1POV1 4RHV3 1MQTA 1BMV1 5BNOA 3FBMA 1RUH3 3JD72 1R1A1 1PVC2 1TMF2 5CFCA 4RS5A 1CD3G 1VBE1 3VDDC 1QJX3 1BEV1 1RUG2 2RR13 1RUD3 1C8M1 1K5MC 3JBG3 5CFDB 1QQP3 2RS32 1X33A 1RUC3 5A33B 3J8F2 4RHV1 4JGYB 1HQNA 4Z92B 1NCRC 5LK7B 1RUH1 5L7OA 1RUJ1 1H8TC 5ABJA 1AR73 3ZFFB 3DPRC 4CDXB 1QJX1 1HRI3 5AC93 1AR63 1AYN2 2RR11 1RUD1 4QPGC 1F8VA 1VB4A 1QQP1 1RUC1 2WFF3 5A32B 1MQTC 1NCQB 5BNOC 2GSYA 5BNPB 4CEWA 4N53A 2WZR2 2BFUS 5CFCC 1AR71 4RS5C 1VRH3 1QJU2 2BUKA 5AC91 1AR61 4N43B 3VBOB 1VBA3 3CJIA 4GMP0 1Z7S2 1E57A 4FTSA 2WS93 2WFF1 4JGYC 4FSJA 5K0UA 1VBD3 1MEC3 4YVSB 4Q4V2 3ZFFC 1VRH1 4CDXC 5D8AB 4CDWB 1HXS1 2WS91 2IZWA 1HRV2 4CDQA 1CJDA 1ZBA2 4Q4Y3 1B35A 2HWD2 4GB32 1DDLA 2PLV3 1VBD1 1MEC1 2HWF3 5FOJB 2VQ0A 4IV1A 2HWC3 4IV3B 2RM22 2XBO2 5BNNC 4WM8A 3CJIC 2R043 3VBHA 1OHFA 1RUF1 4Q4Y1 5ACA2 5FMOS 1NOVA 2PLV1 4PDWA 1EV12 2BFUL 2HWF1 2RS53 1R1A2 4WM7A 2HWC1 1AR93 1RHI2 3VDDB 1C8M2 2R041 1K5MB 3M8LA 1B35C 1COV3 3LOBA 1RMU2 1V9U2 4YVWB 1NCRB 1OPOA 1AR83 2RS51 2HWB2 4IV1C 1H8TB 1PGW2 4GH4A 1AR91 1WCDJ 4LLFA 1QJX2 2R063 2RR12 1RUD2 3JBG2 3VBUA 3ZFGB 3VBHC 4CDUA 1RUC2 2TBVA 1NY72 3VBSA 1COV1 4Q4W3 1MQTB 4PDWC 5DDJ2 1PO22 3JB4C 5BNOB 2X5IA 2RMU1 1QJZA 1R082 1AR81 1RUJ3 4WM7C 4JGZA 3TN92 1RB8G 4QPIA 5CFCB 4RS5B 5GKAC 1HRI2 1AR62 2R061 1RUI3 1GFF2 1TME3 4RQPA 1AYM3 1R092 1EAH2 1FOD1 1M06G 4Q4W1 4YVWC 1PGL1 1ND2A 5ABJB 3ZFEA 1QJY3 4GH4C 1POV0 1VBC3 3ZFGC 1VBA2 1RUI1 1W39A 1TME1 1AYM1 2WS92 3VBSC 5CFDA 3VBRA 1D4M2 5A33A 1VBB2 1MEC2 4Q4X2 4BCUA 4JGZC 5C8CA 1QJY1 4Y5Z0 1VBC1 3JD73 1ZBE2 1ND3A 1HXS3 5BNNB 3CJIB 4Y4YA 1PO12 4Q4Y2 1AL22 5A32A 1RVF2 4AEDA 5L7OC 1ND2C 2RS12 5ABJC 3ZFEC 2HWF2 1OOPA 5BNPA 5C4WA 3JD71 1RUE2 2HWC2 5J98B 2GH8A 1PIV3 3VBRC 1RUF3 4CDQB 1B35B 2WLPA 4CEWC 2HWE3 4N53C 5C8CC 1FPN3 2RS52 3NAPA 2DF7A 4YVSA 1AR92 1ND3C 4IV1B 1AL0G 4WM8B 1QJU3 4CDWA 1AYN1 3VBHB 1PIV1 4CEYA 1Z7S3 5K0UC 4AEDC 1COV2 2HWE1 1BMV2 4PDWB 2R073 1OOPC 1FPN1 5C9AA
chains in the Genus database with same CATH superfamily
4CPBD 1SMVA 3DL3A 1E5SA 3KV6A 4XHBA 1SLCA 3IN9A 4QM9A 4LA3A 3ZOIA 2CHHA 3C7EA 5JZGA 1R64A 1A8DA 3T4HB 1UZ0A 5FWEA 4P08A 3ACLA 1Z7S1 4QHZA 1ALYA 1RUOA 3KT1A 5CVRA 1FMD3 2DCKA 3MGUA 5E16A 3BIEA 1ZZCA 2J1RA 2R071 2ZCWA 3GYDA 1RUH2 4XDQA 5I0UA 3NAPC 2B9UA 3LWCA 1MS1A 3R05A 4GB33 4QX2A 5LRRA 3WW2A 2BPA2 3LFMA 4O7XA 4AK3A 4EQVA 5JXHA 2XMLA 3IBMA 4LEJA 3VB9A 2D98A 1VE0A 1C28A 2ZPXA 3ZXEA 2ZGNA 4JDNA 4BM8A 1OH4A 1KFUL 1AXZA 5D2AA 2W08A 5FZ7A 3RZGA 2HWD1 2K2SA 3HN3A 1AR72 2A1XA 4JGZB 5CKQA 3MHZA 4H14A 4IQPA 1MS3A 1SLBA 1CX4A 2XLAA 3MW4A 4FPYA 5AC92 5JZGC 1CWPA 3JXSA 3RYPA 2RM21 1W9TA 2XBO1 2BOJA 1BBT1 2ZGMA 1MVQA 1KQRA 4NWWA 5F6LB 4XC9A 1O3QA 5F32A 4KGGA 5FMOL 2DURA 3HVDA 1V6JA 1ST8A 2VR4A 2V5YA 2Q1ZB 2JIJA 4LQRA 3RWKX 3OSDA 1D2QA 1RMU3 2GNMA 2YPJA 5AFEA 4CSWA 1I5ZA 1EV11 2VUDA 3OBAA 2H6BA 2V09A 3H7JA 1UY0A 1XE7A 1S1AA 2HWB3 1QKQA 4GMP3 3WG1A 3VBUC 1E5HA 5LB6A 2VVEA 2ZTNA 2XQRA 4L97A 4W50A 4K1YA 4OZXA 4IUGA 2RJLA 5CG9A 3T1MA 3KT4A 3LGRA 1ZRRA 2KXLA 2B42B 4ISRA 4B1LA 5C7GA 4GJZA 2ZOEB 5T5OA 4ES8A 2VL4A 3I8TA 4CCNA 1FI2A 2JX9A 4XZPA 2Y26A 4NVPA 3S0MA 1PGW1 4IE7A 5IVJA 2ZGRA 3ILNA 3PUIA 4GALA 1X36A 3WZ1A 3VZMA 3WT3A 4A45A 1IS4A 2AGSA 3UGHA 4E2SA 1PX4A 5BYNA 4K20A 1UU6A 2BVBA 1NCQA 2CWMA 2FHRA 1FPN2 2GP3A 5LBEA 2FDGA 4N9IA 2ARCA 1OOPB 3V56A 2UURA 3EJKA 3LSDA 4BQ5A 4TWTA 4ITCA 2FZ1A 4D7SA 1DLCA 1PVC1 2VNOA 5JI7A 2WIIB 1YO8A 2XVKA 2ZKNA 5E8AA 5AFBA 1JUIA 2QZ2A 2R042 3VBOA 1AYN3 2UY8A 1W6MA 5BNNA 1ZM1A 2F4PA 3J7MA 5LA2A 4MSVA 4I3PA 4QX1A 2D6OX 3J8F1 5JDBA 1EAH1 2WA4A 2YDEA 4QDRA 3WQ1A 3WNNA 3WW3A 1VBB3 4QB6A 4FVVA 2DTWA 3ZN5A 4B1MA 4GWIA 2V4VA 4Q4X3 4BMBA 4IXLA 2JDNA 2WT0A 3P5BA 1O8SA 1W9SA 2KA3A 5D8AA 3WP4A 1NE4A 3ABZA 4ATEA 4E4ZA 4OMCA 3ILRA 1SPPA 2ZGKA 3DYPA 4AE2A 2JDHA 1H0BA 1NCQC 2MEV2 3I97A 4CUAA 1D4M1 2DVDA 2P34A 2RJKA 5C4WC 1K3IA 1Q8OA 3LFIA 1I5PA 3USUB 5K7PA 2RS13 1W03A 2ZGLA 4DUXA 1ZRCA 4QXBA 4UW5A 3TEWA 3TEXA 5T52A 5F3EA 1WMXA 2IVIB 2LRPA 4IV3A 2ZACA 2J1TA 3VBOC 3F2ZA 5T5JA 4GQ7A 2IXHA 1UXZA 1UMHA 1SFPA 2BV4A 1YFXA 2Q30A 3GHNA 4D8MA 3AYDA 1HRV3 1YQ2A 3A23A 3DKQA 1RVF1 4RR3B 4GULA 5I91A 3HN1A 1Q5OA 3FL7A 4FOQA 2ADEA 4UFMA 2BGCA 1LR5A 3DKWA 3AKRA 4JKMA 1OVSA 5D8AC 4D7TA 5A3NA 1JZ7A 1V70A 3R4DB 2HBUA 3BTYA 1AYM2 1U12A 1QOOA 2VGDA 1UU4A 3VBFB 3ZMNA 4QX3A 3NRUA 3HD8B 1JS9A 3LIGA 1LTEA 3A7QA 4W8JA 1TQ5A 2J1SA 4FCAA 1GQGA 2X5IB 1DQ5A 3I59A 4MGSA 4XIOA 1S0DA 2VM9A 4UOJA 4I02A 3ENRA 5FZ0A 1NCRA 2ARAA 2PYTA 4QPIB 3VDCA 1XRUA 1R1A3 3AB0A 4IV3C 4XABA 5BXXA 2B46X 1W9YA 2XOMA 4RFRB 4XFAA 4BE3A 1O91A 5EHDA 3PJYA 1URXA 4RQPB 2BP6A 3D8CA 2ET7A 1NA1B 1Q56A 1XPWA 4Q1PA 1N1SA 5FUNA 5LATA 3U75A 4FQ4A 5DZFA 4Z2WA 2A71A 3HT2A 4R9AA 3TRSB 1POV1 4RHV3 4E4SA 5ANQA 1TZOA 3B69A 4AI2A 3FBMA 3FMGA 2X8KA 3H3LA 5FY8A 1OA3A 4UYBA 5FKCA 3ZLIA 4O65A 2KR2A 5A1AA 3JQXA 1BZWA 4XAEA 3S7EA 2WNUB 1L7QA 1UX7A 2C24A 3JBG3 4IW3A 4UFIA 5FYCA 3BIWE 3BTAA 3OUIA 3LKJA 4XDPA 5CFDB 4CE8A 4Y20A 1QEXA 5FY7A 1X33A 4XAAA 4A7KA 5A33B 1PZ8A 3JCIA 3WVJA 1ZZ6A 3U4XA 3UT0A 1NCRC 3IMNA 4CCLA 2B5HA 5LK7B 1RUH1 3GBWA 1QOTA 2OKXA 2XJSA 2GALA 5JMCA 1A3KA 3PTRB 5GLTA 1DG6A 1F4AA 1OD5A 3VHPA 3VKNA 4I2OA 1W99A 3DPRC 4AAXA 4LBQA 2UYBA 4EN8B 1MS4A 1QJX1 2DVFA 1HRI3 1CESA 1AR63 2K46A 5GLZA 4QPGC 4BIOA 1YWKA 1VB4A 4LXLA 5DG2A 4P9IA 3DYMA 4BB3A 1JHJA 2WFF3 1XYNA 4PHZA 2ZX4A 4J1XA 4LBMA 5FZ9A 2GSYA 5JUVA 4N53A 4PQQA 4LO8A 4XFCA 3ST7A 3IKWA 1KDMA 1AR71 4ASLA 3MFCA 3OPZA 4NHXA 4F7ZA 4JKKA 1YUDA 5AC91 1VBA3 1Q8VA 2P5BA 3AMNA 2EAKA 1LRHA 4FPOB 4EWEA 3TNPB 2ZEWA 2WS93 3AKPA 4JGYC 3I2JA 3IM0A 5K0UA 4ARXA 1O4ZA 4BK4A 4DXTA 3I2FA 4YVSB 2C1FA 1NE6A 4HOOA 3NMBA 3ZFFC 3OGVA 4CP9B 2OW4A 3PU8A 4NMIA 3POBA 5A7NA 4HLTA 2VZ1A 1G6NA 4MXWB 4A6SA 1WCUA 4CXXA 1PGSA 3ZN6B 4FOYA 2P3JA 4Q4Y3 3UKTA 1PMHX 2CSGA 3ZXFA 5LY1A 4N8MA 4IE4A 4CCCA 2PLV3 1O6UA 2ERFA 2XJQA 3C2UA 5FQ0A 1E5RA 2HWF3 3D3AA 2PHUA 3N35A 3K4ZA 1IS5A 2VQ0A 4J25A 1PZ9A 1PMIA 3D4KA 4NO4A 2H0VA 2BYVE 3I49A 3WP6A 3ZXGA 2GNTA 2NZ9A 4KG0A 1G9FA 1NUKA 4WM8A 1MVEA 2WZPP 3NVCA 2Y60A 5IAVA 5SV5A 3S5QA 3QACA 5EPAA 3HQRA 1OHFA 2V72A 1OXCA 2UU8A 3O1SA 4Q8KA 5ACA2 2YG0A 4CU9A 1RL3A 2PHRA 1SLIA 2PN5A 4MHUA 1LHNA 2VTXJ 4UFKA 3VKOA 4JQTA 5HPOA 3N4MA 2Q8CA 1LULA 5AVPA 4Q0VA 2HWC1 1FV2A 2O8OA 3N7JA 3NV2A 5JSPA 2CGOA 4B29A 1NZCA 1IOAA 3JU9A 4AHZA 5FJHA 2R041 3POEA 4DXRA 1FX5A 3DECA 3LF7A 1J3PA 2B8MA 2GH2A 4I0WB 5FBZA 1IPKA 1OI6A 4M0NA 4Q2FA 4NRMA 5A80A 3FLRA 4HPKB 3MLKA 4U36A 3IDAA 3I7DA 3LEGA 2BWCA 1DBNA 1V9U2 2HEYF 1UY1A 3ATGA 4FPKA 4YVWB 3BPSA 4H3WA 5C3SA 1JOBA 1OPOA 4CXYA 3B94A 3H3UA 4QGNA 3V65A 1F4HA 1XB9A 1HJFA 3U1XA 1POQA 1CAVA 3I3EA 1GMMA 1N1TA 2XUEA 4BDVB 4NIIA 4JRLA 2XL9A 3ZFGB 3WP3A 4IEOA 1YC61 3OUHA 4CDUA 1XYPA 1RUC2 1U5YA 2E7AA 5C3OA 2WNVC 5A3WA 3WEZA 2GU9A 2NLRA 1J3RA 4Q4W3 1GNZA 4NN0A 2JDAA 3WNOA 1RUJ3 3UV9A 1NZIA 4JGZA 4W65A 4B4RA 5CFCB 4RS5B 1NQJA 4BQWA 2QDNA 1JZ6A 1PVXA 2VZUA 3BU7A 3ROUA 2QQVA 3WP5A 3OGSA 2ZX0A 3BGAA 3BTXA 5F1RA 3AC0A 1TME3 3THTA 3TEZA 4OHVA 3MEPA 3ASIA 2CDPA 2CGNA 5KBFA 1S2EA 3SITA 4GWMA 1EUTA 1SEFA 2WL1A 1OQDA 3CL1A 2FDHA 4GKXA 4AGVA 4MV2A 4N90A 4AI1A 4E8CA 4NPLA 3O1OA 4QGLA 1BVVA 1JZ5A 1WUVA 4MHRA 1QJY3 1LOFA 1JYNA 1KDKA 2EVXA 1VBC3 1S0CA 4FO9A 5A3PA 4YGCA 3EHKA 2ZS6B 4WVMB 5IAXA 2CNAA 4XJ9A 4Z8BA 1ZA7A 4S2FA 5CADA 4BHPA 5F3CA 2ZABA 1AYM1 1NLQA 2A6WA 2Z5WA 4YPJA 2SLIA 5SV8A 4CP1A 4MGIE 1PK6B 4E9KA 2CV6A 2YV8A 1W28A 1MEC2 3NQHA 3T4VA 4BCUA 4JGZC 4ZKTB 1J84A 2XWBB 2AZ5A 2Z69A 3RYRA 4B7EA 1JOJA 1ZBE2 3OPTA 2VBBA 1I6XA 1HXS3 4HANA 5KHHA 4HONA 1WKYA 5BNNB 3ZSMA 2PHXA 5I0TA 3CJIB 1T2XA 4XFHA 4K21A 2VC9A 4HN1A 3WCSA 5FLHA 4A3ZA 4LIVA 1AL22 5FPZA 2XL7A 4YM3A 2P6CA 1GOGA 4KG8A 5I8TA 4AHXA 3O1RA 1W06A 1OOPA 1LOFC 5A6ZA 4NIDA 4OHXA 5FZIA 2WN2A 3FUQA 4P00B 2W47A 4PIZA 4UWDA 1JTZX 2CY6A 1UF2C 2NMNA 4QAWA 5KHGA 1GZCA 2GC3A 1K12A 5FYIA 4AGRA 1WW7A 1XYOA 2VOKA 5KWRA 2PAEA 5ISLA 1LHOA 3AL5A 1DZQA 5H9SA 1PIV3 3K46A 1S0FA 2ORZA 1CR7A 4CTEA 4YM0A 1MS0A 3BTZA 2R1BA 4MLOA 3RMYA 1WBLA 1B35B 1X82A 2VNVA 2WLPA 3B02A 5GZFA 4GA9A 2HWE3 3SCFA 2VOWA 3KV9A 4CUCA 4LK6A 5EXOA 4EYUA 2RS52 5A7SA 5JMOA 2CAUA 3T0AA 1TE1B 2VOXA 1AR92 1YI9A 3SH3A 3MLJA 4V1PA 5FLIA 3ACHA 4DFSA 4CDWA 4KGQA 4YSFA 1SACA 5F3GA 4OYUA 5LK5A 1RIRA 4Z1VA 4YZ5A 5FYTA 3WF4A 5DAVA 1Z7S3 4HKWA 4JTOA 3MYXA 4ZU5A 2R16A 2JDKA 4HKOA 3OB8A 5LZ6A 2WSVA 5FPAA 2R073 2VVFA 1OOPC 3KV4A 4U2AA 3WV6A 4DB5A 2WYFA 2VW1A 1LB2A 4R9CA 4M3CE 3USUA 4Q0UA 1NLRA 4CXWA 1UOGA 3J7HA 3BODA 1OQ1A 3T3YA 1BEV2 1RJ8A 2Q1MA 1PNGA 3PJQA 1YQ8A 1LGNA 1OSGA 3SISA 4DEQA 2XVGA 3ZR6A 3DYOA 3NNJA 4CDQC 3BB6A 5F5QA 2JJ6A 1BQPA 4NHKA 1WMEA 1GUIA 1LJ7A 3U14A 1VALA 5HCAA 4RR3A 5JXGA 1EPZA 4CCEA 2JG8B 1JW6A 4K8FA 3N7LA 4YZ4A 5DUWA 3S6PA 2Q5TA 3I54A 4ZPIA 4ZS2A 3WW4A 3CZJA 2W3JA 1UZZA 3LOIA 3SXWA 1WLWA 3FWEA 2G1MA 2D40A 4KL1A 2QZ3A 4LKFA 2RM23 2XBO3 1QQP2 2DBIA 4HMZA 1MZ5A 1BBT3 4SLIA 3VDDA 4B4PA 1OF3A 2A70A 2HJIA 3VBFA 4C8DA 2R0HA 2R30A 1V00A 4QX0A 3FC0A 1W8WA 3AJZA 3BALA 2UY9A 2Y8KA 4AAPA 5GZGA 3V0BB 4KQ7A 2LM3A 3MUZ1 4YYOA 3B7MA 4FOVA 2ZXQA 3RSJA 2YFUA 5FZ1A 1UD1A 1EV13 4PQ9A 5IUQA 3VKMA 4TYSA 4Q0SA 5LA0A 2ZGTA 4XDOA 2WUHA 4V2VA 4LBJA 5J3UA 2OPWA 3T2PA 4S2GA 4BWOA 1ASJ1 1YI7A 2JG9A 2J42A 2ORXA 2PMWB 2E33A 5FZBA 3GXUA 4C91A 1NA1A 4LT5A 1UPIA 3LPGA 3ZX7A 4TSVA 1HV0A 5ACA1 2IVJA 5H9QA 3F95A 4OMDA 4ZY9A 2JDMA 3RDIA 4OI4A 4EE2A 1X50A 4KU8A 2DUQA 5FO9B 2MHFA 2WAOA 1SLLA 4SBVA 5T50A 3RFRA 5F5AA 5I8SA 3WDVA 5EJZB 1QDOA 4OUEA 1GZWA 3VBFC 2F4LA 2C5DA 3CU7A 4FTBA 3HIFA 2E32A 4FPFA 2WO1A 2B45X 1STMA 3DCQA 1W0OA 4AYUA 2BJSA 4AG4A 4RYDA 4CZSA 1R1ZA 2X5IC 4X8NA 4K40A 1VBD2 2L9LA 1V9U1 3E5XA 1Q43A 4N53B 1H9WA 2PAKA 4QPIC 3A0NA 1LNSA 2HYKA 2HH9A 4I3GA 4M00A 5FP4A 4LBOA 3ELNA 3PVBB 1PVC3 2ZGPA 3RQ0A 3ZMOA 1V6IA 4RQPC 4BISA 1O3RA 1NA1C 1RUF2 3RZHA 2VZ3A 2OYZA 2TUNA 4NUBA 2E6VA 2ZGSA 3ZYGA 5K0UB 2BBVA 1OUXA 2ETEA 1L7RA 5LW9A 3J8F3 4MX3A 1EAH3 3WNKA 1LHVA 3DGTA 1W8ZA 4YLZA 1JZ4A 4HVOA 4Y4RA 3WHTA 2HYXA 5FZAA 4EZHA 1W6PB 2WWSA 1JU4A 3OPWA 5FREA 4CU7A 1CZSA 3ZXAC 4COUA 4QX5A 2QQUA 4YFZA 4XMIA 1HIXA 1TMF1 2W91A 4ZZ5A 2WNUC 4TZDA 3OBTA 3SQOA 2E63A 1RUG1 5CFDC 1KS5A 2AYHA 4XJAA 2DVBA 4BQ3A 2RS31 1IZ3A 1AJOA 4IEXA 5C3RA 3H50A 3Q8CA 1XNAA 2W1SA 4FFHA 4IGQA 2X10A 4ZONA 1S0EA 1D4M3 3AXDA 4YNIA 1SQ4A 3HAGA 3BYWA 5FQ0B 1IS3A 3AYCA 3IIIA 3IZOA 4P9LA 2BERA 3ZVXA 4XF0A 2XH6A 3ZKYA 4AW7A 4PF1A 4CP9A 1NLSA 2V4AA 2WO3A 4UF0B 1HLCA 1CAUB 2VMGA 5A3OA 2DFCA 1SBDA 5GM0A 3ZSKA 4MXWA 3N36A 4CEYB 1XQNA 3ZN6A 3B9IA 1LESA 1FMD2 3QH7A 5L9BA 2QTWB 4AZZA 4LBNA 4EWDA 1N47A 2GNBA 3S57A 1RVF3 1AR82 1SHWB 1F2NA 2BQPA 5GLUA 2WZR1 4OFGA 1ZRDA 5EFUA 1ZBE1 2R062 2XVLA 5H9RA 1Y3TA 1OBNA 3T2TA 3Q8EA 1CIYA 3GZUC 1YXWA 4NAOA 4UBGA 5A7WB 2R6QA 4EV0A 1GV9A 2P3KA 1VAKA 4J1WA 3OTFA 5DXDA 2ZHMA 3RZKA 2FMYA 4XTPA 1FT9A 4QX8A 4D0QA 1AL21 4Y1UA 4O9EA 5A3LA 3NKTA 5FYZA 1OC1A 1RYYA 2NM1A 4MADA 5GALA 2Y6LA 4YVSC 3K77A 3KCYA 1AJKA 2C6SA 4AWDA 2W95A 3WR0A 4BLIA 4KWJA 1UY2A 1DGRA 3B01A 3ES1A 1CAVB 1RUI2 4ES9A 4XCAA 4CDUB 4YFWA 2ET1A 5FXXA 5KXDA 2Q1FA 3KWVA 1GICA 4OCTA 3OCPA 3WSOA 4HK8A 3PUQA 3GJAA 3E6BA 1W2TA 2ZBJA 3PHMA 4HPKA 1POV3 4KNCA 3H1WA 3AX4A 3H3ZA 1W0PA 1HN1A 4CU8A 1NYWA 4QWNA 5DMYA 3K4DA 4W6YA 4YVWA 1W8FA 3RMXA 3B5LB 3W58A 1KXGA 2YBPA 1HX6A 3K2OA 2YC2A 2QQPA 2Z42A 2GZWA 1UYXA 4OLLA 3WXPA 1G9CA 3VDBA 4IETA 1TNFA 3OD4A 5JOYA 3ZFGA 3ZXDA 4XE9A 1SDDB 4Y1XA 3NKGA 3VL8A 3PNAA 1RTVA 3VHOA 3M7AA 3MICA 3ZXJA 2OA2A 1CZTA 5FPUA 3WDUA 2DFBA 4E8DA 1V6MA 1UIKA 1RUH3 3JD72 3H8RA 2EALA 1UYYA 3SH5A 3WY6A 5CFCA 1QJEA 3AYEA 4RS5A 1CD3G 3GCXA 4QXCA 1QJX3 1SCRA 1BEV1 4XYXA 4CPBA 3FZ3A 1C8M1 1OLMA 2W9XA 2PELA 3CIHA 2VPVA 3POIA 3UL2A 5IVFA 5M0TA 2XG3A 1ZYBA 3UNPA 5DPNA 2E7QA 2JXAA 1I9RA 1H1IA 3IDBB 5LBFA 5C5TA 3CBNA 4XIKA 4YW3A 5FYMA 4QQ2A 2YC4A 5FZLA 1AR73 3T0BA 1UKGA 1WZXA 3O1UA 3D6EA 4CDXB 1YJKA 4WVMA 5AC93 1AYN2 2RR11 4PLOA 1QNWA 1RUD1 4FQZA 2WWJA 5LEKA 1W2OA 1QQP1 2WYSA 2A75A 3M3QA 4Z07A 1C1LA 5G05L 1PK6A 2E51A 1SG3A 3D0JA 3KS7A 3CDZB 3DV8A 5A7PA 5BPXA 4XUOA 2ATFA 3E5QA 5CFCC 3C7OA 1JN2P 4RS5C 4NIHA 1FV3A 1M4WA 3KQRA 1QJU2 3LE0A 2P37A 2VAUA 3PL0A 1YQCA 1W2AX 4BXFA 1MR5A 4N43B 4XVHA 4BMEA 2WT2A 2WFPA 2WABA 3TBDA 2VMIA 3CJIA 1S0JA 2XB6C 4XQWA 5T55A 1E57A 1CX1A 1QH7A 3AZZA 3M3CA 3RYKA 3N9LA 1LEMA 2I45A 3UGGA 2G9GA 5IVBA 2WQ8A 4OHZA 4FAGA 3ACGA 2D6MA 5FXZA 1O8PA 2YPDA 4FPHA 3BPZA 5F5CA 3ZN4A 2QQIA 3BCWA 4Q4V2 5KC5A 3J7NA 2W1UA 3C8XA 2HKXA 2ZHNA 1TNRA 4CDWB 2R32A 4XBNA 3I3BA 2D6NA 3AJYA 3MFAA 2WINB 3LA7A 4QQLA 1JYTA 2IZWA 1HRV2 3RI9A 1ZBA2 3Q8BA 2DUPA 2OZJA 2PHLA 3NV3A 1B35A 4YRDA 3USSA 2GMMA 3FHQA 1VBD1 4KWKA 2WDBA 3O1VA 1EY2A 2VZVA 1G86A 2AREA 5IW0A 4LO5B 1DZTA 3WHUA 2HWC3 3WF0A 3LCPA 3D0SA 3LIHA 1MPXA 1WMFA 5BNNC 4PIXA 1KGYA 3CJIC 3OOXA 4AFCA 1CPMA 5FLJA 5JXIA 4QT6A 2R043 5C3QA 3VUOA 1RUF1 1U0AA 1VAVA 2EXHA 3ZXKA 2BDRA 2YGLA 2XWJB 1NOVA 1HB1A 4IL7A 3KGZA 4X6QB 2Z2SB 4DMIA 3W5MA 2E26A 2ZMKA 3M1HA 1JYIA 3R4UA 1OD3A 2DU0A 4FFGA 1OA2A 5AVAA 4F8AA 1R1A2 1T6GC 4XCBA 4XUQA 5K4LA 1YRZA 3T2OA 4GWNA 1CQ9A 4RD7A 1RHI2 4ZZ8A 2ZA9A 3VDDB 3DF0A 3OGGA 3KCCA 4LO4B 3KMHA 2IC1A 1GLHA 1S2BA 3OY8B 1B35C 3WDWA 4IGPA 4R4XA 5EIYB 3LOBA 2PHDA 4XJUA 1BKZA 1Q8SA 1U5ZA 2WO2A 3OGJA 3POFA 4E2GA 4LBQD 2JG8A 3IPVB 3M4FA 3OF1A 2TEPA 4XFIA 1GQHA 2H6CA 2RDQA 1SBFA 3CKHA 4QX7A 2Y6GA 2SBAA 4MUVA 5DAQA 3PUSA 3SCHA 3ZSJA 5IT6A 4LLFA 3ZO0B 1W6NB 2FCVA 3B93A 4L8QA 3JBG2 2JG9B 4NHYA 4Q26A 1VPHA 5GZCA 1EPWA 3AL6A 3GJBA 2VMCA 2O0OA 1UO9A 4P5YA 4YW5A 1REDA 4MYEA 3SEPA 3FLTA 1COV1 2QNKA 5DDJ2 4RN5A 3TOJA 1LGCA 2AEYA 1PO22 3GHMA 3V0BA 3NV1A 5FO7B 5GZEA 2VY0A 4LE3A 1R082 2A73B 1AR81 2J1AA 2LTNA 3FJSA 1VMHA 2DYCA 3TN92 4O61A 4O9GA 1Y9GA 5J36A 4AI8A 1HRI2 4XMAA 2W2IA 4C0HA 1GZWB 2R061 2ZX2A 2ZZJA 3THCA 3WW1A 1AR62 4AFDA 1JUHA 3NO8A 1OT5A 1XJAA 1AYM3 4MOAA 1X8EA 1LHUA 3I4IA 1DIWA 1R092 5F2WA 5C33A 1M06G 1KEXA 4YW6A 2JB8A 2VXRA 5BUVA 1F5JA 2ZKLA 4D7YA 4LHSA 2ZGUA 2JG8C 5FZEA 2GN3A 4QU2A 4HSLA 5FZMA 3M3EA 2X05A 5ABJB 2D6KA 1PZ7A 5A70A 5CEHA 3NW4A 4Y1YA 3WNLA 5C71A 1D2SA 4R4ZA 4NR1A 1JYVA 5EJ1B 5DN2A 3WDXA 1VBA2 1RUI1 1XSRA 4BJ0A 4AVAA 1FNZA 4M3CF 3O1MA 4NROA 2WS92 5F3IA 1Q8QA 3UGFA 3PIJA 1AVBA 5D21A 1SCSA 5FK8A 3ECQA 5FYVA 4QGMA 4D6SA 1KD7A 2YHJA 3OJBA 3QCWA 4LUKA 2FDKA 3HQUA 2DVGA 4QU1A 2PA7A 1DGWA 1TG7A 3BOPA 1ODMA 4C1XA 1DYKA 1K5JA 4JZRA 4DRRA 5DABA 4AI0A 1MS5A 4OHYA 4HK9A 1ODNA 1XNBA 3VLBB 3ZXLA 2XDVA 1LHWA 3H1YA 1HJGA 1PO12 4Y4YA 4Q4Y2 5FR3A 1UMIA 1CAXB 3CZUA 2PTMA 4YW4A 4FPEA 4DNYA 4XJWA 4BQ2A 1OKQA 1OQEA 5A32A 5APAA 1G9DA 2JICA 3SHRA 2E7TA 3KHBA 4YG3A 2HWF2 3H1MA 5BNPA 5FZ8A 4OZOA 1W6PA 3AVRA 4ZU7A 3MF9A 1G9AA 3JD71 5KHJA 1RUE2 4A7ZA 2WNOA 3N9NA 2QFEA 5J98B 3VD7A 4BH9A 4E2QA 3MI8A 4XUPA 2G4IA 3MF6A 2W1WA 4CVUA 3E6CC 3ZYBA 3I2IA 4FI9A 4TTGA 1H1MA 1RINA 2Y34A 2GNDA 3OD0A 4X8PA 2FD8A 4QQHA 4Y1VA 2XQXA 4BU2A 1WW6A 2EF6A 4XFBA 4BQXA 4N53C 1UYZA 4RA0A 5EJ3A 4NOTA 5IWFA 2DF7A 2R0FA 2A7AA 2D7FA 1W8TA 4DINB 1XOYA 4IV1B 4DY5A 5FZHA 5JI9A 3I3MA 1UY3A 4UF0A 1CAUA 1OA4A 4DO0A 3C7GA 4AFBA 3E1F1 3AKQA 1NT0A 3B9CA 2PQQA 1AYN1 4JCKA 1XNDA 4E4HA 1GWLA 1OPMA 3CMGA 3VBHB 3KQ4B 3LDKA 4CEYA 5A3MA 1GZTA 5K0UC 1QNYA 2OT7A 1LOCA 4CUBA 2ARBA 1BMV2 2W1QA 4PDWB 2WJSA 2VBPA 3SCGA 1FPN1 4C0BA 5I0RA 4LUMA 1S55A 4WM7B 2PHWA 4DUWA 2Y33A 1JYCA 1VBE2 1DLLA 1XBFA 4EN9B 1JI6A 3VL9A 1QJU1 4IGOA 5A7WA 5FO8B 4NAMA 4Y5TA 1WCKA 4LHNA 1WA4A 4D94A 5L9RA 5EQUA 2C26A 4BLJA 1G7YA 5FXVA 3RZMA 3T09A 1HQWA 3MIFA 2FQPA 3PDQA 4XQDA 2ZZQA 1GSLA 4EWAA 2RMU3 2YUEA 4Z2AA 4AVBA 1RUJ2 1UOFA 1BK0A 4YGEA 1VR3A 3D5OA 1ULOA 1LKNA 3R0RA 4PBPA 1ZREA 4Q4V1 3LEMA 4WM8C 4Y22B 5G04L 1UCXA 5LCWL 1GWMA 1TME2 3RRDA 1IHMA 3VD5A 1US2A 2WNEA 1ASJ3 1W8HA 2OUJA 1LENA 4PF5A 4CEYC 2XGXA 5I8YA 4LLOA 1LAJA 2W94A 4IEWA 1X7NA 1K5MA 5HXMA 3VKLA 1W3VA 1FOD3 2EXJA 2JECA 1J3QA 1F5FA 5FCCA 2VG9A 1ZBA1 2MEV1 4LULA 5FFOC 4ZXKA 1DYPA 2RJ2A 4A6OA 5ACA3 5JWPA 5HCFA 3PIGA 3ZSEA 5DAPA 1BLZA 3KVAA 3O14A 3POSA 4LTAA 1K45A 1ULDA 3IDCB 1MACA 4XILA 3WQBA 4GAZA 1FATA 2P2KA 3GGLA 3O0VA 4QPWA 5GLVA 1H8TA 2E31A 4YW1A 4DIQA 2OVUA 1ENSA 1IPSA 5KXEA 3H9AA 5T54A 2FMDA 2BVVA 1EYBA 1OH3A 4YZ2A 5HV4A 1LU1A 1QXPA 2JE8A 1SLAA 5F5IA 1W6QB 3NJXA 2QQOA 2VCAA 1ND2B 2DBNA 1V9U3 1QMJA 2VU9A 1YCIA 2J7MA 4CU6A 3ZFEB 4RSUA 1UNBA 1VRH2 5J48A 2CTVA 2WBKA 1HXS2 3JUUA 3P3NA 3FBYA 1P8JA 4UAPA 5JVVA 1O59A 4CDUC 3THDA 5FP7A 1RHI1 2EXKA 3AZWA 4TLGA 3MPBA 1X9TA 3RJ2X 3VBRB 3TYJA 2FDJA 3I2HA 5FXWA 4L11A 5KHIA 1DZRA 3CNAA 1BCXA 4FOWA 2JENA 2E53A 4HT1T 4K8RB 4QB2A 1DQ6A 4ORFA 2DCYA 1TMF3 1VRBA 1ND3B 4LO6B 4URTA 4A4AA 2RDSA 4K9SA 4MXVA 4CDXA 2XONA 4S2HA 5LEJA 4YM1A 3JBG1 2NP0A 1RUG3 3BN6A 1F35A 1PIV2 2EIGA 2VJXA 2CL2A 3HR9A 3WG4A 1OLRA 4RFT0 2AUYA 2RS33 5EV7A 1NKGA 1RXFA 2J1EA 4M4RA 4AEDB 4AFAA 2HWE2 1G8WA 2BNMA 3G7DA 5DDJ1 1PO21 5FV3A 2EIBA 2O8QA 4H7MA 3ILFA 4Y3OA 1D0HA 2V73A 5C4WB 4BPZA 1R081 4Y33A 2EA7A 5T3NA 1SLTA 2A6ZA 3U0ZA 2BOIA 3TN91 3ZPYA 3GNEA 3MIBA 2ZAHA 4J6GA 1HRI1 5J37A 2RE9A 4NPMA 3LA2A 4N43A 2YROA 5FRAA 3U07A 5B4NA 3WNXA 4LK7A 5FZCA 4KWLA 4JKLA 1R091 3VHRA 2R072 1JH5A 4LNVA 4XF9A 1YEWA 1UL9A 2Q8EA 1JBCA 4LKSA 2XKOA 1DGRN 1UIJA 2CYFA 2WZR3 3U37A 1KJLA 1ULEA 5A7OA 3SKVA 1WMDA 1X8MA 3T08A 3H7YA 3BVCA 1N3QA 1ZBE3 2YMZA 3PLQA 4EN6B 1Z78A 1AXKA 1VBA1 1H4HA 3ACIA 4Q0QA 3H8XA 1QU0A 5CA6A 4YM2A 5A6QA 3VGIA 1UAIA 2JWPA 2YGMA 4QQOA 4DUVA 4AL9A 5JOWA 1QH6A 1AL23 5T5PA 4UFHA 2B39A 3X29B 3GZEA 5C9AB 4L99A 3OBRA 1US3A 4NWVA 3TNQA 2VNRA 4B4QA 3MIDA 4IEQA 2XKPA 1Y43B 4JVAA 4N43C 2RHPA 1LCLA 3LEKA 2FDFA 4D6RA 1BBT2 2OXBA 2VCCA 4CA9A 2R1DA 1H8VA 1W8NA 4M4PA 2D3PA 1DGWX 2VZRA 3ORJA 3ZR5A 2JEMA 3AM2A 4LA2A 3WUCA 3T2QA 4DOUA 1NG0A 1PO11 1J1TA 1N1YA 1FXZA 3OUJA 1PGL2 4MZUA 1WLTA 4F83A 1RC6A 2ILMA 2HWD3 3LSEA 3ZDSA 3IMMA 2ENRA 4DZGA 3N9QA 4P9WA 1RUE1 4AHWA 3NNMA 4CDWC 3N3HA 3C3VA 2FZ2A 1GNHA 3E97A 3PUHA 3WF3A 3OYWB 2QQMA 4W4ZA 2XXZA 4AHYA 1WGPA 5CBLA 2KD7A 2A3WA 1BHGA 2ID4A 4IE5A 4QXKA 4XXPA 1YHFA 5J7MA 3OY8A 3OGRA 1WCSA 3VD3A 3JB8A 4CYDA 1B09A 4MO3M 4KMQA 2VMHA 5FZ4A 1C3HA 2HLEA 2JE9A 2VQUA 3A21A 3FLPA 3IPVA 2EXIA 2VQTA 1D4VB 3HT1A 2GC2A 4V2WA 3WX5A 2GN7A 5CU1A 2F6BA 1W6NA 5FMBA 4LKEA 3DPRB 4JRAA 4A41A 1H9PA 1BEV3 5LRSA 1C8M3 4XFGA 4FXGB 4AF9A 3LAGA 4QPGB 2NN8A 3O0XA 4MGYE 3AZYA 1REEA 1UXXX 2VXJA 3WQ7A 3ZYJB 4LKDA 4RR3C 4OQ9A 2WZ8A 2JDUA 4BYYA 3VZOA 1BMV1 2WLQA 4COYA 5FY1A 5FZOB 3MLLA 1DU3D 3K48A 1DQ2A 1PVC2 2XHNA 3O0WA 1JZ3A 1VBE1 3VDDC 1SZBA 2JKBA 2Y0OA 4COVA 4IESA 1S0BA 3ZIXA 4LPLA 2RR13 3AP4A 1RUD3 4N9HA 2NYYA 1IG0A 1QQP3 4W6WA 2D3SA 3AP6A 3H42B 1W9WA 3J8F2 4S2DA 5FP8A 3UKVA 3CJXA 1HDKA 4A3XA 5F39A 4JGYB 2UYAA 2D93A 4Z92B 1MS9A 2VNGA 2BNOA 5JSRA 2XJVA 5L7OA 3ETPA 1RUJ1 4OHWA 5ABJA 2AH2A 3IAQA 1XE0A 4JHZA 1WA6X 5BY5A 1ZVFA 2D43A 3ZFFB 1CN1A 1J59A 4XXAA 3HMYA 3RZZA 2JG9C 2E9QA 4FP3A 5DAXA 3K75B 4GJYA 4TXWA 1UYPA 2QQJA 1QGLA 1F15A 1RUC1 5GLWA 4PLNA 5A32B 3VD4A 1D7PM 3B3QE 1Y9MA 5FPLA 2W39A 5IVVA 1KITA 5CZKA 4COWA 2W68A 5DQ0A 1LODA 1V6OA 3Q8FA 5BNPB 3LB9A 3DXUA 4CEWA 4JC1A 5FKBA 4AXOA 2VUCA 1WLDA 1H1AA 1OVPA 1ULFA 2ZMNA 3I3QA 2JDPA 4H7LA 3IAPA 4PI2A 2ZJCA 3LZZA 1KFXL 1ENXA 2BUKA 4XJZA 1U5IA 3FUOA 3I3DA 4CUGA 1W90A 5FUIA 2XLFA 4GMP0 5A6YA 1YYNA 4FTSA 5DZGA 1CAXA 4ZHNA 4FSJA 4XBLA 3MZHA 4Q27A 5IK8A 1VJ2A 4JQRA 4XUNA 1GBGA 4DPNA 4MH0E 1VBD3 4LOTA 3RI8A 4HVQA 1HB2A 3MIHA 1VRH1 3VZNA 3N9MA 4D3WA 4QKDA 1HXS1 2V5DA 4DXZA 2PXJA 3ZYHA 1W04A 1WBFA 4RGGA 4ZXEA 3NV4A 3M70A 4EN7B 2BTVC 3PVEA 4K6BA 2PHFA 3AKSA 1XNCA 3QBQA 3SC7X 4YG0A 5LWBA 4AGGA 4YW2A 2BBAA 5FZ6A 2VZOA 3GCWA 1DCSA 2WQZC 3EB7A 4GB32 1W2NA 1DDLA 1A34A 4AQ6A 1WLCA 1MEC1 2DV9A 4P14A 4Y5SA 4PBOA 2QBXA 3EMRA 3WNPA 4IV1A 2X53S 5IVCA 1XE8A 2RDNA 3N7MA 4A44A 4XUTA 3PURA 1QOSA 1WCQA 3OG2A 3VBHA 4LJHA 2BU9A 4I09A 5J1XA 2VZTA 3MDPA 4LOSA 3RZJA 3I2OA 5JPNB 3AMHA 2WNVB 4ET7A 1AX1A 1H2NA 4PDWA 3KF5A 4IEUA 2ZAAA 1JXNA 5F6KA 4PCRA 2BFUL 5KC6A 2FDIA 4MG2A 2PQSA 4WM7A 4BQ1A 3GALA 1NX9A 4Y26A 3GM8A 4XURA 1O3SA 1X9PA 5IVYA 1IS6A 2VBDA 3MV01 2VD7A 1K5MB 2YB7A 4LMFA 2ZX1A 1JMUB 2ZGQA 5FZDA 1N3PA 3U78A 1CVNA 5J09A 5F9TA 1COV3 2WRAA 1RMU2 2WT1A 3E6DA 3ZIWA 1JU3A 2JKXA 2OPKA 1DYOA 1AR83 2RS51 2HWB2 4I30A 4WZCA 1VLNA 2EIDA 2XHKA 4IV1C 4M01A 1H8TB 4XBQA 1AR91 2I07B 1I1EA 1LOGA 5C70A 1QJX2 4Y22A 2R063 3VBUA 4XETA 4ATFA 2JDYA 4YZ1A 3VBHC 1V6KA 5DZEA 1JYWA 1PX3A 1OKOA 1ZZ7A 1L3JA 1O5LA 4GWJA 5FWJA 1H2KA 3EXUA 2TBVA 1NY72 4XF4A 1MQTB 3HQXA 4PDWC 3Q8AA 2R7EB 1Y7BA 5JAXA 5BNOB 1Z0HA 3FHAA 5FY0A 2Y0IA 4JX0A 4WM7C 4GD4A 1V6LA 3NJZA 1RB8G 3RVHA 4HKLA 2ZMLA 4JDMA 4G3YC 1HQLA 3QH6A 2BGPA 5LASA 3P1IA 1RUI3 1GFF2 1VIWB 4QB1A 3IWZA 4PT6A 2P4EA 3AMMA 4YZ3A 4KBBA 1YIFA 2EICA 3UYJA 2Y6KA 3ZYPA 1VP6A 3P6BA 2YY1A 3CQOA 2VOVA 2F17A 3ZYIB 1W6QA 4YVWC 1W9FA 2TNFA 5H9PA 3PVOA 1PGL1 2I2SA 2C9KA 4YGDA 1ND2A 4INDA 1BK1A 3ZFEA 2ZGOA 1HB4A 2ZHLA 5GZDA 2YXSA 4UW3A 5C5UA 4HL0A 1C5IA 3MV11 4FPCA 1L7LA 4N7UA 4QQPA 1FAYA 4NIGA 3ZFGC 4QHBA 2R49A 4AI3A 3WQ0A 3RJRA 1UOBA 2WA3A 2Y38A 3ON7A 2AENA 2P6HA 2Z4FA 3H8UA 5FJKA 2LS6A 3KGLA 2ADDA 3URFA 2GDFA 2XJTA 4QD2A 4Q29A 3CF6E 2VTXA 3ME2A 3VBRA 4OUSA 1W6OB 1VBB2 3DUIA 2XJPA 2Q8OA 2W87A 2LROA 3V64A 4Q4X2 1ZZ9A 5LA9A 3L2HA 4UFLA 4Y5Z0 3JD73 3M2MA 4M3CB 3FE5A 3LD8A 1C1FA 1ND3A 4IERA 2GC1A 5EYYA 1PNFA 1W05A 4XHXA 3AXEA 4AVVA 1GQPA 3AP5A 2FCTA 2VECA 1RJ7A 2QQWA 4EZ4A 3VZJA 2IFWA 1YJLA 3NL1A 2IFRA 4FP2A 4JTNA 1YFWA 4OVEA 4FAHA 5K8SA 4AEDA 3CO2A 3O1PA 1RXGA 1ND2C 3KZ4C 2RS12 3EYPA 5A6XA 3KCXA 2YBKA 3ZFEC 3JZVA 3WDYA 5C4WA 3TWIA 4UFJA 1TEIA 2HWC2 3ITQA 4RL7A 1Q8PA 2A3XA 1OLME 2Y6JA 5FUPA 2YZ4A 4BA6A 1SDWA 3VBRC 4CDQB 2ZHKA 4JV4A 1PK6C 1YFYA 2JE7A 2C4XA 4URAA 1A8MA 1NAEA 2JDZA 2OZ6A 3A0KA 4XOGA 4GXLA 4BIFA 3RZLA 1UKRA 2RG4A 1FPN3 5I0DA 1GP6A 1IQAA 5HBAA 1N3OA 2QQLA 4JAAA 2D6PA 5LBBA 1V6NA 4ASMB 1ND3C 1O3TA 1ZNPA 4QMAA 4NE9A 5F7UA 4XEZA 2OQ7A 4YGBA 2NMOA 1QJU3 1U5XA 3IT8A 4GIQA 5F37A 2QE3A 3HBKA 4XF1A 2QKDA 4DQAA 3K3NA 5FY4A 5BV6A 4UW6A 4OI2A 5JSOA 5DUXA 3B00A 1OFNA 4FT8A 2W0XA 1GOFA 1GWKA 1HN0A 5FYYA 1ZZ8A 4AEDC 4LITA 4EROA 5CISA 3GF6A 3AVSA 1UOJA 1GP4A 1J83A 5C9AA 3ZPOA 4CP0A 1JZ2A 1LOAA 3POWA 4NJ4A 5JOZA 4Q4V3 2FBEA 3ACFA 2AEZA 3K3OA 1W8UA 1C8NA 1DF0A 1QIQA 2RDRA 3N9PA 3ZYRA 3ZKUA 1W3XA 3AMQA 5LA1A 1QJFA 4FBFA 1OFSA 2JB4A 4RHV2 2WSUA 4UT5A 1ZBA3 2MEV3 3J7LA 5F2SA 2VVDA 3FFZA 3SEEA 5HCBA 3T1LA 1OURA 2QJVA 4K3UA 5JIAA 4C90A 3O12A 4DS0A 4GH4B 1AX0A 4DY3A 5A3TA 2QCSB 2WKKA 2G9ZA 3H0OA 2ZX3A 3AP9A 5FZFA 4ARYA 5IK4A 3OYWA 4HETA 4L92A 4M0HA 4ZS3A 4BK5A 3VBSB 2XJRA 1UZWA 3RNSA 1FMD1 4OQ8A 5C9AC 3MO4A 4QM8A 5FTTC 4GB31 1VB2A 1V0AA 3A22A 3HOBA 3UJOA 5HCHA 3I2KA 1VMFA 3KLSA 4QKNA 4W6XA 3ZM8A 1YQ6A 4Q0PA 1J1LA 4HXCA 3P3PA 3M3OA 1LOBA 3HJRA 3DPRA 1ONAA 1UPSA 4FTEA 1GR3A 1RHI3 5ERLA 2W52A 2VCMA 3UESA 2WFF2 4QPGA 1OUSA 5FY9A 5FP9A 2B9VA 4MGKE 5FPXA 1DQ1A 1GP5A 4HN0A 5IYYA 2P17A 2O14A 1D0GA 4Z82A 2C9AA 5L7OB 5FZKA 2G9FA 5FZOA 3V0AB 3WG2A 4Y1ZA 5FYHA 4XPVA 4AI9A 2X29A 1CAWA 1GOHA 5FP3A 3GZAA 2D97A 5JPMB 3Q9OA 4NPRA 1RGSA 4HZFA 5EWSA 2OS2A 1Y9QA 2WQ4A 1OMIA 1MZ6A 2W5FA 3PVNA 3KVBA 3BUCA 1ZA4A 4KI5M 4K7JA 2D5FA 1ULPA 3I2DA 4AR2A 3J26N 3OBZA 3POYA 4IEPA 1RMU1 4JGYA 5DDJ3 4CEWB 2GMPA 1PO23 5C8CB 1N1VA 1YLLA 2XUMA 2A6VA 4MVTA 1C57A 2EIEA 1R083 2Q4SA 3LA3A 1QXRA 2HWB1 4D69A 4GMP1 1CGPA 1FNYA 4MGQA 3ZFFA 3TN93 5C8WA 1ZZBA 3PU3A 4HSJA 3HWJA 2BNNA 1ZRFA 3LEIA 2CGPA 1T6BX 4G4FA 4P9GA 1XC6A 3AFKA 1MS8A 1NY71 1R093 2PLV2 4LBLA 2QUOA 1BVP1 3I2GA 2PHTA 2FCUA 1XU1A 5JXJA 4UI9L 3HEIA 3KV5A 3IDEA 4BQYA 5IK5A 1XNKA 2XLGA 2IWGB 2XPJA 1H2MA 1IQDC 5B2GB 2A5ZA 4AVSA 4WVVA 4IE0A 1APNA 1H30A 1SBEA 1ULCA 1W2UA 2WC2A 2WWUA 3O5SA 3AMPA 1DQ0A 1UWWA 4COZA 3CLPA 4XW3A 3WD5A 4P9XA 1ENRA 3U11A 4UBHA 3NAPB 1IKQA 4IDZA 4LORA 4YW7A 4XACA 2MPFA 4CCDA 3HBZA 4EJRA 5JR2A 2LUWA 4I0BA 5CYYA 4G9SB 4QDSA 2VZPA 2YU1A 2DCZA 3NJVA 4LE4A 1H4GA 1QXJA 4RGKA 2IXJA 5HXVA 4IEVA 1LOEA 3A4UA 1MZFA 5TSWA 5E1RA 1PHMA 2UWBA 1JZ8A 2ZEYA 1PO13 1NXMA 4A2UA 1W8OA 2RMU2 1VBB1 5BNPC 4TLFA 5FAXA 2PFWA 2QDRA 3NWKA 1S0GA 2A6YA 5FPVA 5C6CA 3N9OA 1I3HA 4Q4X1 5T5LA 2VO5A 2GP5A 1RUE3 2VZQA 3L2YA 1WD4A 2A6XA 2X09A 3QOPA 4JHTA 5JZGB 4GZ9A 5FYBA 1ASJ2 3VZKA 5JIUA 3TAYA 2CDOA 3MUY1 2VUJA 2LALA 4YWAA 1FOD2 5FK7A 2D44A 4Q4W2 2BGOA 2NPIA 3GDBA 2JD4A 5FBJA 4AEKA 4UW4A 1CJPA 2WNVA 2WZEA 2H0BA 3HPNA 3S30A 2AACA 4H2AA 1KRIA 3EO6A 2MNGA 2RS11 1FYUA 3KM5A 1RUNA 2KM2A 2WR9A 3VBUB 3WOGA 2VE1A 1IG3A 2Y64A 3W20A 1JYXA 5DUUA 2CU5A 3SKJE 3INAA 5DG1A 4FPGA 2OX0A 1G9BA 1HRV1 1OLQA 2OUHA 1AHSA 4LHKA 2IXCA 3QLQA 5JCTA 2Z79A 2Q0AA 1QJY2 4FPJA 4XFFA 1VBC2 3RWNA 1UY4A 3RG0A 2DCTA 1A6CA 1UZVA 1LU2A 1LECA 1NQDA 3LDBA 1XXNA 5KXCA 3PMSA 1VBE3 2GAUA 1AUYA 5FMDA 2JD9A 1UU5A 3KF3A 4E27A 1QF3A 2QQKA 5F8PA 2CWSA 5CAZA 5J96B 2VULA 3G6JB 1HW5A 5L73A 3MIEA 2J1UA 1H6XA 4BQ4A 1MQTA 5IVEA 1CONA 3FFQA 4NRPA 5BNOA 1UN1A 5HV0A 3AKTA 4B8EA 2ARXA 1MZEA 4P02B 1R1A1 4XQ4A 1TMF2 2HBTA 4B7KA 3BOWA 2WAAA 4IEYA 4R8HA 4AVCA 1ENQA 3UETA 1S0IA 4META 4MGZE 5FPBA 1RUG2 1K5MC 2IXLA 2J22A 1QWRA 1W0NA 2RS32 4HVRA 3POJA 3VKFC 1RUC3 1UX6A 4PIYA 3SH4A 1GU3A 2O1QA 3ETQA 4RHV1 4QKFA 4BXSV 1HQNA 4A7YA 1BJQA 1HB3A 3VZLA 1A78A 1OF4A 3L9JT 4AEJA 1WW5A 5EZWA 2K0GA 4KBZA 2P1BA 4I0AA 1BXHA 3LQCA 1H8TC 2VW2A 2NQYA 4PLMA 3KHCA 3BU0A 5CNAA 2YFZA 5LY2A 4FPLA 4AQTA 4HFSA 2B7YA 1LGBA 3RS6A 3HNMA 2Q8DA 4FFFA 3OEAA 1F8VA 3EQEA 3UJQA 3DN7A 2DDUA 4R9BA 5KXBA 4AFMA 4A42A 2D5HA 5L9VA 1MQTC 2DU1A 1PMJX 1W6OA 1HV1A 1NCQB 1NXD1 5BNOC 2AC1A 3PUAA 5FIXA 2WZR2 2BFUS 2IXIA 4QXHA 4X6RB 3AZXA 1LEDA 1AF9A 3SNMA 3W21A 4F3JA 1VRH3 4M3CA 2BEOA 2DCJA 2ES3A 1AR61 4FXKB 3VBOB 5K9YA 3BKZA 1W6MB 4WVZA 3ALQA 1Z7S2 4K1ZA 3PTYA 1HKDA 5DAWA 3WDTA 2WFF1 2GC0A 2OIIA 4Q5OA 2YYOA 1KJRA 2VH9A 3HNBM 3SLIA 2AR6A 1XSQA 1DGLA 1YFUA 2LW8A 3E5UA 3S5AA 1MEC3 1F9KA 3WUDA 3WG3A 4PI0A 1ZX5A 4CDXC 2ZEZA 2ZEXA 3ZSLA 1YQ5A 5JOXA 2VMFA 5D8AB 1S2KA 4NHLA 1GANA 3MIGA 1Y4WA 1O4YA 1SPPB 4HG6B 4ZU4A 1TVGA 2WS91 3HNYM 4KWUA 3WLUA 4CDQA 1C4RA 1CJDA 1CIWA 3OEBA 4HBNA 4AQ2A 4ASKA 2HWD2 3TB0A 1VAMA 2BWAA 1Q3EA 2PAMA 2VW0A 3APBA 4E4DX 3AYAA 2EAAA 4XZUG 3WCRA 5IHRA 5FOJB 3W59A 2QVSB 3DXTA 4RGAA 1WWYA 3POGA 4IV3B 2IUWA 1AXYA 1JHNA 5LBCA 2RM22 2XBO2 1EP0A 1GNYA 3FHIB 1CZVA 1S4CA 3R4SA 5DUVA 4LO7A 1WD3A 3LDRA 3AK0A 2DWRA 4CCOA 4D6QA 1GYKA 2K9ZA 4Q4Y1 2YBSA 5FMOS 2DUOA 3NNLA 1UW8A 5E88A 1O5UA 4L0PA 2HEWF 2GMEA 2PLV1 3MPPG 4LBKA 4DEVA 1EV12 2A3YA 3EBRA 4WBBA 2HWF1 1DP0A 2RS53 3O7OA 3QD6A 1DQ4A 5FMCA 5L36A 3H8OA 4KU7A 5ANNA 4Q8LA 5HI0A 2Y6FA 1AR93 3JQWA 2HEVF 3CEWA 3M3IA 5CIRA 1C8M2 3KD4A 3NNFA 3M8LA 4N7IA 2BZDA 1XNTA 3VD9A 3DEMA 3ZYFA 3WF2A 3I59B 3J4UH 2WN3A 5KR7A 2D3RA 3K4AA 1QY4A 5A1LA 4OUMA 1AX2A 1NCRB 3ZDVA 5I93A 1PGW2 4GH4A 4P5HA 2DTYA 1WCDJ 5CB7A 1ULGA 2XJUA 3W5NA 4YG6A 2RR12 3NJYA 1RUD2 3PMEA 2WO7A 3WINE 5IK7A 5A3UA 2VMDA 3RPQA 1CPNA 5KHKA 1J58A 2CAVA 1IKPA 3VBSA 1WW4A 1E5IA 2I74A 4AOCA 3AZVA 5C3PA 5A7QA 4QHOA 3JB4C 1EUUA 2X5IA 2RMU1 1ZRIA 2BW8A 1O4TA 1QJZA 2RV9A 2VOTA 2UWCA 3AP7A 4OULA 5FOBB 2VUAA 1UMZA 3THPA 4QPIA 1CAWB 5IFPA 4PJYA 5GKAC 5I0SA 4GKYA 5FZ3A 2VTFA 3UKNA 3MBWA 4ONUA 2B4KA 2BRTA 4TN7A 3S7IA 1YNAA 4RQPA 4Y20B 3T30A 4WV8A 1EAH2 1FOD1 2OQ6A 3K51A 4Q4W1 2YU2A 1UZYA 5JR7B 5CG8A 1XU2A 5FZGA 2J1VA 2N7GA 4FFIA 4CCKA 1BYHA 2D6LX 3MW3A 4QPYA 4GH4C 1POV0 2VMEA 5E6HA 3U10A 3KSCA 5IATA 3V0AA 4NRQA 4LBQB 4AQSA 5D1IA 1F31A 1W39A 4LHLA 1TME1 3GBFA 4P9JA 2WNUA 3KT7A 1ACCA 4IE6A 1VMJA 3LPFA 4L2NA 2Y6HA 4XTMA 5CFDA 3VBSC 4Q1RA 5GJ6A 4CCMA 5FDBA 1UQXA 1D4M2 1H6YA 4Y24A 5A33A 3R6SA 4BOWA 3GZTB 3VHNA 5L19A 5A1FA 5C8CA 4IEZA 5IFTA 1QJY1 3D82A 3N7KA 4R9DA 1VBC1 3C7HA 5E89A 1C5HA 4WVWA 2IXKA 1IGOA 4LR4A 4H55A 4XJ8A 3VDAA 4CCJA 1O7FA 4DXSA 1PM4A 1AZDA 3O1TA 1KS4A 1YIPA 5FYSA 4NIAA 2QQNA 3VV1A 2P3YA 1H2LA 1QHDA 4KH9A 2YC0A 1RVF2 5CKMA 1SFNA 4WZFA 5FY5A 2UWAA 3NNGA 5L7OC 2W46A 4P9YA 3UK9A 5EP9A 4C1WA 5ABJC 4YARA 3RGBA 3IB3A 1DHKB 3MW2A 3AFGA 5JLVA 4EN0A 3WF1A 5BNQA 3FX3A 5EYXA 2GH8A 5IJRA 4MGTA 3CHXA 4L9BA 5FYUA 4AVTA 4AEMA 3J9SA 2VZSA 4JDOA 4OI0A 4NHMA 1RUF3 3W9AA 3IIAA 3NSTA 4ISQA 3VN4A 1IPJA 2DVAA 4CEWC 1GKBA 1JOPA 5C8CC 5CKNA 4R52A 2VQAA 3WNMA 3NAPA 3TEYA 4YVSA 4B3NA 1GZ9A 1JODA 4UXAA 2G19A 4CP2A 1AL0G 3C7FA 4I01A 4WM8B 3SMHA 3U4SA 4QDQA 3BI3A 4LIUA 1REFA 1RITA 2XR4A 1PM7A 3FN9A 3ES4A 1PIV1 4XF3A 3KB5A 2RVAA 3GBGA 4OI1A 4DRVA 2JIGA 2P3IA 1DFQA 2VCBA 1COV2 1K42A 2C0ZA 1SFYA 2HWE1 4QKBA 5B4XA 3T0DA 4CRQA 2W92A 4BZ4A 1QDCA
chains in the Genus database with same CATH topology
1SMVA 3DL3A 4XHBA 1SLCA 3IN9A 4QM9A 4LA3A 5JZGA 1A8DA 3ACLA 1Z7S1 1ALYA 1RUOA 3KT1A 5CVRA 1FMD3 2DCKA 3MGUA 5E16A 1ZZCA 2R071 4XDQA 2ZCWA 3GYDA 1RUH2 5I0UA 3NAPC 2B9UA 3LWCA 1MS1A 3R05A 4GB33 5LRRA 3WW2A 2BPA2 4AK3A 4LEJA 3IBMA 2D98A 1C28A 2ZPXA 3ZXEA 2ZGNA 4JDNA 4BM8A 1KFUL 1AXZA 2W08A 2HWD1 2K2SA 1AR72 4JGZB 4H14A 4IQPA 1MS3A 1SLBA 1CX4A 2XLAA 3MW4A 4FPYA 5AC92 5JZGC 3RYPA 2RM21 2XBO1 1BBT1 2ZGMA 1MVQA 1KQRA 4NWWA 5F6LB 1O3QA 4KGGA 5FMOL 2DURA 1V6JA 2V5YA 2Q1ZB 1D2QA 1RMU3 2GNMA 2YPJA 5AFEA 1I5ZA 1EV11 2H6BA 2V09A 3H7JA 1XE7A 1S1AA 2HWB3 1QKQA 4GMP3 3WG1A 3VBUC 2VVEA 2ZTNA 4L97A 4K1YA 4OZXA 2RJLA 5CG9A 3T1MA 3KT4A 3LGRA 1ZRRA 2KXLA 2B42B 4ISRA 2ZOEB 5T5OA 4ES8A 3I8TA 1FI2A 2JX9A 4XZPA 2Y26A 4NVPA 3S0MA 1PGW1 2ZGRA 3ILNA 4GALA 1X36A 3WZ1A 3VZMA 3WT3A 1IS4A 2AGSA 4E2SA 5BYNA 4K20A 1UU6A 2BVBA 1NCQA 2CWMA 2FHRA 1FPN2 4N9IA 1OOPB 3V56A 2UURA 3EJKA 3LSDA 4TWTA 4ITCA 2FZ1A 4D7SA 1PVC1 2VNOA 5JI7A 2WIIB 1YO8A 2XVKA 2ZKNA 5E8AA 5AFBA 1JUIA 2QZ2A 2R042 3VBOA 1AYN3 2UY8A 1W6MA 5BNNA 1ZM1A 2F4PA 4MSVA 4I3PA 2D6OX 3J8F1 5JDBA 1EAH1 2WA4A 2YDEA 3WQ1A 3WW3A 1VBB3 4FVVA 2DTWA 3ZN5A 4Q4X3 4BMBA 4IXLA 2WT0A 2KA3A 5D8AA 3WP4A 1NE4A 4ATEA 4E4ZA 3ILRA 2ZGKA 4AE2A 1H0BA 1NCQC 2MEV2 1D4M1 2DVDA 2P34A 2RJKA 5C4WC 1Q8OA 5K7PA 3USUB 2RS13 2ZGLA 1ZRCA 4UW5A 5T52A 4IV3A 2ZACA 3VBOC 5T5JA 4GQ7A 2IXHA 1YFXA 2Q30A 3GHNA 3AYDA 1HRV3 1RVF1 4RR3B 4GULA 5I91A 3HN1A 1Q5OA 4FOQA 4D7TA 2BGCA 1LR5A 3DKWA 3AKRA 5D8AC 1V70A 3R4DB 1AYM2 1U12A 1QOOA 2VGDA 1UU4A 3VBFB 3ZMNA 3HD8B 1LTEA 1TQ5A 4FCAA 1GQGA 2X5IB 1DQ5A 3I59A 4XIOA 1S0DA 4I02A 3ENRA 1NCRA 2PYTA 4QPIB 1XRUA 1R1A3 3AB0A 4IV3C 5BXXA 2B46X 4XFAA 4BE3A 1O91A 3PJYA 1URXA 4RQPB 3D8CA 2ET7A 1NA1B 1Q56A 4Q1PA 3VN4A 1N1SA 4Z2WA 4FQ4A 5DZFA 2A71A 3HT2A 4R9AA 1POV1 4RHV3 4E4SA 3B69A 4AI2A 3FBMA 3FMGA 2X8KA 1OA3A 3JQXA 1BZWA 3S7EA 2WNUB 3JBG3 3BIWE 3BTAA 3LKJA 5CFDB 4Y20A 1X33A 4A7KA 5A33B 1PZ8A 3JCIA 3WVJA 1ZZ6A 3U4XA 1NCRC 3IMNA 5LK7B 2B5HA 1RUH1 3GBWA 1QOTA 2XJSA 2GALA 5JMCA 1A3KA 5GLTA 1DG6A 3VHPA 1OD5A 3VKNA 4I2OA 3DPRC 4LBQA 2UYBA 4EN8B 1MS4A 1QJX1 2DVFA 1HRI3 1CESA 1AR63 5GLZA 4QPGC 4BIOA 1YWKA 1VB4A 5DG2A 4P9IA 2WFF3 1XYNA 2ZX4A 4J1XA 4LBMA 2GSYA 4N53A 4XFCA 4LO8A 3ST7A 3IKWA 1KDMA 1AR71 4ASLA 3MFCA 3OPZA 4F7ZA 1YUDA 5AC91 1VBA3 1Q8VA 4FPOB 3AMNA 2EAKA 1LRHA 4EWEA 3TNPB 2WS93 3AKPA 4JGYC 3IM0A 5K0UA 1O4ZA 4YVSB 2C1FA 1NE6A 3ZFFC 2OW4A 4HLTA 1G6NA 4MXWB 1PGSA 3ZN6B 4FOYA 2P3JA 4Q4Y3 3UKTA 3ZXFA 2PLV3 2ERFA 2XJQA 3C2UA 5FQ0A 2HWF3 2PHUA 3N35A 1IS5A 2VQ0A 1PZ9A 1PMIA 3D4KA 4NO4A 2H0VA 2BYVE 3WP6A 3ZXGA 2GNTA 2NZ9A 4KG0A 1G9FA 4WM8A 1MVEA 2WZPP 3NVCA 5SV5A 3QACA 1OHFA 2UU8A 4Q8KA 5ACA2 1RL3A 2PHRA 1SLIA 2PN5A 1LHNA 3VKOA 3N4MA 1LULA 5AVPA 4Q0VA 2HWC1 1FV2A 2O8OA 3N7JA 3NV2A 5JSPA 2CGOA 4B29A 1NZCA 1IOAA 3JU9A 4AHZA 2R041 1FX5A 4I0WB 1J3PA 2B8MA 2GH2A 5FBZA 1IPKA 1OI6A 4M0NA 4Q2FA 3FLRA 4HPKB 3MLKA 4U36A 3I7DA 2BWCA 1DBNA 1V9U2 2HEYF 4FPKA 3ATGA 4YVWB 4H3WA 1OPOA 3B94A 3H3UA 4QGNA 3V65A 1CAVA 1N1TA 4JRLA 2XL9A 3ZFGB 3WP3A 4IEOA 4CDUA 1XYPA 1RUC2 1U5YA 2E7AA 2WNVC 2GU9A 2NLRA 1J3RA 4Q4W3 1GNZA 4NN0A 1RUJ3 3UV9A 4JGZA 4W65A 4B4RA 5CFCB 4RS5B 1NQJA 2QDNA 1PVXA 3BU7A 3ROUA 3WP5A 2ZX0A 5F1RA 1TME3 3THTA 4OHVA 3MEPA 3ASIA 5KBFA 2CGNA 3SITA 4GWMA 1SEFA 2WL1A 3CL1A 1OQDA 4GKXA 4AGVA 4MV2A 4N90A 4AI1A 4QGLA 1BVVA 1WUVA 1QJY3 1LOFA 1KDKA 2EVXA 1VBC3 1S0CA 4FO9A 4YGCA 3EHKA 2ZS6B 4WVMB 2CNAA 4XJ9A 4Z8BA 5CADA 4S2FA 4BHPA 2ZABA 1AYM1 2A6WA 2Z5WA 2SLIA 5SV8A 4CP1A 4MGIE 1PK6B 4E9KA 2CV6A 2YV8A 1MEC2 4BCUA 4ZKTB 4JGZC 2XWBB 2AZ5A 2Z69A 3RYRA 4B7EA 1JOJA 1ZBE2 1I6XA 1HXS3 4HANA 5KHHA 5BNNB 3ZSMA 2PHXA 5I0TA 3CJIB 4XFHA 4K21A 4HN1A 3WCSA 5FLHA 1AL22 5FPZA 2XL7A 4YM3A 4KG8A 5I8TA 4AHXA 1OOPA 1LOFC 4OHXA 3FUQA 4PIZA 1JTZX 2CY6A 1UF2C 2NMNA 5KHGA 1GZCA 2GC3A 4AGRA 1WW7A 1XYOA 2VOKA 5KWRA 2PAEA 1LHOA 1DZQA 5H9SA 1PIV3 1S0FA 4CTEA 1CR7A 4YM0A 1MS0A 2R1BA 4MLOA 3RMYA 1WBLA 1B35B 1X82A 2WLPA 3B02A 5GZFA 3SCFA 4GA9A 2HWE3 2VOWA 5EXOA 2RS52 2CAUA 1TE1B 2VOXA 1AR92 1YI9A 3SH3A 3MLJA 4V1PA 5FLIA 4DFSA 4CDWA 4KGQA 4YSFA 1SACA 5LK5A 1RIRA 4Z1VA 4YZ5A 1Z7S3 4HKWA 4JTOA 3MYXA 4ZU5A 2R16A 4HKOA 2WSVA 2R073 2VVFA 1OOPC 4U2AA 3WV6A 4DB5A 2VW1A 1LB2A 4R9CA 4M3CE 3USUA 4Q0UA 1NLRA 3BODA 1OQ1A 1BEV2 1RJ8A 2Q1MA 1PNGA 3PJQA 1LGNA 1OSGA 3SISA 2XVGA 4CDQC 3BB6A 5F5QA 2JJ6A 1BQPA 4NHKA 1WMEA 1LJ7A 1VALA 5HCAA 4RR3A 1EPZA 2JG8B 1JW6A 4K8FA 3N7LA 4YZ4A 5DUWA 3S6PA 2Q5TA 3I54A 3WW4A 1UZZA 3LOIA 3SXWA 1WLWA 3FWEA 2D40A 4KL1A 2QZ3A 2RM23 2XBO3 1QQP2 4HMZA 4SLIA 1MZ5A 1BBT3 3VDDA 4B4PA 2A70A 2HJIA 3VBFA 2R0HA 2R30A 1V00A 3FC0A 3AJZA 3BALA 2UY9A 5GZGA 3V0BB 4KQ7A 2LM3A 4YYOA 3B7MA 4FOVA 3RSJA 1UD1A 1EV13 4PQ9A 5IUQA 3VKMA 4TYSA 4Q0SA 2ZGTA 4LBJA 5J3UA 4S2GA 4BWOA 1ASJ1 1YI7A 2JG9A 4C91A 1NA1A 4LT5A 1UPIA 3ZX7A 4TSVA 1HV0A 5ACA1 5H9QA 3RDIA 4OI4A 1X50A 4KU8A 2DUQA 5FO9B 2MHFA 4SBVA 1SLLA 5T50A 5I8SA 3WDVA 1QDOA 1GZWA 3VBFC 2C5DA 3CU7A 4FTBA 3HIFA 4FPFA 2B45X 1W0OA 4AYUA 4AG4A 4CZSA 1R1ZA 2X5IC 4X8NA 4K40A 1VBD2 1V9U1 3E5XA 1Q43A 4N53B 1H9WA 2PAKA 4QPIC 3A0NA 2HYKA 4I3GA 4M00A 4LBOA 3ELNA 3PVBB 1PVC3 2ZGPA 3RQ0A 3ZMOA 1V6IA 4RQPC 1O3RA 1NA1C 1RUF2 2OYZA 2TUNA 2E6VA 2ZGSA 3ZYGA 5K0UB 2BBVA 2ETEA 3J8F3 4MX3A 1EAH3 1LHVA 3DGTA 4YLZA 4HVOA 3WHTA 1W6PB 2WWSA 5FREA 3ZXAC 4COUA 4QX5A 4YFZA 4XMIA 1HIXA 1TMF1 2WNUC 4TZDA 3OBTA 2E63A 1RUG1 5CFDC 1KS5A 2AYHA 4XJAA 2DVBA 5KC6A 2RS31 1IZ3A 1AJOA 4IEXA 3H50A 1S0EA 1D4M3 3AXDA 4YNIA 1SQ4A 3HAGA 5FQ0B 1IS3A 3AYCA 4P9LA 3ZVXA 4XF0A 2XH6A 4AW7A 1NLSA 1HLCA 1CAUB 2VMGA 2DFCA 1SBDA 5GM0A 3ZSKA 4MXWA 3N36A 4CEYB 1XQNA 3ZN6A 3B9IA 1LESA 1FMD2 3QH7A 4LBNA 4EWDA 1N47A 2GNBA 1RVF3 1AR82 1F2NA 2BQPA 5GLUA 2WZR1 4OFGA 1ZRDA 5EFUA 1ZBE1 2R062 2XVLA 5H9RA 1Y3TA 3T2TA 3GZUC 1YXWA 4UBGA 2R6QA 4EV0A 1GV9A 2P3KA 1VAKA 4J1WA 3OTFA 5DXDA 2ZHMA 2FMYA 4XTPA 1FT9A 5A3LA 1AL21 4Y1UA 4O9EA 3NKTA 2NM1A 5GALA 4YVSC 3KCYA 1AJKA 4AWDA 3WR0A 4BLIA 4KWJA 1DGRA 3B01A 3ES1A 1CAVB 1RUI2 4ES9A 4CDUB 4YFWA 2ET1A 5KXDA 1GICA 3OCPA 4HK8A 3PHMA 3E6BA 4KNCA 2ZBJA 4HPKA 4R9BA 1POV3 3H1WA 3AX4A 3H3ZA 1W0PA 1NYWA 4YVWA 4W6YA 3RMXA 3B5LB 3W58A 1KXGA 1HX6A 2QQPA 2Z42A 2GZWA 4OLLA 1G9CA 3WXPA 4IETA 1TNFA 3OD4A 5JOYA 3ZFGA 3ZXDA 4XE9A 4Y1XA 3NKGA 3VL8A 3PNAA 1RTVA 3VHOA 3M7AA 3MICA 3ZXJA 2OA2A 3WDUA 2DFBA 1V6MA 1UIKA 1RUH3 3JD72 2EALA 3SH5A 3WY6A 5CFCA 3AYEA 4RS5A 1CD3G 1QJX3 1SCRA 1BEV1 4XYXA 3FZ3A 1C8M1 2PELA 2VPVA 3UL2A 2XG3A 1ZYBA 2E7QA 2JXAA 1I9RA 1H1IA 3IDBB 4XIKA 4YW3A 4QQ2A 1AR73 1UKGA 3D6EA 4CDXB 1YJKA 4WVMA 5AC93 1AYN2 2RR11 4PLOA 1QNWA 1RUD1 4FQZA 5LEKA 1QQP1 2A75A 3M3QA 4Z07A 1C1LA 1PK6A 2E51A 3D0JA 3KS7A 3DV8A 5BPXA 2ATFA 3E5QA 5CFCC 1JN2P 4RS5C 1FV3A 1M4WA 3KQRA 1QJU2 2P37A 1MR5A 4N43B 4BMEA 2WT2A 2WFPA 3TBDA 2VMIA 3CJIA 1S0JA 2XB6C 4XQWA 5T55A 1E57A 1QH7A 3AZZA 3M3CA 3RYKA 1LEMA 2I45A 2G9GA 4OHZA 4FAGA 2D6MA 4FPHA 3ZN4A 3BPZA 3BCWA 4Q4V2 5KC5A 2HKXA 2ZHNA 1TNRA 4CDWB 2R32A 4XBNA 3MFAA 2D6NA 3AJYA 2WINB 3LA7A 4QQLA 2IZWA 1HRV2 3RI9A 1ZBA2 2DUPA 2OZJA 2PHLA 3NV3A 1B35A 4YRDA 3USSA 2GMMA 4KWKA 1VBD1 1EY2A 1G86A 2AREA 4LO5B 1DZTA 3WHUA 2HWC3 3LCPA 3D0SA 5BNNC 1WMFA 4PIXA 3CJIC 4AFCA 1CPMA 5FLJA 4QT6A 2R043 3VUOA 1RUF1 1U0AA 1VAVA 2EXHA 3ZXKA 2YGLA 2XWJB 1NOVA 4X6QB 4IL7A 3KGZA 4DMIA 2Z2SB 2ZMKA 3M1HA 1JYIA 3R4UA 2DU0A 5AVAA 1OA2A 4F8AA 1R1A2 1T6GC 1YRZA 4GWNA 1CQ9A 4RD7A 1RHI2 2ZA9A 3VDDB 3DF0A 3OGGA 3KCCA 4LO4B 3KMHA 2IC1A 1GLHA 1S2BA 3OY8B 1B35C 3WDWA 4R4XA 3LOBA 2PHDA 4XJUA 1BKZA 1Q8SA 1U5ZA 3OGJA 4E2GA 4LBQD 2JG8A 3IPVB 3M4FA 3OF1A 2TEPA 4XFIA 1GQHA 2H6CA 3TRSB 1SBFA 2SBAA 4MUVA 3SCHA 3ZSJA 5IT6A 4LLFA 3ZO0B 1W6NB 3B93A 4L8QA 3JBG2 2JG9B 4Q26A 5GZCA 1EPWA 2O0OA 4YW5A 1REDA 4MYEA 3FLTA 1COV1 2QNKA 5DDJ2 3TOJA 1LGCA 3GHMA 1PO22 3V0BA 3NV1A 5FO7B 5GZEA 2VY0A 4LE3A 1R082 2A73B 1AR81 2LTNA 3FJSA 2DYCA 3TN92 4O9GA 5J36A 4AI8A 1HRI2 4XMAA 4C0HA 1GZWB 2R061 2ZX2A 2ZZJA 1AR62 3WW1A 4AFDA 1JUHA 3NO8A 1AYM3 1X8EA 1LHUA 3I4IA 1DIWA 1R092 5C33A 1M06G 5BUVA 2VXRA 1F5JA 2ZKLA 4D7YA 2ZGUA 2JG8C 2GN3A 4QU2A 4HSLA 3M3EA 5ABJB 2D6KA 1PZ7A 3NW4A 4Y1YA 1D2SA 4R4ZA 3WDXA 1VBA2 1RUI1 4AVAA 1FNZA 4M3CF 2WS92 1Q8QA 1AVBA 1SCSA 3ECQA 4QGMA 1KD7A 2YHJA 3OJBA 3QCWA 4LUKA 2DVGA 2PA7A 1DGWA 3BOPA 4C1XA 1DYKA 4DRRA 4AI0A 1MS5A 4OHYA 4HK9A 1XNBA 3VLBB 3ZXLA 3H1YA 1LHWA 4Y4YA 1PO12 4Q4Y2 1CAXB 2PTMA 4YW4A 4FPEA 4DNYA 4XJWA 5A32A 1OKQA 1OQEA 1G9DA 2JICA 3SHRA 2E7TA 4YG3A 2HWF2 3H1MA 5BNPA 1W6PA 4ZU7A 3MF9A 1G9AA 3JD71 5KHJA 1RUE2 4A7ZA 2QFEA 5J98B 4BH9A 4E2QA 3MI8A 2G4IA 3MF6A 3E6CC 1H1MA 1RINA 3OD0A 2GNDA 4X8PA 4QQHA 4Y1VA 1WW6A 2EF6A 4XFBA 4N53C 4RA0A 5EJ3A 4NOTA 2DF7A 2R0FA 2A7AA 2D7FA 4DINB 4DY5A 4IV1B 5JI9A 1CAUA 1OA4A 4AFBA 3AKQA 3B9CA 2PQQA 1AYN1 4JCKA 1XNDA 1OPMA 3VBHB 5A3MA 4CEYA 5K0UC 1QNYA 1LOCA 2ARBA 1BMV2 3SCGA 4PDWB 2WJSA 5I0RA 1FPN1 4C0BA 4LUMA 1S55A 4WM7B 2PHWA 1JYCA 1VBE2 1DLLA 4EN9B 3VL9A 1QJU1 5FO8B 1WCKA 4LHNA 1WA4A 4D94A 4BLJA 1G7YA 1HQWA 3MIFA 2FQPA 4XQDA 2ZZQA 1GSLA 4EWAA 2RMU3 2YUEA 4AVBA 1RUJ2 4YGEA 1VR3A 3D5OA 1LKNA 3R0RA 4PBPA 1ZREA 4Q4V1 4WM8C 4Y22B 1UCXA 1TME2 3RRDA 1IHMA 2WNEA 1ASJ3 2OUJA 4PF5A 1LENA 4CEYC 2XGXA 5I8YA 4LLOA 4IEWA 1X7NA 1K5MA 3VKLA 1FOD3 2EXJA 2JECA 1J3QA 1F5FA 5FCCA 2VG9A 1ZBA1 2MEV1 4LULA 5FFOC 4ZXKA 1DYPA 5ACA3 5JWPA 5HCFA 3ZSEA 4LTAA 3O14A 3POSA 3IDCB 1ULDA 1MACA 4XILA 1FATA 2P2KA 3O0VA 5GLVA 1H8TA 4YW1A 2OVUA 1ENSA 5KXEA 3H9AA 5T54A 2FMDA 2BVVA 1EYBA 4YZ2A 1LU1A 1QXPA 1SLAA 1W6QB 1ND2B 1V9U3 1QMJA 2VU9A 1YCIA 5J48A 3ZFEB 4RSUA 1VRH2 2CTVA 1HXS2 3JUUA 3P3NA 3FBYA 5JVVA 4CDUC 1RHI1 2EXKA 3AZWA 3MPBA 3RJ2X 3VBRB 3TYJA 4L11A 5KHIA 1DZRA 3CNAA 1BCXA 4FOWA 2JENA 2E53A 4HT1T 1DQ6A 4ORFA 2DCYA 1TMF3 4URTA 1ND3B 4LO6B 5LEJA 4K9SA 4MXVA 4CDXA 4S2HA 4YM1A 3JBG1 2NP0A 1RUG3 1PIV2 3HR9A 2EIGA 2CL2A 3WG4A 1OLRA 4RFT0 2AUYA 2RS33 5EV7A 4AEDB 4AFAA 2HWE2 1G8WA 2BNMA 3G7DA 5DDJ1 1PO21 2O8QA 4H7MA 3ILFA 1D0HA 2V73A 5C4WB 4BPZA 1R081 2EA7A 5T3NA 1SLTA 2A6ZA 3U0ZA 3TN91 3ZPYA 3GNEA 3MIBA 2ZAHA 4J6GA 1HRI1 5J37A 2RE9A 3LA2A 4N43A 2YROA 5FRAA 3U07A 3WNXA 4KWLA 1R091 3VHRA 2R072 1JH5A 4LNVA 4XF9A 1UL9A 1JBCA 2XKOA 1DGRN 1UIJA 2CYFA 2WZR3 1KJLA 1ULEA 1WMDA 1X8MA 3H7YA 1N3QA 1ZBE3 2YMZA 3PLQA 4EN6B 1Z78A 1AXKA 1VBA1 1H4HA 4Q0QA 1QU0A 5CA6A 4YM2A 3VGIA 1UAIA 4QQOA 2YGMA 5JOWA 1QH6A 1AL23 5T5PA 3X29B 2B39A 5C9AB 4L99A 3OBRA 4NWVA 3TNQA 2VNRA 4B4QA 3MIDA 4IEQA 2XKPA 1Y43B 4JVAA 4N43C 2RHPA 1LCLA