4RHV4

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4rhv400
1R094 1AR74 1RUD4 1RUJ4 1HRV4 1COV4 1HXS4 1RUF4 1Z7S4 2RR14 1AR84 1AR94 1RUI4 3JBG4 4RHV4 2R044 2RS54 2X5ID 1RUC4 1VRH4 1OOPD 1PO24 1PVC4 1D4M4 1HRI4 2RMU4 4Q4W4 4PDWD 2RS34 1RVF4 1VBC4 1POV0 1MQTD 2HWB4 4GB34 2R074 1AL24 1BEV4 2HWC4 2RS14 1PO14 1ASJ4 1VBE4 3JD74 1NCQD 1R084 1EV14 4Q4X4 2RM24 1H8TD 1EAH4 1VBD4 1RHI4 1VBB4 1RMU4 1RUE4 1PIV4 4Q4V4 1NA1D 1VBA4 1RUH4 4Q4Y4 2PLV4 1K5MD 2R064 1RUG4 1AR64 3J8F4
chains in the Genus database with same CATH superfamily
1R094 1ZP0A 1RUJ4 1HRV4 3P4PA 1HXS4 3GQKA 3JBG4 4RHV4 4KX6A 2PY5A 2X5ID 1RUC4 2ACZA 1HRI4 2RMU4 3AEAA 1XHXA 3VRAA 1BEV4 2RS14 3AE2A 1PO14 4Q4X4 3AEEA 1EAH4 4YTPA 1VBB4 1YQ3A 4Q4V4 3SUCA 4YXDA 1RUH4 4YTMA 1L0VA 2RR14 2WDVA 2FBWA 1RUD4 1AR74 4YT0A 4YSYA 5C2TA 3VR9A 3VR8A 1AR94 2R044 1XI1A 2WP9A 4YSXA 3AEFA 4YSZA 2HWB4 2R074 2HWC4 2PYJA 3JD74 3AE1A 2H89A 4YTNA 2EX3A 1RMU4 2WDRA 3AECA 2R064 1RUG4 1COV4 3P4QA 1NEKA 1RUF4 2WS3A 3AE8A 3VRBA 1RUI4 1VRH4 2WQYA 2H88A 3SFDA 1PO24 1PVC4 4Q4W4 1VBC4 1AL24 1ASJ4 1NCQD 1KFYA 1EV14 3P4RA 1KF6A 1NENA 2WDQA 1VBD4 3AEGA 1NA1D 1VBA4 3AE5A 4Q4Y4 3FI7A 1K5MD 2PYLA 5C3JA 3GQHA 2PZSA 2B76A 1Z7S4 3AE3A 1AR84 1YQ4A 2RS54 3P4SA 3AEDA 1OOPD 1D4M4 4PDWD 2RS34 1RVF4 2PW9A 2WU5A 1POV0 1MQTD 4GB34 3AE9A 3AE7A 1VBE4 3AE6A 1R084 2RM24 1H8TD 1ZOYA 3AE4A 3SFEA 3AEBA 1XHZA 3ABVA 3CIRA 1RHI4 1RUE4 1PIV4 2R7FA 2PLV4 2WU2A 1AR64 3J8F4
chains in the Genus database with same CATH topology
1R094 1AR74 1RUD4 1RUJ4 1HRV4 1COV4 1HXS4 1RUF4 1Z7S4 2RR14 1AR84 1AR94 1RUI4 3JBG4 4RHV4 2R044 2RS54 2X5ID 1RUC4 1VRH4 1OOPD 1PO24 1PVC4 1D4M4 1HRI4 2RMU4 4Q4W4 4PDWD 2RS34 1RVF4 1VBC4 1POV0 1MQTD 2HWB4 4GB34 2R074 1AL24 1BEV4 2HWC4 2RS14 1PO14 1ASJ4 1VBE4 3JD74 1NCQD 1R084 1EV14 4Q4X4 2RM24 1H8TD 1EAH4 1VBD4 1RHI4 1VBB4 1RMU4 1RUE4 1PIV4 4Q4V4 1NA1D 1VBA4 1RUH4 4Q4Y4 2PLV4 1K5MD 2R064 1RUG4 1AR64 3J8F4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R09 4;  1AR7 4;  1RUD 4;  1RUJ 4;  1HRV 4;  1COV 4;  1HXS 4;  1RUF 4;  1Z7S 4;  2RR1 4;  1AR8 4;  1AR9 4;  1RUI 4;  3JBG 4;  4RHV 4;  2R04 4;  2RS5 4;  2X5I D;  1RUC 4;  1VRH 4;  1OOP D;  1PO2 4;  1PVC 4;  1D4M 4;  1HRI 4;  2RMU 4;  4Q4W 4;  4PDW D;  2RS3 4;  1RVF 4;  1VBC 4;  1POV 0;  1MQT D;  2HWB 4;  4GB3 4;  2R07 4;  1AL2 4;  1BEV 4;  2HWC 4;  2RS1 4;  1PO1 4;  1ASJ 4;  1VBE 4;  3JD7 4;  1NCQ D;  1R08 4;  1EV1 4;  4Q4X 4;  2RM2 4;  1H8T D;  1EAH 4;  1VBD 4;  1RHI 4;  1VBB 4;  1RMU 4;  1RUE 4;  1PIV 4;  4Q4V 4;  1NA1 D;  1VBA 4;  1RUH 4;  4Q4Y 4;  2PLV 4;  1K5M D;  2R06 4;  1RUG 4;  1AR6 4;  3J8F 4; 
#chains in the Genus database with same CATH topology
 1R09 4;  1ZP0 A;  1RUJ 4;  1HRV 4;  3P4P A;  1HXS 4;  3GQK A;  3JBG 4;  4RHV 4;  4KX6 A;  2PY5 A;  2X5I D;  1RUC 4;  2ACZ A;  1HRI 4;  2RMU 4;  3AEA A;  1XHX A;  3VRA A;  1BEV 4;  2RS1 4;  3AE2 A;  1PO1 4;  4Q4X 4;  3AEE A;  1EAH 4;  4YTP A;  1VBB 4;  1YQ3 A;  4Q4V 4;  3SUC A;  4YXD A;  1RUH 4;  4YTM A;  1L0V A;  2RR1 4;  2WDV A;  2FBW A;  1RUD 4;  1AR7 4;  4YT0 A;  4YSY A;  5C2T A;  3VR9 A;  3VR8 A;  1AR9 4;  2R04 4;  1XI1 A;  2WP9 A;  4YSX A;  3AEF A;  4YSZ A;  2HWB 4;  2R07 4;  2HWC 4;  2PYJ A;  3JD7 4;  3AE1 A;  2H89 A;  4YTN A;  2EX3 A;  1RMU 4;  2WDR A;  3AEC A;  2R06 4;  1RUG 4;  1COV 4;  3P4Q A;  1NEK A;  1RUF 4;  2WS3 A;  3AE8 A;  3VRB A;  1RUI 4;  1VRH 4;  2WQY A;  2H88 A;  3SFD A;  1PO2 4;  1PVC 4;  4Q4W 4;  1VBC 4;  1AL2 4;  1ASJ 4;  1NCQ D;  1KFY A;  1EV1 4;  3P4R A;  1KF6 A;  1NEN A;  2WDQ A;  1VBD 4;  3AEG A;  1NA1 D;  1VBA 4;  3AE5 A;  4Q4Y 4;  3FI7 A;  1K5M D;  2PYL A;  5C3J A;  3GQH A;  2PZS A;  2B76 A;  1Z7S 4;  3AE3 A;  1AR8 4;  1YQ4 A;  2RS5 4;  3P4S A;  3AED A;  1OOP D;  1D4M 4;  4PDW D;  2RS3 4;  1RVF 4;  2PW9 A;  2WU5 A;  1POV 0;  1MQT D;  4GB3 4;  3AE9 A;  3AE7 A;  1VBE 4;  3AE6 A;  1R08 4;  2RM2 4;  1H8T D;  1ZOY A;  3AE4 A;  3SFE A;  3AEB A;  1XHZ A;  3ABV A;  3CIR A;  1RHI 4;  1RUE 4;  1PIV 4;  2R7F A;  2PLV 4;  2WU2 A;  1AR6 4;  3J8F 4; 
#chains in the Genus database with same CATH homology
 1R09 4;  1AR7 4;  1RUD 4;  1RUJ 4;  1HRV 4;  1COV 4;  1HXS 4;  1RUF 4;  1Z7S 4;  2RR1 4;  1AR8 4;  1AR9 4;  1RUI 4;  3JBG 4;  4RHV 4;  2R04 4;  2RS5 4;  2X5I D;  1RUC 4;  1VRH 4;  1OOP D;  1PO2 4;  1PVC 4;  1D4M 4;  1HRI 4;  2RMU 4;  4Q4W 4;  4PDW D;  2RS3 4;  1RVF 4;  1VBC 4;  1POV 0;  1MQT D;  2HWB 4;  4GB3 4;  2R07 4;  1AL2 4;  1BEV 4;  2HWC 4;  2RS1 4;  1PO1 4;  1ASJ 4;  1VBE 4;  3JD7 4;  1NCQ D;  1R08 4;  1EV1 4;  4Q4X 4;  2RM2 4;  1H8T D;  1EAH 4;  1VBD 4;  1RHI 4;  1VBB 4;  1RMU 4;  1RUE 4;  1PIV 4;  4Q4V 4;  1NA1 D;  1VBA 4;  1RUH 4;  4Q4Y 4;  2PLV 4;  1K5M D;  2R06 4;  1RUG 4;  1AR6 4;  3J8F 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...