4RI1A

Crystal structure of helicobacter pylori pseudaminic acid biosynthesis n -acetyltransferase pseh complex with acetyl-coa
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
178
Chain Sequence
KKNYSYKNIQAIDFTNLNDGEKLLVLEFRNHPNTALWMYSTFISLKTHLQFIEDLKNSPNHRYFLFKEEGVYLGVGSITKINFFHKHGYLGIYKNPFLKNGGETILKALEFIAFEEFQLHSLHLEVMENNFKAIAFYEKNHYELEGRLKGFISKDKEFIDVLLYYKDKKGYNDQSLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyl
publication title Crystal Structure of Helicobacter pylori Pseudaminic Acid Biosynthesis N-Acetyltransferase PseH: Implications for Substrate Specificity and Catalysis.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 57
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature ec 2.3.1.202: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase.
pdb deposition date 2014-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ri1A00
4KVME 2FXFA 3FRMA 4HKFA 4HNWB 4PSXA 2P0WA 4B5PB 4MY3A 4QBJA 1P0HA 5F47A 3UY5A 3TCVA 4UWIA 2OZUA 2QMLA 5KTCA 4KLVA 3G3SA 4RS2A 2Q7BA 2JEVA 3DNSA 2G0BA 3PZJA 2OZGA 3DDDA 4FD4A 2VQYA 1Q2YA 3BJ8A 1YX0A 1YR0A 4QUSA 3K9UA 2VZZA 4UBRA 2Q0YA 3E0KA 3I9SA 4QVTA 4PV6A 1SQHA 3DR8A 4KZTA 2G3TA 2Q4YA 2R98A 5ISVA 1I21A 4CAWA 2PQ8A 4Y49B 3QAHA 5C82A 4XNHB 2REEA 4JWPA 2PR1A 3D2PA 4MI4A 2B5GA 4R3LA 4MY0A 2Z0ZA 4R57A 3R96A 4E0AA 1TIQA 2VI7A 2FSRA 2IL4A 2CY2A 2DXQA 5J8CA 1Y7RA 2BUEA 2Z11A 2ZXVA 1KUXA 3B8GA 4DNCA 3CXQA 1S7LA 3SXOA 2HQYA 2CNTA 4E2AA 4YGOA 4XNHC 4AB7A 4FD7A 3TE4A 3OWCA 3TO9A 4ORFA 4KOXA 1VHSA 4CAXA 2B3VA 2I00A 5EBVA 1Y9KA 4IF5A 3W91A 2Z10A 1S60A 2PRBA 3DSBA 2G3AA 1IIDA 4U9ZA 2ZW5A 4OLLA 5GCNA 3TTHA 1IYKA 3TO7A 1M4IA 4JD6A 4JLYA 1NMTA 1QSTA 2REFA 3TOAA 5JQ4A 4OADA 3IGRA 2WPXA 2J8RA 4XPDB 3CXSA 3T90A 4L8AA 2FCKA 3CXPA 4B5PA 2B4BA 2C27A 2HUZA 3S6HA 1IICA 3TT2A 2VZYA 4KLWA 4L89A 5KTDA 3JUWA 4XPDC 4U5YA 5F46A 1I12A 5H86A 4I49A 1S7NA 3SHPA 3FXTA 1XIXA 2FE7A 2OB0A 2QECA 3R9FA 1KZFA 1S7FA 2FS5A 4MBUA 1QSNA 1BO4A 1KUVA 3ZJ0A 4R87A 3H4QA 1V0CA 2K5TA 3FB3A 3GY9A 3D3SA 3C26A 5F48A 2BSWA 1UFHA 1QSOA 2EUIA 4FD5A 4M85A 1K4JA 2AE6A 3W6XA 4AG7A 4JXRA 1FY7A 1PU9A 4AG9A 5IV0A 1CM0A 2F5IA 2R7HA 3FIXA 2PDOA 3LODA 2A4NA 3TO6A 1S3ZA 2X7BA 3FNCA 2BEIA 1Z4EA 2JDDA 3TOBA 2P6GA 4H6ZA 4K30A 4JJXA 3N7ZA 3V8IA 4XPLA 5DWMA 4B5OA 4KUAA 3D8PA 2PR8A 2JDCA 2RC4A 4NEXA 4KVOE 3S6GA 1MJBA 3EO4A 1WK4A 4ONUA 3EXNA 4M3SA 2Q4VA 2PSWA 3FYNA 4AVAA 2CNMA 2CNSA 2R8VA 1YGHA 1M4DA 4KUBA 4KVXA 2OZHA 5CNPA 4YFJA 4QC6A 2I79A 4H89A 3ZZIA 4CRZB 2ARHA 3R95A 4FD6A 3SXNA 2D4PA 1RO5A 5JPHA 1J4JA 2ZW7A 1MJ9A 1PUAA 4H6UA 2GIVA 4GS4A 3BLNA 3F5BA 4YRHA 2VEZA 3VWDA 3TFYA 1S5KA 1NE9A 4KOTA 2EVNA 2OU2A 4PSWA 4PK2A 2ZW4A 3F8KA 4R9MA 3PGPA 3EY5A 1IB1E 3BJ7A 3GKRA 3EFAA 3R9EA 5C88A 1NSLA 1ON0A 1LRZA 1VKCA 2FIWA 2P6EA 1CJWA 3GYAA 2B4DB 3VWEA 2R1IA 1Y9WA 1M44A 2Q04A 1Z9UA 4CAVA 1BOBA 2Y0MA 5DWNA 5J8FA 4AVBA 3W6SA 2B3UA 2KCWA 2FIAA 4KOWA 4KOYA 3P2FA 2Q44A 4X5KA 2VBQA 2ATRA 1M4GA 4J3GA 4LUAA 2GE3A 4IUSA 4UA3A 4NF1A 1IYLA 2WPWA 5EC4A 5E96A 5I0CA 4F6AA 3S6FA 2O28A 3IWGA 2J8NA 2VXKA 3JVNA 2QIRA 1Q2CA 4KOVA 4HNYB 4KOSA 1M1DA 4LX9A 4KOUA 2ZW6A 5H84A 3T9YA 3KKWA 5HMNA 1GHEA 4PK3A 3FBUA 4EVYA 2NMTA 2GANA 1XMTA 3F0AA 4CS0B 3P2HA 1B87A 3WR7A 2D4OA 1KUYA 4RI1A 3DR6A 2P6FA 4F0YA 1XEBA 2B5GB 4Y49C 2PC1A 1YK3A 4JXQA 5FVJA 4BMHA 3EC4A 1MJAA 2FL4A 5IB0A 4MHDA 3I3GA 3LD2A 4NSQA 4XPKA 4NCZA 1QSRA 5HH1A 4E8OA 2FT0A 2J8MA 1Q2DA 3MGDA 1MK4A 1S7KA 2B58A 4U9YA 1L0CA 4ZBGA 1RXTA 1YLEA 4KORA 1P4NA 3R9GA 1Z4RA 3G8WA 4AVCA 5KTAA 1YVOA 1B6BA 2BL1A 1WWZA 4HNXB 4QB9A 1XF8A 1YREA 2B4DA 3RYOA 1I1DA 1R57A 1OZPA 3NE7A 4NXYA 1U6MA 4MJ8A 2JLMA 4CRYB 2ZPAA 1YVKA 3QB8A 2H5MA 5IX3A 3S6KA 1N71A 4II9A 3PP9A 3R1KA 5F49A 4UWJA 2OH1A 4OAEA 1QSMA 4R3KA 1XE4A 2HV2A 2AJ6A 3D2MA
chains in the Genus database with same CATH superfamily
1F57A 4KVME 5JGFA 2FXFA 3FRMA 4HKFA 4UEFA 3WT4A 4ZY2A 4HNWB 4PSXA 4A31A 4EWTA 2P0WA 4B5PB 4Q7AA 4MY3A 4R7MA 2C6PA 2JEWA 4QBJA 1P0HA 1VHEA 5F47A 3UY5A 3TCVA 4UWIA 2OZUA 4OC1A 5HVFA 1ZLHA 3FJUA 4CYPA 2QMLA 2F8HA 4KLVA 3NH8A 4UEZA 4OIWA 4ZYQA 5KTCA 3G3SA 4RS2A 2PVVA 3NE8A 2Q7BA 5BWAB 5AGEA 2JEVA 2IQ6A 1VHOA 3DNSA 2QJ8A 4P4DA 2G0BA 5THWA 1PCAA 2PIZA 4MFQA 3PZJA 2OZGA 3DDDA 3MN8A 4CGOA 2RB7A 4FD4A 2VQYA 3LWUA 1Q2YA 1XBUA 4GXHA 3BJ8A 4JZ0A 3GIUA 4X3RA 1YX0A 1YR0A 1Z8TA 4QUSA 3B3CA 4R8FA 3K9UA 4F9VA 4B6ZA 5JPHA 4C2ZA 2EO8A 1YW4A 2VZZA 4JYWA 4UBRA 2Q0YA 2GU2A 3H8GA 3E0KA 3I9SA 4QVTA 4PV6A 1SQHA 1YQEA 1XRYA 3DR8A 2J9AA 3FF3A 4KZTA 4MFZA 2G3TA 2Z3PA 2Q4YA 1Y0RA 4FUUA 4BBHA 2R98A 5ISVA 1I21A 2CXAA 2PQ8A 4CAWA 2Q7SA 4Y49B 3QAHA 2XEGA 4XNHB 2REEA 2WYRA 4JWPA 5C82A 2PR1A 3D2PA 5AG6A 4MI4A 5K8NA 1BPMA 1YSJA 4OC2A 2B5GA 4R3LA 4MY0A 2Z0ZA 4R57A 3R96A 3RAMA 1UWYA 3IWWA 4FBEA 1TKHA 2V8GA 3VH9A 1ELMP 4E0AA 4PQAA 1TIQA 2VI7A 2FSRA 1VIXA 2IL4A 2ZEEA 2ZEGA 2CY2A 4LQGA 2DXQA 5J8CA 1Y7RA 2YGWA 2BUEA 2Z11A 3IU2A 4ONWA 2ZXVA 4P6YA 3NH5A 4A32A 1KUXA 1PYTB 3B8GA 4C7IA 4DNCA 3CXQA 5ELYA 1S7LA 3FECA 3SXOA 4KSIA 2HQYA 2GREA 2CNTA 4E2AA 4MCRA 1XJOA 1ZG8A 2NYQA 4YGOA 1DE4C 4XNHC 5G22A 4FD7A 4AB7A 3TE4A 2V8HA 3OWCA 3TO9A 4ORFA 4FAIA 4KOXA 4DUKA 2ZELA 2F7VA 3H8FA 3KR4A 3RZAA 1VHSA 4CAXA 3NH4A 2AFMA 4A2ZA 2B3VA 2I00A 5EBVA 5JM6A 1Y9KA 4IF5A 4MHYA 2Z3MA 3W91A 3S9LA 2QVPA 1GYTA 1Z8XA 2Z10A 1M4LA 1S60A 1XOVA 2PRBA 1TF8A 2IJZA 3RNZA 2DPSA 2XEJA 3DSBA 4P4FA 2G3AA 1IIDA 1EE3P 4P4EA 2PJ1A 4U9ZA 2PJBA 2ZW5A 4OLLA 5GCNA 3TTHA 5K8OA 1IYKA 4P10A 4Z65A 3TO7A 1F2OA 3BI0A 3PFEA 2BO9A 1M4IA 4MRIA 2OR4A 4JD6A 3SJGA 4JLYA 1NMTA 1QSTA 4C7HA 2REFA 4NGNA 3TOAA 5JQ4A 3FEEA 4OADA 3IGRA 2WPXA 4NGRA 3PB4X 2J8RA 1TKJA 4OIDA 4XPDB 3B35A 3CXSA 3QNVA 3T90A 4L8AA 2AFWA 3PBBA 4P4BA 3FH4A 4CGNA 3KHXA 1TXRA 4M6IA 4A94A 4R76A 2WZNA 1ZG9A 2FCKA 3L2NA 3CXPA 3WABA 3IWEA 4B5PA 3RO0A 1HEEA 1IU8A 2B4BA 2C27A 2HUZA 3S6HA 2AFZA 1IICA 3TT2A 2VZYA 4KLWA 4L89A 5KTDA 1CX8A 4MHNA 1CP7A 4PXBA 5CPAA 3JUWA 3CDXA 4G1PA 1H8LA 1AYEA 4UCPA 4MHZA 2ANPA 5LRKA 3KGQA 4XPDC 4UFWA 4P45A 3KZWA 3GLJA 3SJXA 4U5YA 4UFXA 5F46A 1I12A 5H86A 3PB9X 4I49A 1S7NA 3S9NA 4TNUA 3SHPA 2GLFA 4MCQA 5K8MA 2AFOA 3FXTA 1XIXA 2C6CA 2YNEA 2FE7A 2Z3NA 3KASA 3I1UA 2OB0A 1JWQA 2QECA 3R9FA 3PB7X 2Q51A 4DJLA 1KZFA 1VGYA 1XFOA 4C2YA 2ZEFA 1S7FA 2FS5A 4MBUA 1QSNA 2ZENA 1BO4A 1KUVA 3DLJA 4M6HA 3ZJ0A 5D8NA 4RN7A 4MFJA 4R87A 1V0CA 3B3SA 3H4QA 2K5TA 3CPAA 3FB3A 3GY9A 5DS0A 1Z2LA 3D3SA 2PRQA 3C26A 2BSWA 5EMIA 5F48A 3TX8A 8CPAA 1UFHA 1QSOA 2EUIA 4FD5A 4M85A 3IJ3A 4MXUA 2DEAA 3PB8X 1K4JA 3B7IA 3V38A 2AE6A 1CPSA 1R3NA 2PJ5A 2V8DA 3T8WA 3W6XA 4AG7A 4JXRA 4C68A 3H8EA 2PJ4A 1FY7A 3KQZA 4P4JA 3WC7A 1PU9A 7CPAA 4OKOA 4AG9A 4M6GA 4Q38A 3HUVA 2V77A 1X10A 3PFOA 1FT7A 3BXMA 5IV0A 3WC6A 1CM0A 2F5IA 2EBJA 2PVWA 2WUUA 2R7HA 3FIXA 4NGQA 5HVGA 3PRTA 4OP4A 4UIBA 4UF4A 3SJEA 4X2TA 4R6TA 2PDOA 3LODA 5AG5A 2A4NA 2PIYA 5G20A 3TO6A 1S3ZA 2POKA 2QYVA 3BI1A 2EK9A 2BCOA 2IMOA 2X7BA 3FNCA 4FWUA 4CGMA 4CAFA 2BEIA 5F09A 1Z4EA 2JDDA 4CGPA 4OC4A 4KS9A 3SJFA 3TOBA 2P6GA 4H6ZA 2ZEMA 4K30A 4CYQA 4JJXA 3N7ZA 3V8IA 3D7FA 4XPLA 6CPAA 5DWMA 4BD9A 4B5OA 3FVLA 4ZGYB 4KUAA 2PJAA 3D8PA 2PR8A 5LRJA 2JDCA 2PJ8A 1ELLP 3IU1A 4YU9A 2RC4A 4NEXA 4KVOE 3S6GA 1MJBA 2ZOGA 2JBKA 3EO4A 1QMUA 1WK4A 4ONUA 3EXNA 4M3SA 2PJ9A 2Q4VA 3B3TA 1CP6A 1CPXA 1LFWA 1IGBA 2PSWA 2CTCA 2Z3KA 3FYNA 4AVAA 3QAYA 5HVHA 2WSAA 2CNMA 2CNSA 2Q43A 2R8VA 1YGHA 1M4DA 4WJBA 5AG4A 2EWBA 4KUBA 3CPXA 3KI9A 4KVXA 4NJQA 4ZX9A 2O53A 3SI2A 4B12A 2OZHA 5CNPA 1Z8WA 4YFJA 1HDQA 4QC6A 2YNCC 5LYLA 2I79A 4P44A 4H89A 3D7HA 3ZZIA 4C2XA 1TF9A 4CRZB 2ARHA 3R95A 2ZEPA 4FD6A 3SXNA 2D4PA 2ABZA 4B10A 3FMCA 1A2ZA 5G21A 4F8ZA 5K8PA 1RO5A 4NGTA 1J4JA 1Y7EA 1MJ9A 2ZW7A 5A27A 1PUAA 3TC8A 4H6UA 2GIVA 2CF4A 1Z8LA 3BLNA 3F5BA 4GS4A 4YRHA 4W9YA 5G1ZA 2VL1A 2VEZA 3VWDA 3ISXA 3TFYA 3NFZA 1S5KA 1NE9A 5CBMA 4KOTA 2EVNA 2OU2A 4UFVA 4PSWA 4PK2A 2ZW4A 2PE3A 1BPNA 3F8KA 4OC0A 2V8VA 4R9MA 5A28A 2CTBA 3PGPA 1ZG7A 4OC5A 3EY5A 2GFQA 4UEEA 1DTDA 4A38A 4A39A 1OBRA 1IB1E 3PEIA 4ZI6A 2CIJA 2DF5A 3BJ7A 1X12A 3GKRA 3EFAA 4TWEA 3R9EA 5C88A 2I3CA 1IOFA 3IC1A 1NSLA 2AFSA 1ON0A 1LRZA 3BHXA 3V7ZA 1VKCA 4BINA 1Q7LA 5LRGA 4MCPA 1LANA 1Z5RA 2FIWA 2P6EA 3KL9A 3PB6X 4MFKA 4IK2A 2DPTA 1CJWA 3GYAA 2B4DB 3IEHA 4B14A 4PXEA 2FVGA 3VWEA 2R1IA 1Y9WA 1M44A 2Q04A 4EFDA 1Z9UA 1F2PA 2HC9A 3D66A 4CAVA 4LQ6A 4MFPA 1BOBA 4F9UA 2XEIA 4K3NA 2Y0MA 5DWNA 4A30A 3PBEA 5J8FA 4NGPA 1YMEA 1ZO0A 4RUHA 4NFRA 3KQXA 3IIBA 4AVBA 3W6SA 2B3UA 2KCWA 2FIAA 3JRUA 4KOWA 4ZX8A 4IAVA 1BLLE 2ZOFA 4KOYA 3P2FA 3B3WA 1YW6A 2Q44A 2ZEHA 4X5KA 5JH9A 3WC5A 2VBQA 1ARMA 4X8IA 1KWMA 2ATRA 2NSMA 1M4GA 1YLOA 4H2KA 4J3GA 4LUAA 2GE3A 4IUSA 4KSFA 4UA3A 4NF1A 1IYLA 2WPWA 3FX6A 2PJCA 1FNOA 5EC4A 2YNCA 5E96A 5IB9A 3VARA 4F6AA 5I0CA 3S6FA 3CT9A 2O28A 3NA6A 3IWGA 1NSAA 2JBJA 3K9TA 2J8NA 4B11A 3CZXA 5D29A 3D68A 2VXKA 3VATA 3JVNA 3ISZA 4DYOA 5I4MA 4UIAA 2QIRA 2Q4ZA 1Q2CA 4CPAA 2O4HA 2C1CA 3N5FA 1QQ9A 4KOVA 4HNYB 5LYDA 4KOSA 1M1DA 1AMPA 4LX9A 4OC3A 1LOKA 3B2YA 4KOUA 2ZW6A 5H84A 3T9YA 3KKWA 5HMNA 4P4IA 1GHEA 3KHZA 4KSAA 4PK3A 3LACA 3FBUA 4EVYA 2OOTA 4ZY0A 1XMBA 2NMTA 2GANA 1XMTA 3F0AA 3IO1A 4CS0B 3P2HA 1B87A 3LMSA 3WR7A 2D4OA 1ARLA 1KUYA 2AFXA 1JQGA 5J1QA 2PJ2A 4NJRA 4RI1A 3DR6A 2P6FA 4F0YA 2C6GA 1XEBA 1Y0YA 4O23A 2PJ6A 2B5GB 2HB6A 1R43A 4Y49C 2PC1A 2ODFA 4F0XA 1YK3A 4JXQA 5FVJA 3D67A 4BMHA 3EC4A 4ZY1A 4MHPA 1MJAA 2FL4A 2AFUA 4MFLA 5IB0A 1LCPA 4MHDA 2PJ3A 1LAMA 3I3GA 3LD2A 4NSQA 4XPKA 4NCZA 3D7GA 4YWYA 1QSRA 4GM5A 2RFHA 3HLPA 5HH1A 2PCUA 2FT0A 2J8MA 5LYIA 4A95A 4B13A 4E8OA 1Q2DA 4MMOA 3MGDA 3GB0A 3JTKA 1MK4A 1S7KA 2B58A 4U9YA 1L0CA 1HDUA 1ZLIA 4ZBGA 3IFEA 1RXTA 1YLEA 2PJ7A 4KORA 1P4NA 3H5ZA 1LAPA 4PPZA 3K2KA 3R9GA 1Z4RA 3D7DA 3G8WA 3SI0A 4OMEA 4AVCA 4A37A 3FEDA 2XEFA 5KTAA 2PJ0A 1YVOA 4CYNA 2ZEDA 3D4UA 1B6BA 2BL1A 4PXDA 3DGVA 1WWZA 4HNXB 4QB9A 1XF8A 1YREA 2B4DA 3RYOA 4HPSA 1I1DA 1R57A 2YNDA 1CBXA 1OZPA 3NE7A 4WWVA 4NXYA 1U6MA 1IY7A 4MJ8A 3SI1A 5HXDA 3S9MA 3B3VA 3KR5A 4UCNA 5AG7A 2BOAA 3GUXA 2JLMA 4CRYB 4CYOA 4MCSA 2ZPAA 1YVKA 3QB8A 1AUGA 2H5MA 5IX3A 3S6KA 1N71A 4II9A 4PXCA 3MRUA 3PP9A 1TKFA 1RTQA 2Z3OA 4Q36A 4EMEA 2EK8A 3R1KA 4UCMA 5F49A 4UWJA 2OH1A 4NGSA 4CAEA 4AXVA 4OAEA 1QSMA 3A9LA 4A33A 3RBUA 2Z3LA 1CG2A 4R3KA 1XE4A 4IHMA 4NGMA 1BAVA 2ZEOA 2HV2A 5LYFA 2GLJA 4CGLA 2G9DA 2AJ6A 3D2MA 1IOIA
chains in the Genus database with same CATH topology
4KVME 2FXFA 3FRMA 4HKFA 4HNWB 4PSXA 4A31A 2P0WA 4B5PB 4MY3A 4QBJA 1P0HA 5F47A 3UY5A 3TCVA 4UWIA 2OZUA 4CYPA 2QMLA 5KTCA 4KLVA 3G3SA 4RS2A 2Q7BA 5BWAB 5AGEA 2JEVA 3DNSA 2G0BA 4MFQA 3PZJA 2OZGA 3DDDA 4CGOA 4FD4A 2VQYA 1Q2YA 3BJ8A 1YX0A 1YR0A 4QUSA 3K9UA 4C2ZA 2VZZA 4UBRA 2Q0YA 3E0KA 3I9SA 4QVTA 4PV6A 1SQHA 3DR8A 4KZTA 4MFZA 2G3TA 2Z3PA 2Q4YA 4BBHA 2R98A 5ISVA 1I21A 2CXAA 2PQ8A 4CAWA 4Y49B 3QAHA 5C82A 4XNHB 2REEA 4JWPA 2PR1A 3D2PA 5AG6A 4MI4A 2B5GA 4R3LA 4MY0A 2Z0ZA 4R57A 3R96A 4E0AA 1TIQA 2VI7A 2FSRA 2IL4A 2CY2A 2DXQA 5J8CA 1Y7RA 2YGWA 2BUEA 2Z11A 3IU2A 2ZXVA 4A32A 1KUXA 3B8GA 4C7IA 4DNCA 3CXQA 1S7LA 3SXOA 2HQYA 2CNTA 4E2AA 4YGOA 4XNHC 5G22A 4AB7A 4FD7A 3TE4A 3OWCA 3TO9A 4ORFA 4KOXA 1VHSA 4CAXA 4A2ZA 2B3VA 2I00A 5EBVA 1Y9KA 4IF5A 3W91A 2Z3MA 2Z10A 1S60A 2PRBA 2DPSA 3DSBA 2G3AA 1IIDA 4U9ZA 2ZW5A 4OLLA 5GCNA 3TTHA 1IYKA 3TO7A 1M4IA 4JD6A 4JLYA 1NMTA 1QSTA 4C7HA 2REFA 3TOAA 5JQ4A 4OADA 3IGRA 2WPXA 2J8RA 4XPDB 3CXSA 3T90A 4L8AA 4CGNA 2FCKA 3CXPA 3IWEA 4B5PA 2B4BA 2C27A 2HUZA 3S6HA 1IICA 3TT2A 2VZYA 4KLWA 4L89A 5KTDA 3JUWA 4UCPA 4XPDC 4UFWA 4U5YA 4UFXA 5F46A 1I12A 5H86A 4I49A 1S7NA 3SHPA 3FXTA 1XIXA 2YNEA 2FE7A 2Z3NA 2OB0A 2QECA 3R9FA 1KZFA 4C2YA 1S7FA 2FS5A 4MBUA 1QSNA 1BO4A 1KUVA 3ZJ0A 4MFJA 4R87A 3H4QA 1V0CA 2K5TA 3FB3A 3GY9A 3D3SA 3C26A 5F48A 2BSWA 1UFHA 1QSOA 2EUIA 4FD5A 4M85A 1K4JA 2AE6A 3W6XA 4AG7A 4JXRA 4C68A 1FY7A 1PU9A 4AG9A 4Q38A 5IV0A 1CM0A 2F5IA 2WUUA 2R7HA 3FIXA 2PDOA 3LODA 5AG5A 2A4NA 3TO6A 5G20A 1S3ZA 4F0XA 2X7BA 3FNCA 4CGMA 4CAFA 2BEIA 1Z4EA 2JDDA 4CGPA 4KS9A 3TOBA 2P6GA 4H6ZA 4CYQA 4K30A 4JJXA 3N7ZA 3V8IA 4XPLA 5DWMA 4B5OA 4ZGYB 4KUAA 3D8PA 2PR8A 2JDCA 3IU1A 2RC4A 4NEXA 4KVOE 3S6GA 1MJBA 3EO4A 1WK4A 4ONUA 3EXNA 4M3SA 2Q4VA 2PSWA 2Z3KA 3FYNA 4AVAA 2WSAA 2CNMA 2CNSA 2R8VA 1YGHA 1M4DA 5AG4A 4KUBA 4KVXA 4B12A 2OZHA 5CNPA 4YFJA 4QC6A 2YNCC 2I79A 4H89A 3ZZIA 4C2XA 4CRZB 2ARHA 3R95A 4FD6A 3SXNA 2D4PA 4B10A 5G21A 1RO5A 5JPHA 1J4JA 2ZW7A 1MJ9A 5A27A 1PUAA 4H6UA 2GIVA 4GS4A 3BLNA 3F5BA 4YRHA 5G1ZA 2VEZA 3VWDA 3TFYA 1S5KA 1NE9A 4KOTA 2EVNA 2OU2A 4UFVA 4PSWA 4PK2A 2ZW4A 3F8KA 4R9MA 5A28A 3PGPA 3EY5A 1IB1E 3BJ7A 3GKRA 3EFAA 3R9EA 5C88A 1NSLA 1ON0A 1LRZA 1VKCA 2FIWA 2P6EA 4MFKA 2DPTA 1CJWA 3GYAA 2B4DB 4B14A 3VWEA 2R1IA 1Y9WA 1M44A 2Q04A 1Z9UA 4CAVA 4MFPA 1BOBA 2Y0MA 5DWNA 4A30A 5J8FA 1ZO0A 4AVBA 3W6SA 2B3UA 2KCWA 2FIAA 4KOWA 4KOYA 3P2FA 2Q44A 4X5KA 2VBQA 2ATRA 1M4GA 4J3GA 4LUAA 2GE3A 4IUSA 4KSFA 4UA3A 4NF1A 1IYLA 2WPWA 5EC4A 2YNCA 5E96A 5I0CA 4F6AA 3S6FA 2O28A 3IWGA 2J8NA 4B11A 2VXKA 3JVNA 2QIRA 1Q2CA 4KOVA 4HNYB 4KOSA 1M1DA 4LX9A 4KOUA 2ZW6A 5H84A 3T9YA 3KKWA 5HMNA 1GHEA 4KSAA 4PK3A 3FBUA 4EVYA 2NMTA 2GANA 1XMTA 3F0AA 4CS0B 3P2HA 1B87A 3WR7A 2D4OA 1KUYA 4RI1A 3DR6A 2P6FA 4F0YA 1XEBA 2B5GB 4Y49C 2PC1A 1YK3A 4JXQA 5FVJA 4BMHA 3EC4A 1MJAA 2FL4A 4MFLA 5IB0A 4MHDA 3I3GA 3LD2A 4NSQA 4XPKA 4NCZA 1QSRA 5HH1A 4E8OA 2FT0A 2J8MA 4A95A 4B13A 1Q2DA 3MGDA 3JTKA 1MK4A 1S7KA 2B58A 4U9YA 1L0CA 4ZBGA 1RXTA 1YLEA 4KORA 1P4NA 3H5ZA 3R9GA 1Z4RA 3G8WA 4AVCA 5KTAA 1YVOA 4CYNA 1B6BA 2BL1A 1WWZA 4HNXB 4QB9A 1XF8A 1YREA 2B4DA 3RYOA 1I1DA 1R57A 2YNDA 1OZPA 3NE7A 4NXYA 1U6MA 4MJ8A 4UCNA 5AG7A 2JLMA 4CRYB 4CYOA 2ZPAA 1YVKA 3QB8A 2H5MA 5IX3A 3S6KA 1N71A 4II9A 3PP9A 2Z3OA 4Q36A 3R1KA 4UCMA 5F49A 4UWJA 2OH1A 4CAEA 4OAEA 1QSMA 3A9LA 4A33A 2Z3LA 4R3KA 1XE4A 2HV2A 4CGLA 2AJ6A 3D2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVM E;  2FXF A;  3FRM A;  4HKF A;  4HNW B;  4PSX A;  2P0W A;  4B5P B;  4MY3 A;  4QBJ A;  1P0H A;  5F47 A;  3UY5 A;  3TCV A;  4UWI A;  2OZU A;  2QML A;  5KTC A;  4KLV A;  3G3S A;  4RS2 A;  2Q7B A;  2JEV A;  3DNS A;  2G0B A;  3PZJ A;  2OZG A;  3DDD A;  4FD4 A;  2VQY A;  1Q2Y A;  3BJ8 A;  1YX0 A;  1YR0 A;  4QUS A;  3K9U A;  2VZZ A;  4UBR A;  2Q0Y A;  3E0K A;  3I9S A;  4QVT A;  4PV6 A;  1SQH A;  3DR8 A;  4KZT A;  2G3T A;  2Q4Y A;  2R98 A;  5ISV A;  1I21 A;  4CAW A;  2PQ8 A;  4Y49 B;  3QAH A;  5C82 A;  4XNH B;  2REE A;  4JWP A;  2PR1 A;  3D2P A;  4MI4 A;  2B5G A;  4R3L A;  4MY0 A;  2Z0Z A;  4R57 A;  3R96 A;  4E0A A;  1TIQ A;  2VI7 A;  2FSR A;  2IL4 A;  2CY2 A;  2DXQ A;  5J8C A;  1Y7R A;  2BUE A;  2Z11 A;  2ZXV A;  1KUX A;  3B8G A;  4DNC A;  3CXQ A;  1S7L A;  3SXO A;  2HQY A;  2CNT A;  4E2A A;  4YGO A;  4XNH C;  4AB7 A;  4FD7 A;  3TE4 A;  3OWC A;  3TO9 A;  4ORF A;  4KOX A;  1VHS A;  4CAX A;  2B3V A;  2I00 A;  5EBV A;  1Y9K A;  4IF5 A;  3W91 A;  2Z10 A;  1S60 A;  2PRB A;  3DSB A;  2G3A A;  1IID A;  4U9Z A;  2ZW5 A;  4OLL A;  5GCN A;  3TTH A;  1IYK A;  3TO7 A;  1M4I A;  4JD6 A;  4JLY A;  1NMT A;  1QST A;  2REF A;  3TOA A;  5JQ4 A;  4OAD A;  3IGR A;  2WPX A;  2J8R A;  4XPD B;  3CXS A;  3T90 A;  4L8A A;  2FCK A;  3CXP A;  4B5P A;  2B4B A;  2C27 A;  2HUZ A;  3S6H A;  1IIC A;  3TT2 A;  2VZY A;  4KLW A;  4L89 A;  5KTD A;  3JUW A;  4XPD C;  4U5Y A;  5F46 A;  1I12 A;  5H86 A;  4I49 A;  1S7N A;  3SHP A;  3FXT A;  1XIX A;  2FE7 A;  2OB0 A;  2QEC A;  3R9F A;  1KZF A;  1S7F A;  2FS5 A;  4MBU A;  1QSN A;  1BO4 A;  1KUV A;  3ZJ0 A;  4R87 A;  3H4Q A;  1V0C A;  2K5T A;  3FB3 A;  3GY9 A;  3D3S A;  3C26 A;  5F48 A;  2BSW A;  1UFH A;  1QSO A;  2EUI A;  4FD5 A;  4M85 A;  1K4J A;  2AE6 A;  3W6X A;  4AG7 A;  4JXR A;  1FY7 A;  1PU9 A;  4AG9 A;  5IV0 A;  1CM0 A;  2F5I A;  2R7H A;  3FIX A;  2PDO A;  3LOD A;  2A4N A;  3TO6 A;  1S3Z A;  2X7B A;  3FNC A;  2BEI A;  1Z4E A;  2JDD A;  3TOB A;  2P6G A;  4H6Z A;  4K30 A;  4JJX A;  3N7Z A;  3V8I A;  4XPL A;  5DWM A;  4B5O A;  4KUA A;  3D8P A;  2PR8 A;  2JDC A;  2RC4 A;  4NEX A;  4KVO E;  3S6G A;  1MJB A;  3EO4 A;  1WK4 A;  4ONU A;  3EXN A;  4M3S A;  2Q4V A;  2PSW A;  3FYN A;  4AVA A;  2CNM A;  2CNS A;  2R8V A;  1YGH A;  1M4D A;  4KUB A;  4KVX A;  2OZH A;  5CNP A;  4YFJ A;  4QC6 A;  2I79 A;  4H89 A;  3ZZI A;  4CRZ B;  2ARH A;  3R95 A;  4FD6 A;  3SXN A;  2D4P A;  1RO5 A;  5JPH A;  1J4J A;  2ZW7 A;  1MJ9 A;  1PUA A;  4H6U A;  2GIV A;  4GS4 A;  3BLN A;  3F5B A;  4YRH A;  2VEZ A;  3VWD A;  3TFY A;  1S5K A;  1NE9 A;  4KOT A;  2EVN A;  2OU2 A;  4PSW A;  4PK2 A;  2ZW4 A;  3F8K A;  4R9M A;  3PGP A;  3EY5 A;  1IB1 E;  3BJ7 A;  3GKR A;  3EFA A;  3R9E A;  5C88 A;  1NSL A;  1ON0 A;  1LRZ A;  1VKC A;  2FIW A;  2P6E A;  1CJW A;  3GYA A;  2B4D B;  3VWE A;  2R1I A;  1Y9W A;  1M44 A;  2Q04 A;  1Z9U A;  4CAV A;  1BOB A;  2Y0M A;  5DWN A;  5J8F A;  4AVB A;  3W6S A;  2B3U A;  2KCW A;  2FIA A;  4KOW A;  4KOY A;  3P2F A;  2Q44 A;  4X5K A;  2VBQ A;  2ATR A;  1M4G A;  4J3G A;  4LUA A;  2GE3 A;  4IUS A;  4UA3 A;  4NF1 A;  1IYL A;  2WPW A;  5EC4 A;  5E96 A;  5I0C A;  4F6A A;  3S6F A;  2O28 A;  3IWG A;  2J8N A;  2VXK A;  3JVN A;  2QIR A;  1Q2C A;  4KOV A;  4HNY B;  4KOS A;  1M1D A;  4LX9 A;  4KOU A;  2ZW6 A;  5H84 A;  3T9Y A;  3KKW A;  5HMN A;  1GHE A;  4PK3 A;  3FBU A;  4EVY A;  2NMT A;  2GAN A;  1XMT A;  3F0A A;  4CS0 B;  3P2H A;  1B87 A;  3WR7 A;  2D4O A;  1KUY A;  4RI1 A;  3DR6 A;  2P6F A;  4F0Y A;  1XEB A;  2B5G B;  4Y49 C;  2PC1 A;  1YK3 A;  4JXQ A;  5FVJ A;  4BMH A;  3EC4 A;  1MJA A;  2FL4 A;  5IB0 A;  4MHD A;  3I3G A;  3LD2 A;  4NSQ A;  4XPK A;  4NCZ A;  1QSR A;  5HH1 A;  4E8O A;  2FT0 A;  2J8M A;  1Q2D A;  3MGD A;  1MK4 A;  1S7K A;  2B58 A;  4U9Y A;  1L0C A;  4ZBG A;  1RXT A;  1YLE A;  4KOR A;  1P4N A;  3R9G A;  1Z4R A;  3G8W A;  4AVC A;  5KTA A;  1YVO A;  1B6B A;  2BL1 A;  1WWZ A;  4HNX B;  4QB9 A;  1XF8 A;  1YRE A;  2B4D A;  3RYO A;  1I1D A;  1R57 A;  1OZP A;  3NE7 A;  4NXY A;  1U6M A;  4MJ8 A;  2JLM A;  4CRY B;  2ZPA A;  1YVK A;  3QB8 A;  2H5M A;  5IX3 A;  3S6K A;  1N71 A;  4II9 A;  3PP9 A;  3R1K A;  5F49 A;  4UWJ A;  2OH1 A;  4OAE A;  1QSM A;  4R3K A;  1XE4 A;  2HV2 A;  2AJ6 A;  3D2M A; 
#chains in the Genus database with same CATH topology
 1F57 A;  4KVM E;  5JGF A;  2FXF A;  3FRM A;  4HKF A;  4UEF A;  3WT4 A;  4ZY2 A;  4HNW B;  4PSX A;  4A31 A;  4EWT A;  2P0W A;  4B5P B;  4Q7A A;  4MY3 A;  4R7M A;  2C6P A;  2JEW A;  4QBJ A;  1P0H A;  1VHE A;  5F47 A;  3UY5 A;  3TCV A;  4UWI A;  2OZU A;  4OC1 A;  5HVF A;  1ZLH A;  3FJU A;  4CYP A;  2QML A;  2F8H A;  4KLV A;  3NH8 A;  4UEZ A;  4OIW A;  4ZYQ A;  5KTC A;  3G3S A;  4RS2 A;  2PVV A;  3NE8 A;  2Q7B A;  5BWA B;  5AGE A;  2JEV A;  2IQ6 A;  1VHO A;  3DNS A;  2QJ8 A;  4P4D A;  2G0B A;  5THW A;  1PCA A;  2PIZ A;  4MFQ A;  3PZJ A;  2OZG A;  3DDD A;  3MN8 A;  4CGO A;  2RB7 A;  4FD4 A;  2VQY A;  3LWU A;  1Q2Y A;  1XBU A;  4GXH A;  3BJ8 A;  4JZ0 A;  3GIU A;  4X3R A;  1YX0 A;  1YR0 A;  1Z8T A;  4QUS A;  3B3C A;  4R8F A;  3K9U A;  4F9V A;  4B6Z A;  5JPH A;  4C2Z A;  2EO8 A;  1YW4 A;  2VZZ A;  4JYW A;  4UBR A;  2Q0Y A;  2GU2 A;  3H8G A;  3E0K A;  3I9S A;  4QVT A;  4PV6 A;  1SQH A;  1YQE A;  1XRY A;  3DR8 A;  2J9A A;  3FF3 A;  4KZT A;  4MFZ A;  2G3T A;  2Z3P A;  2Q4Y A;  1Y0R A;  4FUU A;  4BBH A;  2R98 A;  5ISV A;  1I21 A;  2CXA A;  2PQ8 A;  4CAW A;  2Q7S A;  4Y49 B;  3QAH A;  2XEG A;  4XNH B;  2REE A;  2WYR A;  4JWP A;  5C82 A;  2PR1 A;  3D2P A;  5AG6 A;  4MI4 A;  5K8N A;  1BPM A;  1YSJ A;  4OC2 A;  2B5G A;  4R3L A;  4MY0 A;  2Z0Z A;  4R57 A;  3R96 A;  3RAM A;  1UWY A;  3IWW A;  4FBE A;  1TKH A;  2V8G A;  3VH9 A;  1ELM P;  4E0A A;  4PQA A;  1TIQ A;  2VI7 A;  2FSR A;  1VIX A;  2IL4 A;  2ZEE A;  2ZEG A;  2CY2 A;  4LQG A;  2DXQ A;  5J8C A;  1Y7R A;  2YGW A;  2BUE A;  2Z11 A;  3IU2 A;  4ONW A;  2ZXV A;  4P6Y A;  3NH5 A;  4A32 A;  1KUX A;  1PYT B;  3B8G A;  4C7I A;  4DNC A;  3CXQ A;  5ELY A;  1S7L A;  3FEC A;  3SXO A;  4KSI A;  2HQY A;  2GRE A;  2CNT A;  4E2A A;  4MCR A;  1XJO A;  1ZG8 A;  2NYQ A;  4YGO A;  1DE4 C;  4XNH C;  5G22 A;  4FD7 A;  4AB7 A;  3TE4 A;  2V8H A;  3OWC A;  3TO9 A;  4ORF A;  4FAI A;  4KOX A;  4DUK A;  2ZEL A;  2F7V A;  3H8F A;  3KR4 A;  3RZA A;  1VHS A;  4CAX A;  3NH4 A;  2AFM A;  4A2Z A;  2B3V A;  2I00 A;  5EBV A;  5JM6 A;  1Y9K A;  4IF5 A;  4MHY A;  2Z3M A;  3W91 A;  3S9L A;  2QVP A;  1GYT A;  1Z8X A;  2Z10 A;  1M4L A;  1S60 A;  1XOV A;  2PRB A;  1TF8 A;  2IJZ A;  3RNZ A;  2DPS A;  2XEJ A;  3DSB A;  4P4F A;  2G3A A;  1IID A;  1EE3 P;  4P4E A;  2PJ1 A;  4U9Z A;  2PJB A;  2ZW5 A;  4OLL A;  5GCN A;  3TTH A;  5K8O A;  1IYK A;  4P10 A;  4Z65 A;  3TO7 A;  1F2O A;  3BI0 A;  3PFE A;  2BO9 A;  1M4I A;  4MRI A;  2OR4 A;  4JD6 A;  3SJG A;  4JLY A;  1NMT A;  1QST A;  4C7H A;  2REF A;  4NGN A;  3TOA A;  5JQ4 A;  3FEE A;  4OAD A;  3IGR A;  2WPX A;  4NGR A;  3PB4 X;  2J8R A;  1TKJ A;  4OID A;  4XPD B;  3B35 A;  3CXS A;  3QNV A;  3T90 A;  4L8A A;  2AFW A;  3PBB A;  4P4B A;  3FH4 A;  4CGN A;  3KHX A;  1TXR A;  4M6I A;  4A94 A;  4R76 A;  2WZN A;  1ZG9 A;  2FCK A;  3L2N A;  3CXP A;  3WAB A;  3IWE A;  4B5P A;  3RO0 A;  1HEE A;  1IU8 A;  2B4B A;  2C27 A;  2HUZ A;  3S6H A;  2AFZ A;  1IIC A;  3TT2 A;  2VZY A;  4KLW A;  4L89 A;  5KTD A;  1CX8 A;  4MHN A;  1CP7 A;  4PXB A;  5CPA A;  3JUW A;  3CDX A;  4G1P A;  1H8L A;  1AYE A;  4UCP A;  4MHZ A;  2ANP A;  5LRK A;  3KGQ A;  4XPD C;  4UFW A;  4P45 A;  3KZW A;  3GLJ A;  3SJX A;  4U5Y A;  4UFX A;  5F46 A;  1I12 A;  5H86 A;  3PB9 X;  4I49 A;  1S7N A;  3S9N A;  4TNU A;  3SHP A;  2GLF A;  4MCQ A;  5K8M A;  2AFO A;  3FXT A;  1XIX A;  2C6C A;  2YNE A;  2FE7 A;  2Z3N A;  3KAS A;  3I1U A;  2OB0 A;  1JWQ A;  2QEC A;  3R9F A;  3PB7 X;  2Q51 A;  4DJL A;  1KZF A;  1VGY A;  1XFO A;  4C2Y A;  2ZEF A;  1S7F A;  2FS5 A;  4MBU A;  1QSN A;  2ZEN A;  1BO4 A;  1KUV A;  3DLJ A;  4M6H A;  3ZJ0 A;  5D8N A;  4RN7 A;  4MFJ A;  4R87 A;  1V0C A;  3B3S A;  3H4Q A;  2K5T A;  3CPA A;  3FB3 A;  3GY9 A;  5DS0 A;  1Z2L A;  3D3S A;  2PRQ A;  3C26 A;  2BSW A;  5EMI A;  5F48 A;  3TX8 A;  8CPA A;  1UFH A;  1QSO A;  2EUI A;  4FD5 A;  4M85 A;  3IJ3 A;  4MXU A;  2DEA A;  3PB8 X;  1K4J A;  3B7I A;  3V38 A;  2AE6 A;  1CPS A;  1R3N A;  2PJ5 A;  2V8D A;  3T8W A;  3W6X A;  4AG7 A;  4JXR A;  4C68 A;  3H8E A;  2PJ4 A;  1FY7 A;  3KQZ A;  4P4J A;  3WC7 A;  1PU9 A;  7CPA A;  4OKO A;  4AG9 A;  4M6G A;  4Q38 A;  3HUV A;  2V77 A;  1X10 A;  3PFO A;  1FT7 A;  3BXM A;  5IV0 A;  3WC6 A;  1CM0 A;  2F5I A;  2EBJ A;  2PVW A;  2WUU A;  2R7H A;  3FIX A;  4NGQ A;  5HVG A;  3PRT A;  4OP4 A;  4UIB A;  4UF4 A;  3SJE A;  4X2T A;  4R6T A;  2PDO A;  3LOD A;  5AG5 A;  2A4N A;  2PIY A;  5G20 A;  3TO6 A;  1S3Z A;  2POK A;  2QYV A;  3BI1 A;  2EK9 A;  2BCO A;  2IMO A;  2X7B A;  3FNC A;  4FWU A;  4CGM A;  4CAF A;  2BEI A;  5F09 A;  1Z4E A;  2JDD A;  4CGP A;  4OC4 A;  4KS9 A;  3SJF A;  3TOB A;  2P6G A;  4H6Z A;  2ZEM A;  4K30 A;  4CYQ A;  4JJX A;  3N7Z A;  3V8I A;  3D7F A;  4XPL A;  6CPA A;  5DWM A;  4BD9 A;  4B5O A;  3FVL A;  4ZGY B;  4KUA A;  2PJA A;  3D8P A;  2PR8 A;  5LRJ A;  2JDC A;  2PJ8 A;  1ELL P;  3IU1 A;  4YU9 A;  2RC4 A;  4NEX A;  4KVO E;  3S6G A;  1MJB A;  2ZOG A;  2JBK A;  3EO4 A;  1QMU A;  1WK4 A;  4ONU A;  3EXN A;  4M3S A;  2PJ9 A;  2Q4V A;  3B3T A;  1CP6 A;  1CPX A;  1LFW A;  1IGB A;  2PSW A;  2CTC A;  2Z3K A;  3FYN A;  4AVA A;  3QAY A;  5HVH A;  2WSA A;  2CNM A;  2CNS A;  2Q43 A;  2R8V A;  1YGH A;  1M4D A;  4WJB A;  5AG4 A;  2EWB A;  4KUB A;  3CPX A;  3KI9 A;  4KVX A;  4NJQ A;  4ZX9 A;  2O53 A;  3SI2 A;  4B12 A;  2OZH A;  5CNP A;  1Z8W A;  4YFJ A;  1HDQ A;  4QC6 A;  2YNC C;  5LYL A;  2I79 A;  4P44 A;  4H89 A;  3D7H A;  3ZZI A;  4C2X A;  1TF9 A;  4CRZ B;  2ARH A;  3R95 A;  2ZEP A;  4FD6 A;  3SXN A;  2D4P A;  2ABZ A;  4B10 A;  3FMC A;  1A2Z A;  5G21 A;  4F8Z A;  5K8P A;  1RO5 A;  4NGT A;  1J4J A;  1Y7E A;  1MJ9 A;  2ZW7 A;  5A27 A;  1PUA A;  3TC8 A;  4H6U A;  2GIV A;  2CF4 A;  1Z8L A;  3BLN A;  3F5B A;  4GS4 A;  4YRH A;  4W9Y A;  5G1Z A;  2VL1 A;  2VEZ A;  3VWD A;  3ISX A;  3TFY A;  3NFZ A;  1S5K A;  1NE9 A;  5CBM A;  4KOT A;  2EVN A;  2OU2 A;  4UFV A;  4PSW A;  4PK2 A;  2ZW4 A;  2PE3 A;  1BPN A;  3F8K A;  4OC0 A;  2V8V A;  4R9M A;  5A28 A;  2CTB A;  3PGP A;  1ZG7 A;  4OC5 A;  3EY5 A;  2GFQ A;  4UEE A;  1DTD A;  4A38 A;  4A39 A;  1OBR A;  1IB1 E;  3PEI A;  4ZI6 A;  2CIJ A;  2DF5 A;  3BJ7 A;  1X12 A;  3GKR A;  3EFA A;  4TWE A;  3R9E A;  5C88 A;  2I3C A;  1IOF A;  3IC1 A;  1NSL A;  2AFS A;  1ON0 A;  1LRZ A;  3BHX A;  3V7Z A;  1VKC A;  4BIN A;  1Q7L A;  5LRG A;  4MCP A;  1LAN A;  1Z5R A;  2FIW A;  2P6E A;  3KL9 A;  3PB6 X;  4MFK A;  4IK2 A;  2DPT A;  1CJW A;  3GYA A;  2B4D B;  3IEH A;  4B14 A;  4PXE A;  2FVG A;  3VWE A;  2R1I A;  1Y9W A;  1M44 A;  2Q04 A;  4EFD A;  1Z9U A;  1F2P A;  2HC9 A;  3D66 A;  4CAV A;  4LQ6 A;  4MFP A;  1BOB A;  4F9U A;  2XEI A;  4K3N A;  2Y0M A;  5DWN A;  4A30 A;  3PBE A;  5J8F A;  4NGP A;  1YME A;  1ZO0 A;  4RUH A;  4NFR A;  3KQX A;  3IIB A;  4AVB A;  3W6S A;  2B3U A;  2KCW A;  2FIA A;  3JRU A;  4KOW A;  4ZX8 A;  4IAV A;  1BLL E;  2ZOF A;  4KOY A;  3P2F A;  3B3W A;  1YW6 A;  2Q44 A;  2ZEH A;  4X5K A;  5JH9 A;  3WC5 A;  2VBQ A;  1ARM A;  4X8I A;  1KWM A;  2ATR A;  2NSM A;  1M4G A;  1YLO A;  4H2K A;  4J3G A;  4LUA A;  2GE3 A;  4IUS A;  4KSF A;  4UA3 A;  4NF1 A;  1IYL A;  2WPW A;  3FX6 A;  2PJC A;  1FNO A;  5EC4 A;  2YNC A;  5E96 A;  5IB9 A;  3VAR A;  4F6A A;  5I0C A;  3S6F A;  3CT9 A;  2O28 A;  3NA6 A;  3IWG A;  1NSA A;  2JBJ A;  3K9T A;  2J8N A;  4B11 A;  3CZX A;  5D29 A;  3D68 A;  2VXK A;  3VAT A;  3JVN A;  3ISZ A;  4DYO A;  5I4M A;  4UIA A;  2QIR A;  2Q4Z A;  1Q2C A;  4CPA A;  2O4H A;  2C1C A;  3N5F A;  1QQ9 A;  4KOV A;  4HNY B;  5LYD A;  4KOS A;  1M1D A;  1AMP A;  4LX9 A;  4OC3 A;  1LOK A;  3B2Y A;  4KOU A;  2ZW6 A;  5H84 A;  3T9Y A;  3KKW A;  5HMN A;  4P4I A;  1GHE A;  3KHZ A;  4KSA A;  4PK3 A;  3LAC A;  3FBU A;  4EVY A;  2OOT A;  4ZY0 A;  1XMB A;  2NMT A;  2GAN A;  1XMT A;  3F0A A;  3IO1 A;  4CS0 B;  3P2H A;  1B87 A;  3LMS A;  3WR7 A;  2D4O A;  1ARL A;  1KUY A;  2AFX A;  1JQG A;  5J1Q A;  2PJ2 A;  4NJR A;  4RI1 A;  3DR6 A;  2P6F A;  4F0Y A;  2C6G A;  1XEB A;  1Y0Y A;  4O23 A;  2PJ6 A;  2B5G B;  2HB6 A;  1R43 A;  4Y49 C;  2PC1 A;  2ODF A;  4F0X A;  1YK3 A;  4JXQ A;  5FVJ A;  3D67 A;  4BMH A;  3EC4 A;  4ZY1 A;  4MHP A;  1MJA A;  2FL4 A;  2AFU A;  4MFL A;  5IB0 A;  1LCP A;  4MHD A;  2PJ3 A;  1LAM A;  3I3G A;  3LD2 A;  4NSQ A;  4XPK A;  4NCZ A;  3D7G A;  4YWY A;  1QSR A;  4GM5 A;  2RFH A;  3HLP A;  5HH1 A;  2PCU A;  2FT0 A;  2J8M A;  5LYI A;  4A95 A;  4B13 A;  4E8O A;  1Q2D A;  4MMO A;  3MGD A;  3GB0 A;  3JTK A;  1MK4 A;  1S7K A;  2B58 A;  4U9Y A;  1L0C A;  1HDU A;  1ZLI A;  4ZBG A;  3IFE A;  1RXT A;  1YLE A;  2PJ7 A;  4KOR A;  1P4N A;  3H5Z A;  1LAP A;  4PPZ A;  3K2K A;  3R9G A;  1Z4R A;  3D7D A;  3G8W A;  3SI0 A;  4OME A;  4AVC A;  4A37 A;  3FED A;  2XEF A;  5KTA A;  2PJ0 A;  1YVO A;  4CYN A;  2ZED A;  3D4U A;  1B6B A;  2BL1 A;  4PXD A;  3DGV A;  1WWZ A;  4HNX B;  4QB9 A;  1XF8 A;  1YRE A;  2B4D A;  3RYO A;  4HPS A;  1I1D A;  1R57 A;  2YND A;  1CBX A;  1OZP A;  3NE7 A;  4WWV A;  4NXY A;  1U6M A;  1IY7 A;  4MJ8 A;  3SI1 A;  5HXD A;  3S9M A;  3B3V A;  3KR5 A;  4UCN A;  5AG7 A;  2BOA A;  3GUX A;  2JLM A;  4CRY B;  4CYO A;  4MCS A;  2ZPA A;  1YVK A;  3QB8 A;  1AUG A;  2H5M A;  5IX3 A;  3S6K A;  1N71 A;  4II9 A;  4PXC A;  3MRU A;  3PP9 A;  1TKF A;  1RTQ A;  2Z3O A;  4Q36 A;  4EME A;  2EK8 A;  3R1K A;  4UCM A;  5F49 A;  4UWJ A;  2OH1 A;  4NGS A;  4CAE A;  4AXV A;  4OAE A;  1QSM A;  3A9L A;  4A33 A;  3RBU A;  2Z3L A;  1CG2 A;  4R3K A;  1XE4 A;  4IHM A;  4NGM A;  1BAV A;  2ZEO A;  2HV2 A;  5LYF A;  2GLJ A;  4CGL A;  2G9D A;  2AJ6 A;  3D2M A;  1IOI A; 
#chains in the Genus database with same CATH homology
 4KVM E;  2FXF A;  3FRM A;  4HKF A;  4HNW B;  4PSX A;  4A31 A;  2P0W A;  4B5P B;  4MY3 A;  4QBJ A;  1P0H A;  5F47 A;  3UY5 A;  3TCV A;  4UWI A;  2OZU A;  4CYP A;  2QML A;  5KTC A;  4KLV A;  3G3S A;  4RS2 A;  2Q7B A;  5BWA B;  5AGE A;  2JEV A;  3DNS A;  2G0B A;  4MFQ A;  3PZJ A;  2OZG A;  3DDD A;  4CGO A;  4FD4 A;  2VQY A;  1Q2Y A;  3BJ8 A;  1YX0 A;  1YR0 A;  4QUS A;  3K9U A;  4C2Z A;  2VZZ A;  4UBR A;  2Q0Y A;  3E0K A;  3I9S A;  4QVT A;  4PV6 A;  1SQH A;  3DR8 A;  4KZT A;  4MFZ A;  2G3T A;  2Z3P A;  2Q4Y A;  4BBH A;  2R98 A;  5ISV A;  1I21 A;  2CXA A;  2PQ8 A;  4CAW A;  4Y49 B;  3QAH A;  5C82 A;  4XNH B;  2REE A;  4JWP A;  2PR1 A;  3D2P A;  5AG6 A;  4MI4 A;  2B5G A;  4R3L A;  4MY0 A;  2Z0Z A;  4R57 A;  3R96 A;  4E0A A;  1TIQ A;  2VI7 A;  2FSR A;  2IL4 A;  2CY2 A;  2DXQ A;  5J8C A;  1Y7R A;  2YGW A;  2BUE A;  2Z11 A;  3IU2 A;  2ZXV A;  4A32 A;  1KUX A;  3B8G A;  4C7I A;  4DNC A;  3CXQ A;  1S7L A;  3SXO A;  2HQY A;  2CNT A;  4E2A A;  4YGO A;  4XNH C;  5G22 A;  4AB7 A;  4FD7 A;  3TE4 A;  3OWC A;  3TO9 A;  4ORF A;  4KOX A;  1VHS A;  4CAX A;  4A2Z A;  2B3V A;  2I00 A;  5EBV A;  1Y9K A;  4IF5 A;  3W91 A;  2Z3M A;  2Z10 A;  1S60 A;  2PRB A;  2DPS A;  3DSB A;  2G3A A;  1IID A;  4U9Z A;  2ZW5 A;  4OLL A;  5GCN A;  3TTH A;  1IYK A;  3TO7 A;  1M4I A;  4JD6 A;  4JLY A;  1NMT A;  1QST A;  4C7H A;  2REF A;  3TOA A;  5JQ4 A;  4OAD A;  3IGR A;  2WPX A;  2J8R A;  4XPD B;  3CXS A;  3T90 A;  4L8A A;  4CGN A;  2FCK A;  3CXP A;  3IWE A;  4B5P A;  2B4B A;  2C27 A;  2HUZ A;  3S6H A;  1IIC A;  3TT2 A;  2VZY A;  4KLW A;  4L89 A;  5KTD A;  3JUW A;  4UCP A;  4XPD C;  4UFW A;  4U5Y A;  4UFX A;  5F46 A;  1I12 A;  5H86 A;  4I49 A;  1S7N A;  3SHP A;  3FXT A;  1XIX A;  2YNE A;  2FE7 A;  2Z3N A;  2OB0 A;  2QEC A;  3R9F A;  1KZF A;  4C2Y A;  1S7F A;  2FS5 A;  4MBU A;  1QSN A;  1BO4 A;  1KUV A;  3ZJ0 A;  4MFJ A;  4R87 A;  3H4Q A;  1V0C A;  2K5T A;  3FB3 A;  3GY9 A;  3D3S A;  3C26 A;  5F48 A;  2BSW A;  1UFH A;  1QSO A;  2EUI A;  4FD5 A;  4M85 A;  1K4J A;  2AE6 A;  3W6X A;  4AG7 A;  4JXR A;  4C68 A;  1FY7 A;  1PU9 A;  4AG9 A;  4Q38 A;  5IV0 A;  1CM0 A;  2F5I A;  2WUU A;  2R7H A;  3FIX A;  2PDO A;  3LOD A;  5AG5 A;  2A4N A;  3TO6 A;  5G20 A;  1S3Z A;  4F0X A;  2X7B A;  3FNC A;  4CGM A;  4CAF A;  2BEI A;  1Z4E A;  2JDD A;  4CGP A;  4KS9 A;  3TOB A;  2P6G A;  4H6Z A;  4CYQ A;  4K30 A;  4JJX A;  3N7Z A;  3V8I A;  4XPL A;  5DWM A;  4B5O A;  4ZGY B;  4KUA A;  3D8P A;  2PR8 A;  2JDC A;  3IU1 A;  2RC4 A;  4NEX A;  4KVO E;  3S6G A;  1MJB A;  3EO4 A;  1WK4 A;  4ONU A;  3EXN A;  4M3S A;  2Q4V A;  2PSW A;  2Z3K A;  3FYN A;  4AVA A;  2WSA A;  2CNM A;  2CNS A;  2R8V A;  1YGH A;  1M4D A;  5AG4 A;  4KUB A;  4KVX A;  4B12 A;  2OZH A;  5CNP A;  4YFJ A;  4QC6 A;  2YNC C;  2I79 A;  4H89 A;  3ZZI A;  4C2X A;  4CRZ B;  2ARH A;  3R95 A;  4FD6 A;  3SXN A;  2D4P A;  4B10 A;  5G21 A;  1RO5 A;  5JPH A;  1J4J A;  2ZW7 A;  1MJ9 A;  5A27 A;  1PUA A;  4H6U A;  2GIV A;  4GS4 A;  3BLN A;  3F5B A;  4YRH A;  5G1Z A;  2VEZ A;  3VWD A;  3TFY A;  1S5K A;  1NE9 A;  4KOT A;  2EVN A;  2OU2 A;  4UFV A;  4PSW A;  4PK2 A;  2ZW4 A;  3F8K A;  4R9M A;  5A28 A;  3PGP A;  3EY5 A;  1IB1 E;  3BJ7 A;  3GKR A;  3EFA A;  3R9E A;  5C88 A;  1NSL A;  1ON0 A;  1LRZ A;  1VKC A;  2FIW A;  2P6E A;  4MFK A;  2DPT A;  1CJW A;  3GYA A;  2B4D B;  4B14 A;  3VWE A;  2R1I A;  1Y9W A;  1M44 A;  2Q04 A;  1Z9U A;  4CAV A;  4MFP A;  1BOB A;  2Y0M A;  5DWN A;  4A30 A;  5J8F A;  1ZO0 A;  4AVB A;  3W6S A;  2B3U A;  2KCW A;  2FIA A;  4KOW A;  4KOY A;  3P2F A;  2Q44 A;  4X5K A;  2VBQ A;  2ATR A;  1M4G A;  4J3G A;  4LUA A;  2GE3 A;  4IUS A;  4KSF A;  4UA3 A;  4NF1 A;  1IYL A;  2WPW A;  5EC4 A;  2YNC A;  5E96 A;  5I0C A;  4F6A A;  3S6F A;  2O28 A;  3IWG A;  2J8N A;  4B11 A;  2VXK A;  3JVN A;  2QIR A;  1Q2C A;  4KOV A;  4HNY B;  4KOS A;  1M1D A;  4LX9 A;  4KOU A;  2ZW6 A;  5H84 A;  3T9Y A;  3KKW A;  5HMN A;  1GHE A;  4KSA A;  4PK3 A;  3FBU A;  4EVY A;  2NMT A;  2GAN A;  1XMT A;  3F0A A;  4CS0 B;  3P2H A;  1B87 A;  3WR7 A;  2D4O A;  1KUY A;  4RI1 A;  3DR6 A;  2P6F A;  4F0Y A;  1XEB A;  2B5G B;  4Y49 C;  2PC1 A;  1YK3 A;  4JXQ A;  5FVJ A;  4BMH A;  3EC4 A;  1MJA A;  2FL4 A;  4MFL A;  5IB0 A;  4MHD A;  3I3G A;  3LD2 A;  4NSQ A;  4XPK A;  4NCZ A;  1QSR A;  5HH1 A;  4E8O A;  2FT0 A;  2J8M A;  4A95 A;  4B13 A;  1Q2D A;  3MGD A;  3JTK A;  1MK4 A;  1S7K A;  2B58 A;  4U9Y A;  1L0C A;  4ZBG A;  1RXT A;  1YLE A;  4KOR A;  1P4N A;  3H5Z A;  3R9G A;  1Z4R A;  3G8W A;  4AVC A;  5KTA A;  1YVO A;  4CYN A;  1B6B A;  2BL1 A;  1WWZ A;  4HNX B;  4QB9 A;  1XF8 A;  1YRE A;  2B4D A;  3RYO A;  1I1D A;  1R57 A;  2YND A;  1OZP A;  3NE7 A;  4NXY A;  1U6M A;  4MJ8 A;  4UCN A;  5AG7 A;  2JLM A;  4CRY B;  4CYO A;  2ZPA A;  1YVK A;  3QB8 A;  2H5M A;  5IX3 A;  3S6K A;  1N71 A;  4II9 A;  3PP9 A;  2Z3O A;  4Q36 A;  3R1K A;  4UCM A;  5F49 A;  4UWJ A;  2OH1 A;  4CAE A;  4OAE A;  1QSM A;  3A9L A;  4A33 A;  2Z3L A;  4R3K A;  1XE4 A;  2HV2 A;  4CGL A;  2AJ6 A;  3D2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...