4RHXA

Structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
185
structure length
181
Chain Sequence
ELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title First Crystal Structures of Mycobacterium tuberculosis 6-Oxopurine Phosphoribosyltransferase: Complexes with GMP and Pyrophosphate and with Acyclic Nucleoside Phosphonates Whose Prodrugs Have Antituberculosis Activity.
pubmed doi rcsb
molecule tags Transferase/transferase inhibitor
total genus 56
structure length 181
sequence length 185
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rhxA00
2EHJA 2H06A 1G2QA 3ACDA 1NULA 4RADA 2H07A 3O7MA 3OHPA 1ZN8A 2JI4A 1A4XA 1I5EA 3GEPA 4FYMA 4X44A 4JITA 1BZYA 1A96A 4LZAA 4RAOA 1VSTA 5E38A 1D6NA 1L1QA 3G6WA 1BD3A 2WNSA 3QW4B 1OROA 1P4AA 3MBIA 5HIAA 3EFHA 1R3UA 4LZOA 1YFZA 3OZFA 1ECFA 4LYYA 1TC2A 1QB7A 4RAQA 1ECCA 4P3KA 4S2UA 4ZFNA 1HMPA 3GGCA 4RHUA 1BD4A 4M0UA 1ZN9A 1Z7GA 4Z1OA 1P17A 5BQOA 1XTTA 1MZVA 4RHTA 1DKUA 4WN3A 5JSQA 2JBHA 1G9TA 1NONA 1XZ8A 3LRTA 1P19A 1QK4A 1VCHA 2P1ZA 4LZNA 1L1RA 2PS1A 1JLSA 4P83A 1QCDA 4OHCA 1DBRA 4P80A 1U9ZA 3M3HA 1A98A 1QK3A 2VFAA 1ECBA 3H83A 5BRNA 3ACCA 4F8EA 4M0KA 1V9SA 1QK5A 2GEBA 4WMLA 4MB6A 1JLRA 1HGXA 4P82A 1TC1A 1O5OA 5ESWA 1STOA 1OPRA 2FXVA 3HVUA 4RABA 1OREA 4RQBA 1I0IA 3DMPA 4PFQA 3S5JA 1A3CA 4QRIA 4QYIA 4JLSA 4RANA 3KB8A 1AO0A 5IAOA 3NAGA 3OZGA 4RHYA 4TWBA 4P81A 1I13A 2IGBA 5KAMA 1GPH1 5BSKA 1G2PA 4PAWA 1W30A 1Y0BA 1G9SA 1UFRA 4KN6A 5KAPA 5IPFA 2PRZA 2H08A 2YZKA 5ESXA 5JV5A 3MJDA 5HKLA 1WD5A 1A97A 1DKRA 2DY0A 1CJBA 3GGJA 1XTVA 1P18A 4X45A 1A95A 2E55A 2C4KA 1UPUA 2PRYA 4RACA 1LH0A 1ZN7A 4QYIB 1ECGA 4RHXA 1ECJA 3ACBA 1I0LA 1J7JA 4LYGA 4RV4A 1DQPA 1PZMA 2JKYA 2XBUA 4P84A 4P86A 5K51A 1U9YA 5BQPA 4M0PA 2HCRA 2AEEA 4RQAA 1GRVA 1XTUA 3DEZA 1VDMA 3DAHA 1I14A 1O57A 3LPNA 4IJQA 1FSGA 2JKZA 1UPFA 5EUCA 1QCCA 1DQNA 1IBSA 1XZNA 3N2LA 1QB8A
chains in the Genus database with same CATH superfamily
1V8BA 1QGUB 3M9WA 3EDMA 5BWOA 4NPCA 5HUHA 3BB1A 1W7AA 3HTXA 1KZGB 2DCUA 2H1FA 1M5UA 1YQQA 4QEKA 4RMHA 3C4VA 3TLKA 2BTEA 4LBWA 1IC6A 3Q9LA 1XMSA 2WW8A 2E3JA 2GVZC 1Q7TA 5BYJA 4AJPA 5JYBA 2WD7A 2Q0HA 4AJKA 2RKWA 3D6UA 3BWDD 1SIBE 2VJYA 4PLCA 5FPSA 3HYSA 4G41A 1IBCA 4EWLA 3KG2A 2G5TA 3OZIA 3KHUA 4IHAA 1X74A 2WOJA 1DAEA 5F2KA 3RU3A 1XK6A 3AZOA 4L5CA 4P58A 4WZAA 4B7CA 4D96A 4JQSA 3HZHA 1HMPA 4M6WA 2WF8A 4R9RA 4DA9A 2HSZA 1XFAA 1GU7A 3JX9A 3CZPA 3U7RA 3HFRA 2HSDA 1KZ6A 4RE5A 1U8YA 2C07A 2FQ1A 2PT5A 4MJLA 2J5RA 3AP3A 4FJ2A 1BXGB 4OJNA 3ZWXA 3TECE 3OOHA 2WDZA 3A6JA 1AQ6A 1AHPA 3WJAA 1E8NA 1QQTA 4YRZA 4HGQA 4F8JA 3AV3A 2GAFA 4YDRA 1H42A 1RVDA 5IAGA 2J87A 1E5QA 4H6VA 1Z7BA 2SKEA 4RKQA 3QPCA 3B38A 4DR2B 1BO6A 1IQPA 3J81A 3HK2A 3HCPA 4TUYA 1XIVA 1X9IA 4L28A 4X6UA 1UJMA 3QEJA 1PWXA 4G0MA 1XL1A 3N6VA 3IAM1 3CW2A 3MJFA 1JPVA 1E1NA 2Z8YM 5CA1F 2MMGA 4RVUA 3T5BA 5IJ0B 3CNBA 5G53C 3MWYW 4WY2A 3R8XA 2GERA 4LYEA 1GY8A 2OD9A 2YJ5A 5ECDA 4GQIA 3FZEA 3GRVA 3GZ4A 5FCDA 1V3TA 3I5YA 3ILVA 4JB2A 2JI7A 1A9PA 5I8PA 4FC6A 4LKRA 1XRMA 4JB0A 4EHHA 3MWGA 2J6CA 3IBTA 1F8XA 1FFBA 2R25B 3A37A 2UYYA 3O94A 4GICA 4LFBB 5DISB 1Z33A 3MC1A 3FOFC 4CEIA 1ZXLA 2CCKA 1NXSA 2X13A 3K30A 4MUBA 4EAAA 5D5HA 2CXQA 5LB2A 3PPVA 4HQNA 3DCJA 4RKWA 4D81A 3CJRA 5GMOA 4UTNA 5IUNC 3RSGA 1AS3A 3C8MA 2WAOA 3IKMB 1SHZA 3EY4A 3L4EA 3I39X 3QTBA 3VAZA 2A35A 4ATNA 3R7DA 2JL1A 5SY6A 2IUEA 5I7EA 1NJSA 3TJZA 3PC7A 4K6KA 2PQ6A 3WISA 1VHWA 1CBUA 2JK0A 3A6ZA 2HGSA 1G42A 4D0LB 2EFEB 1Y80A 2YRWA 3RIYA 1M34A 1Y3DE 1QTQA 4C4OA 2JIQA 4PZPA 2GEDA 3M6VA 4ON9A 3O8OB 4KC0A 1F38A 2WSSA 3QSGA 4ND2A 4RORA 1CJSA 4LV6A 4AC9A 1USKA 4C2UA 4I6GA 1L4BA 4UHHA 4GSLA 1GKUB 2BEVA 3AY6A 4WNAB 3OA2A 5EHZA 2DF8A 1AHNA 2W11A 1H6DA 3BDAA 4OBWA 1DEXA 1CUEA 1O7JA 3LCCA 4GS5A 4CM3A 4UE3S 5JEEA 3OU2A 4KKXB 3DEZA 4HSGA 1OWLA 2X5JO 4BOYA 1WDWB 1Z4JA 5CPFA 4D92A 1DIHA 3DFMA 5BN5A 4F91B 1NE7A 1D2RA 3EDRA 2ZRKA 3ZX5A 1A8IA 3U3KA 1HKHA 3NXSA 3W4JA 1O77A 1ADFA 2OBFA 1WX1A 4NOLA 1XVVA 1KDRA 3OHPA 1U0EA 3O92A 1GPMA 1DJPA 1PUIA 5DK4A 5JFTA 1JI3A 4ZOLF 5EWMA 1F3LA 3C7AA 3B9QA 2XMPA 4JYPA 3CZRA 3CT4A 4I55A 2M98A 2QTBA 2W9XA 3DNPA 2JASA 1D6NA 5D51S 3RUFA 2IYVA 1PNRA 4N49A 4XJVA 3ZWQA 1MIHA 2PE5A 5DNEA 3WB9A 3F7OA 2A4MA 3ZZ1A 5EZSA 4PPNA 5E9JA 5EE9A 4B81A 5G3YA 4RFSB 3NBYC 3PRYA 1HMYA 5JJBA 1P0FA 3UB3A 1K7YA 1M2VB 4LN1A 3S44A 3WYAA 3WWPA 1W6RA 1IYZA 1I4LD 1ZEJA 1Z25A 3DKRA 4GR9A 1YHNA 4NQRA 3QKWA 4Q15A 1Z6TA 2QJFA 5F5XA 3HCNA 3ZE6A 1JR6A 3KDPA 2QP4A 2IBMA 3I4LA 2Y0DA 2CFCA 4Z49A 1OWOA 1YS6A 1WXWA 1YO6A 2BI4A 2ODEA 3RAFC 5C35A 1ZISA 3FETA 1BJRE 4HH4A 2A5GA 4MCAA 3RARA 4ESEA 1VXRA 1CYDA 3PWSA 4LRYA 1JVSA 3VO2A 1QPBA 1TKAA 1NBMD 1Z34A 1TT5A 2Q49A 3EXG2 3VH1A 4ZCMA 1QG0A 1CUZA 1V9SA 3R3UA 4KQKA 4R0VA 1ZN2A 5EAIA 5ADWA 2OV4A 4G9EA 4CMIB 3OMWA 3VV2A 2PLRA 2D13A 3ROXA 3W4KA 4MGHA 5A4DA 4RQTA 5DNVA 4RTQA 5KMGB 2QSUA 4IICA 4BY9E 3BREA 5DW3A 1KU0A 4LTNA 1F2TB 1XVIA 1OJLA 2CLMB 4JT8A 3HWSA 4LWZA 4GOND 1TCCA 3ADOA 3F6CA 3RWOA 1C0EA 1LTHR 2BL4A 4WI1A 1VC2A 3H5VA 3RUIA 3E22B 5A4AA 1R27A 1KQOA 1RAIA 3F8WA 4ZV4A 2A2ZA 2ALJA 3KJFA 2EYUA 3VC2A 1JEJA 2LDXA 3KHSA 2WIGA 2FE1A 2WUVA 1KYZA 2SKDA 1FVOA 1NQTA 1ZQ9A 2ZJ5A 3GGJA 4B3HA 3PRJA 1P1CA 3DCIA 3ZHZA 3CA8A 4LG1A 2Y68A 3VHLB 4L78A 1PV2A 1RRKA 2HXYA 1XZJA 4GGOA 3VR6H 1QZUA 2M6RA 2FRDC 2UYOA 4MYRA 2XYRA 4AL4A 4PX9A 3MINB 2WG2A 1KDVA 4MH0R 5ABPA 1HPLA 2LXNA 4GO1A 3SQLA 4FX5A 4ZVPA 3T0IA 1E1YA 2JLAA 2CLOB 3FG9A 1YZLA 2PNJA 4C5CA 2H3EA 3LX4A 2BGJA 1NRWA 3CN7A 3QA9A 3WBJA 4Y6LA 1YQXA 3X1DA 3BMOB 1MJHA 3GJQA 4FDUA 3GJ5A 3RWBA 3ENWA 1VPWA 5LQJA 2IOFA 3HI4A 3MJ4A 4OHFA 2C4WA 1L4FA 4ZZ0A 5K4AA 1CVLA 1BGXT 4LZLA 2VYNA 2Z09A 1QJCA 1VE1A 4WACA 1C9EA 2WHPB 4V0NA 1SH7A 4C04A 1CY8A 3NB0A 1NVVQ 1R1DA 3B1KA 4KSYA 1GL6A 1PX2A 4LA4A 3T7EA 1EGMB 3EN0A 1ESNA 1PFQA 1YR8A 5AI4A 3SS8A 5KKNB 3FE2A 1W0KD 2ZUWA 4MP6A 4HFMA 5GOZA 2TSYB 1G5RA 3QGMA 1ZCFA 2RG1A 3JPYA 4ROSA 3DV0A 5FIUA 4IKEA 4TL8A 5CM8B 5GM2A 1A0OA 1GNQA 3IEVA 5F3DA 4AO8A 3UXEA 3KKLA 2RHHA 3GL9A 3O5AA 4TTJA 1WMBA 3RHZA 4U7WA 3UENA 4PYRA 3HWX1 5LLDA 1FFGA 1H1LA 4FIDA 3B1YA 1Z12A 4S2UA 1GGHA 3EY9A 4FEEA 4FR5A 4FOTA 4EKGA 4PIPA 4CZ2A 4W5NA 5COAA 3BB3A 2UVPA 3GRCA 3L0DA 4TKMA 5AI6A 4EG4A 3TIGA 2ZYUX 2QSZA 5DBOA 2GPJA 2HK6A 3T7DA 4HLCA 1T9HA 3VZCA 1R8YA 2KE5A 4B6JA 2XTNA 1UP4A 3GA7A 2PM8A 5IAEA 1ZIXA 4EL0A 2FI1A 4XTRA 4BAGA 3UAOA 1YS9A 2PZAA 4UTOA 2A0WA 3EXAA 4G5SA 4IRUB 5DM1A 4L2IA 5DTJA 4U02A 2PX6A 3M6WA 2BLLA 1CD5A 4WZBB 3V46A 4BNZA 5AVVA 3ZHOA 1GAQA 1QH1A 2A5DA 1AB5A 1N6IA 2QZ9A 2UZAA 2YMPA 1VGVA 1WB6A 1E3EA 2JI8A 2VJMB 2HEGA 1M3SA 3JQCA 2JPDA 2AK3A 1YOVB 1JLRA 4UCWA 1YR9A 2H1CA 1HV8A 5G3ZA 4Z4IA 2JZOA 2FEXA 1T2AA 2C9ZA 2B4KA 4OFZA 2Y0EA 3JPWA 2OBNA 1VJDA 2NVUA 2EBUA 4EK9A 3ZWPA 2C2OA 3SBXA 1LWOA 4YALA 4V1CB 1XMIA 2HF8A 4URHA 3TTTA 3OPYI 3VVLA 4D56A 4D9HA 3H5RA 1OFUX 4DNFA 4EYGA 2VC2B 2JIDA 1ZIPA 1S2IA 2ZIAA 2P6NA 2VQDA 2WIKA 3AB8A 4JLVA 5DWVA 3ZCRA 4B8YA 4YAIA 2MTBA 4JIGA 1MX5A 1UFRA 2AE2A 2P2CA 1PWEA 4QVGA 2XOKD 1UKCA 3H4MA 1KU6A 5CJJA 5G0SA 5T41A 1XNHA 7ABPA 3K20A 5F1KA 1N3YA 1IOVA 4I4IA 4MW6A 4TVKA 5E0OA 2BGRA 2BMDA 4NCAA 5BV1A 3JYPA 4DRXA 1SBHA 2VQ6A 3CKMA 1JXQA 3G2KA 3MRXA 4RY8A 4HATA 4MDHA 3CNHA 2WRZA 4KQ1A 1M9NA 4KK3A 4BVFA 3G2QA 5DX1A 1H0RA 3RD5A 3S40A 2VYVA 4YRCA 1P77A 1PFKA 3MZ0A 1VG0B 1PN3A 3NKVA 4B9AA 2X41A 3EQZA 2Y4NA 1NI5A 2F1JA 2I5PO 4D44A 3D3NA 2GFHA 5JADA 2D1FA 3A1WA 1SIUA 3R8FA 1ITZA 1V5IA 4BFSA 3AEUB 2B61A 1J5PA 4UVHA 2OC4A 4H3KB 3ORRA 1NWHA 2QNRA 2BCGY 3NGMA 4W6ZA 5EJ8A 1VL0A 3IOMA 5HKKD 1I2AA 1AV7A 2HMUA 3PE4A 2NTEA 4ENUA 3OQMA 1DC5A 5JUWA 1R0ZA 2YXLA 3BGIA 4C4ZA 1AUVA 4L15A 3U56A 1WSDA 2NVWA 5M3BA 3ICOA 3CVXA 4BB0A 4BEWA 2QE7A 2BFFB 3ADKA 1PZFA 4UEOA 1OH8A 1DXOA 5T57A 5HQJA 3S68A 4F12A 4AJEA 4P54A 3STWA 3WMXA 4BNUA 3VFDA 1KSHA 4QOJA 1L7BA 2NV0A 4RK0A 1PF7E 2E7ZA 3QX8A 1ZGGA 3EVDA 4JWTA 2P77A 2JCGA 5DHPA 4IKOA 1DQRA 3VKWA 3NUQA 1DLIA 1UBRS 3CUSA 4LZOA 1QU2A 5IVHA 3H8VA 2C88A 4NARA 3R5KA 1ZJJA 5IT0A 3L0ZA 4PPYA 1P6UA 1GFWA 5HMMA 3RRNA 4EHLA 1PEAA 3LMKA 2V4ZA 1XF1A 4EFNA 1PL7A 2IYWA 2PRJA 2X1VA 2VNIA 4ZXPA 1JUDA 1JMVA 3D5QA 4D82A 2JFYA 2FW8A 3OM0A 4Q19A 1TVCA 1N0HA 1H66A 2HB6A 4KTTE 4CCWA 2FMHA 2HHAA 5EN4A 3RJMA 3UFXA 2H2DA 2O1EA 1ZKMA 2F1OA 4QNMA 3FPEA 5KTRA 1L8LA 1P5FA 3ILXA 4KYIB 5JDCC 2IEGA 3PD0A 1E2FA 3OD1A 4R51A 1E6WA 4FWIB 1IEQA 3ANXA 3WKBA 5CLLA 5JXGA 1U9IC 1QK3A 2RIRA 4XWOA 5KX5A 4HMQA 3H83A 2GK3A 1G7TA 1OTHA 1CY7A 4DJ5X 4FW8A 1W5FA 4X7PA 1PT5A 1YDWA 1A50B 2HU8A 3C98A 3I58A 3IP6A 5DHTA 2IYEA 5DLQC 3RC7A 4JDPA 2OXEA 4CMKA 1C7QA 2YHAA 1ZM7A 1WTAA 3MWKA 4WZ6A 5AW7A 2EQAA 4RA9A 1A9ZA 2OBYA 2VSQA 2ZJAA 4C5BA 4Z9YA 4TKVB 1ZWLA 3JATA 4LHSA 4BX2A 2G82A 4K2HA 4L9AA 3H2ZA 1FDUA 1YVPA 2ODQA 3W6ZA 1X80B 1RLUA 4GLLA 3EXHB 3KUUA 1WCIB 4NPAA 3HV2A 1FJGB 5AM3A 3NM6B 1I2BA 3NWBA 2FQYA 2PX3A 2VZ0A 3C7CB 5B53A 2W6CX 1Z8HA 4PZYA 3WYEA 2VWQA 3PGKA 4RBNA 4WKGA 4B17A 2XKAA 2L17A 4RPHA 1UPUA 5AOVA 2VRCD 3NEJA 4ZPXA 3VZRA 4TQGA 4TT3D 2FRXA 2DZDA 3EH2A 3CINA 4BMDA 2QN9A 1YMQA 3INRA 3I9OA 4ROTA 5HTOA 1G21E 1ZN7A 4XR4A 1TFUA 1VI6A 3AR8A 2RHJA 4MAFA 1QIMA 2CXXA 4W8OA 3ZK7A 5CG2A 1SA0B 1UWKA 2ERYA 3R3VA 3UJNA 4FGUA 1SUPA 1VIYA 1XQXA 3K31A 4M9SA 3FDXA 5H83A 3KCNA 3P0HA 4NCJA 4P5DA 3GLIB 4FUQA 1OX5A 5FBHA 3E9NA 3UMRA 1GNVA 5LC1A 3WKAA 3LCJA 5ECYA 5HRUA 3OZEA 2AW3A 5F5LA 2ORYA 1CETA 3IX7A 3LWZA 1TNDA 1HYGA 3IAS1 2FSGA 4TTPA 2YMLA 4A0HA 3H7IA 2PX0A 4EW3A 2DSTA 2H06A 2OXCA 1U7WA 2TMKA 4P4GA 3FFWA 2CXSA 2FMFA 2VHZA 5ALIA 2G1UA 1SOMA 2Q28A 5EKXA 1C9KA 1A4XA 2JI4A 4OPMA 4JXXA 3VKUA 5F7OA 3BGOS 3FX2A 1G5HA 1OX4B 4NBSA 1AS2A 4O1IA 1DDIA 1B8NA 1E2MA 2QG9A 5DEOA 4TV8B 2IU0A 4RGQA 4OYLA 4CIBA 2JLWA 1GNLA 1LEHA 5H9WA 3HXQA 3S8MA 5FUBA 5HIMA 4RETA 3OFND 1RQPA 3B7GA 5IJ9A 2ASVA 4E7OA 5CFRA 2FHPA 3MJTA 4OA5A 1BS9A 3MGBA 4KLAA 1G21A 4J0IA 5JAZA 5KYTA 1AKTA 1AUOA 3OP1A 3P71T 4IDNA 5KZMB 4DJTA 1MMFB 2PMDA 1EQ2A 1EXMA 2BELA 1AGPA 1E2QA 2WIJA 4AJIA 4KBFA 1PLLA 1WHSA 2F7SA 1F6DA 1G41A 1B6RA 3M81A 3RUAA 3MRSA 1JLLA 4MRMA 4KOAA 4OQDA 3LP5A 1UJ2A 4IQGA 1EGQA 1NMYA 1SVIA 1ZMBA 4RDHA 4RK7A 5LKRA 2UYCA 2C04A 4WKNA 4MWBA 3BUSA 4E31A 4YGYA 5AK3A 5JU6A 2FLKA 5JO9A 3LQYA 3W2EA 4BJ6A 3Q8MA 1YQEA 4KIUA 1G7RA 1YU9A 3KJXA 1IY1A 2ZQYA 1WVGA 4S2EA 3RODA 1N2JA 5CG1A 3FI9A 3DMFA 3S28A 2M2IA 3H2IA 3HB1A 1O1YA 2BFDA 2YZ7A 2I7XA 4MUJA 5TMEA 5BYAA 4XGNA 3QNWA 4X91A 3KOXA 2WBLC 2DFVA 2YXBA 2A14A 4EJSC 4FEAA 5ITZA 4DIBA 1VRWA 2BMJA 1NVDA 3A26A 5HWSA 3HBFA 5AVZA 1QFYA 1VKNA 2CDAA 2V7QA 4IH9A 4L8LA 4MB2A 4R0NA 3GLHE 3MSCA 2Q9CA 2I8LA 2PHZA 2DPYA 3EW7A 4GI7A 4KN8A 4BATA 3HYRA 3BH7A 3W6UA 1H2ZA 1MGPA 2G28A 4Q7LA 5FD8A 1SNYA 5UKDA 4E5MA 4ALMA 3QKIA 4EBFA 2YRFA 1U04A 2OO5C 3OLVA 5D87A 4B80A 4UEJA 1EXVA 5J2TA 2Z98A 2QIPA 2PIDA 4OHPA 4MLCA 2A58A 1DC4A 4KQ6A 4RSMA 4B47A 2OKGA 2PMCA 2O4UX 4KHPB 4FDVA 5B37A 4R6WA 1BEEA 1QO0A 2XMDA 5EIBC 2XGOA 1PTJC 3K9HA 4F3RA 3UVEA 4BVEA 3IOYA 1WQ1R 3MJCA 5AKHA 1TU4A 5KREA 3HP4A 5HEKA 3T9EA 2W98A 4DMLA 2HBQA 2BEUB 1DWPA 2ODWA 2VJCA 1RYEA 1GTZA 4RD6A 4XWGA 1OI7A 2A57A 1FPQA 4HX5A 4INZA 1G8MA 2JS7A 4OG2A 2VF4X 5G0TA 4C0XA 3F2VA 4EJ0A 1QTNA 4I4LA 2WQ6A 2C0PA 3DEAA 2Y1DA 1T0IA 3GGPA 4UTZA 4YFVA 3R9KA 1I5OA 4EVQA 3AIOA 1VKZA 1L7OA 1QSGA 4I1YA 4S3MA 1H6BA 2W2LA 3K2BA 4EO7A 2PJUA 3HXPA 2DUMA 1RI1A 2PGJA 1TECE 2ZWIA 4GSKA 3FDZB 2BT4A 4Q4JB 1S8NA 1QZ3A 4DCSA 3IH5A 4URXR 5KOYA 4YUVA 3ZHXA 4BN0A 2PUGA 2R68A 1JQDA 3KXIA 4PZLA 1ZUD1 5FADA 4C0SA 4YAKA 4WJZA 2FPGA 5IUKC 5FOSA 1A2OA 3GLHA 3T7TA 5KU7A 1KKUA 2VZLA 2CHQA 4BLOA 3G2JA 3K0SA 2H85A 3ZDDA 1AQJA 1C1HA 2SNIE 5AOCA 2JAQA 1FXUA 1SBYA 1RWOA 2YVQA 3WLMA 3O8LA 1BCSA 2B4TO 4HVAA 2OUKA 4B3CA 1F48A 2F3TA 4S0XA 1EVJA 2JFFA 4A73A 4D6YA 3ITEA 5INTA 2W2XA 1DUIA 5LQAA 2F67A 3TUJC 3TCKA 3WFIA 1H0HA 3EQ9A 5LXTB 4BFLA 3DE0X 5F9FA 2ZVDA 4KRXA 3ZE0B 4U3JA 3NKFA 3B3AA 2CJWA 4C7VA 1PZXA 1COZA 4B3BA 3THWA 2IUFA 3WLOA 4E4YA 4M8LA 5A5EA 1XAIA 3LC7O 4ZC1A 1XP8A 3DJYA 4CQLB 4PNEA 4ZI3A 4OTZA 1SQSA 3VO9A 1BKSB 4WN3A 4XIJA 1EDDA 1W35A 2AT1A 4YECA 5LZ5A 4M0MA 2C4HA 3USCS 2PGDA 3O4HA 1KWGA 3LWNA 4KE9A 2O3RA 1FU8A 3HB9A 3CUTA 4UVGA 2YHSA 1N5MA 3ZI7A 4CYMA 2H5IA 3F5FA 3RLFA 1F4VA 4I4NA 1YE8A 1JG2A 4WCFC 5AI9A 3KR0A 3THXB 2AFRA 1ZJ4A 3GROA 1YHYA 1B2LA 1XA3A 4O4IF 2FR0A 4C4AA 1IUPA 3WO0A 1U9ZA 1YMVA 1S2GA 1ZW1A 1OV6A 3FSGD 1WV1A 3AFHA 3OAAD 2C03A 3ACCA 5A03A 5JY1A 4PVDA 1HT1E 2BRUA 4DSZA 4GPTA 4PC3A 3PQ8A 5LXTF 3SEFA 1RYDA 2JCYA 5K5EA 1OPRA 3B2QA 2X3YA 1T2UA 3DMPA 2CD7A 1FS5A 5EE3A 2EX1A 1HT0A 3H0CA 4C2AA 2WFLA 4CIXA 4ETNA 2O6HA 1DEOA 2AFHB 4F2PA 4JH0A 4K6CA 4U0KA 2G63A 2OQ2A 1ZLXA 3OY7A 1N8TA 2AOVA 2Q5QA 5H3CA 2B1RA 3UJ6A 3LC0A 1VZ2A 1COWD 2BZ0A 4RHCA 4DLZA 1MZPA 4KK4A 1N6HA 3LHSA 2GBPA 4PF1A 4XD7A 1CQZA 1H8HA 1THZA 2DE0X 2EFDB 4JMLA 3P2OA 1WBBA 4PWZA 1YC2A 2D59A 3AP2A 3A3PA 2IWRA 4EFMA 1V6AA 4TM8A 5FUYA 2ZATA 2AZTA 4GVLA 4P53A 1PWZA 1ZIYA 1LH0A 3IVXA 1C5KA 4O33A 3RUEA 4IVRA 2H4HA 3EASA 4K9MA 4NENA 2B25A 2H1RA 3L7MA 1J4AA 3NATA 1DPGA 5A3JA 4K1XA 5AHOA 3SWWA 3O8BA 4AFNA 2GDZA 4NLLA 2B35A 5HHTA 3BQMB 5AVKA 3M1YA 3ASZA 1E9RA 3DBOB 5ALHA 4A1FA 2O2XA 3X1XA 4BO5A 1BA3A 4HI0E 3V32A 1V1JA 2WWTA 1Z2PX 3I6IA 1YIOA 2QTVB 4X71A 2PT9A 3RSSA 4PZAA 2BM1A 3BMQA 3DLIA 2MR5A 3CPEA 3CX7A 4TZKA 2IUUA 1UMKA 2FWNA 3ER6A 1BG6A 1T1EA 4G0QA 4B6GA 2CEAA 2G1JA 4DLLA 1S2DA 4IINA 4ZVMA 1OV4A 1ZCJA 1XTPA 5FBRB 1YRHA 4JWKA 3G0IA 4Z53A 1JAYA 5K0FA 3SVTA 1W581 5D85A 1DZIA 3PC8C 2J0QA 3AF0A 4LRXA 3TRDA 2P6OA 2W00A 1JE1A 3DAFA 3K0FA 4F72A 2WHYA 5BWLA 2XYVA 1UOPA 3P19A 2NYRA 1D9ZA 4JELA 1DXQA 2RFLA 2OBMA 2ZITA 2H65A 1O6ZA 1R2QA 1TE2A 2F9MA 2HEIA 1KE1A 4AX8A 3MBIA 1HLFA 1X15A 3H9GA 4DBLC 3EFOA 1R4NB 2BUCA 1XYVA 3HU3A 4HO1X 2R0QC 4QASA 3IKLA 1KJIA 2OB2A 1J7KA 1T1RA 1ZC4A 1YKFA 3GG9A 3IHLA 1H2RS 3KQYA 4IILA 4R4JA 3EMBA 2AA3A 1SXIA 2JBHA 1EP2B 5ALEA 3UHJA 3M6XA 3NHZA 4QTYA 4R05A 4TOIA 4X20A 4EX6A 3OBBA 2H9YA 5BW6B 4D0NA 1SM4A 5DRTA 1EEHA 1J07A 1BE1A 3WMWA 4X65B 3G2MA 3PDIB 4QXOA 3W9UA 3KQWA 2IZ0A 4ZJZA 1E4VA 1J97A 4MGIR 3GXOA 1T4DA 1EVLA 1T10A 1CFZA 1NBHA 4I3FA 4G25A 3IE2A 4J94A 2C9BA 4HQRA 4O2LA 2XCOA 4J7AA 3SKXA 3VHXB 3ZW9A 4B6SA 3ZV6A 1I8TA 3MCWA 2QM7A 3W1EA 2XF2A 5I7HA 3SQOA 3ND6A 2BHSA 1STOA 1WDKA 4I1RA 3ZBPA 2PKCA 4BFVA 1W1UA 4HUTA 3E9QA 3GZJA 3MEQA 3QUTA 4IHJF 5ALUA 3G82C 4CIWA 1BOOA 4BLRA 2R8BA 3ELUA 2JZCA 1KH2A 2Q8PA 4MHSA 4ZOCA 4AKSA 1RWNA 5HQTA 3UPUA 3ICQB 2GBGA 1FVXA 3QVWA 3QWIA 3IOEA 1SR8A 1XQWA 4DV3B 1R18A 3DOIA 1GNPA 2J1LA 4ICIA 4I50B 2Q3LA 3T34A 3KE8A 4REQB 1CUSA 4IBOA 2JBAB 5BW8A 3H0KA 3KXKA 3T61A 1UQTA 1K63A 4CR6A 1KFBB 2A9QA 2YJTD 2VJOA 1BMDA 3STVA 1NLMA 4AYTA 3BAZA 4R8VA 4ZAYA 5JJCA 4PLZA 3COSA 2RHDA 3II6X 2ONKA 3I4FA 2G7MC 2VQSA 2WM9B 5HQ3B 1ZJZA 3NIWA 3P4UA 4URUR 1NVTA 3BH6A 5IK2A 5DNCA 3T5CA 2J3JA 3KYCA 4Z5XA 1V6CA 1XZBA 3ILYA 3CH5A 1LTKA 1XDUA 1U98A 2XVXA 4O2AB 5ALFA 3TW4A 4NXMB 3ZJTA 5K8CA 4OQYA 4MDFA 3K8OE 2IW1A 4E46A 2CLHB 2VNHA 1U0SY 2YR0A 1ODTC 2JJ1D 1M54A 3K72B 4DEVA 1IHYA 1QHHA 2V3WA 5JS7A 5DLYA 4WH0A 1QU3A 3DEJA 4BEJA 3KUXA 1XA0A 1E2DA 3B36A 4XIIA 2Y6VA 5LCXA 3I2FA 3SZRA 1XCMA 1ZH8A 1EDZA 4WL0A 2NP7A 3BHNA 3C3WA 4I9UA 1OXTA 3PUHA 1N1MA 1BDHA 4EP1A 4Z51A 4HVTA 4WECA 3KS9A 2R8ZA 1K5GA 1NVUQ 2UYHA 3AIKA 4W8HA 1W85A 3PTZA 1V7PC 1SUIA 3WIVA 4EYQA 2HHCA 1U5CA 2QVGA 4OCZA 2CK3A 3RFVA 3V4VB 3OE1A 4NCHA 3NO4A 3J7TA 1OXMA 3M4JA 2D6FA 4GKKB 3GBVA 4PWYA 3FBGA 4YAEA 3V42A 5C1DA 1YR7A 4LZAA 4QULA 4O2AF 5JSUA 3LNCA 2IS6A 2WJWA 1SXHA 2BGMA 3GT3A 2JGAA 1E77A 4BWFB 3PU6A 1GAEO 1W4ZA 5SZIA 4JASB 4UARA 5F33A 2JD1A 2CJYA 1CUCA 4BTEA 1N6OA 3PHGA 4EEXA 2J67A 4F8YA 4Z1MA 4M0UA 1GQRA 2JB9A 3FNBA 1EJ2A 3VUEA 1DB3A 3WLHA 2RCNA 4FTWA 1TK9A 5GM1A 4CL8A 2OHFA 1DKUA 2XWPA 1KMHB 3H2GA 3H99A 3K09C 3MMSA 4OHMA 2QN7A 3TRKA 3AH8A 3ZLVA 2HN9A 4IOMA 5DP2A 3ZV4A 4LTDA 4TVOA 3CKYA 2BFBA 1I7SB 1KY2A 3W78A 2HO4A 2VAMA 3EQ2A 4F9EA 4BLWA 2QYTA 4WESB 1T9CA 1O94D 4A1OA 4R2MA 1EFAA 3W5IA 3ETEA 4EQZA 2NT4A 3AVVA 3H2YA 3ZCVA 4YP7A 4D5EA 3AUKA 3IIJA 5E6UB 4F04A 5KYNA 3OQOA 4G36A 4EEZA 1L8AA 1XZDA 2F43B 4LIPD 4UNNA 4IUCS 2FPXA 3DM9B 1SHUX 2XWBF 4G07A 4FZ3A 2FEOA 2NUPB 3IA2A 3N8HA 4QGAA 4RTOA 4R98A 5I7RA 5JC8A 2XKJE 3OEEA 3IPXA 2E82A 5DN9A 3EIEA 1PNOA 1LK5A 1DG1G 2BCEA 3ADDA 4LY0A 5KYKA 4FT4A 4UD2A 3GI1A 5D3QA 1L5ZA 4R1PA 3WK6A 1NI4B 3ZDCA 2HBZA 2HZBA 2XTAA 3O2JA 4EFKA 3CG0A 5BV8A 2HLHA 2VWHA 1DMRA 1XN1A 1LBTA 1VG8A 5CYPA 3K5WA 5BSMA 2FSIA 2GJKA 4EZEA 4F4UA 1F2UA 4HWOA 4FFBB 4DQVA 5A2GA 1N2BA 5DYIA 2UZ4A 1HTTA 1T9BA 4L57A 1PJLA 3PNSA 4CT4B 1YR6A 1DV1A 3BD7A 1UBTS 1D5WA 2VRBA 4IJ5A 2HA5A 2I22A 1HDEA 3L06A 3OE5A 3H2BA 1JQEA 3SC6A 5C18A 1JFTA 1M1UA 2WJ6A 3K15A 3NALA 4P98A 2IYSA 1WZCA 2GNPA 3B82A 4IDOA 4NE7A 1QV6A 1KJ8A 1MX3A 1IB6A 5ES4B 3GZTB 2GJ8A 3DT6A 2G67A 4TMYA 4KAAA 1JZTA 1LNZA 1QQ5A 4HLDA 1NQ5A 4X1KA 1RJEA 5C80A 3VH4A 3T95A 4MUIA 4OHXA 3DD5A 1EDEA 3V8BA 1JHZA 1N4AA 3R4CA 1C7FA 3WGUA 2NZJA 4HGPA 1XALA 1RYYA 4DLSA 3W04A 2O06A 2WD9A 1MVNA 3OZWA 2DFKB 3RS9A 3LP8A 3R1IA 2FH5B 4CKBB 2Y92A 4RYDA 1IZ8A 1U8UA 2LR0A 3GPCA 1EYZA 2NSJA 1QG4A 1QF7A 1ENZA 3QNMA 5K6AA 4PRYA 4L5AA 4YRNA 1HDGO 4NYIQ 2EZUA 2GDJA 1G8YA 1Z0IA 5IARA 2VHJA 1NA5A 3GF4A 3W3AA 4QJ4A 4ZYWA 4PE5B 2W42A 4XYEA 3D8UA 1I5EA 3HDHA 4K6HA 4R83A 3A1SA 3JQAA 3TD2A 5IMSA 2XCRB 1C3VA 2HU2A 2VIIA 1E4YA 2HKIA 4L51A 2ZCUA 5DFAA 3ZH9B 1C9JA 2CXHA 5FFFA 3I76A 3AR6A 1FY2A 1BX0A 4NSNA 3RS3A 4J29A 1P5JA 1G5PA 1WSBA 1X1EA 3TD6A 3OOEA 4IJVA 2YY6A 3ESBA 3NJ8A 2ZI9A 3W5HA 1D6MA 3KOYA 1A9YA 3NHUA 1FLAA 1NP6A 1C4OA 1VP3A 2OM2A 3FZGA 3NDPA 4HGYA 1PEDA 5IH3A 3WWYA 3KTDA 2OQIA 1EM6A 1MF7A 1YRBA 2FZEA 5C1OA 3NIBA 1K27A 4QL3A 2XB8A 5DULA 1KMIY 3BRWA 3WYCA 3MILA 1V5FA 3G9ZA 1DTWA 4W8GA 5HF9A 3I12A 3WMGA 4HX9A 1U3DA 4KGVA 5L3QA 1GUBA 4N8SA 3SLGA 3J7AC 4MVJG 5TGDA 4TTRA 3IALA 1QCYA 4EY8A 1YQWA 1TPYA 4EUNA 1UCFA 2Y1WA 3RV3A 1O4WA 2VF8A 3ENVA 5ALWA 2HZ7A 4H1VA 3L02A 3VU9A 1OWMA 1KDOA 3DMTC 3SFVA 4CDRA 1BDJA 1U0LA 2G5CA 2PWBA 1MPTA 2VTEA 3Q0EA 4ZPJA 1IUOA 5T4FA 1GQQA 3MFQA 3LUCA 1BWRA 3D64A 1N7HA 2PXCA 2B0JA 2AN5A 1ML3A 2VA9A 2BE7A 3QU2A 4X8MA 1WU8A 4BKUA 4DSUA 3HM9A 2P68A 3EVAA 3FN4A 5A9SB 3EZNA 2EJWA 2VJKA 2O3JA 4GVPA 2CDCA 3P2YA 4B09A 2GBCA 3K6KA 4MV9A 5BW4A 5IG2A 1J0CA 2ZBGA 3OZRA 1OX6A 3AHIA 4RZSA 3WWDA 3BMCA 2IEZA 2GEKA 1W87A 1YC5A 1K88A 2BGUA 2NU9A 4CMEC 2WA1A 2VO1A 3TXAA 1EVIA 4KQHA 5FPYA 4F5WA 5ED4A 1BQ4A 1B14A 3K9FC 2X2FA 1WB9A 2ZIXA 3EC2A 3N7AA 3OCXA 2BGTA 4KBGA 5JRJA 3SR3A 2YCBA 2QW0X 2LCQA 1GO2A 1ZOIA 4MIKA 3SJUA 4ZAGA 1RRCA 1LA2A 1SKYE 3PLAE 4OM7A 3MBKA 3MM4A 4JC5A 5AJYA 2QK4A 3LP6A 1SU8A 2QN6A 2CXRA 1Q3HA 2I2AA 4NS1A 3SSAA 3I0NA 3ENQA 1WUTA 3A9VA 4JK3A 1C41A 2A4KA 1UAYA 1XTBA 3SSOA 4XWWA 4Q3LA 3F5SA 3RDPA 5JD6A 2LZ0A 4P36A 2XWSA 2ILTA 4OU5A 1TYDE 2ZRBA 1RLMA 1OWNA 3TEJA 1NBIA 1V43A 8ATCA 4JI5B 1JEYB 1ZHFA 3IDQA 4OF4A 4ZQEA 3KJZA 2UZ3A 2QVZX 2DR0A 4GBJA 4H3VA 3R7FA 3C70A 3DDWA 3HY3A 4EA6A 5KWEA 4NTZA 4DLNA 1RLIA 3PXEA 2P9YA 1Z5ZA 3D6TB 5LMZA 3RFTA 1BXGA 2PUEA 1GQFA 2C0CA 2ZLBA 1NN0A 3WGTA 2MYUA 3D1VA 4JSRA 5PGMA 3OT5A 1PS8A 3C87A 2OGZA 4FKMA 5BN3B 2VXCA 3GGGA 3H8SA 2C92A 3VBEA 3WB0A 3FWHA 1N78A 3WIOA 1O96B 4D3FA 1VIDA 2I6GA 1EXDA 3EPHA 4EDHA 1FMCA 4H7PA 2O1SA 4N7JA 5C34B 5TQVA 4FI3F 4JP2A 1ZOSA 3G6WA 1BD3A 4P1ZA 1VHLA 4UOQA 2IHBA 1XN4A 5AHRA 4IDDA 4M55A 2BM9A 2NU8A 4WJLA 4RWZA 1HQCA 1LQTA 3BD6A 5IJ0A 2A1UB 1H5QA 5JTUA 3DPIA 5EWJB 1VSUA 3OMXA 1OB5A 1E94E 2GAIA 4O63O 1LPBB 1HE1C 2DRIA 2ZVQX 3H6HA 3VX3A 4F4HA 2AN9A 4L0CA 4FLFA 2JJ2A 4BFCA 2NM0A 3LHDA 1ZD5A 2VAVA 3VO1A 2A1TS 3U19A 1OLSB 3VR6A 2ZRFA 1GKLA 2HK8A 2JNWA 1KDZA 4BLVA 1L9XA 4UUOA 3TW8B 3DMYA 5FA8A 4YJDA 1Z7WA 4ZVQA 4J07A 4E1BA 4JN6B 3PF8A 4QTXA 1CJVC 1HEYA 3FIUA 4C06A 3SU8A 1O54A 2IY8A 2VDPB 2O14A 1V26A 4PAGA 5M2QA 1T6ZA 1AGNA 4FGSA 5E1DA 1PG2A 4P33A 4EGFA 2A5LA 2OCXA 4F97A 2VDNB 5LZ7A 1M0EA 1KI1A 4HYQA 2XRFA 4HOYA 4WE3A 2YICA 1E2BA 3PTLA 1KVUA 3R41A 1JFFB 3L6RA 4IZHA 4H7FA 5DHFA 5JQGF 2OBXA 3GVXA 3JYOA 5LIPA 3K71B 1TA9A 2GKGA 1JRLA 3O8OA 1RMQA 4Z9FA 1PL8A 1Z4OA 3ZOZA 3M9LA 1Z2EA 2M1XA 4IGFA 4PCUA 1JG6A 3TVTA 4C22A 1ZONA 1Q0PA 5HJ5A 1A7UA 2UAGA 1QGAA 1GEGA 3RS8A 3KOUA 2RJNA 3B70A 4A8JB 4WNAA 3IMKA 5I48A 2ZE7A 4KVAA 4TZTA 1NMXA 4KR9A 3EOBI 2F1IA 3HCWA 2QBYB 2O8NA 1JFLA 1PSDA 2Q2QA 2QR5A 3GDHA 2FPLA 3ZIAA 1WP9A 4M1KA 2PL1A 1P8JA 1RJWA 4L9SA 3KZ1E 5EMLA 3C7DB 4B74A 4KB5A 1DTEA 1OT5A 4GOXA 1KQGA 1OGJA 4TXHA 1R5BA 2AN4A 5AR1A 2VUSA 1ZL0A 3AHFA 4I1PA 1IK6A 2N9UA 3O83A 4YUZA 1Z2NX 1EPUA 4RV4A 3CKLA 3CV3A 4JGGA 2VA8A 4LYAA 1K8RA 2WKWA 3FCOA 5BSGA 4KAFA 5HJ2A 3HVKA 3HKDB 3NXKA 4W9NC 2VUUA 4LVNA 3HG7A 4ZAXA 4C20A 2GLTA 5C5DA 4LOIA 3FUUA 4IO0A 1E2PA 2I4LA 2FW9A 2P0EA 2SCUB 4RFSA 5ETJA 4ZJYA 3DMRA 1JFSA 1A4RA 1UM8A 3CUEF 1M2VA 1W5AA 2UUPA 2UV8A 3L7CA 1KZ7B 2B78A 2JIBA 1HY3A 3DT8A 3FOCA 3IJPA 1WJGA 4FSXA 4RIIA 5G41A 1L5YA 1R8JA 3BCRA 3HR7A 3EB9A 4XLTA 3FGZA 5A3QA 3Q2OA 3D6NB 2AYXA 3DHYA 4KMOA 5FTLA 3DVLA 1KKLA 4TZ0A 2I6SA 4NBWA 1JH9A 1RAFA 4NONA 4IW3B 4M9CA 4OHUA 1NKVA 1LDGA 1VB3A 2YHUA 3ZU4A 4CM9A 1U28A 3EXIB 1ZD4A 5JNWA 5KUTA 4MTCA 4V0RA 2Q6KA 1H2XA 4WERA 4ARCA 3N2YA 4NRDA 4HRAA 1P5HA 2R6AA 3IUSA 4OXYA 5JNSA 3QFTA 2E18A 3TOSA 4A0SA 1W46A 1H94A 2NAPA 1QHFA 3D2CA 3HXLA 1H8EA 1F1JA 4ISCA 4JR0A 4ARVA 2I2FA 4FKBA 2Z9BA 4RGVA 1C7JA 2GZ2A 1KXZA 4MWDA 4DLVA 2ZYHA 1Y1QA 1ZU5A 2WTBA 3CJQA 5CEJA 1ZH0A 2J45A 3BRCA 4CMIA 2Z83A 1MENA 4BQQA 1KVQA 3A58B 5HIIA 1KPIA 1G6HA 3G2OA 3GUUA 3VA7A 3Q8LA 1TZJA 3IVAA 5KMGA 2BPOA 3SM9A 2TMDA 2WSSD 3AJAA 4E5NA 1F2TA 5M29A 1SBNE 2I03A 3PXDA 2HJHA 4YBZA 5EHIA 4D4IA 4ER7A 2VPWA 3N2KB 4WASA 4JUBA 4S1WA 5KNCD 1UDRA 4RPJA 2YZGA 1KYYA 3NEAA 4FT2A 4JJ7A 1HYBA 4R2JA 2CKMA 1G63A 2O50A 1KP3A 2Q8QA 3NU1A 3E22A 4RELA 4Z0NA 4ZC8A 1KSGA 2FN4A 4BX0A 1X6VA 4F1KA 5BUQA 1YI1A 3CT6A 4MRNA 2YWFA 2II6A 4I19A 2KB0A 1XCBA 3LWDA 2DLNA 1IJKA 4G1CA 2DBVO 2GQ0A 4JFRA 4AAYA 4D2IA 5IAAA 4EKNB 2PBLA 4JVSB 1O87A 1R8SA 3EF3A 1VHDA 4IH4A 4ODIA 5AXDA 3TZKA 5KYWB 1XKLA 2PZGA 3CLSD 2RJOA 4AYWA 1G2IA 4L1KA 3IBGA 4RZQA 3AB7A 2IGTA 1DKLA 1Z4KA 5ALLA 5FO1A 4JLWA 3HMQA 3HFSA 5IDVA 4GPIB 2ATCA 3GPDG 3MBOA 1XXLA 2UKDA 3EH1A 1FXWA 2QMUA 2XUJA 1CUIA 5TX7A 2OXTA 4TL7A 4CVNA 1XE3A 3GPIA 1IQ0A 2PO5A 4TT8A 4D1YA 1G2PA 5AT1A 2I4OA 2PX8A 1WE2A 1ZBDA 2VAXA 4J4TA 3OLQA 1CDOA 2HJRA 2A3NA 2NYAA 3BMOA 3RYFB 5B30A 1YBAA 3REGA 4JUAA 4ZI7B 3ESDA 3K7EA 3IR5A 3QVKA 2XMQA 5E9QA 3HLKA 3SICE 2EF1A 3N87A 5K6TA 5A3RA 4ENTA 3MMZA 2WHPA 2XCIA 2X2OA 5AKLA 3VC7A 2CBZA 4TKZA 5GJVC 1KIMA 4MULA 1EKXA 3ZDAA 3CF2A 4D80A 3UNXA 4NCKA 1JG1A 4L8FA 1KEWA 1HFJA 1XHFA 3PXAA 4HD8A 5IBQA 2I6UA 4S12A 3UT5B 2MSCB 2ACVA 2V6FA 2PGOA 3QP9A 4H7JA 2CMFA 2AZMA 3OZCA 3ZXXA 4TLEA 1HX7A 2QRUA 2BGKA 2FGKA 4ARZA 3OUUA 1MDFA 4QGHA 3M3DA 1FFWA 5B1EA 4YJ3F 4DGSA 3WHIA 3ND7A 4LOAA 1CRWG 3A4VA 5DCWA 5CIYA 1JLMA 3HGQA 4XLLA 1XUOA 2C54A 1MO4A 3WL4A 4ZI7F 3G5TA 4V3BA 4E4TA 2CZQA 1EU1A 1RU3A 1Z4IA 3ONEA 5CT5A 3WTBA 3GLQA 1JU3A 1W5BA 4LGCA 3QK7A 1DWQA 1K5HA 3RAJA 1R3DA 3H3XA 1ZDMA 5LN1A 5JAHA 3KFVA 4KQWA 3BWVA 4ND7A 3HDJA 4K6OA 1C3OB 1ZCBA 4WZBA 2ZAOA 1XNQB 4GE3A 4Y2VA 3W5CA 3BWCA 1CNFA 3ZG6A 5J4KA 1N33B 1J0DA 4Q1VA 1WOMA 2KWIA 1PWHA 3H1PA 2VJMA 5E7JA 5IM4F 4P4SB 2C7BA 2RGAA 2D2IA 2GA8A 4B2YA 1YOVA 4NPHA 2P2LA 1DSSG 1ZC3A 3MRTA 3VAYA 1ZZGA 2J5KA 3GNQA 4L8GA 2XYHA 3TM4A 4CW7A 3MHPA 1E79A 2L18A 3WR5A 4NFHA 4ADSG 3UICA 3L2OB 4ZYXA 2OD7A 4RQUA 5FB3A 4V1CA 2OMKA 5KQLA 3SM3A 3ADPA 3RBAA 3Q7TA 4BEVA 3HUFA 4D9NA 4B2IA 4W1QA 4DLUA 3CRQA 5LKAA 1WPGA 4P92A 2XHZA 4B5LA 5A1TA 1NVAA 1S5PA 4U2KA 3MPOA 2P2YA 4M60A 5DLEA 2DB3A 2ZDQA 5ANRB 1Q2XA 3TLYA 3FTFA 5CM9C 2Z2IA 4LK3A 4LFCB 3LPMA 3HCCA 2WK1A 5IW8A 1A9SA 4E15A 5C5EA 3T9DA 1CEYA 1X38A 3CH4B 4ZVKA 5AVXA 4C0KA 1QIGA 3KUKA 1GPWB 3RVRA 3AGPA 1RKVA 5FUQA 3PVSA 2Q4DA 4G01B 4BRSA 4ZCPA 4TQAA 3E5NA 4ETMA 3PX3A 3HNPA 3BYZA 3KM0A 4UMDA 5AW9A 3TFWA 1KXJA 1LNSA 3HI6A 3V6MA 4WK4B 3R6WA 4EA8A 3V7FA 4XJXA 1UZUA 2VF2A 4YAFA 4W1SA 1WXEA 2RGYA 1X1AA 3JWGA 4YIHA 2R60A 3PX2A 2AR9A 4BC0A 5HS4A 1GRNA 3AEUA 5LYJB 4FM9A 4WK2B 5TQ2B 5FHRA 2YWHA 4D79A 5EQJB 2CHGA 4BNJA 3FB4A 1WVIA 1JT9A 1G4UR 1TXGA 3HZZA 3UH0A 1RHQA 5C5IA 4ENVA 5HF6A 4HLUA 1A82A 4YAGA 1NC3A 4DA7A 3V4ZA 2P6UA 1NUUA 4QGGA 1XG5A 2R7LA 1YJCA 2RAFA 5L95A 2BFFA 4X00A 2VHUA 1WV0A 1W19A 1V9LA 3GUZA 1HE3A 4OMUA 3RJZA 3S1LA 3STXA 3RVSA 4XKJA 1RSZA 3T5GA 1BMFA 1W25A 2ZPTX 2BGGA 2H51A 3FTQA 3GV0A 1U4SA 2YYYA 3K0EA 4WV3A 1K7SN 1IB0A 1XA4A 3TSAA 2NUAA 3QX9A 2GXSA 4UXHA 5AW5A 1F0KA 4DB4A 3WRWA 3ZQUA 3BCSA 2XODA 4XCVA 2FMUA 2C4UA 4JT4A 3UK6A 4H59A 1S4MA 1IIBA 3HPRA 4MJ7A 5D7NA 4NDAA 5KYXB 4MWGA 3H5NA 5LVAA 1GKYA 3R09A 1FNDA 2V5VA 1ZKDA 4LFAB 2GJSA 2JBWA 2J0SA 4CMJA 3GYGA 2QNIA 4QO8A 4X61A 4F85A 1Z28A 4PPGA 3DM5A 1AKRA 4ZK2A 1T3HA 5B6JA 5JZVA 5AW1A 2ZS8A 3SR0A 1R6XA 3PGVA 3O8QB 3TOXA 2RD2A 3EIOA 1EK1A 1HYEA 2XCQA 2ZRIA 4MJXA 3OQBA 3VNBA 3WJ2A 4DSNA 1PT6A 5CFLA 2IF0A 4P4NA 3K1YA 3Q9SA 2VT6A 3OOYA 1BN7A 2JLYA 1E96A 2V7BA 4BO4A 5IU6A 4OKSA 5IAJA 3ROFA 1MUUA 3ED1A 2ATXA 3GNSA 3GA5A 3O4JA 3F73A 1XKTA 5KKAA 1P0QA 1YZUA 4QOIA 1FFCA 1JGTA 1UEJA 1TM3E 3EDQA 3VVMA 1M33A 1YZQA 3ROGA 4RHUA 1OFHA 3QXHA 3STHA 4XVUA 2AVNA 3GLIE 3ESRA 3JZDA 3LUDA 3DDOA 1CVRA 4JQOA 3W2IA 4PCAA 5J3JA 2QLFA 5P21A 1VXOA 2HWXA 3V1MA 1F5SA 3T5AA 5ALNA 3VH3A 4BQFA 4N76A 1ULAA 2W2TA 4M36A 2XBMA 3R5FA 2CDBA 2DQZA 2W4MA 4YBRA 1M1ZA 5EPUA 4TKVA 1PG0A 1M7BA 5TY0A 1SUBA 1YB2A 4GFDA 5B4TA 4DKXA 3ZLJA 2AJCA 1X8LA 2CV1A 1X80A 3NONA 2QR3A 3NVAA 5CGQB 3BGDA 3CX8A 3EXHA 1WCIA 2JHPA 3JAWB 4HH3C 4JUFA 1LB1B 1N2EA 2R1TB 3TE6A 5IVPA 4ND6A 1NPYA 3LXXA 1JPNA 2P40A 4TKLA 5HRCA 5L7WA 1H3EA 4F0JA 3DLHA 1L6RA 1TQ6A 3AXSA 3ZDEA 1I80A 4PG7A 1X3SA 1NLZA 5DNUA 3TLGB 3KLNA 3ND5A 3NBQA 2PPVA 2QE7D 3B6IA 4E3ZA 3RFXA 4BDTA 4GBGA 1EK5A 3KT6A 2O23A 1V5WA 3DE6X 3AFIA 4MRRA 4YAJA 4CCSA 4UM5A 1MCZA 3KPVA 1SA0A 2E89A 4UEWA 4D99A 1CJKC 3A14A 2UXCB 3F3MA 4OYYA 3LT0A 4YRMA 1UBEA 5EL0A 1EX7A 3N58A 1I10A 4MA0A 1Y9EA 1LPOA 4ZO4A 2I2BA 1UEXC 3GA0A 4AJLA 3GLIA 4GWKA 4Y9TA 2REBA 3W2GA 4IXDA 2ECKA 4XIYA 3B8EA 4QVKA 1RLJA 3Q7RA 1A9XA 4NC9A 1MJNA 1QOPB 1T1SA 4JBNA 5AM5A 2HR1A 3TRFA 4JA0A 1VL6A 3LQQA 2Q5HA 3MIZA 4UCXA 1JNYA 1XMVA 3CRMA 1BCRB 3QLEA 2CLDX 2ZSDA 3DR3A 3QEKA 3CLRC 3KL4A 2OXIA 1OX4A 2ZRQA 3O82A 2J41A 1EFHA 4GG1A 5L7TA 2CLIB 4AZWA 1QIJA 1I0LA 1TVEA 4TV8A 1CR0A 1QIHA 2J9GA 2XF8A 5JATA 3KU1A 2ZIVB 5EGSA 2VHQA 3QKUA 2J7PA 1OJ7A 1IAVA 1L8OA 2PT7A 1TB4A 1UDCA 4RDCA 3VDMA 1H2BA 1NASA 1XDBA 4UQLA 4MR7B 4ZQGA 4YT8A 4BN5A 1H4VB 1JP7A 2I33A 1V8FA 5L4NA 3WL5A 4EENA 5J5AA 1Q3KA 2NVBA 4Q7MB 3RYHB 3BXPA 4AUEA 4ESOA 4DQKA 2UXBB 3VU0A 1QGOA 4F3KA 1KS2A 4ZEWA 3TQIA 2BFMA 9MHTA 4JGIA 3NCHA 1D8TA 4Y2XA 1VKOA 4JJFA 4MGKR 4HDQB 3OQIB 3D81A 5BV7A 4YQEA 4PM4A 2Q50A 3NC4A 4PBTA 4AZTA 1J23A 4MA5A 5LJIA 2HSJA 2VP3A 1V4BA 5BOVA 1I1OA 3SIRA 3T99A 4QHYA 5D1HA 2FETA 1T8WA 1S3FA 4F86A 1JDNA 3GEMA 2JC3A 3IDAA 5CNJA 3AUYA 5CIQA 4XOIA 3SYMA 4DWOA 2IX9A 1J70A 3C3PA 4BKPA 4Y2UA 1TOAA 4BKRA 3SXUB 4KPUB 4Y6OA 1OKKA 3IMCA 3LU1A 1UC5B 3UYKA 3L18A 2WAMA 4B84A 3U1VA 4FOOA 3PNKA 3HYNA 3IE0A 1FBNA 1F2VA 4G0ZA 2GZMA 5HVNA 1X42A 4CI9A 1ZMOA 1J8FA 5ICSA 4LJAA 1YBFA 5DGHA 4GSYA 5B7GA 3RQIA 1XZ8A 2YXDA 5GWXA 2BJHA 3SS9X 2DUJA 4ABYA 2HY7A 1ABEA 4ZV9A 3SAJA 2Z58A 1HE8B 3K94A 5B1HA 3R7LA 4LGMA 3RYCB 2VUIB 2PJZA 4KFTA 2Q3CA 4R69A 5E4YA 1Z5OA 4UU1A 2J9RA 2Y66A 1DXHA 2GYWA 3RVPA 2GPSA 1AUXA 2J0VA 2OHIA 4YUWA 4ZYUA 5F35A 2FPUA 3NOVA 1NLUA 1TM5E 2E5WA 3RIGA 4B3TB 1G98A 4JMPA 2FN3A 3SHFA 4M1YA 4S1VA 4CIYA 4I9HA 4QPJC 4YQYA 1B8PA 2PK3A 5J4HA 3EGWA 3G7NA 1LFAA 1PD1A 1R6UA 2YVAA 3MJHA 4HB4A 4QD3A 4LZWA 4OHKA 2HJSA 4RZIA 2JJ8A 1BE0A 4KL8S 3E9DA 3EUWA 3VOTA 5C8DA 4DCMA 3FHJA 1ZK3A 1IZYA 1L7RA 1ZVJA 3IAM6 1M10A 3G8YA 3EXFB 3PC3A 4P31A 4CJXA 2IV3A 3FDZA 3Q3HA 4Q4JA 2QRKA 1PFGA 1YS2X 1NSFA 1H2YA 4QA9A 1RFGE 4PO3X 3IPCA 4RSRA 4MKXA 5TGTA 4MQ5A 2QUZA 5GJCA 2JFNA 4MI6A 3ROMA 3RU9A 1LPPA 3GD5A 2AMYA 4D5GA 4NOMA 3M3PA 3PGJA 4R1OA 4CG0A 3M0EA 3BD9A 4G0XA 2CDRA 2C5SA 3IHKA 4O4IA 2FCAA 1HLPA 4NHOA 1UBLS 4WOPA 4OQFA 5HG0A 1T5IA 3ZVLA 3QTLA 1N0VC 3GLSA 5A71A 1DRWA 4KGXA 4XDGA 2OCPA 4NZPA 2WNHA 4RTKA 2AFHE 1YB5A 2C4TA 3BHIA 5E0KB 3UJAA 3ZTTA 5LXTA 4D25A 2C5HA 2FQWA 3EEQA 2WAYA 4LJ7A 4X1YB 4JI6B 4WQMA 5KWIA 4UEKA 1VPVA 3AR2A 1XWFA 4I7EA 1XCLA 2HA2A 5U1PA 4A8PA 1SUEA 2D5BA 4CQLA 4AVYA 1UXHA 2J0UB 4JC8A 2VF7A 3U31A 2ZBVA 1Y33E 1NULA 5L40A 2G6BA 4NYMR 4DJDC 3D6HA 4JUDX 4LQDA 2PKQP 1MC1A 3TTWA 2L19A 3KYIB 2D06A 5KVCA 2FQXA 1IG0A 3OJEA 2CC2A 4EPWA 4BL5A 1R0LA 1HUQA 3GB9A 3E2PA 4BMYA 2UUOA 3FOAA 4HDKB 3IR7A 1FFXB 4R8SA 4ZO9A 1XF9A 1EZZA 4Q5IA 1YRAA 2VHTA 4RAOA 1GTG1 1X92A 2EFHB 3HU2A 1EP9A 1SVLA 2G7ZA 1G8JA 2HPHA 1OLUB 2IYLD 3HCBA 4BX9A 1JSCA 3ELWA 1UANA 1ULSA 2KPOA 4UQPA 4E2YA 2EP5A 1Z2CA 4DVJA 3VI3B 2G9RA 3C74A 1Y8AA 2H9AA 4A0FA 5J5CA 5CB6A 3LUHA 2QZ4A 4TTTS 2LRHA 4CMBA 1TA4A 1DQSA 5DT2A 3DE7X 4YROA 2PFSA 1TUEA 2G4CA 1ORIA 4WSOA 2MSKA 5CCXA 3ZUPA 1YZVA 1RNLA 3HJRA 1UUFA 1QIDA 4JX8A 4IWYA 4JY7A 4D9GA 4CMGA 2H5JA 4XWTA 1TO6A 1U7OA 1Z6GA 3A9RA 4ZEXA 4E0BA 3HJCA 4KFRA 2Z56A 3DTVB 1L1RA 1UJBA 4DMUB 1Q1BA 4OREX 2I65A 1TK3A 2W2LD 3EZFA 3NIDB 3NIFB 4N9QA 1ODIA 1XI2A 1KGSA 4BYMA 1RABA 1EUQA 2OENG 4RKRA 3ETJA 1E7YA 1JB9A 1OBVA 3A2MA 3PB3A 1Y9JA 2ZI5A 3V34A 2ZB3A 3OQPA 1IZ0A 4OXXA 3BA1A 3TZCA 3VAAA 1YL7A 1TKCA 2DY1A 2COEA 3NYQA 4HNRA 1LDYA 3B20A 4IIJB 1CIVA 3CE6A 5K8TA 4RGYA 3R3HA 4JOCA 3MVEA 3UJPA 5CEFA 1ZGJA 4PINA 1EGHA 4OBBA 5L53A 3TQHA 3JTMA 1XFDA 3DZFA 1RHMA 5ERGB 1E98A 2SKCA 3IQHX 3A11A 4FQ5A 3RHFA 3B53X 3W2HA 1FNSA 1K92A 3AM5A 1R0CA 1QS0B 1VJCA 3BICA 3HCFA 2O54A 1H4SA 3HH8A 2W6IA 4M21A 4PN3A 2CFIA 5BSKA 4LSGA 3VZSA 3MJRA 2RC6A 5K6RA 1MTOA 4MPTA 1Z0UA 1H1DA 2QTVA 3C1UA 1U80A 1Z0ZA 2B99A 3FLAA 4AW9A 1ND6A 3WLQA 4QYMA 2OHOA 5K99A 2QB5A 4B75A 3FRHA 5IT5A 3ISJA 5TQJA 2HA4A 3RC9A 1F9AA 3GAAA 3Q4GA 1VBFA 3LDHA 2X22A 3IBFA 2VP6A 1I6LA 1W44A 1HFWA 1CHNA 3JYHA 3H1EA 4NVRA 4RS4A 4ZQBA 3LLCA 1VYUA 5GJWC 2F1HA 4RO0A 1L7PA 3RT7A 3S4YA 1H2EA 3M5DA 4EFLA 4AQ7A 3AY3A 1W9MA 3WYGA 4AUNA 5ARBA 4PNPA 5SZHB 4C01A 3GUYA 1VLLA 4JLJA 4M22A 4XJSA 3R76A 4DYHA 2ORWA 2NQ2C 2V7TA 721PA 4M8NE 4QT4A 2H8GA 4HVLA 4YMTA 1QHYA 1R4NA 3DZCA 5FBQB 3BZUA 4ID3A 2QN2A 4FZJA 1DRUA 4DR7B 4WXRA 1KBQA 1Q1GA 3EEIA 2Q2VA 1MT3A 3GFOA 3BQ9A 3MB8A 3I6MA 3TTSA 1RTTA 3W2TA 1KFJB 3HB5X 3IUNA 5JAPA 1AA9A 1FU4A 1NYLA 2D1SA 3LGXA 1LLCA 5KTOA 3D54D 2JLZA 3MT0A 1XJQA 2XTMA 3W8NA 3RTEA 3BL6A 4ZGBA 1YJBA 3N7UA 1T36B 3L6CA 2V65A 4JKOA 5LWHA 3PDIA 2IS4A 4M1TA 1YI8A 1UDXA 3L07A 2JATA 3NVMB 1H8HD 2VCYA 4PHGA 4AZ3B 5KNLA 3AJ9A 4RPKA 3DAPA 3F8TA 3UT0A 1U2EA 5JTTA 3BWBA 3VHXA 4PSAA 4X8HA 2C8VA 1E69A 4NULA 4ZHQB 1PJZA 1JKJB 3UFBA 1HDOA 2YL2A 3DEIA 3GMSA 3M5PA 1P2UA 1Z9BA 2IOFK 3R9IA 1J0XO 1O95A 3A32A 4F3NA 5A0FA 4Q1AA 1WY7A 2A9JA 3ITKA 4JODA 4EF5A 4QU9A 1DADA 4H7DA 3PWKA 4NH0A 3WLAA 1FSSA 2MIIA 4QECA 4O6VA 4WUVA 1SZPA 1ZJ5A 4PHFA 3TZHA 4I50A 1KEZA 3TIFA 4PNZA 1R7RA 5JROA 4REQA 1UMCB 3DOUA 2JBAA 2P9CA 3DZKA 3ZZMA 4X24A 1GRCA 4D45A 2BKAA 2Y67A 3WS7A 2I54A 2DERA 3ZK9A 2QDKA 4IIVA 4EY6A 2XSZA 3CW8X 1HE2A 4PPQA 2WHXA 5AM0A 5HQ3A 1QK5A 5HFNA 2E5FA 2JAHA 1GQSA 1NYTA 2JFUA 3HP7A 4OMDA 2YIMA 4ZHQF 2SHKA 4X7BA 4O2AA 1GLNA 3E9EA 2P2NA 3L0IB 4NV1A 5DM4A 3U3DA 2OA0A 2PMBA 2CUKA 3CSSA 4D4HA 2PMFA 2YN4A 4DDMA 4HFRA 1ACLA 1G4HA 4WD3A 4L6AA 4ZEVA 1P2TA 4GMHA 2VKTA 3AUAA 4KV9A 5AW2A 3A1DA 5LZ8A 4D9CA 3DMNA 3H8JA 3I42A 4DM4A 4CV1A 1KORA 2VNJA 4WOKA 4N3AA 1NSTA 3MRVA 1BKYA 3MOIA 2DBYA 3I05A 3CJTA 2BYTA 1JIUA 1VMIA 4DDWA 1YACA 2IOQA 2X0EA 2R751 3WK9A 2A88A 2Q4OA 1M2JA 1Q0QA 3IB3A 1TCUA 4J76A 4JV5B 2J4DA 4IVNA 4YUXA 1JU9A 4FBGA 3ZVMA 1WMFA 3FFTA 4M9QA 2JA2A 5FL7A 5I47A 3SGLA 1LVGA 2XBUA 3CBQA 1GN9A 2DHQA 3T06B 3UAGA 3OZ7A 2FYTA 5F77A 1ZD3A 3MTBA 4K0RA 3ZKWB 3EVEA 2EFYA 8ADHA 2PIAA 3LOPA 2X7JA 2G88A 4I4TF 1KC1A 2FX3A 3SP1A 3VQTA 2H18A 1KYWA 4C3VA 1FQOA 2BSXA 4X3CA 1WZIA 2AMVA 1IBSA 4I9NA 3WKCA 2F8TA 4M1EA 1R16A 1IOLA 5F1OA 4AMYA 1NOIA 1KMHA 2R7KA 3A6GA 3AEQB 4FS8A 2ZDGA 1DS6A 3ZW8A 2WKRA 3QJGA 1OQAA 3DDCA 3VPXA 1J99A 1XJ5A 3OECA 2KBEA 1UBSB 1RRGA 1B3BA 2FR1A 2WFZA 3E27A 4H6WA 5ALKA 3S55A 2A5FA 3ZWAA 4EARA 3QOXA 4C07A 2IODA 2BRUC 4NOKA 1QHEA 1SBIA 3D0RA 3T3EA 4H0CA 3S2SA 3M1LA 4OQXA 3VR2A 1NPTO 2F43A 1DC3A 1QNLA 1MAWA 3ZY5A 1L7VC 3LSTA 3IMFA 4R31A 3SHQA 4CIDA 2QTFA 1PNVA 2P3QA 1UBKS 3TVYA 1XRNA 2NUPA 3W9BA 1QDEA 3OI7A 3CRZA 4G8BA 4R84A 5FBVB 1HM5A 1XPOA 4B3MB 3ENKA 1MVLA 2WWFA 2YJ3A 2Z0MA 2ZI6A 2XZPA 3KVVA 4GQAA 4BLPA 2D0IA 4RJLA 3WZ2A 2J85A 1NI4A 3GVPA 3KX2A 2I34A 3WL8A 1YCFA 4CCYB 5K4GA 4F4JA 2P9JA 2DHCA 4DLAA 2CE2X 1CK4A 1N57A 4DIKA 3L79A 3C5CA 3P2JA 3FPGA 3LRPA 3VR3D 1OASA 4HAWA 3GMIA 3CHYA 4J0EA 4Y6GB 4C3UA 2HT6A 2XPCA 3FMGA 4GMXA 4WGFA 1U6IA 4G1EB 1MR3F 4H9GA 2VK2A 4YWJA 3PDCA 3RBVA 4ZZ3A 1CLEA 2VFAA 4NMLA 4PQYA 1G0OA 1P62B 3SEZA 4D9IA 1H0SA 1OU0A 4YMWA 3PP8A 2X9LA 3QYAA 2PSDA 5K3EA 1EWVA 3K70D 4ZCRA 3AUJB 4A23A 4GRIA 2RH4A 2XJ9A 2XUDA 1B3RA 2AZ4A 2VPTA 2H1SA 2O05A 2EJTA 4GPEA 1A69A 4GYKA 4RQBA 1GG9A 4UXIA 1HDIA 5EP3A 3UJHA 1Z6QA 1G17A 1G3RA 2C9YA 3E53A 3JR3A 2AMLA 1Q6ZA 3GY0A 4Z4EA 2CZGA 3OLWA 2WKSA 2BMFA 5ALPA 2XUIA 1BOFA 5FNZA 4P38A 1MJFA 1Y0BA 2IXBA 2W6QA 4CKBA 5HCNA 1E63A 1G8HA 4Z7OB 1AO3A 2GSDA 2X0DA 2WSBA 4RPGA 2QN8A 3GJ0A 3OQHA 1Z13A 1CG6A 2EKZA 1NF9A 2EW8A 2ADFA 2G40A 1S8OA 3ENZA 4UUNA 3RRYA 3ZBTA 3DHEA 2WG0A 2VPXA 4JLMA 4PRLA 3DH0A 2AKEA 2HMSA 2YWDA 2HI0A 5KWVA 1Z8FA 3FCAA 3I9NA 2UZ0A 2F1RA 2XQGA 3RASA 3EZ2A 2I67A 4LE0A 1NIJA 1QVRA 3M4YA 4TWZA 5TF0A 4PW0A 1CX9B 1YRYE 3AZQA 4MAMA 1NATA 4LSMA 3JQFA 3B52X 1R74A 4B87A 5AM4A 1PGPA 3V4FA 2NNWB 5B3AA 4TRRA 3SY8A 4QOHA 2R85A 3CRVA 2PSFA 1UJ6A 4KSCA 4JQZA 3FNFA 4EA9A 4QGBA 4NK4A 2PRKA 1RBMA 3SJCA 1MV5A 3DAHA 3OEED 3OF2A 4NV3A 1DBIA 1U0FA 2WU4A 1UPFA 3F1LA 3LXUX 1RQLA 1LPNA 2W6PA 4RKYA 2ZJ4A 1M8KA 1HKUA 4JJ8A 5I4CA 3I01A 3WRVA 4RC9A 3BXXA 2VP9A 5FWDA 1RWVA 4BQSA 1E1KA 2ZI3A 4A8TA 3E2IA 5AVQA 1RCUA 4X41A 5J4YA 2NU6B 1BHJA 5BR7A 5I3ZA 1RYBA 4XB2A 1XHEA 3RREA 4LCJA 3FUXA 3A9SA 4LVOA 2RI1A 1BE8A 5EKUA 4WN9B 4C4SA 2KI5A 4WXPA 3R7NA 1FDWA 3SDBA 4M1SA 3IAS6 2KJQA 4IMIB 4N6NA 4FR2A 5BNFA 4B2PA 2XQKA 1SCNE 3P9NA 4KN5A 2X9GA 4TXLA 4BFXA 5I8ZA 4DIEA 1TJYA 1FYWA 4UDXX 1MO2A 3TBKA 3N8GA 3GDWA 4Q9NA 1DU4A 1N9KA 1WZUA 2TMYA 1ODFA 2CNLA 5A9SA 2FWBA 1OOEA 4JOSA 1QC5B 3GBSA 2CF6A 2XEDA 3OFVA 4N0MA 5HBGA 5DCUA 2HADA 4XDZA 3UB4A 4LV5B 4MV1A 5AVSA 3H9CA 2GD6A 1AZTA 2R48A 1Z6ZA 3P27A 3O8DA 1RMYA 3A28A 1J0AA 4MKIA 4H4DA 3G0BA 4G5OA 3UMYA 2QDXA 4OLHA 3L8DA 1Z4MA 1V37A 4LNAA 5AXCA 1A9TA 3KEQA 1EFUA 2I87A 3KQSA 1E4OA 2FZ5A 3N3BC 4V02A 4YJHB 5DHRA 3G0GA 1P1HA 2X8JB 3RIEA 5GINE 3QU7A 2QYOA 3PHLA 1ZUWA 2XE6A 3SXJA 5AK5A 2ID8A 3FJYA 4FSHA 4F7WA 3AF6A 5LSAA 2I66A 6PFKA 2IRWA 2GYUA 5E3JA 1YE3A 2OPHA 2ZCVA 5IN4A 1DX4A 4NZZA 4W5RA 2YQZA 4G6ZA 1SUSA 2C42A 4FHEA 5TEVA 3L0BA 2WE8A 4QQRA 4L7QA 1T9KA 4K86A 3VYTB 5FPHA 2GM4A 2EKPA 3KVNA 4YP1A 4TPKA 5JNRA 1ZD8A 1W9HA 1I13A 3L1HA 2IXDA 3GLUA 2YQ4A 5FEMA 5HTKA 1MB2A 4A3SA 1NX9A 2EZ4A 1UBMS 1JEYA 3VV3A 4LHXA 4BP3A 5GONF 2OZLB 1FBTA 5A4FS 1FQWA 2XVYA 1QDUA 3NBKA 2FGJA 1WD5A 5FUWA 3LLUA 2NO6A 2CDNA 5B3JA 3F98A 4RWEA 2W5UA 4YS6A 4OQQA 1ODCA 4KXNA 4X6XA 4XTCS 4UUPA 5C1BA 2GPTA 3LY7A 4AK9A 2LIPA 2APJA 3WSVA 3L1JA 2IS2A 4NJMB 3QSYA 2HD4A 1R6TA 1F14A 4WY5A 5BN3A 3EGCA 3WOHA 1J2TA 2Q3FA 1KA9H 1E0DA 1O96A 3ZHQA 3T4PA 2PVCA 3ABIA 4M9RA 2ICAA 1UF9A 3HR4A 3MT7A 1IDN1 2B9VA 2BZGA 4FXOA 5DU2A 5JCXA 2WHRA 3OFKA 4EJMA 4N3CA 3I9KA 3NX4A 4G0PA 1PJ8A 1T3LA 2M32A 5K51A 2A1UA 4JFAA 5G40A 5EWJA 3N5KA 4BMVA 1L4KA 4FYPA 4RM3A 3DOCA 3EUFA 4BJ5A 2VUHB 3O3OB 3UV6A 5IXSA 1AQUA 4RTLA 4DV5B 2YCLA 3VU1A 1UMBB 4B31A 1KI8A 2PLAA 4FD2A 4Q3BA 3AW9A 2H07A 2IL1A 1KRHA 1OLSA 3HRIA 1KYVA 1ZHHA 5FL3A 3U48A 4H27A 3KQKA 4K88A 4KDCA 2XMRA 2HU7A 5B58C 3BCHA 3LQRA 1NNI1 4IF4A 1JR3E 2ODTX 2XE8A 3ELYA 3OX3A 3SG0A 4OLBA 4Q34A 4I1UA 4DPMA 2VYQA 1T6YA 1AX9A 3B6MA 3AR5A 3GP5A 2OZPA 4UVIA 1YQDA 2QTGA 3LD9A 2CUTA 3P96A 3O8CA 3KOZA 3OHMA 2NSLA 2XUFA 4ZAFA 3C5HA 2VP5A 2AR0A 4BV9A 4YUYA 3ESAA 1PKXA 5D5QA 5FBKA 1JFFA 1SCBA 4LJRA 3LUGA 1SG0A 4DBVO 3EHDA 1OIVA 1SRQA 3L8HA 3ZEIA 1RHJA 5THXA 4XIFA 2QR2A 1B0ZA 1WKVA 4OH7A 4IR7A 4A8JA 4FWBA 1AIPA 4B4DA 1YL6A 4PO9A 2PRIA 3T3PB 3EZLA 2IDJA 3T7SA 1P60A 3ZV3A 1REQB 4I8DA 3T9FA 1SUDA 1L3CA 1HK7A 2QBYA 3RTAA 2MSEB 3T54A 4OX9B 4N82A 5JNLA 1PJ2A 4A9AA 2WB2A 2BCJQ 3ZXYA 2IYUA 2VT2A 2O2CA 3QQ5A 3NRBA 3VJLA 3B85A 3NVDA 2VJAA 3ONVA 4NYJR 3S29A 4X1OA 3FYHA 3AKZA 5KHLB 5F2EA 1K9SA 3NBUA 3A36A 3ETGA 1NDHA 2CXTA 4M3NA 1QJ4A 4E2WA 3IJRA 2DUUA 3PPXA 1UXJA 2A84A 3U2QA 3STUA 5CB0A 4GP6A 2QZSA 4KI0A 4L3OA 4HGNA 16PKA 1SAYA 1N2CB 4WBXC 5CYOA 3Q2KA 4YASA 4D8UA 1ZINA 2BLNA 3F90A 5K6AC 4CWAA 3CU5A 3HKDA 1K08A 3K5HA 1BVRA 1QVVA 2NXNA 1R9NA 2C59A 1H4TA 3AFMA 3ANMA 2HWKA 3R0IA 4Q3KA 2SCUA 4BGVA 1P0PA 1JA0A 3TZEA 1N5OX 1L5OA 4YHHB 4NJEB 3IUMA 4YMHA 4CODB 4G23A 1NBMA 4XSVA 4RTMA 1M1YB 1U1EA 2BBSA 4X7MA 1K7EB 5FOTA 2XCTB 2I3BA 3F67A 4FEYA 3IUEA 5LWQA 2AOUA 3VYSB 1RIFA 5I9IA 5IF9A 4ZAWA 2A6PA 5JVDB 3EZYA 3LDUA 3UO8B 1UAGA 1IM2A 1DBVO 2FNAA 2ZJZA 3EXIA 3HQ4O 5BRJA 2QV0A 4H4CA 1P0CA 5DW0A 4ND5A 1UJ4A 2QIOA 2O5RA 3DOOA 4I2NA 3ZHVA 1AC5A 1GZHB 1QYWA 1RWWA 1IH8A 2Z3ZA 5E8JA 3G13A 3GLGB 1VJTA 1JH8A 3FY4A 3N07A 2ETVA 4ZICA 4O3MA 2C31A 4BFWA 2O2ZA 3WAGA 3W6PA 5KYYB 2QWXA 1RJ9B 4BO6A 4NMWA 1E3JA 1NDUA 2EC5A 4X6YA 3LKBA 4FE4A 4P93A 5H7XA 2IXAA 1OPXA 4ABTA 3HB7A 1JHOA 4H60A 1D2EA 4YNBA 5FQOA 5G0UA 1K66A 1XZNA 2NP6A 2DKOA 1NFFA 3LT5A 1XZEA 1F17A 4BNLA 5ICEA 1H5NA 1TQ4A 5IC4A 1FC0A 4HZIA 1WAMA 1ZN8A 3ZIDA 5JG7A 2A30A 5L8VA 3N2KA 3OQJA 4PZ9A 4DY4A 4MIYA 2G80A 2QRHA 3CZ5A 2GCIA 3E7FA 1GRQA 1JQAA 2CGEA 4YRDA 5DMHA 3S7ZA 3UGTA 2XT0A 5THQA 2PUAA 3LL7A 2DH5A 3VPHA 3NPAA 1Q15A 4U5XA 3CX3A 4BPRA 5F5NA 1DV2A 2QD5A 3PQ5A 1GOTA 2IOHA 3HSSA 3M5WA 2PSHA 3QVOA 4JP5A 3FSRA 5KYWA 3ZD8A 5CDGA 4N5LA 1D6JA 3ORFA 3SZ3A 1SC4A 2V4MA 2H1HA 3A3OA 1HE5A 4TMVA 5H68A 1JN0A 5AJXA 4NBLA 1FRNA 4FMDB 2OILA 1HORA 5B2ZA 4C0JA 4DNPA 1N6RA 2XE4A 3ZDQA 4HEQA 3IL2A 3R6GA 2FKAA 2PAAA 4NEQA 1K7FB 3TGPA 4E03A 3FCEA 3BTUA 3HJFA 4FOSA 1W0KA 4IZOA 3BILA 3RYFA 4MUAA 3THSA 1YB4A 5FFMA 4B43A 4QBKA 2O3QA 3RTCA 4ZI7A 4I55F 5IN5A 5ITWA 3FOZA 4NH4A 2HO5A 4MINA 2VPIA 1L5GB 2J8ZA 2JLQA 7MDHA 1NVWQ 4LISA 1QE3A 3GJYA 1ZG3A 1Q16A 4R9VA 1DOZA 4ZOEA 4QFMA 2UYQA 3NAQA 4EHKA 4M0CA 1HQYE 4BLUA 4EB6B 2ZQ5A 1GA1A 1USWA 4TMZA 2ZT8A 1UDWA 4DR4B 5DASA 2V9CA 1MOQA 3VSEA 4NCNA 3WNCA 2WMYA 3HUUA 3MJSA 3GNTA 4IGIA 1OZHA 2G25A 1J42A 2PLWA 3MGCA 4J1TA 2BWJA 4AJNA 5L6MB 1YTUA 3L8CA 4X95A 3ZDBA 4LVCA 2KS6A 3V80A 2QX9A 3L6UA 3QTTA 1H8ED 3SXPA 5B1SA 3AF4A 3AJRA 4D9MA 4HYEA 2HMWA 3N9IA 3AT1A 5CNMA 5DBFA 4D3ZA 3S2UA 1M2WA 4LOJA 2HNAA 5L3SB 2DXIA 3A6HA 2VJLA 2R6R1 2QGNA 5FKJA 4XQ9A 1FOEB 5K3CA 1G291 1Y3HA 2ZUDA 4PZCA 4QPNA 2O4CA 3G5UA 4HAYA 5TPZA 1NURA 3T7RA 2ZJ6A 1U2DA 4MJ3A 4CL2A 2ZSHA 1OI3A 3AL3A 4F3YA 1M2OB 2V9ZA 4RZUA 2A9RA 3TW0A 1C3OA 3RRBA 1NR7A 3ZXSA 5HPYB 2CHUA 1FZTA 2JFBA 4DUPA 2FB9A 1A9QA 4K28A 2DMRA 4II2A 4LOKA 3NFYA 4JHXA 1UKZA 3B2EA 3JQBA 3O2SB 1MX9A 1SXPA 4MS3B 4L22A 2VHEA 3AW8A 3COVA 1G3MA 1EE1A 1Y81A 2XOKA 4WGGA 2F9FA 3RVOA 4ETIA 4FB4A 1KZ9A 5HE9A 4CQMD 1FYXA 1NVFA 3Q3CA 5AJWA 4JYMA 4LY3A 5TC4A 3QWHA 1HDRA 1IFXA 3H1TA 1MHTA 3Q6IA 1MAVA 2D2XA 2PD3A 1VPEA 3I4CA 2QTLA 4TLLB 4LF9B 3QFRA 3PHJA 3IC5A 1E7QA 1QRAA 3K6SA 3C2QA 5HBRA 4BP9A 3S8YA 2H57A 1UM9B 1XQYA 4IX9A 1AQLA 3G6KA 1P7ZA 5E3IA 3ND8A 3P9YA 2RCYA 4HNSA 5JSHA 4W5WA 5E2BA 3ZWNA 4BZXA 2OESA 3O8NA 2R6HA 4WIAA 1LLUA 3BJRA 4F5YA 4EG1A 8MHTA 1UBGA 4RMJA 3DKPA 3LTNC 4DIUA 2JFPA 4ZHSA 1B8UA 1KI3A 1I6KA 5AI0A 5ESRA 2QLNA 3G1WA 2XCLA 4R1TA 3VZDA 5REQB 1KK2A 1RR6A 3VH2A 1B1AA 1S2LA 2R4TA 1ISMA 1B0PA 4BEBA 1RADA 3BE6A 3KKNA 1GUDA 3E7XA 3L92A 3QKTA 2WMDA 1N5LA 4U7TB 1KI7A 4UPVA 2P90A 1AZLA 3RNOA 5CFNA 1LI4A 1ORDA 2HWWA 4MV4A 3VPGA 4BVLA 2CNNA 4HWTA 1FJ2A 1KI9A 1Y3BE 2VZ8A 3LC1O 1J8QA 3WRXA 2Z43A 3FMIA 4BCBA 1VMAA 3GUHA 1VFPA 5LYJA 2IHKA 5TQ2A 4N0EA 2BHNA 4TLDA 3QFFA 4L5YA 3ZWMA 4XE5A 5CCDA 4BFYA 5I9NA 1HG0A 1ZRMA 2FMXA 2PTHA 4IWXA 4QUIA 2X0NA 2VH1A 1K6IA 2I78A 3LPLA 3SD7A 4ZZIA 1ETUA 2Q8NA 3R6TA 5BWMA 1DKPA 1W8DA 3CZAA 4IDHA 2D2EA 2HSWA 2QI9F 1WA5A 3U40A 5I7VA 3TTYA 1Y6RA 4UU0A 2FJUA 1A1SA 1OFUA 1Q7RA 3LYAA 5JSYA 1MGOA 4DLBA 4J4BA 3EISA 1VLVA 3SYLA 5BORA 4UAJA 1XEXB 3NUGA 1SKQA 1U8ZA 1AURA 4UU8A 4BRWA 1HSOA 1HE4A 3U1TA 3VR1A 3PQCA 3V2GA 5J40A 4DA6A 5HZKA 3P97A 2PEYA 1CP3A 1FFAA 1FTGA 1NOJA 1KTVA 3TLJA 4HLNA 3CCCA 4A2PA 2IEIA 2QRZA 4CGYA 3QVJA 1VCNA 2HIHA 1EXNA 1U8FO 1DC7A 3G0HA 5KYXA 3BDVA 1O89A 3CF4A 1NFRA 1P7CA 3H04A 3IP9A 1BWQA 3K1AA 4MKFA 3G8AA 1U28C 1G8KA 2H0QA 1E79D 3VXKA 4MUNA 3U4AA 3KKOA 2VWGA 4R1NA 1B93A 2E6UX 2RK4A 3HPQA 4NEHB 4K2AA 1M7HA 4NZNA 3IYLW 4PC6A 3I3OA 4ZT7A 1VL1A 4K9LA 1K4KA 1QVZA 4HPWA 5BQ5A 1EUCA 1G1AA 2N46A 3O8QA 1UPBA 4REOA 1BRMA 5HCUA 4XFJA 3ZGYA 2N1BA 4PQEA 2A5YB 4Y6SA 3D2AA 5KTYA 4BNGA 4GM4A 4PLHA 1I3MA 3IR6A 1HG1A 5KDOA 2FFAA 3ZY3A 3OIUA 4E14A 1CZLA 3CLTC 3PKZA 3QVGB 3AR7A 5I9BA 3T35A