4RI1A

Crystal structure of helicobacter pylori pseudaminic acid biosynthesis n -acetyltransferase pseh complex with acetyl-coa
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
178
Chain Sequence
KKNYSYKNIQAIDFTNLNDGEKLLVLEFRNHPNTALWMYSTFISLKTHLQFIEDLKNSPNHRYFLFKEEGVYLGVGSITKINFFHKHGYLGIYKNPFLKNGGETILKALEFIAFEEFQLHSLHLEVMENNFKAIAFYEKNHYELEGRLKGFISKDKEFIDVLLYYKDKKGYNDQSLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyl
publication title Crystal Structure of Helicobacter pylori Pseudaminic Acid Biosynthesis N-Acetyltransferase PseH: Implications for Substrate Specificity and Catalysis.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 57
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature ec 2.3.1.202: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase.
pdb deposition date 2014-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ri1A00
4FD4A 2VEZA 2Q7BA 1MJBA 4PK3A 2ZXVA 2F5IA 3SXNA 5IB0A 1YR0A 2ZW6A 4DNCA 1IYLA 2BUEA 1S7NA 2VI7A 3R1KA 2PDOA 4AB7A 4JLYA 2G0BA 3H4QA 1M4DA 3DR8A 2ATRA 3EXNA 4E2AA 1NE9A 2I79A 2ZW7A 1Z4RA 3NE7A 2K5TA 5C82A 1UFHA 2IL4A 3LD2A 5FVJA 4JWPA 4KOTA 4GS4A 5KTDA 1IIDA 3BJ7A 2PR1A 4IUSA 1Q2CA 2GIVA 3P2FA 3WR7A 2GE3A 4XPKA 2A4NA 2AJ6A 4KVOE 4H89A 4KUAA 1B87A 1P0HA 1R57A 5I0CA 1K4JA 2BEIA 2EVNA 4FD6A 3S6HA 3V8IA 4M3SA 1YK3A 1VKCA 3G3SA 1Y9WA 3K9UA 4AVCA 2CNTA 4CRYB 1QSOA 5DWNA 3EC4A 3I9SA 3PP9A 5EC4A 1N71A 4JD6A 4MJ8A 1NMTA 2Z10A 4AG7A 1Y9KA 2J8MA 1M4GA 4KVXA 2CY2A 4MY0A 1CM0A 1WK4A 4NF1A 3TO6A 2CNSA 1XE4A 4MI4A 3QAHA 2CNMA 4KOWA 3TCVA 4AVBA 2Y0MA 3BJ8A 3VWDA 4QVTA 4UWJA 2OU2A 4JJXA 5CNPA 2Z0ZA 4NSQA 4OADA 2WPXA 1S7LA 2VZZA 1S3ZA 1PU9A 2ARHA 3R9FA 4PSWA 3RYOA 3VWEA 5HH1A 4Y49C 2B4BA 4KOUA 4F6AA 1Y7RA 2JEVA 4KOVA 1MJAA 3EO4A 2R98A 2FCKA 1M44A 2Q04A 3R96A 4UA3A 1S7KA 4XNHC 2DXQA 2Q4VA 2FIAA 2VBQA 5HMNA 4XNHB 3I3GA 4KUBA 2JDCA 4KORA 2OZUA 4IF5A 2GANA 2FXFA 5KTAA 4NXYA 2OB0A 4YFJA 1MJ9A 2VXKA 3FNCA 2Q4YA 1YVOA 3SXOA 2H5MA 3CXPA 3FBUA 4R57A 3DSBA 3EFAA 2QIRA 4E0AA 4XPDC 1BO4A 2Z11A 4ONUA 2B58A 4KLVA 5F48A 2R7HA 3FB3A 3IGRA 3CXQA 3JUWA 3PZJA 2KCWA 5KTCA 1LRZA 4CAWA 2B3UA 2D4PA 2OZHA 1S60A 3P2HA 1KUVA 3DNSA 4CRZB 1XEBA 1PUAA 5GCNA 3E0KA 3ZJ0A 5F49A 2Q44A 4PK2A 5IV0A 3SHPA 2HV2A 3T9YA 2P0WA 4NEXA 1KZFA 4I49A 5E96A 4H6UA 2EUIA 1XF8A 3D8PA 1YREA 4M85A 2FT0A 4YRHA 1BOBA 4KOSA 4CAVA 1Z4EA 3CXSA 1B6BA 4ZBGA 5H86A 4H6ZA 3R9EA 4K30A 2B5GA 1P4NA 1IICA 1QSNA 4R87A 1KUYA 3F5BA 1Z9UA 3FIXA 4HNWB 1QSRA 4U9ZA 4PV6A 2PSWA 1MK4A 3N7ZA 1FY7A 5H84A 2AE6A 2WPWA 1IYKA 5F46A 3FRMA 3QB8A 1U6MA 3G8WA 4ORFA 4Y49B 2REFA 4J3GA 4JXQA 2I00A 2C27A 2ZPAA 3DR6A 5EBVA 4E8OA 4RI1A 2JLMA 1KUXA 2G3TA 3W6SA 2G3AA 1I21A 1M1DA 2P6GA 2HUZA 1RXTA 3ZZIA 1IB1E 3GY9A 3C26A 3LODA 4LUAA 1J4JA 3BLNA 5JPHA 3IWGA 4FD5A 2QMLA 3TO9A 1YX0A 2BSWA 1CJWA 4B5PA 2PRBA 4QC6A 1YLEA 2NMTA 4L8AA 4II9A 3GKRA 2FL4A 5F47A 1M4IA 3W91A 1QSTA 1L0CA 1OZPA 3TE4A 3TFYA 3TT2A 5C88A 4OAEA 1YVKA 2J8NA 4L89A 4R9MA 2P6EA 2VQYA 1RO5A 1SQHA 2R1IA 2D4OA 4XPDB 5JQ4A 4U5YA 3D2MA 2Q0YA 4KLWA 1Q2DA 5J8FA 4UWIA 2B5GB 4MY3A 2RC4A 1XMTA 5IX3A 3TO7A 3UY5A 3OWCA 4HNYB 3R9GA 3F8KA 4AG9A 1YGHA 2OZGA 2X7BA 3S6FA 3TOAA 1S7FA 1NSLA 2BL1A 3S6GA 2B4DA 3R95A 3D3SA 4B5OA 3W6XA 3F0AA 3FXTA 2FIWA 4PSXA 3GYAA 3JVNA 2FE7A 3TOBA 2PC1A 2QECA 4HKFA 4KVME 2PR8A 4FD7A 2PQ8A 4AVAA 5ISVA 2FS5A 3T90A 2FSRA 5DWMA 1GHEA 1WWZA 4B5PB 4KOXA 2JDDA 3KKWA 4F0YA 1S5KA 1V0CA 4X5KA 4RS2A 4OLLA 2ZW5A 2REEA 3EY5A 4KZTA 4KOYA 4XPLA 4LX9A 4HNXB 2J8RA 4NCZA 4YGOA 1VHSA 2P6FA 1ON0A 3FYNA 1I1DA 3MGDA 3TTHA 4CS0B 3DDDA 4QUSA 3B8GA 4BMHA 2B3VA 2O28A 4MBUA 2R8VA 1Q2YA 4QBJA 1I12A 1XIXA 4QB9A 4U9YA 2VZYA 4JXRA 5J8CA 1TIQA 4R3LA 3S6KA 3PGPA 2ZW4A 2OH1A 4R3KA 2HQYA 3D2PA 4EVYA 4UBRA 1QSMA 2B4DB 4MHDA 4CAXA
chains in the Genus database with same CATH superfamily
4FD4A 4NGRA 4F8ZA 3FMCA 2VEZA 2Q7BA 4X2TA 1MJBA 4PK3A 2ZXVA 2NSMA 2F5IA 4UCPA 3SXNA 5IB0A 1YR0A 2ZW6A 4CYNA 2PVVA 1IYLA 4B14A 4DNCA 2BUEA 1S7NA 4NGTA 4YWYA 2VI7A 3FJUA 4MMOA 3R1KA 2PDOA 4A38A 4Q38A 4ZY2A 4AB7A 1ARLA 4JLYA 2G0BA 3H4QA 1M4DA 5K8MA 3DR8A 2ATRA 5K8NA 1LAPA 2DPSA 3IWWA 2ZEMA 3EXNA 4KSIA 4PXEA 4E2AA 4CYQA 1NE9A 1PCAA 2ZENA 3JTKA 1UWYA 2I79A 2Z3NA 2ZW7A 1Z4RA 3NE7A 2EK9A 4OIWA 2AFSA 2K5TA 2WSAA 3B35A 1UFHA 2IJZA 2PIZA 3IO1A 2IL4A 3KR5A 3LD2A 4JZ0A 4JWPA 3H5ZA 4KOTA 4MFZA 5FVJA 4DJLA 4MFKA 4GS4A 5KTDA 2PRQA 1IIDA 3BJ7A 2PR1A 2IQ6A 2CTCA 3IJ3A 2RB7A 4IUSA 1Q2CA 2GIVA 2CTBA 3P2FA 3WR7A 2GE3A 4XPKA 2A4NA 2AJ6A 4ZY0A 4Z65A 3BXMA 2ZEGA 4KVOE 1IU8A 1VHOA 4H89A 4C2ZA 4KUAA 3GUXA 1B87A 3PB8X 3KASA 1FT7A 3PB4X 4RN7A 1P0HA 1R57A 5I0CA 1K4JA 2BEIA 2EVNA 2WZNA 4FD6A 4W9YA 3S6HA 3D7FA 3V8IA 1HDQA 3LACA 4M3SA 1YK3A 2PJ7A 1VKCA 3G3SA 1Y9WA 4K3NA 5LRKA 3D7DA 5G1ZA 1R3NA 3H8FA 3V38A 3FECA 3K9UA 1JQGA 4AVCA 2CNTA 4M6IA 4B6ZA 3H8GA 6CPAA 3VH9A 4CRYB 1QSOA 1XOVA 2HC9A 4UIBA 3EC4A 5DWNA 3I9SA 3B7IA 3PP9A 3IU1A 3SI0A 5EC4A 1N71A 1TKJA 4MHZA 4C2YA 4JD6A 2XEJA 2YNDA 4MJ8A 1NMTA 4OC1A 4WWVA 2Z10A 5JM6A 2C6GA 4PXCA 1Z2LA 1YQEA 3B3SA 4AG7A 1A2ZA 3S9LA 2PJ4A 1Z8WA 1Y9KA 2J8MA 1M4GA 4KVXA 4DYOA 2YNEA 1Z5RA 1OBRA 2CY2A 2ZEDA 4KS9A 2YNCA 4MY0A 2PE3A 1CM0A 1WK4A 4CAEA 4NF1A 3IFEA 3I1UA 3TO6A 5HVGA 3RZAA 2ANPA 3GLJA 2AFZA 3ISZA 4PXDA 2CNSA 1XE4A 1XJOA 4MI4A 4EMEA 1LANA 3QAHA 2CNMA 4KOWA 5AGEA 4RUHA 3TCVA 4AVBA 2Y0MA 3GIUA 3BJ8A 4FUUA 3VWDA 1ELMP 3SJEA 4QVTA 4UWJA 2OU2A 3NH8A 4JJXA 5CNPA 2Z0ZA 4NSQA 1KWMA 4OADA 2WPXA 1S7LA 2VZZA 1S3ZA 3W91A 2V8HA 1PU9A 2ARHA 3PFEA 5F47A 3R9FA 4BD9A 4PSWA 4ZI6A 3ISXA 4NJQA 3DGVA 3RYOA 1IGBA 3VWEA 2V77A 5HH1A 4F0XA 5JH9A 1QQ9A 3SI2A 4Y49C 2B4BA 4C7IA 2ZOGA 2QJ8A 4KOUA 4PXBA 5LYIA 3NFZA 4F6AA 2PCUA 1QMUA 1Y7RA 1TKHA 2JEVA 1Z8TA 3PBBA 4KOVA 2G9DA 1MJAA 3EO4A 4E8OA 4EWTA 2R98A 2FCKA 1M44A 2Q04A 5LRJA 3R96A 4UA3A 1TF9A 1S7KA 1PYTB 2XEGA 2EK8A 4B13A 4XNHC 3WABA 2BCOA 4TNUA 2DXQA 1AYEA 1ZG8A 1IOIA 1Z8LA 2FIAA 2DPTA 2Q4VA 2VBQA 4A94A 5HMNA 4XNHB 4B11A 3I3GA 4M6GA 1F2OA 4KUBA 1HEEA 3BHXA 4UFVA 4NFRA 2JDCA 4KORA 2OZUA 4IF5A 2GANA 4A95A 2FXFA 5LYLA 5KTAA 4NXYA 4P44A 2OB0A 5EMIA 4ZYQA 8CPAA 4YFJA 1MJ9A 2VXKA 3FNCA 2Q4YA 2EBJA 4FAIA 3CPAA 2C6CA 1YVOA 3KI9A 3NA6A 3SXOA 4CYOA 3SI1A 2H5MA 3FH4A 4UIAA 3B3CA 2QYVA 2PJCA 3CXPA 3FBUA 4R57A 4X8IA 2DF5A 2YNCC 3DSBA 4ZX9A 4Q36A 3EFAA 2QIRA 4E0AA 2CXAA 4XPDC 1BO4A 5F09A 2Z11A 2F8HA 4ONUA 2B58A 4KLVA 5F48A 3SJXA 2R7HA 3FB3A 3IGRA 3WT4A 3CXQA 3JUWA 3PZJA 3CPXA 2KCWA 2J9AA 4NJRA 4P45A 4R7MA 2EWBA 4P6YA 3VATA 5KTCA 1LRZA 4OKOA 4CAWA 2B3UA 2D4PA 4MFQA 1Z8XA 2IMOA 4ZY1A 2XEFA 2DEAA 2OZHA 1S60A 3NH5A 1CG2A 3P2HA 1KUVA 3DNSA 3IEHA 1XEBA 4O23A 4A30A 1R43A 2Z3KA 1PUAA 5GCNA 1BPNA 4IAVA 3E0KA 1Y0YA 4P4JA 3KZWA 5F49A 3ZJ0A 5JGFA 2Q44A 2PJ6A 4PK2A 3QNVA 5IV0A 1ZLHA 3D67A 3SHPA 2HV2A 3T9YA 2P0WA 1CPSA 4NEXA 2ZEEA 3IIBA 1KZFA 1XMBA 1XBUA 1ZG7A 4I49A 4KSFA 4MXUA 4UFWA 5E96A 4H6UA 4R8FA 3KL9A 1Y0RA 2EUIA 3CDXA 5G21A 1XF8A 4NGQA 4OP4A 3D8PA 1YREA 4M85A 4C2XA 1VGYA 2FT0A 4YRHA 4A31A 1BOBA 1ELLP 3KQZA 4KOSA 3S9NA 1ZG9A 4R6TA 3MRUA 4CAVA 1BPMA 3B3WA 1Z4EA 3CXSA 2JEWA 1B6BA 4ZBGA 4A32A 5H86A 1CBXA 4H6ZA 3KHXA 3R9EA 4K30A 2B5GA 3PBEA 1P4NA 4B12A 5HXDA 1IICA 1QSNA 4R87A 5D8NA 3PRTA 1KUYA 2PJBA 3F5BA 2V8DA 1Z9UA 3FIXA 1AUGA 1QSRA 2GU2A 4HNWB 2O4HA 4U9ZA 4G1PA 2GLJA 4NGPA 4MHYA 1VIXA 3RAMA 1LOKA 4OC2A 4PV6A 2PSWA 1MK4A 3N7ZA 1FY7A 5H84A 2AE6A 2WPWA 1IYKA 4A39A 3T8WA 1YSJA 5F46A 3FRMA 3QB8A 1U6MA 2BO9A 2ZEPA 3G8WA 4ORFA 4Y49B 2REFA 4J3GA 4MHNA 1YMEA 4OC4A 3PB6X 4JXQA 2I00A 2C27A 2ZPAA 3DR6A 3PB9X 4JYWA 5EBVA 4CGMA 4RI1A 3CZXA 4ZX8A 4MFJA 3RO0A 4CGOA 2JLMA 1KUXA 3GB0A 2G3TA 3W6SA 2G3AA 1CP7A 2HB6A 2BOAA 1I21A 1X12A 1IY7A 3N5FA 3TX8A 5A28A 1M1DA 2NYQA 1JWQA 2P6GA 2HUZA 1RXTA 1NSAA 3ZZIA 5G20A 1IB1E 4UFXA 1AMPA 3C26A 3GY9A 4IHMA 4UCNA 2GREA 2C1CA 3LODA 3D7GA 4LUAA 4MHPA 4MRIA 5CPAA 4CYPA 4OIDA 1J4JA 4NGNA 3BLNA 5AG7A 5JPHA 3IWGA 4FD5A 2QMLA 4UEFA 3TO9A 1EE3P 1YX0A 2BSWA 3WC6A 1CJWA 1HDUA 4B5PA 2PRBA 5AG4A 4MCRA 4QC6A 2FVGA 1YLEA 2NMTA 1YW4A 4UEZA 3A9LA 5K8OA 4L8AA 4MFLA 4II9A 1ARMA 2RFHA 2FL4A 2ZOFA 1M4IA 1FNOA 2GLFA 1F57A 1QSTA 3GKRA 1L0CA 5AG5A 1ZO0A 4FBEA 2PVWA 3K9TA 2ZEFA 1OZPA 3LMSA 4UCMA 5CBMA 1RTQA 2I3CA 3TE4A 4CPAA 3CT9A 2AFUA 3BI1A 3TFYA 5LYDA 3TT2A 4NGMA 5C88A 4OAEA 1YVKA 1YLOA 2J8NA 3HLPA 4L89A 4R9MA 1CX8A 2P6EA 2VQYA 3PFOA 1RO5A 1LFWA 4H2KA 4A33A 1SQHA 2R1IA 3QAYA 2D4OA 4CGLA 2Z3PA 4XPDB 5JQ4A 4U5YA 4AXVA 4OC3A 2ZELA 3D2MA 2Q0YA 3RBUA 4A2ZA 2ODFA 3H8EA 3NH4A 4KLWA 1Q2DA 5J8FA 1TXRA 4UWIA 3RNZA 3D66A 2CIJA 2AFWA 4BBHA 2B5GB 5LYFA 4MY3A 2ABZA 1XMTA 2PJ3A 2RC4A 2CF4A 1CP6A 3TO7A 3UY5A 3IC1A 3OWCA 2C6PA 4HNYB 3R9GA 4F9UA 1GYTA 3FX6A 4YU9A 4PPZA 3F8KA 1Y7EA 4AG9A 1VHEA 1ZLIA 2VL1A 4CGNA 2POKA 1YGHA 1TKFA 2OZGA 2X7BA 2AFOA 2JBJA 2XEIA 2ZEOA 3HUVA 2PJ5A 3S6FA 1IOFA 3D68A 3TOAA 4ONWA 1S7FA 1DTDA 4HPSA 4P4EA 1NSLA 2BL1A 5THWA 4OMEA 4PQAA 3S6GA 2B4DA 4BINA 5BWAB 5C82A 2Z3MA 5IX3A 3PB7X 1X10A 3R95A 4EFDA 3D3SA 3V7ZA 1XFOA 4B5OA 3DLJA 3PEIA 4MFPA 3W6XA 2V8GA 5AG6A 3F0AA 2Q4ZA 3FXTA 2FIWA 3LWUA 4PSXA 3GYAA 4P10A 3JVNA 2FE7A 5LRGA 3TOBA 2PJ9A 4KSAA 2PC1A 4TWEA 3VARA 2Q7SA 3IU2A 3MN8A 2QECA 1XRYA 4B10A 4MCPA 5J1QA 2O53A 4HKFA 2AFXA 3KGQA 4P4DA 4KVME 4UF4A 5I4MA 2PR8A 4FD7A 4X3RA 2PJAA 2JBKA 3D4UA 1BLLE 3KR4A 2PQ8A 3SJFA 1DE4C 1M4LA 4UEEA 4AVAA 5ISVA 4IK2A 3B3TA 4OC5A 4GM5A 2FS5A 3T90A 2FSRA 3JRUA 5DWMA 1GHEA 4C7HA 4WJBA 2PJ2A 1WWZA 3S9MA 3IWEA 2PJ0A 3WC5A 4B5PB 5A27A 4KOXA 2V8VA 2WUUA 2JDDA 3KKWA 1YW6A 4F0YA 2AFMA 4FWUA 4M6HA 4F9VA 3FEDA 4MCSA 5ELYA 4MCQA 1S5KA 1V0CA 4X5KA 4RS2A 3TC8A 4CRZB 3B3VA 4C68A 2Z3LA 4OLLA 1LAMA 2ZW5A 2REEA 3EY5A 4KZTA 4KOYA 4XPLA 1CPXA 4HNXB 2J8RA 4LX9A 4NCZA 4YGOA 5IB9A 1VHSA 3SJGA 2Q43A 1Q7LA 3FVLA 4LQ6A 5HVHA 2P6FA 2F7VA 4DUKA 1ON0A 5K8PA 1H8LA 3FYNA 2EO8A 4GXHA 1I1DA 5HVFA 3MGDA 4P4IA 2Z3OA 4LQGA 3TTHA 2OOTA 1LCPA 3KHZA 4A37A 2WYRA 2PIYA 3L2NA 4Q7AA 4R76A 3DDDA 4CS0B 4QUSA 3B8GA 5D29A 4BMHA 1BAVA 4P4FA 2B3VA 2O28A 3BI0A 2R8VA 3NE8A 4MBUA 4CGPA 3FF3A 4ZGYB 1TF8A 1Q2YA 4QBJA 1I12A 4P4BA 3KQXA 3K2KA 1XIXA 2OR4A 3B2YA 4QB9A 4U9YA 2VZYA 4JXRA 5J8CA 2YGWA 1TIQA 1F2PA 4R3LA 3D7HA 2GFQA 3FEEA 4NGSA 7CPAA 2QVPA 3S6KA 3PGPA 5G22A 2ZW4A 2OH1A 4OC0A 4R3KA 2PJ1A 2ZEHA 2Q51A 4CAFA 2PJ8A 2HQYA 3WC7A 3D2PA 4EVYA 4UBRA 1QSMA 5DS0A 2B4DB 4MHDA 4CAXA
chains in the Genus database with same CATH topology
4FD4A 2VEZA 2Q7BA 1MJBA 4PK3A 2ZXVA 2F5IA 4UCPA 3SXNA 5IB0A 1YR0A 2ZW6A 4CYNA 4DNCA 1IYLA 4B14A 2BUEA 1S7NA 2VI7A 3R1KA 2PDOA 4Q38A 4AB7A 4JLYA 2G0BA 3H4QA 1M4DA 3DR8A 2ATRA 2DPSA 3EXNA 4E2AA 4CYQA 1NE9A 3JTKA 2I79A 2Z3NA 2ZW7A 1Z4RA 3NE7A 2K5TA 5C82A 2WSAA 1UFHA 3LD2A 2IL4A 4MFZA 5FVJA 4JWPA 3H5ZA 4KOTA 4MFKA 4GS4A 5KTDA 1IIDA 3BJ7A 2PR1A 4IUSA 1Q2CA 2GIVA 3P2FA 3WR7A 2GE3A 4XPKA 2A4NA 2AJ6A 4KVOE 4H89A 4C2ZA 4KUAA 1B87A 1P0HA 1R57A 5I0CA 1K4JA 2BEIA 2EVNA 4FD6A 3S6HA 3V8IA 4M3SA 1YK3A 1VKCA 3G3SA 1Y9WA 5G1ZA 3K9UA 4AVCA 2CNTA 4CRYB 1QSOA 5DWNA 3EC4A 3I9SA 3PP9A 3IU1A 5EC4A 1N71A 4C2YA 4JD6A 2YNDA 4MJ8A 1NMTA 2Z10A 4AG7A 1Y9KA 2J8MA 1M4GA 4KVXA 2YNEA 2CY2A 4KS9A 2YNCA 4MY0A 1CM0A 1WK4A 4CAEA 4NF1A 3TO6A 2CNSA 1XE4A 4MI4A 3QAHA 2CNMA 4KOWA 5AGEA 3TCVA 4AVBA 2Y0MA 3BJ8A 3VWDA 4QVTA 4UWJA 2OU2A 4JJXA 5CNPA 2Z0ZA 4NSQA 4OADA 2WPXA 1S7LA 2VZZA 1S3ZA 1PU9A 2ARHA 3R9FA 4PSWA 3RYOA 3VWEA 5HH1A 4F0XA 4Y49C 2B4BA 4C7IA 4KOUA 4F6AA 1Y7RA 2JEVA 4KOVA 1MJAA 3EO4A 2R98A 2FCKA 1M44A 2Q04A 3R96A 4UA3A 1S7KA 4B13A 4XNHC 2DXQA 2Q4VA 2FIAA 2DPTA 2VBQA 5HMNA 4XNHB 4B11A 3I3GA 4KUBA 4UFVA 2JDCA 4KORA 2OZUA 4IF5A 2GANA 4A95A 2FXFA 5KTAA 4NXYA 2OB0A 4YFJA 1MJ9A 2VXKA 3FNCA 2Q4YA 1YVOA 4CYOA 3SXOA 2H5MA 3CXPA 3FBUA 4R57A 2YNCC 3DSBA 4Q36A 3EFAA 2QIRA 4E0AA 2CXAA 4XPDC 1BO4A 2Z11A 4ONUA 2B58A 4KLVA 5F48A 2R7HA 3FB3A 3IGRA 3CXQA 3JUWA 3PZJA 2KCWA 5KTCA 1LRZA 4CAWA 2B3UA 2D4PA 4MFQA 2OZHA 1S60A 3P2HA 1KUVA 3DNSA 4CRZB 1XEBA 4A30A 2Z3KA 1PUAA 5GCNA 3E0KA 3ZJ0A 5F49A 2Q44A 4PK2A 5IV0A 3SHPA 2HV2A 3T9YA 2P0WA 4NEXA 1KZFA 4I49A 4KSFA 4UFWA 5E96A 4H6UA 2EUIA 5G21A 1XF8A 3D8PA 1YREA 4M85A 4C2XA 2FT0A 4YRHA 4A31A 1BOBA 4KOSA 4CAVA 1Z4EA 3CXSA 1B6BA 4ZBGA 4A32A 5H86A 4H6ZA 3R9EA 4K30A 2B5GA 1P4NA 4B12A 1IICA 1QSNA 4R87A 1KUYA 3F5BA 1Z9UA 4HNWB 3FIXA 1QSRA 4U9ZA 4PV6A 2PSWA 1MK4A 3N7ZA 1FY7A 5H84A 2AE6A 2WPWA 1IYKA 5F46A 3FRMA 3QB8A 1U6MA 3G8WA 4ORFA 4Y49B 2REFA 4J3GA 4JXQA 2I00A 2C27A 2ZPAA 3DR6A 5EBVA 4CGMA 4E8OA 4RI1A 4MFJA 4CGOA 2JLMA 1KUXA 2G3TA 3W6SA 2G3AA 1I21A 5A28A 1M1DA 2P6GA 2HUZA 1RXTA 3ZZIA 5G20A 1IB1E 4UFXA 3GY9A 3C26A 4UCNA 3LODA 4CYPA 4LUAA 1J4JA 3BLNA 5AG7A 5JPHA 3IWGA 4FD5A 2QMLA 3TO9A 1YX0A 2BSWA 1CJWA 4B5PA 2PRBA 5AG4A 4QC6A 1YLEA 2NMTA 3A9LA 4L8AA 4MFLA 4II9A 3GKRA 2FL4A 5F47A 1M4IA 3W91A 5AG5A 1QSTA 1L0CA 1ZO0A 1OZPA 4UCMA 3TE4A 3TFYA 3TT2A 5C88A 4OAEA 1YVKA 2J8NA 4L89A 4R9MA 2P6EA 2VQYA 1RO5A 4A33A 1SQHA 2R1IA 2D4OA 4CGLA 2Z3PA 4XPDB 5JQ4A 4U5YA 3D2MA 2Q0YA 4A2ZA 4KLWA 1Q2DA 5J8FA 4UWIA 4BBHA 2B5GB 4MY3A 2RC4A 1XMTA 5IX3A 3TO7A 3UY5A 3OWCA 4HNYB 3R9GA 3F8KA 4AG9A 4CGNA 1YGHA 2OZGA 2X7BA 3S6FA 3TOAA 1S7FA 1NSLA 2BL1A 3S6GA 2B4DA 5BWAB 2Z3MA 3R95A 3D3SA 4B5OA 4MFPA 3W6XA 5AG6A 3F0AA 3FXTA 2FIWA 4PSXA 3GYAA 3JVNA 2FE7A 3TOBA 4KSAA 2PC1A 3IU2A 2QECA 4B10A 4HKFA 4KVME 2PR8A 4FD7A 2PQ8A 4AVAA 5ISVA 2FS5A 3T90A 2FSRA 5DWMA 1GHEA 4C7HA 1WWZA 3IWEA 4B5PB 5A27A 4KOXA 2WUUA 2JDDA 3KKWA 4F0YA 1S5KA 1V0CA 4X5KA 4RS2A 4C68A 2Z3LA 4OLLA 2ZW5A 2REEA 3EY5A 4KZTA 4KOYA 4XPLA 4HNXB 2J8RA 4LX9A 4NCZA 4YGOA 1VHSA 2P6FA 1ON0A 3FYNA 1I1DA 3MGDA 2Z3OA 3TTHA 4CS0B 3DDDA 4QUSA 3B8GA 4BMHA 2B3VA 2O28A 4MBUA 2R8VA 4CGPA 4ZGYB 1Q2YA 4QBJA 1I12A 1XIXA 4QB9A 4U9YA 2VZYA 4JXRA 5J8CA 2YGWA 1TIQA 4R3LA 3S6KA 3PGPA 5G22A 2ZW4A 2OH1A 4R3KA 4CAFA 2HQYA 3D2PA 4EVYA 4UBRA 1QSMA 2B4DB 4MHDA 4CAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FD4 A;  2VEZ A;  2Q7B A;  1MJB A;  4PK3 A;  2ZXV A;  2F5I A;  3SXN A;  5IB0 A;  1YR0 A;  2ZW6 A;  4DNC A;  1IYL A;  2BUE A;  1S7N A;  2VI7 A;  3R1K A;  2PDO A;  4AB7 A;  4JLY A;  2G0B A;  3H4Q A;  1M4D A;  3DR8 A;  2ATR A;  3EXN A;  4E2A A;  1NE9 A;  2I79 A;  2ZW7 A;  1Z4R A;  3NE7 A;  2K5T A;  5C82 A;  1UFH A;  2IL4 A;  3LD2 A;  5FVJ A;  4JWP A;  4KOT A;  4GS4 A;  5KTD A;  1IID A;  3BJ7 A;  2PR1 A;  4IUS A;  1Q2C A;  2GIV A;  3P2F A;  3WR7 A;  2GE3 A;  4XPK A;  2A4N A;  2AJ6 A;  4KVO E;  4H89 A;  4KUA A;  1B87 A;  1P0H A;  1R57 A;  5I0C A;  1K4J A;  2BEI A;  2EVN A;  4FD6 A;  3S6H A;  3V8I A;  4M3S A;  1YK3 A;  1VKC A;  3G3S A;  1Y9W A;  3K9U A;  4AVC A;  2CNT A;  4CRY B;  1QSO A;  5DWN A;  3EC4 A;  3I9S A;  3PP9 A;  5EC4 A;  1N71 A;  4JD6 A;  4MJ8 A;  1NMT A;  2Z10 A;  4AG7 A;  1Y9K A;  2J8M A;  1M4G A;  4KVX A;  2CY2 A;  4MY0 A;  1CM0 A;  1WK4 A;  4NF1 A;  3TO6 A;  2CNS A;  1XE4 A;  4MI4 A;  3QAH A;  2CNM A;  4KOW A;  3TCV A;  4AVB A;  2Y0M A;  3BJ8 A;  3VWD A;  4QVT A;  4UWJ A;  2OU2 A;  4JJX A;  5CNP A;  2Z0Z A;  4NSQ A;  4OAD A;  2WPX A;  1S7L A;  2VZZ A;  1S3Z A;  1PU9 A;  2ARH A;  3R9F A;  4PSW A;  3RYO A;  3VWE A;  5HH1 A;  4Y49 C;  2B4B A;  4KOU A;  4F6A A;  1Y7R A;  2JEV A;  4KOV A;  1MJA A;  3EO4 A;  2R98 A;  2FCK A;  1M44 A;  2Q04 A;  3R96 A;  4UA3 A;  1S7K A;  4XNH C;  2DXQ A;  2Q4V A;  2FIA A;  2VBQ A;  5HMN A;  4XNH B;  3I3G A;  4KUB A;  2JDC A;  4KOR A;  2OZU A;  4IF5 A;  2GAN A;  2FXF A;  5KTA A;  4NXY A;  2OB0 A;  4YFJ A;  1MJ9 A;  2VXK A;  3FNC A;  2Q4Y A;  1YVO A;  3SXO A;  2H5M A;  3CXP A;  3FBU A;  4R57 A;  3DSB A;  3EFA A;  2QIR A;  4E0A A;  4XPD C;  1BO4 A;  2Z11 A;  4ONU A;  2B58 A;  4KLV A;  5F48 A;  2R7H A;  3FB3 A;  3IGR A;  3CXQ A;  3JUW A;  3PZJ A;  2KCW A;  5KTC A;  1LRZ A;  4CAW A;  2B3U A;  2D4P A;  2OZH A;  1S60 A;  3P2H A;  1KUV A;  3DNS A;  4CRZ B;  1XEB A;  1PUA A;  5GCN A;  3E0K A;  3ZJ0 A;  5F49 A;  2Q44 A;  4PK2 A;  5IV0 A;  3SHP A;  2HV2 A;  3T9Y A;  2P0W A;  4NEX A;  1KZF A;  4I49 A;  5E96 A;  4H6U A;  2EUI A;  1XF8 A;  3D8P A;  1YRE A;  4M85 A;  2FT0 A;  4YRH A;  1BOB A;  4KOS A;  4CAV A;  1Z4E A;  3CXS A;  1B6B A;  4ZBG A;  5H86 A;  4H6Z A;  3R9E A;  4K30 A;  2B5G A;  1P4N A;  1IIC A;  1QSN A;  4R87 A;  1KUY A;  3F5B A;  1Z9U A;  3FIX A;  4HNW B;  1QSR A;  4U9Z A;  4PV6 A;  2PSW A;  1MK4 A;  3N7Z A;  1FY7 A;  5H84 A;  2AE6 A;  2WPW A;  1IYK A;  5F46 A;  3FRM A;  3QB8 A;  1U6M A;  3G8W A;  4ORF A;  4Y49 B;  2REF A;  4J3G A;  4JXQ A;  2I00 A;  2C27 A;  2ZPA A;  3DR6 A;  5EBV A;  4E8O A;  4RI1 A;  2JLM A;  1KUX A;  2G3T A;  3W6S A;  2G3A A;  1I21 A;  1M1D A;  2P6G A;  2HUZ A;  1RXT A;  3ZZI A;  1IB1 E;  3GY9 A;  3C26 A;  3LOD A;  4LUA A;  1J4J A;  3BLN A;  5JPH A;  3IWG A;  4FD5 A;  2QML A;  3TO9 A;  1YX0 A;  2BSW A;  1CJW A;  4B5P A;  2PRB A;  4QC6 A;  1YLE A;  2NMT A;  4L8A A;  4II9 A;  3GKR A;  2FL4 A;  5F47 A;  1M4I A;  3W91 A;  1QST A;  1L0C A;  1OZP A;  3TE4 A;  3TFY A;  3TT2 A;  5C88 A;  4OAE A;  1YVK A;  2J8N A;  4L89 A;  4R9M A;  2P6E A;  2VQY A;  1RO5 A;  1SQH A;  2R1I A;  2D4O A;  4XPD B;  5JQ4 A;  4U5Y A;  3D2M A;  2Q0Y A;  4KLW A;  1Q2D A;  5J8F A;  4UWI A;  2B5G B;  4MY3 A;  2RC4 A;  1XMT A;  5IX3 A;  3TO7 A;  3UY5 A;  3OWC A;  4HNY B;  3R9G A;  3F8K A;  4AG9 A;  1YGH A;  2OZG A;  2X7B A;  3S6F A;  3TOA A;  1S7F A;  1NSL A;  2BL1 A;  3S6G A;  2B4D A;  3R95 A;  3D3S A;  4B5O A;  3W6X A;  3F0A A;  3FXT A;  2FIW A;  4PSX A;  3GYA A;  3JVN A;  2FE7 A;  3TOB A;  2PC1 A;  2QEC A;  4HKF A;  4KVM E;  2PR8 A;  4FD7 A;  2PQ8 A;  4AVA A;  5ISV A;  2FS5 A;  3T90 A;  2FSR A;  5DWM A;  1GHE A;  1WWZ A;  4B5P B;  4KOX A;  2JDD A;  3KKW A;  4F0Y A;  1S5K A;  1V0C A;  4X5K A;  4RS2 A;  4OLL A;  2ZW5 A;  2REE A;  3EY5 A;  4KZT A;  4KOY A;  4XPL A;  4LX9 A;  4HNX B;  2J8R A;  4NCZ A;  4YGO A;  1VHS A;  2P6F A;  1ON0 A;  3FYN A;  1I1D A;  3MGD A;  3TTH A;  4CS0 B;  3DDD A;  4QUS A;  3B8G A;  4BMH A;  2B3V A;  2O28 A;  4MBU A;  2R8V A;  1Q2Y A;  4QBJ A;  1I12 A;  1XIX A;  4QB9 A;  4U9Y A;  2VZY A;  4JXR A;  5J8C A;  1TIQ A;  4R3L A;  3S6K A;  3PGP A;  2ZW4 A;  2OH1 A;  4R3K A;  2HQY A;  3D2P A;  4EVY A;  4UBR A;  1QSM A;  2B4D B;  4MHD A;  4CAX A; 
#chains in the Genus database with same CATH topology
 4FD4 A;  4NGR A;  4F8Z A;  3FMC A;  2VEZ A;  2Q7B A;  4X2T A;  1MJB A;  4PK3 A;  2ZXV A;  2NSM A;  2F5I A;  4UCP A;  3SXN A;  5IB0 A;  1YR0 A;  2ZW6 A;  4CYN A;  2PVV A;  1IYL A;  4B14 A;  4DNC A;  2BUE A;  1S7N A;  4NGT A;  4YWY A;  2VI7 A;  3FJU A;  4MMO A;  3R1K A;  2PDO A;  4A38 A;  4Q38 A;  4ZY2 A;  4AB7 A;  1ARL A;  4JLY A;  2G0B A;  3H4Q A;  1M4D A;  5K8M A;  3DR8 A;  2ATR A;  5K8N A;  1LAP A;  2DPS A;  3IWW A;  2ZEM A;  3EXN A;  4KSI A;  4PXE A;  4E2A A;  4CYQ A;  1NE9 A;  1PCA A;  2ZEN A;  3JTK A;  1UWY A;  2I79 A;  2Z3N A;  2ZW7 A;  1Z4R A;  3NE7 A;  2EK9 A;  4OIW A;  2AFS A;  2K5T A;  2WSA A;  3B35 A;  1UFH A;  2IJZ A;  2PIZ A;  3IO1 A;  2IL4 A;  3KR5 A;  3LD2 A;  4JZ0 A;  4JWP A;  3H5Z A;  4KOT A;  4MFZ A;  5FVJ A;  4DJL A;  4MFK A;  4GS4 A;  5KTD A;  2PRQ A;  1IID A;  3BJ7 A;  2PR1 A;  2IQ6 A;  2CTC A;  3IJ3 A;  2RB7 A;  4IUS A;  1Q2C A;  2GIV A;  2CTB A;  3P2F A;  3WR7 A;  2GE3 A;  4XPK A;  2A4N A;  2AJ6 A;  4ZY0 A;  4Z65 A;  3BXM A;  2ZEG A;  4KVO E;  1IU8 A;  1VHO A;  4H89 A;  4C2Z A;  4KUA A;  3GUX A;  1B87 A;  3PB8 X;  3KAS A;  1FT7 A;  3PB4 X;  4RN7 A;  1P0H A;  1R57 A;  5I0C A;  1K4J A;  2BEI A;  2EVN A;  2WZN A;  4FD6 A;  4W9Y A;  3S6H A;  3D7F A;  3V8I A;  1HDQ A;  3LAC A;  4M3S A;  1YK3 A;  2PJ7 A;  1VKC A;  3G3S A;  1Y9W A;  4K3N A;  5LRK A;  3D7D A;  5G1Z A;  1R3N A;  3H8F A;  3V38 A;  3FEC A;  3K9U A;  1JQG A;  4AVC A;  2CNT A;  4M6I A;  4B6Z A;  3H8G A;  6CPA A;  3VH9 A;  4CRY B;  1QSO A;  1XOV A;  2HC9 A;  4UIB A;  3EC4 A;  5DWN A;  3I9S A;  3B7I A;  3PP9 A;  3IU1 A;  3SI0 A;  5EC4 A;  1N71 A;  1TKJ A;  4MHZ A;  4C2Y A;  4JD6 A;  2XEJ A;  2YND A;  4MJ8 A;  1NMT A;  4OC1 A;  4WWV A;  2Z10 A;  5JM6 A;  2C6G A;  4PXC A;  1Z2L A;  1YQE A;  3B3S A;  4AG7 A;  1A2Z A;  3S9L A;  2PJ4 A;  1Z8W A;  1Y9K A;  2J8M A;  1M4G A;  4KVX A;  4DYO A;  2YNE A;  1Z5R A;  1OBR A;  2CY2 A;  2ZED A;  4KS9 A;  2YNC A;  4MY0 A;  2PE3 A;  1CM0 A;  1WK4 A;  4CAE A;  4NF1 A;  3IFE A;  3I1U A;  3TO6 A;  5HVG A;  3RZA A;  2ANP A;  3GLJ A;  2AFZ A;  3ISZ A;  4PXD A;  2CNS A;  1XE4 A;  1XJO A;  4MI4 A;  4EME A;  1LAN A;  3QAH A;  2CNM A;  4KOW A;  5AGE A;  4RUH A;  3TCV A;  4AVB A;  2Y0M A;  3GIU A;  3BJ8 A;  4FUU A;  3VWD A;  1ELM P;  3SJE A;  4QVT A;  4UWJ A;  2OU2 A;  3NH8 A;  4JJX A;  5CNP A;  2Z0Z A;  4NSQ A;  1KWM A;  4OAD A;  2WPX A;  1S7L A;  2VZZ A;  1S3Z A;  3W91 A;  2V8H A;  1PU9 A;  2ARH A;  3PFE A;  5F47 A;  3R9F A;  4BD9 A;  4PSW A;  4ZI6 A;  3ISX A;  4NJQ A;  3DGV A;  3RYO A;  1IGB A;  3VWE A;  2V77 A;  5HH1 A;  4F0X A;  5JH9 A;  1QQ9 A;  3SI2 A;  4Y49 C;  2B4B A;  4C7I A;  2ZOG A;  2QJ8 A;  4KOU A;  4PXB A;  5LYI A;  3NFZ A;  4F6A A;  2PCU A;  1QMU A;  1Y7R A;  1TKH A;  2JEV A;  1Z8T A;  3PBB A;  4KOV A;  2G9D A;  1MJA A;  3EO4 A;  4E8O A;  4EWT A;  2R98 A;  2FCK A;  1M44 A;  2Q04 A;  5LRJ A;  3R96 A;  4UA3 A;  1TF9 A;  1S7K A;  1PYT B;  2XEG A;  2EK8 A;  4B13 A;  4XNH C;  3WAB A;  2BCO A;  4TNU A;  2DXQ A;  1AYE A;  1ZG8 A;  1IOI A;  1Z8L A;  2FIA A;  2DPT A;  2Q4V A;  2VBQ A;  4A94 A;  5HMN A;  4XNH B;  4B11 A;  3I3G A;  4M6G A;  1F2O A;  4KUB A;  1HEE A;  3BHX A;  4UFV A;  4NFR A;  2JDC A;  4KOR A;  2OZU A;  4IF5 A;  2GAN A;  4A95 A;  2FXF A;  5LYL A;  5KTA A;  4NXY A;  4P44 A;  2OB0 A;  5EMI A;  4ZYQ A;  8CPA A;  4YFJ A;  1MJ9 A;  2VXK A;  3FNC A;  2Q4Y A;  2EBJ A;  4FAI A;  3CPA A;  2C6C A;  1YVO A;  3KI9 A;  3NA6 A;  3SXO A;  4CYO A;  3SI1 A;  2H5M A;  3FH4 A;  4UIA A;  3B3C A;  2QYV A;  2PJC A;  3CXP A;  3FBU A;  4R57 A;  4X8I A;  2DF5 A;  2YNC C;  3DSB A;  4ZX9 A;  4Q36 A;  3EFA A;  2QIR A;  4E0A A;  2CXA A;  4XPD C;  1BO4 A;  5F09 A;  2Z11 A;  2F8H A;  4ONU A;  2B58 A;  4KLV A;  5F48 A;  3SJX A;  2R7H A;  3FB3 A;  3IGR A;  3WT4 A;  3CXQ A;  3JUW A;  3PZJ A;  3CPX A;  2KCW A;  2J9A A;  4NJR A;  4P45 A;  4R7M A;  2EWB A;  4P6Y A;  3VAT A;  5KTC A;  1LRZ A;  4OKO A;  4CAW A;  2B3U A;  2D4P A;  4MFQ A;  1Z8X A;  2IMO A;  4ZY1 A;  2XEF A;  2DEA A;  2OZH A;  1S60 A;  3NH5 A;  1CG2 A;  3P2H A;  1KUV A;  3DNS A;  3IEH A;  1XEB A;  4O23 A;  4A30 A;  1R43 A;  2Z3K A;  1PUA A;  5GCN A;  1BPN A;  4IAV A;  3E0K A;  1Y0Y A;  4P4J A;  3KZW A;  5F49 A;  3ZJ0 A;  5JGF A;  2Q44 A;  2PJ6 A;  4PK2 A;  3QNV A;  5IV0 A;  1ZLH A;  3D67 A;  3SHP A;  2HV2 A;  3T9Y A;  2P0W A;  1CPS A;  4NEX A;  2ZEE A;  3IIB A;  1KZF A;  1XMB A;  1XBU A;  1ZG7 A;  4I49 A;  4KSF A;  4MXU A;  4UFW A;  5E96 A;  4H6U A;  4R8F A;  3KL9 A;  1Y0R A;  2EUI A;  3CDX A;  5G21 A;  1XF8 A;  4NGQ A;  4OP4 A;  3D8P A;  1YRE A;  4M85 A;  4C2X A;  1VGY A;  2FT0 A;  4YRH A;  4A31 A;  1BOB A;  1ELL P;  3KQZ A;  4KOS A;  3S9N A;  1ZG9 A;  4R6T A;  3MRU A;  4CAV A;  1BPM A;  3B3W A;  1Z4E A;  3CXS A;  2JEW A;  1B6B A;  4ZBG A;  4A32 A;  5H86 A;  1CBX A;  4H6Z A;  3KHX A;  3R9E A;  4K30 A;  2B5G A;  3PBE A;  1P4N A;  4B12 A;  5HXD A;  1IIC A;  1QSN A;  4R87 A;  5D8N A;  3PRT A;  1KUY A;  2PJB A;  3F5B A;  2V8D A;  1Z9U A;  3FIX A;  1AUG A;  1QSR A;  2GU2 A;  4HNW B;  2O4H A;  4U9Z A;  4G1P A;  2GLJ A;  4NGP A;  4MHY A;  1VIX A;  3RAM A;  1LOK A;  4OC2 A;  4PV6 A;  2PSW A;  1MK4 A;  3N7Z A;  1FY7 A;  5H84 A;  2AE6 A;  2WPW A;  1IYK A;  4A39 A;  3T8W A;  1YSJ A;  5F46 A;  3FRM A;  3QB8 A;  1U6M A;  2BO9 A;  2ZEP A;  3G8W A;  4ORF A;  4Y49 B;  2REF A;  4J3G A;  4MHN A;  1YME A;  4OC4 A;  3PB6 X;  4JXQ A;  2I00 A;  2C27 A;  2ZPA A;  3DR6 A;  3PB9 X;  4JYW A;  5EBV A;  4CGM A;  4RI1 A;  3CZX A;  4ZX8 A;  4MFJ A;  3RO0 A;  4CGO A;  2JLM A;  1KUX A;  3GB0 A;  2G3T A;  3W6S A;  2G3A A;  1CP7 A;  2HB6 A;  2BOA A;  1I21 A;  1X12 A;  1IY7 A;  3N5F A;  3TX8 A;  5A28 A;  1M1D A;  2NYQ A;  1JWQ A;  2P6G A;  2HUZ A;  1RXT A;  1NSA A;  3ZZI A;  5G20 A;  1IB1 E;  4UFX A;  1AMP A;  3C26 A;  3GY9 A;  4IHM A;  4UCN A;  2GRE A;  2C1C A;  3LOD A;  3D7G A;  4LUA A;  4MHP A;  4MRI A;  5CPA A;  4CYP A;  4OID A;  1J4J A;  4NGN A;  3BLN A;  5AG7 A;  5JPH A;  3IWG A;  4FD5 A;  2QML A;  4UEF A;  3TO9 A;  1EE3 P;  1YX0 A;  2BSW A;  3WC6 A;  1CJW A;  1HDU A;  4B5P A;  2PRB A;  5AG4 A;  4MCR A;  4QC6 A;  2FVG A;  1YLE A;  2NMT A;  1YW4 A;  4UEZ A;  3A9L A;  5K8O A;  4L8A A;  4MFL A;  4II9 A;  1ARM A;  2RFH A;  2FL4 A;  2ZOF A;  1M4I A;  1FNO A;  2GLF A;  1F57 A;  1QST A;  3GKR A;  1L0C A;  5AG5 A;  1ZO0 A;  4FBE A;  2PVW A;  3K9T A;  2ZEF A;  1OZP A;  3LMS A;  4UCM A;  5CBM A;  1RTQ A;  2I3C A;  3TE4 A;  4CPA A;  3CT9 A;  2AFU A;  3BI1 A;  3TFY A;  5LYD A;  3TT2 A;  4NGM A;  5C88 A;  4OAE A;  1YVK A;  1YLO A;  2J8N A;  3HLP A;  4L89 A;  4R9M A;  1CX8 A;  2P6E A;  2VQY A;  3PFO A;  1RO5 A;  1LFW A;  4H2K A;  4A33 A;  1SQH A;  2R1I A;  3QAY A;  2D4O A;  4CGL A;  2Z3P A;  4XPD B;  5JQ4 A;  4U5Y A;  4AXV A;  4OC3 A;  2ZEL A;  3D2M A;  2Q0Y A;  3RBU A;  4A2Z A;  2ODF A;  3H8E A;  3NH4 A;  4KLW A;  1Q2D A;  5J8F A;  1TXR A;  4UWI A;  3RNZ A;  3D66 A;  2CIJ A;  2AFW A;  4BBH A;  2B5G B;  5LYF A;  4MY3 A;  2ABZ A;  1XMT A;  2PJ3 A;  2RC4 A;  2CF4 A;  1CP6 A;  3TO7 A;  3UY5 A;  3IC1 A;  3OWC A;  2C6P A;  4HNY B;  3R9G A;  4F9U A;  1GYT A;  3FX6 A;  4YU9 A;  4PPZ A;  3F8K A;  1Y7E A;  4AG9 A;  1VHE A;  1ZLI A;  2VL1 A;  4CGN A;  2POK A;  1YGH A;  1TKF A;  2OZG A;  2X7B A;  2AFO A;  2JBJ A;  2XEI A;  2ZEO A;  3HUV A;  2PJ5 A;  3S6F A;  1IOF A;  3D68 A;  3TOA A;  4ONW A;  1S7F A;  1DTD A;  4HPS A;  4P4E A;  1NSL A;  2BL1 A;  5THW A;  4OME A;  4PQA A;  3S6G A;  2B4D A;  4BIN A;  5BWA B;  5C82 A;  2Z3M A;  5IX3 A;  3PB7 X;  1X10 A;  3R95 A;  4EFD A;  3D3S A;  3V7Z A;  1XFO A;  4B5O A;  3DLJ A;  3PEI A;  4MFP A;  3W6X A;  2V8G A;  5AG6 A;  3F0A A;  2Q4Z A;  3FXT A;  2FIW A;  3LWU A;  4PSX A;  3GYA A;  4P10 A;  3JVN A;  2FE7 A;  5LRG A;  3TOB A;  2PJ9 A;  4KSA A;  2PC1 A;  4TWE A;  3VAR A;  2Q7S A;  3IU2 A;  3MN8 A;  2QEC A;  1XRY A;  4B10 A;  4MCP A;  5J1Q A;  2O53 A;  4HKF A;  2AFX A;  3KGQ A;  4P4D A;  4KVM E;  4UF4 A;  5I4M A;  2PR8 A;  4FD7 A;  4X3R A;  2PJA A;  2JBK A;  3D4U A;  1BLL E;  3KR4 A;  2PQ8 A;  3SJF A;  1DE4 C;  1M4L A;  4UEE A;  4AVA A;  5ISV A;  4IK2 A;  3B3T A;  4OC5 A;  4GM5 A;  2FS5 A;  3T90 A;  2FSR A;  3JRU A;  5DWM A;  1GHE A;  4C7H A;  4WJB A;  2PJ2 A;  1WWZ A;  3S9M A;  3IWE A;  2PJ0 A;  3WC5 A;  4B5P B;  5A27 A;  4KOX A;  2V8V A;  2WUU A;  2JDD A;  3KKW A;  1YW6 A;  4F0Y A;  2AFM A;  4FWU A;  4M6H A;  4F9V A;  3FED A;  4MCS A;  5ELY A;  4MCQ A;  1S5K A;  1V0C A;  4X5K A;  4RS2 A;  3TC8 A;  4CRZ B;  3B3V A;  4C68 A;  2Z3L A;  4OLL A;  1LAM A;  2ZW5 A;  2REE A;  3EY5 A;  4KZT A;  4KOY A;  4XPL A;  1CPX A;  4HNX B;  2J8R A;  4LX9 A;  4NCZ A;  4YGO A;  5IB9 A;  1VHS A;  3SJG A;  2Q43 A;  1Q7L A;  3FVL A;  4LQ6 A;  5HVH A;  2P6F A;  2F7V A;  4DUK A;  1ON0 A;  5K8P A;  1H8L A;  3FYN A;  2EO8 A;  4GXH A;  1I1D A;  5HVF A;  3MGD A;  4P4I A;  2Z3O A;  4LQG A;  3TTH A;  2OOT A;  1LCP A;  3KHZ A;  4A37 A;  2WYR A;  2PIY A;  3L2N A;  4Q7A A;  4R76 A;  3DDD A;  4CS0 B;  4QUS A;  3B8G A;  5D29 A;  4BMH A;  1BAV A;  4P4F A;  2B3V A;  2O28 A;  3BI0 A;  2R8V A;  3NE8 A;  4MBU A;  4CGP A;  3FF3 A;  4ZGY B;  1TF8 A;  1Q2Y A;  4QBJ A;  1I12 A;  4P4B A;  3KQX A;  3K2K A;  1XIX A;  2OR4 A;  3B2Y A;  4QB9 A;  4U9Y A;  2VZY A;  4JXR A;  5J8C A;  2YGW A;  1TIQ A;  1F2P A;  4R3L A;  3D7H A;  2GFQ A;  3FEE A;  4NGS A;  7CPA A;  2QVP A;  3S6K A;  3PGP A;  5G22 A;  2ZW4 A;  2OH1 A;  4OC0 A;  4R3K A;  2PJ1 A;  2ZEH A;  2Q51 A;  4CAF A;  2PJ8 A;  2HQY A;  3WC7 A;  3D2P A;  4EVY A;  4UBR A;  1QSM A;  5DS0 A;  2B4D B;  4MHD A;  4CAX A; 
#chains in the Genus database with same CATH homology
 4FD4 A;  2VEZ A;  2Q7B A;  1MJB A;  4PK3 A;  2ZXV A;  2F5I A;  4UCP A;  3SXN A;  5IB0 A;  1YR0 A;  2ZW6 A;  4CYN A;  4DNC A;  1IYL A;  4B14 A;  2BUE A;  1S7N A;  2VI7 A;  3R1K A;  2PDO A;  4Q38 A;  4AB7 A;  4JLY A;  2G0B A;  3H4Q A;  1M4D A;  3DR8 A;  2ATR A;  2DPS A;  3EXN A;  4E2A A;  4CYQ A;  1NE9 A;  3JTK A;  2I79 A;  2Z3N A;  2ZW7 A;  1Z4R A;  3NE7 A;  2K5T A;  5C82 A;  2WSA A;  1UFH A;  3LD2 A;  2IL4 A;  4MFZ A;  5FVJ A;  4JWP A;  3H5Z A;  4KOT A;  4MFK A;  4GS4 A;  5KTD A;  1IID A;  3BJ7 A;  2PR1 A;  4IUS A;  1Q2C A;  2GIV A;  3P2F A;  3WR7 A;  2GE3 A;  4XPK A;  2A4N A;  2AJ6 A;  4KVO E;  4H89 A;  4C2Z A;  4KUA A;  1B87 A;  1P0H A;  1R57 A;  5I0C A;  1K4J A;  2BEI A;  2EVN A;  4FD6 A;  3S6H A;  3V8I A;  4M3S A;  1YK3 A;  1VKC A;  3G3S A;  1Y9W A;  5G1Z A;  3K9U A;  4AVC A;  2CNT A;  4CRY B;  1QSO A;  5DWN A;  3EC4 A;  3I9S A;  3PP9 A;  3IU1 A;  5EC4 A;  1N71 A;  4C2Y A;  4JD6 A;  2YND A;  4MJ8 A;  1NMT A;  2Z10 A;  4AG7 A;  1Y9K A;  2J8M A;  1M4G A;  4KVX A;  2YNE A;  2CY2 A;  4KS9 A;  2YNC A;  4MY0 A;  1CM0 A;  1WK4 A;  4CAE A;  4NF1 A;  3TO6 A;  2CNS A;  1XE4 A;  4MI4 A;  3QAH A;  2CNM A;  4KOW A;  5AGE A;  3TCV A;  4AVB A;  2Y0M A;  3BJ8 A;  3VWD A;  4QVT A;  4UWJ A;  2OU2 A;  4JJX A;  5CNP A;  2Z0Z A;  4NSQ A;  4OAD A;  2WPX A;  1S7L A;  2VZZ A;  1S3Z A;  1PU9 A;  2ARH A;  3R9F A;  4PSW A;  3RYO A;  3VWE A;  5HH1 A;  4F0X A;  4Y49 C;  2B4B A;  4C7I A;  4KOU A;  4F6A A;  1Y7R A;  2JEV A;  4KOV A;  1MJA A;  3EO4 A;  2R98 A;  2FCK A;  1M44 A;  2Q04 A;  3R96 A;  4UA3 A;  1S7K A;  4B13 A;  4XNH C;  2DXQ A;  2Q4V A;  2FIA A;  2DPT A;  2VBQ A;  5HMN A;  4XNH B;  4B11 A;  3I3G A;  4KUB A;  4UFV A;  2JDC A;  4KOR A;  2OZU A;  4IF5 A;  2GAN A;  4A95 A;  2FXF A;  5KTA A;  4NXY A;  2OB0 A;  4YFJ A;  1MJ9 A;  2VXK A;  3FNC A;  2Q4Y A;  1YVO A;  4CYO A;  3SXO A;  2H5M A;  3CXP A;  3FBU A;  4R57 A;  2YNC C;  3DSB A;  4Q36 A;  3EFA A;  2QIR A;  4E0A A;  2CXA A;  4XPD C;  1BO4 A;  2Z11 A;  4ONU A;  2B58 A;  4KLV A;  5F48 A;  2R7H A;  3FB3 A;  3IGR A;  3CXQ A;  3JUW A;  3PZJ A;  2KCW A;  5KTC A;  1LRZ A;  4CAW A;  2B3U A;  2D4P A;  4MFQ A;  2OZH A;  1S60 A;  3P2H A;  1KUV A;  3DNS A;  4CRZ B;  1XEB A;  4A30 A;  2Z3K A;  1PUA A;  5GCN A;  3E0K A;  3ZJ0 A;  5F49 A;  2Q44 A;  4PK2 A;  5IV0 A;  3SHP A;  2HV2 A;  3T9Y A;  2P0W A;  4NEX A;  1KZF A;  4I49 A;  4KSF A;  4UFW A;  5E96 A;  4H6U A;  2EUI A;  5G21 A;  1XF8 A;  3D8P A;  1YRE A;  4M85 A;  4C2X A;  2FT0 A;  4YRH A;  4A31 A;  1BOB A;  4KOS A;  4CAV A;  1Z4E A;  3CXS A;  1B6B A;  4ZBG A;  4A32 A;  5H86 A;  4H6Z A;  3R9E A;  4K30 A;  2B5G A;  1P4N A;  4B12 A;  1IIC A;  1QSN A;  4R87 A;  1KUY A;  3F5B A;  1Z9U A;  4HNW B;  3FIX A;  1QSR A;  4U9Z A;  4PV6 A;  2PSW A;  1MK4 A;  3N7Z A;  1FY7 A;  5H84 A;  2AE6 A;  2WPW A;  1IYK A;  5F46 A;  3FRM A;  3QB8 A;  1U6M A;  3G8W A;  4ORF A;  4Y49 B;  2REF A;  4J3G A;  4JXQ A;  2I00 A;  2C27 A;  2ZPA A;  3DR6 A;  5EBV A;  4CGM A;  4E8O A;  4RI1 A;  4MFJ A;  4CGO A;  2JLM A;  1KUX A;  2G3T A;  3W6S A;  2G3A A;  1I21 A;  5A28 A;  1M1D A;  2P6G A;  2HUZ A;  1RXT A;  3ZZI A;  5G20 A;  1IB1 E;  4UFX A;  3GY9 A;  3C26 A;  4UCN A;  3LOD A;  4CYP A;  4LUA A;  1J4J A;  3BLN A;  5AG7 A;  5JPH A;  3IWG A;  4FD5 A;  2QML A;  3TO9 A;  1YX0 A;  2BSW A;  1CJW A;  4B5P A;  2PRB A;  5AG4 A;  4QC6 A;  1YLE A;  2NMT A;  3A9L A;  4L8A A;  4MFL A;  4II9 A;  3GKR A;  2FL4 A;  5F47 A;  1M4I A;  3W91 A;  5AG5 A;  1QST A;  1L0C A;  1ZO0 A;  1OZP A;  4UCM A;  3TE4 A;  3TFY A;  3TT2 A;  5C88 A;  4OAE A;  1YVK A;  2J8N A;  4L89 A;  4R9M A;  2P6E A;  2VQY A;  1RO5 A;  4A33 A;  1SQH A;  2R1I A;  2D4O A;  4CGL A;  2Z3P A;  4XPD B;  5JQ4 A;  4U5Y A;  3D2M A;  2Q0Y A;  4A2Z A;  4KLW A;  1Q2D A;  5J8F A;  4UWI A;  4BBH A;  2B5G B;  4MY3 A;  2RC4 A;  1XMT A;  5IX3 A;  3TO7 A;  3UY5 A;  3OWC A;  4HNY B;  3R9G A;  3F8K A;  4AG9 A;  4CGN A;  1YGH A;  2OZG A;  2X7B A;  3S6F A;  3TOA A;  1S7F A;  1NSL A;  2BL1 A;  3S6G A;  2B4D A;  5BWA B;  2Z3M A;  3R95 A;  3D3S A;  4B5O A;  4MFP A;  3W6X A;  5AG6 A;  3F0A A;  3FXT A;  2FIW A;  4PSX A;  3GYA A;  3JVN A;  2FE7 A;  3TOB A;  4KSA A;  2PC1 A;  3IU2 A;  2QEC A;  4B10 A;  4HKF A;  4KVM E;  2PR8 A;  4FD7 A;  2PQ8 A;  4AVA A;  5ISV A;  2FS5 A;  3T90 A;  2FSR A;  5DWM A;  1GHE A;  4C7H A;  1WWZ A;  3IWE A;  4B5P B;  5A27 A;  4KOX A;  2WUU A;  2JDD A;  3KKW A;  4F0Y A;  1S5K A;  1V0C A;  4X5K A;  4RS2 A;  4C68 A;  2Z3L A;  4OLL A;  2ZW5 A;  2REE A;  3EY5 A;  4KZT A;  4KOY A;  4XPL A;  4HNX B;  2J8R A;  4LX9 A;  4NCZ A;  4YGO A;  1VHS A;  2P6F A;  1ON0 A;  3FYN A;  1I1D A;  3MGD A;  2Z3O A;  3TTH A;  4CS0 B;  3DDD A;  4QUS A;  3B8G A;  4BMH A;  2B3V A;  2O28 A;  4MBU A;  2R8V A;  4CGP A;  4ZGY B;  1Q2Y A;  4QBJ A;  1I12 A;  1XIX A;  4QB9 A;  4U9Y A;  2VZY A;  4JXR A;  5J8C A;  2YGW A;  1TIQ A;  4R3L A;  3S6K A;  3PGP A;  5G22 A;  2ZW4 A;  2OH1 A;  4R3K A;  4CAF A;  2HQY A;  3D2P A;  4EVY A;  4UBR A;  1QSM A;  2B4D B;  4MHD A;  4CAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...