4RHV4

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4rhv400
1R094 1RUH4 2RS54 1NA1D 1H8TD 1RUE4 1EAH4 1Z7S4 1PIV4 2RS34 4GB34 4PDWD 1MQTD 1PO24 1RUD4 1NCQD 1HRI4 1POV0 1VBA4 1K5MD 3J8F4 1AR74 4Q4V4 4Q4X4 1AR94 1PVC4 1RUC4 1VBD4 1RUG4 1RUI4 1AL24 2HWC4 1VRH4 2RM24 1BEV4 2RR14 1HRV4 1RUF4 2X5ID 1ASJ4 2HWB4 1RVF4 1R084 1HXS4 1AR84 1AR64 1RUJ4 1VBC4 4RHV4 1VBE4 1RMU4 2RMU4 2R044 1OOPD 3JBG4 2PLV4 2R074 4Q4W4 1PO14 2R064 3JD74 4Q4Y4 1COV4 1RHI4 1EV14 1VBB4 1D4M4 2RS14
chains in the Genus database with same CATH superfamily
3P4PA 2RS54 1KFYA 2B76A 1XHZA 1PIV4 1RHI4 2PZSA 1NCQD 5C2TA 3SFEA 1K5MD 2WQYA 3J8F4 1AR74 4Q4X4 1PVC4 1RUC4 2EX3A 2R7FA 2ACZA 1VRH4 1HRV4 4YSZA 2H89A 1RVF4 3GQKA 1HXS4 1AR84 1YQ4A 4KX6A 2FBWA 4YTMA 2WU2A 3JBG4 2PLV4 3CIRA 5C3JA 3VR9A 1R094 4YT0A 1H8TD 1EAH4 2RS34 3AE6A 3AEDA 1NEKA 1MQTD 3AE9A 1PO24 1VBA4 1AR94 3AE4A 1RUG4 3AE8A 2WU5A 2HWC4 2RM24 3AE2A 1RUF4 2X5ID 1ASJ4 2HWB4 4YTNA 1AR64 3AEFA 3AE1A 3P4QA 1VBE4 2H88A 1YQ3A 4YSYA 1EV14 1RUH4 1XHXA 3P4RA 1RUE4 3AE3A 1Z7S4 4GB34 4PDWD 3AEEA 1L0VA 3VRAA 4YSXA 1RUD4 1HRI4 1POV0 2WDRA 4Q4V4 2WDVA 2PW9A 2RR14 3FI7A 2PYLA 3AEAA 3GQHA 2PY5A 1RUJ4 1VBC4 3AE5A 3AEGA 3ABVA 1RMU4 2WDQA 2R074 4Q4W4 2R064 4Q4Y4 3JD74 3SFDA 1ZOYA 1ZP0A 2RS14 3VRBA 1NA1D 3P4SA 3AEBA 1NENA 1VBD4 3SUCA 1RUI4 1AL24 2WP9A 2WS3A 1BEV4 3VR8A 1XI1A 1R084 4YTPA 2PYJA 3AECA 4RHV4 1KF6A 4YXDA 2R044 1OOPD 1PO14 1COV4 2RMU4 1VBB4 1D4M4 3AE7A
chains in the Genus database with same CATH topology
1R094 1RUH4 2RS54 1NA1D 1H8TD 1RUE4 1EAH4 1Z7S4 1PIV4 2RS34 4GB34 4PDWD 1MQTD 1PO24 1RUD4 1NCQD 1HRI4 1POV0 1VBA4 1K5MD 3J8F4 1AR74 4Q4V4 4Q4X4 1AR94 1PVC4 1RUC4 1VBD4 1RUG4 1RUI4 1AL24 2HWC4 1VRH4 2RM24 1BEV4 2RR14 1HRV4 1RUF4 2X5ID 1ASJ4 2HWB4 1RVF4 1R084 1HXS4 1AR84 1AR64 1RUJ4 1VBC4 4RHV4 1VBE4 1RMU4 2RMU4 2R044 1OOPD 3JBG4 2PLV4 2R074 4Q4W4 1PO14 2R064 3JD74 4Q4Y4 1COV4 1RHI4 1EV14 1VBB4 1D4M4 2RS14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R09 4;  1RUH 4;  2RS5 4;  1NA1 D;  1H8T D;  1RUE 4;  1EAH 4;  1Z7S 4;  1PIV 4;  2RS3 4;  4GB3 4;  4PDW D;  1MQT D;  1PO2 4;  1RUD 4;  1NCQ D;  1HRI 4;  1POV 0;  1VBA 4;  1K5M D;  3J8F 4;  1AR7 4;  4Q4V 4;  4Q4X 4;  1AR9 4;  1PVC 4;  1RUC 4;  1VBD 4;  1RUG 4;  1RUI 4;  1AL2 4;  2HWC 4;  1VRH 4;  2RM2 4;  1BEV 4;  2RR1 4;  1HRV 4;  1RUF 4;  2X5I D;  1ASJ 4;  2HWB 4;  1RVF 4;  1R08 4;  1HXS 4;  1AR8 4;  1AR6 4;  1RUJ 4;  1VBC 4;  4RHV 4;  1VBE 4;  1RMU 4;  2RMU 4;  2R04 4;  1OOP D;  3JBG 4;  2PLV 4;  2R07 4;  4Q4W 4;  1PO1 4;  2R06 4;  3JD7 4;  4Q4Y 4;  1COV 4;  1RHI 4;  1EV1 4;  1VBB 4;  1D4M 4;  2RS1 4; 
#chains in the Genus database with same CATH topology
 3P4P A;  2RS5 4;  1KFY A;  2B76 A;  1XHZ A;  1PIV 4;  1RHI 4;  2PZS A;  1NCQ D;  5C2T A;  3SFE A;  1K5M D;  2WQY A;  3J8F 4;  1AR7 4;  4Q4X 4;  1PVC 4;  1RUC 4;  2EX3 A;  2R7F A;  2ACZ A;  1VRH 4;  1HRV 4;  4YSZ A;  2H89 A;  1RVF 4;  3GQK A;  1HXS 4;  1AR8 4;  1YQ4 A;  4KX6 A;  2FBW A;  4YTM A;  2WU2 A;  3JBG 4;  2PLV 4;  3CIR A;  5C3J A;  3VR9 A;  1R09 4;  4YT0 A;  1H8T D;  1EAH 4;  2RS3 4;  3AE6 A;  3AED A;  1NEK A;  1MQT D;  3AE9 A;  1PO2 4;  1VBA 4;  1AR9 4;  3AE4 A;  1RUG 4;  3AE8 A;  2WU5 A;  2HWC 4;  2RM2 4;  3AE2 A;  1RUF 4;  2X5I D;  1ASJ 4;  2HWB 4;  4YTN A;  1AR6 4;  3AEF A;  3AE1 A;  3P4Q A;  1VBE 4;  2H88 A;  1YQ3 A;  4YSY A;  1EV1 4;  1RUH 4;  1XHX A;  3P4R A;  1RUE 4;  3AE3 A;  1Z7S 4;  4GB3 4;  4PDW D;  3AEE A;  1L0V A;  3VRA A;  4YSX A;  1RUD 4;  1HRI 4;  1POV 0;  2WDR A;  4Q4V 4;  2WDV A;  2PW9 A;  2RR1 4;  3FI7 A;  2PYL A;  3AEA A;  3GQH A;  2PY5 A;  1RUJ 4;  1VBC 4;  3AE5 A;  3AEG A;  3ABV A;  1RMU 4;  2WDQ A;  2R07 4;  4Q4W 4;  2R06 4;  4Q4Y 4;  3JD7 4;  3SFD A;  1ZOY A;  1ZP0 A;  2RS1 4;  3VRB A;  1NA1 D;  3P4S A;  3AEB A;  1NEN A;  1VBD 4;  3SUC A;  1RUI 4;  1AL2 4;  2WP9 A;  2WS3 A;  1BEV 4;  3VR8 A;  1XI1 A;  1R08 4;  4YTP A;  2PYJ A;  3AEC A;  4RHV 4;  1KF6 A;  4YXD A;  2R04 4;  1OOP D;  1PO1 4;  1COV 4;  2RMU 4;  1VBB 4;  1D4M 4;  3AE7 A; 
#chains in the Genus database with same CATH homology
 1R09 4;  1RUH 4;  2RS5 4;  1NA1 D;  1H8T D;  1RUE 4;  1EAH 4;  1Z7S 4;  1PIV 4;  2RS3 4;  4GB3 4;  4PDW D;  1MQT D;  1PO2 4;  1RUD 4;  1NCQ D;  1HRI 4;  1POV 0;  1VBA 4;  1K5M D;  3J8F 4;  1AR7 4;  4Q4V 4;  4Q4X 4;  1AR9 4;  1PVC 4;  1RUC 4;  1VBD 4;  1RUG 4;  1RUI 4;  1AL2 4;  2HWC 4;  1VRH 4;  2RM2 4;  1BEV 4;  2RR1 4;  1HRV 4;  1RUF 4;  2X5I D;  1ASJ 4;  2HWB 4;  1RVF 4;  1R08 4;  1HXS 4;  1AR8 4;  1AR6 4;  1RUJ 4;  1VBC 4;  4RHV 4;  1VBE 4;  1RMU 4;  2RMU 4;  2R04 4;  1OOP D;  3JBG 4;  2PLV 4;  2R07 4;  4Q4W 4;  1PO1 4;  2R06 4;  3JD7 4;  4Q4Y 4;  1COV 4;  1RHI 4;  1EV1 4;  1VBB 4;  1D4M 4;  2RS1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...