4RHWE

Crystal structure of apaf-1 card and caspase-9 card complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants of caspase-9 activation by the Apaf-1 apoptosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Apoptotic protease-activating factor 1
total genus 39
structure length 95
sequence length 95
chains with identical sequence F
ec nomenclature ec 3.4.22.62: Caspase-9.
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4rhwE00
2LWDA 3KATA 1N3KA 1PN5A 4NQKA 4P4HA 4A2WA 2MS7A 2A5YB 2NZ7A 4N1JA 1Z6TA 4M9XA 2DBHA 2F1SA 2DO9A 4IZAB 2N1FA 4EWIA 1WH4A 4IZ7B 4I16A 2L6AA 3EZQA 2D96A 3J63A 2N83A 2YQFA 2DBDA 2NSNA 1YGOA 3MOPG 2YVIA 4O9FA 2G7RA 2MPCA 2B1WA 1DGNA 3J6JA 1C15A 4RHWA 1D2ZB 1ICHA 3EZQB 1D2ZA 1WXPA 4M9SA 3T6PA 1FADA 2N97A 2MB9A 1NGRA 4O9LA 3LQRA 2YGSA 3MOPA 4F44A 2MS8A 2NAQA 2OF5H 2P1HA 4JQWA 4N1KA 4LWDA 4ZBWA 1UCPA 3YGSC 2L9MA 2N80A 2BBRA 4E9MA 3CL3A 2M5VA 4UZ0A 2IB1A 2DBGA 4DWNA 4FH0A 3QF2A 1DDFA 4JUPA 3YGSP 2YU0A 1A1ZA 2MN4A 4IZ5E 1CWWA 2DBFA 2KN6A 2VGQA 1E41A 2KM6A 2N00A 2N7ZA 3MOPK 2HM2Q 1E3YA 4O6XA 4P4HI 2BBZA 4N1LA 3CRDA 1CY5A 2GF5A 2A9IA 4RHWE 4D8OA 3LQQA 2OF5A 4QOBA 4A2QA 2LS7A 2LWEA 1A1WA 1WMGA 4M9ZA 2O71A 4O7QA 4F42A
chains in the Genus database with same CATH superfamily
2LWDA 3KATA 1N3KA 1PN5A 4NQKA 4P4HA 4A2WA 2MS7A 2A5YB 2NZ7A 4N1JA 1Z6TA 4M9XA 2DBHA 2F1SA 2DO9A 4IZAB 2N1FA 4EWIA 1WH4A 4IZ7B 4I16A 2L6AA 3EZQA 2D96A 3J63A 2N83A 2YQFA 2DBDA 2NSNA 1YGOA 3MOPG 2YVIA 4O9FA 2G7RA 2MPCA 2B1WA 1DGNA 3J6JA 1C15A 4RHWA 1D2ZB 1ICHA 3EZQB 1D2ZA 1WXPA 4M9SA 3T6PA 1FADA 2XV9A 2N97A 2MB9A 1NGRA 4O9LA 3LQRA 2YGSA 3MOPA 4F44A 2MS8A 2NAQA 2OF5H 2P1HA 4JQWA 4N1KA 4LWDA 4ZBWA 1UCPA 3YGSC 2L9MA 2N80A 2BBRA 4E9MA 3CL3A 2M5VA 4UZ0A 2IB1A 2DBGA 4DWNA 4FH0A 3QF2A 1DDFA 4JUPA 3YGSP 2YU0A 1A1ZA 2MN4A 4IZ5E 1CWWA 2DBFA 2KN6A 2VGQA 1E41A 2KM6A 2N00A 2N7ZA 3MOPK 2HM2Q 1E3YA 4O6XA 4P4HI 2BBZA 4N1LA 3CRDA 1CY5A 2GF5A 2A9IA 4RHWE 4D8OA 3LQQA 2OF5A 4QOBA 2MJMA 4A2QA 2LS7A 2LWEA 1A1WA 1WMGA 4M9ZA 2O71A 4O7QA 4F42A
chains in the Genus database with same CATH topology
2LWDA 3KATA 1N3KA 1PN5A 4NQKA 4P4HA 4A2WA 2MS7A 2A5YB 2NZ7A 4N1JA 1Z6TA 4M9XA 2DBHA 2F1SA 2DO9A 4IZAB 2N1FA 4EWIA 1WH4A 4IZ7B 4I16A 2L6AA 3EZQA 2D96A 3J63A 2N83A 2YQFA 2DBDA 2NSNA 1YGOA 3MOPG 2YVIA 4O9FA 2G7RA 2MPCA 2B1WA 1DGNA 3J6JA 1C15A 4RHWA 1D2ZB 1ICHA 3EZQB 1D2ZA 1WXPA 4M9SA 3T6PA 1FADA 2XV9A 2N97A 2MB9A 1NGRA 4O9LA 3LQRA 2YGSA 3MOPA 4F44A 2MS8A 2NAQA 2OF5H 2P1HA 4JQWA 4N1KA 4LWDA 4ZBWA 1UCPA 3YGSC 2L9MA 2N80A 2BBRA 4E9MA 3CL3A 2M5VA 4UZ0A 2IB1A 2DBGA 4DWNA 4FH0A 3QF2A 1DDFA 4JUPA 3YGSP 2YU0A 1A1ZA 2MN4A 4IZ5E 1CWWA 2DBFA 2KN6A 2VGQA 1E41A 2KM6A 2N00A 2N7ZA 3MOPK 2HM2Q 1E3YA 4O6XA 4P4HI 2BBZA 4N1LA 3CRDA 1CY5A 2GF5A 2A9IA 4RHWE 4D8OA 3LQQA 2OF5A 4QOBA 2MJMA 4A2QA 2LS7A 2LWEA 1A1WA 1WMGA 4M9ZA 2O71A 4O7QA 4F42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LWD A;  3KAT A;  1N3K A;  1PN5 A;  4NQK A;  4P4H A;  4A2W A;  2MS7 A;  2A5Y B;  2NZ7 A;  4N1J A;  1Z6T A;  4M9X A;  2DBH A;  2F1S A;  2DO9 A;  4IZA B;  2N1F A;  4EWI A;  1WH4 A;  4IZ7 B;  4I16 A;  2L6A A;  3EZQ A;  2D96 A;  3J63 A;  2N83 A;  2YQF A;  2DBD A;  2NSN A;  1YGO A;  3MOP G;  2YVI A;  4O9F A;  2G7R A;  2MPC A;  2B1W A;  1DGN A;  3J6J A;  1C15 A;  4RHW A;  1D2Z B;  1ICH A;  3EZQ B;  1D2Z A;  1WXP A;  4M9S A;  3T6P A;  1FAD A;  2N97 A;  2MB9 A;  1NGR A;  4O9L A;  3LQR A;  2YGS A;  3MOP A;  4F44 A;  2MS8 A;  2NAQ A;  2OF5 H;  2P1H A;  4JQW A;  4N1K A;  4LWD A;  4ZBW A;  1UCP A;  3YGS C;  2L9M A;  2N80 A;  2BBR A;  4E9M A;  3CL3 A;  2M5V A;  4UZ0 A;  2IB1 A;  2DBG A;  4DWN A;  4FH0 A;  3QF2 A;  1DDF A;  4JUP A;  3YGS P;  2YU0 A;  1A1Z A;  2MN4 A;  4IZ5 E;  1CWW A;  2DBF A;  2KN6 A;  2VGQ A;  1E41 A;  2KM6 A;  2N00 A;  2N7Z A;  3MOP K;  2HM2 Q;  1E3Y A;  4O6X A;  4P4H I;  2BBZ A;  4N1L A;  3CRD A;  1CY5 A;  2GF5 A;  2A9I A;  4RHW E;  4D8O A;  3LQQ A;  2OF5 A;  4QOB A;  4A2Q A;  2LS7 A;  2LWE A;  1A1W A;  1WMG A;  4M9Z A;  2O71 A;  4O7Q A;  4F42 A; 
#chains in the Genus database with same CATH topology
 2LWD A;  3KAT A;  1N3K A;  1PN5 A;  4NQK A;  4P4H A;  4A2W A;  2MS7 A;  2A5Y B;  2NZ7 A;  4N1J A;  1Z6T A;  4M9X A;  2DBH A;  2F1S A;  2DO9 A;  4IZA B;  2N1F A;  4EWI A;  1WH4 A;  4IZ7 B;  4I16 A;  2L6A A;  3EZQ A;  2D96 A;  3J63 A;  2N83 A;  2YQF A;  2DBD A;  2NSN A;  1YGO A;  3MOP G;  2YVI A;  4O9F A;  2G7R A;  2MPC A;  2B1W A;  1DGN A;  3J6J A;  1C15 A;  4RHW A;  1D2Z B;  1ICH A;  3EZQ B;  1D2Z A;  1WXP A;  4M9S A;  3T6P A;  1FAD A;  2XV9 A;  2N97 A;  2MB9 A;  1NGR A;  4O9L A;  3LQR A;  2YGS A;  3MOP A;  4F44 A;  2MS8 A;  2NAQ A;  2OF5 H;  2P1H A;  4JQW A;  4N1K A;  4LWD A;  4ZBW A;  1UCP A;  3YGS C;  2L9M A;  2N80 A;  2BBR A;  4E9M A;  3CL3 A;  2M5V A;  4UZ0 A;  2IB1 A;  2DBG A;  4DWN A;  4FH0 A;  3QF2 A;  1DDF A;  4JUP A;  3YGS P;  2YU0 A;  1A1Z A;  2MN4 A;  4IZ5 E;  1CWW A;  2DBF A;  2KN6 A;  2VGQ A;  1E41 A;  2KM6 A;  2N00 A;  2N7Z A;  3MOP K;  2HM2 Q;  1E3Y A;  4O6X A;  4P4H I;  2BBZ A;  4N1L A;  3CRD A;  1CY5 A;  2GF5 A;  2A9I A;  4RHW E;  4D8O A;  3LQQ A;  2OF5 A;  4QOB A;  2MJM A;  4A2Q A;  2LS7 A;  2LWE A;  1A1W A;  1WMG A;  4M9Z A;  2O71 A;  4O7Q A;  4F42 A; 
#chains in the Genus database with same CATH homology
 2LWD A;  3KAT A;  1N3K A;  1PN5 A;  4NQK A;  4P4H A;  4A2W A;  2MS7 A;  2A5Y B;  2NZ7 A;  4N1J A;  1Z6T A;  4M9X A;  2DBH A;  2F1S A;  2DO9 A;  4IZA B;  2N1F A;  4EWI A;  1WH4 A;  4IZ7 B;  4I16 A;  2L6A A;  3EZQ A;  2D96 A;  3J63 A;  2N83 A;  2YQF A;  2DBD A;  2NSN A;  1YGO A;  3MOP G;  2YVI A;  4O9F A;  2G7R A;  2MPC A;  2B1W A;  1DGN A;  3J6J A;  1C15 A;  4RHW A;  1D2Z B;  1ICH A;  3EZQ B;  1D2Z A;  1WXP A;  4M9S A;  3T6P A;  1FAD A;  2XV9 A;  2N97 A;  2MB9 A;  1NGR A;  4O9L A;  3LQR A;  2YGS A;  3MOP A;  4F44 A;  2MS8 A;  2NAQ A;  2OF5 H;  2P1H A;  4JQW A;  4N1K A;  4LWD A;  4ZBW A;  1UCP A;  3YGS C;  2L9M A;  2N80 A;  2BBR A;  4E9M A;  3CL3 A;  2M5V A;  4UZ0 A;  2IB1 A;  2DBG A;  4DWN A;  4FH0 A;  3QF2 A;  1DDF A;  4JUP A;  3YGS P;  2YU0 A;  1A1Z A;  2MN4 A;  4IZ5 E;  1CWW A;  2DBF A;  2KN6 A;  2VGQ A;  1E41 A;  2KM6 A;  2N00 A;  2N7Z A;  3MOP K;  2HM2 Q;  1E3Y A;  4O6X A;  4P4H I;  2BBZ A;  4N1L A;  3CRD A;  1CY5 A;  2GF5 A;  2A9I A;  4RHW E;  4D8O A;  3LQQ A;  2OF5 A;  4QOB A;  2MJM A;  4A2Q A;  2LS7 A;  2LWE A;  1A1W A;  1WMG A;  4M9Z A;  2O71 A;  4O7Q A;  4F42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...