4RI5A

Crystal structure of ptpn3 (ptph1) d811e mutant in complex with metavanadate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
284
Chain Sequence
SNADTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPEHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate specificity and plasticity of FERM-containing protein tyrosine phosphatases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase non-receptor type 3
total genus 95
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2014-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4ri5A00
1YPTA 2QEPA 5KA0A 2J17A 2CMBA 2I6MA 3S3KA 2VEVA 4GS0A 3OLRA 4YR8B 4MBBA 2F6FA 5KADA 2MBCA 4GFVA 2CNHA 1ONZA 1C84A 1AAXA 4PVGA 2NZ6A 2WGPA 5M43A 2NTAA 1GFYA 1XXPA 2QBRA 1YGUA 1LARA 2HB1A 5KA2A 4QAPA 2HC2A 1XXVA 4TVVA 1P15A 2B4UA 1ZCLA 2IMGA 1OEOX 4NWFA 4KI9A 3B7OA 4I8NA 2I4EA 4D3RA 5I6VA 2I1YA 3EU0A 5EHRA 3S3HA 2J16A 1YWFA 4KYRA 2B4OA 1BZCA 1VHRA 4NWGA 3BLTA 2YDUA 4GWFA 4GFUA 5KA7A 1ZZWA 1I9TA 2CM8A 2CNIA 3PS5A 5KAAA 3AWEA 1EEOA 2F6VA 2B4SA 1PA1A 1OHDA 2QCTA 3ZMPA 1R6HA 2I6JA 1OESA 2QDPA 2ZMMA 1C83A 3O5XA 1YGRA 2I4GA 3MOZA 3V0IA 1G7FA 3F81A 1BZJA 2G59A 2A8BA 2VEWA 5GTJA 3QCLA 3V0EA 1NL9A 1RPMA 3F9AA 5BUGA 3D44A 2HNPA 2G6ZA 3S4OA 1NWEA 5K9VA 4WU3A 5K24A 2F6ZA 1OHCA 1I9SA 2CNEA 1NZ7A 3M4UA 4QBWA 1Q1MA 3V0FA 1PA9A 1M3GA 5KA1A 3QCBA 1FQ1A 1U24A 3QCCA 1T48A 3AWGA 2CJZA 2F71A 1PTYA 1X24A 3ZV2A 3SMEA 1PTTA 2I6PA 5KA4A 5KA9A 4NNDA 2DXPA 2QCJA 4QAHA 1FPZA 3QKQA 3EAXA 3NMEA 3O4TA 2GWOA 4JMJA 3EB1A 3MOWA 1XRIA 3QCIA 1G4WR 1XM2A 3QCGA 2A3KA 2I5XA 3V0HA 2VEUA 1YTWA 5BZXA 1C85A 3ZMQA 5KACA 3AWFA 2CM7A 5KA8A 4RI5A 4RDDA 3BLUA 4JMKA 2QBPA 2PT0A 2CMCA 1G1GA 2F6TA 5KA3A 3I80A 1Q6JA 2I6IA 3OMHA 4J51A 2CFVA 2FJNA 1A5YA 1FPRA 1LYVA 2I42A 2BGDA 1Q6SA 4NYHA 1T49A 1RXDA 2F70A 1PYNA 1WAXA 2CM3A 3F9BA 1J4XA 3V0DA 3CM3A 2H4GA 2P6XA 1YN9A 2F46A 4R0TA 1MKPA 2E0TA 2R0BA 3ZM2A 1LQFA 2BIJA 2OZ5A 5K23A 1Q6MA 3O3LA 2NLKA 1XBOA 3A5JA 3QCNA 4QBEA 1GWZA 4GE5A 2H03A 1OEUA 5HDEA 5BZZA 2PBNA 4BJOA 4D3PA 2PI7A 2HC1A 3MMJA 2J16B 2PSZA 2F6YA 3CWEA 4R30A 3QCFA 2OUDA 4H1OA 4HJPA 1NO6A 4OHIA 1KAVA 2Q47A 3D1HA 1G1HA 2QDMA 3EMUA 2FJMA 2B49A 3QCHA 2AZRA 1C86A 1PTUA 2C7SA 4WU2A 4HJQA 2RF6A 5KABA 2QDCA 2BV5A 2CNGA 1JF7A 2P4DA 3RO1A 2CMAA 1U26A 1OEVA 2OC3A 1U25A 4IKCA 3O4UA 2GJTA 3S3FA 4YAAA 4QUMA 4WTYA 3GXGA 1EENA 4DGXA 4DGPA 2M3VA 2FH7A 2CNFA 1T4JA 1D5RA 4KYQA 2PQ5A 4RHGA 2I6OA 3V0JA 4OHHA 4RH5A 2SHPA 2QBQA 3ZM1A 1Q6NA 3H2XA 4H34A 5K25A 4QUNA 1Q6PA 1L8GA 1G4US 1JLNA 3D1OA 1KAKA 3I7ZA 1Q6TA 2BGEA 1ONYA 2CM2A 4OHLA 5MMZB 2HCMA 4S0GA 3BM8A 2ESBA 3I36A 3BRHA 1ECVA 1G7GA 2Y96A 2H02A 4GE6A 4JBCA 3S3EA 1PXHA 3V0GA 4OHEA 1ZC0A 2OOQA 1YTSA 4ICZA 3RGQA 3RGOA 2AHSA 3D9CA 2NV5A 4HRFA 4GRYA 2QBSA 4ERCA 2JJDA 5K22A 5IBSA 4B04A 3N0AA 1YTNA 2H4KA 2NT7A 4OHDA 2HY3A 3F99A 3U96A 5K9WA 5IBMA 3D42A 4BPCA 4D3QA 5J8RA 1C87A 2ZN7A 2HNQA 1L8KA 3QCEA 1QZ0A 5EHPA 4ZI4A 2GP0A 4WOHA 1G1FA 4RI4A 5BX1A 1PH0A 2VEXA 5LXQB 1NWLA 2HXPA 1QXKA 2BZLA 2C46A 4Z6BA 1NNYA 4RKKA 3O4SA 2B4PA 3ZM3A 1C88A 1YFOA 3ZM0A 1PTVA 3QCJA 2B07A 1ZCKA 1I57A 1OETA 1OHEA 2H4VA 2F6WA 4JNBA 2NT2A 2I3UA 4ZN5A 2Y2FA 4Y14A 1YZ4A 2B3OA 4GE2A 5AWXA 3QCDA 2I4HA 4R0SA 1SUGA 3SR9A 1V3AA 1WRMA 3EZZA 4Y2EA 2I75A 2I3RA 3QCKA 1WCHA 4PYHA 4RH9A 3GXHA 4NX8A 4ZRTA 3A5KA 3F41A 2H04A 1BZHA 2VEYA 2Q05A 2HVLA 3QCMA 1OEMX 3RZ2A 4AZ1A 4GRZA 3D1QA 3LJ8A 2PA5A 3S4EA 3QKPA
chains in the Genus database with same CATH superfamily
1YPTA 2QEPA 5KA0A 2J17A 2GC6A 2CMBA 2I6MA 3S3KA 2VEVA 2GCBA 4GS0A 3OLRA 4YR8B 4MBBA 2F6FA 3PYZA 5KADA 2MBCA 4GFVA 2CNHA 1ONZA 1C84A 1AAXA 4PVGA 2UUOA 2VTEA 2NZ6A 2WGPA 1J6UA 5M43A 2NTAA 1GFYA 1XXPA 4HV4A 2QBRA 1YGUA 2VOSA 4CVMA 1LARA 2HB1A 5KA2A 1W78A 4QAPA 2HC2A 1XXVA 4TVVA 1EEHA 1P15A 4C12A 1E8CA 2B4UA 1ZCLA 2IMGA 1OEOX 4NWFA 2WTZA 4KI9A 3B7OA 4I8NA 2I4EA 4D3RA 4UAGA 5I6VA 2I1YA 3EU0A 5EHRA 3S3HA 2J16A 1YWFA 4KYRA 2B4OA 1BZCA 1VHRA 4NWGA 3BLTA 2YDUA 4GWFA 4GFUA 5KA7A 1ZZWA 1I9TA 2CM8A 2CNIA 3PS5A 5KAAA 3AWEA 1EEOA 2F6VA 2B4SA 1PA1A 1OHDA 2QCTA 3ZMPA 1R6HA 2I6JA 1OESA 2QDPA 2ZMMA 1C83A 3O5XA 1YGRA 2I4GA 3MOZA 3V0IA 1G7FA 3F81A 3ZM6A 1BZJA 2G59A 2A8BA 2VEWA 5GTJA 3QCLA 3V0EA 3HN7A 1NL9A 1RPMA 1W7KA 2Y67A 3F9AA 5BUGA 3D44A 3N2AA 2HNPA 2G6ZA 3S4OA 1NWEA 5K9VA 4WU3A 2Y68A 5K24A 2F6ZA 1OHCA 1I9SA 2VORA 2CNEA 1NZ7A 3M4UA 4QBWA 4C13A 1Q1MA 3V0FA 1PA9A 1M3GA 5KA1A 3QCBA 1FQ1A 1U24A 3QCCA 1T48A 3AWGA 2CJZA 2F71A 2VTDA 1PTYA 1X24A 3ZV2A 3SMEA 1PTTA 2I6PA 5KA4A 5KA9A 4NNDA 2DXPA 2QCJA 4QAHA 1FPZA 3QKQA 3EAXA 3NMEA 3O4TA 2GWOA 4JMJA 3EB1A 3MOWA 1XRIA 3QCIA 1G4WR 1XM2A 3QCGA 2A3KA 2I5XA 3V0HA 2VEUA 1P3DA 1YTWA 5BZXA 1C85A 3ZMQA 4CVLA 5KACA 3AWFA 2CM7A 5KA8A 4RI5A 4RDDA 3BLUA 4JMKA 1JBWA 2QBPA 2PT0A 2CMCA 1G1GA 1JBVA 2F6TA 5KA3A 3I80A 5A5EA 1Q6JA 2I6IA 3OMHA 4J51A 2CFVA 2FJNA 1A5YA 1FPRA 1LYVA 2I42A 2BGDA 1Q6SA 4NYHA 1FGSA 1T49A 1RXDA 2F70A 1PYNA 1WAXA 2CM3A 3F9BA 1J4XA 3V0DA 3CM3A 2H4GA 2P6XA 1YN9A 2F46A 4R0TA 2AM2A 1MKPA 2E0TA 2R0BA 3ZM5A 3ZM2A 1LQFA 2BIJA 2OZ5A 5K23A 1Q6MA 3O3LA 2NLKA 1XBOA 3A5JA 3QCNA 4QBEA 1GWZA 2Y1OA 4GE5A 2H03A 1OEUA 5HDEA 5BZZA 2PBNA 4BJOA 4D3PA 3NRSA 3ZL8A 2PI7A 2HC1A 3MMJA 2J16B 2PSZA 2F6YA 3CWEA 4R30A 3QCFA 2OUDA 4H1OA 4HJPA 1NO6A 4OHIA 1KAVA 2Q47A 4QF5A 3D1HA 1G1HA 2QDMA 3EMUA 2FJMA 2B49A 3QCHA 2AZRA 1GG4A 1C86A 1PTUA 2C7SA 4WU2A 4HJQA 2RF6A 5KABA 2QDCA 2BV5A 2CNGA 1JF7A 2P4DA 3RO1A 2CMAA 1U26A 1OEVA 2OC3A 1U25A 4IKCA 3O4UA 2GJTA 3S3FA 4YAAA 4QUMA 4WTYA 1UAGA 2UAGA 2XPCA 3GXGA 1EENA 4DGXA 4DGPA 2M3VA 2FH7A 2CNFA 1T4JA 1D5RA 4KYQA 2PQ5A 4RHGA 2I6OA 3V0JA 4OHHA 4RH5A 2SHPA 2QBQA 3ZM1A 1Q6NA 3H2XA 4H34A 5K25A 4QUNA 1Q6PA 1L8GA 2GC5A 1G4US 1JLNA 3D1OA 1KAKA 3I7ZA 1Q6TA 2BGEA 1ONYA 2CM2A 3UAGA 4OHLA 4BUBA 5MMZB 2HCMA 4S0GA 3MVNA 3BM8A 2ESBA 3I36A 3BRHA 1ECVA 2GCAA 1G7GA 2Y96A 1GQYA 2JFFA 2H02A 4GE6A 4JBCA 3S3EA 2X5OA 1PXHA 3V0GA 4OHEA 1ZC0A 2OOQA 1YTSA 4ICZA 3RGQA 3RGOA 2AHSA 3D9CA 2NV5A 4HRFA 4GRYA 2QBSA 4ERCA 2JJDA 5K22A 2UUPA 5IBSA 4B04A 2Y66A 3N0AA 1YTNA 2H4KA 2NT7A 4OHDA 4ZIYA 2HY3A 2XJAA 3F99A 3U96A 5K9WA 5IBMA 3D42A 4BPCA 4D3QA 4BUCA 5J8RA 1P31A 1C87A 2ZN7A 2HNQA 1L8KA 3QCEA 1QZ0A 5EHPA 4ZI4A 2GP0A 4WOHA 1G1FA 4RI4A 5BX1A 1PH0A 2VEXA 4QDIA 2JFHA 5LXQB 1NWLA 1E0DA 2HXPA 1QXKA 1GQQA 2BZLA 2C46A 4Z6BA 1NNYA 4RKKA 3O4SA 2B4PA 3ZM3A 1C88A 1YFOA 3ZM0A 1PTVA 3QCJA 2B07A 1ZCKA 1I57A 1OETA 1OHEA 2H4VA 2F6WA 4JNBA 2JFGA 2NT2A 2I3UA 4ZN5A 2Y2FA 4Y14A 2AM1A 1YZ4A 2B3OA 4GE2A 5AWXA 3QCDA 2WJPA 2I4HA 4R0SA 1SUGA 3SR9A 3LK7A 1V3AA 1WRMA 3QCZA 3EZZA 4Y2EA 1O5ZA 2I75A 2I3RA 3QCKA 1WCHA 4CVKA 4PYHA 4RH9A 5A5FA 3GXHA 4NX8A 4ZRTA 3A5KA 3F41A 2H04A 1BZHA 2VEYA 2Q05A 2HVLA 3QCMA 1OEMX 3RZ2A 4AZ1A 4GRZA 3D1QA 2F00A 3LJ8A 2PA5A 3S4EA 3QKPA
chains in the Genus database with same CATH topology
1YPTA 2QEPA 5KA0A 2J17A 2CMBA 2I6MA 3S3KA 2VEVA 4GS0A 3OLRA 4YR8B 4MBBA 2F6FA 5KADA 2MBCA 4GFVA 2CNHA 1ONZA 1C84A 1AAXA 4PVGA 2NZ6A 2WGPA 5M43A 2NTAA 1GFYA 1XXPA 2QBRA 1YGUA 1LARA 2HB1A 5KA2A 4QAPA 2HC2A 1XXVA 4TVVA 1P15A 2B4UA 1ZCLA 2IMGA 1OEOX 4NWFA 4KI9A 3B7OA 4I8NA 2I4EA 4D3RA 5I6VA 2I1YA 3EU0A 5EHRA 3S3HA 2J16A 1YWFA 4KYRA 2B4OA 1BZCA 1VHRA 4NWGA 3BLTA 2YDUA 4GWFA 4GFUA 5KA7A 1ZZWA 1I9TA 2CM8A 2CNIA 3PS5A 5KAAA 3AWEA 1EEOA 2F6VA 2B4SA 1PA1A 1OHDA 2QCTA 3ZMPA 1R6HA 2I6JA 1OESA 2QDPA 2ZMMA 1C83A 3O5XA 1YGRA 2I4GA 3MOZA 3V0IA 1G7FA 3F81A 1BZJA 2G59A 2A8BA 2VEWA 5GTJA 3QCLA 3V0EA 1NL9A 1RPMA 3F9AA 5BUGA 3D44A 2HNPA 2G6ZA 3S4OA 1NWEA 5K9VA 4WU3A 5K24A 2F6ZA 1OHCA 1I9SA 2CNEA 1NZ7A 3M4UA 4QBWA 1Q1MA 3V0FA 1PA9A 1M3GA 5KA1A 3QCBA 1FQ1A 1U24A 3QCCA 1T48A 3AWGA 2CJZA 2F71A 1PTYA 1X24A 3ZV2A 3SMEA 1PTTA 2I6PA 5KA4A 5KA9A 4NNDA 2DXPA 2QCJA 4QAHA 1FPZA 3QKQA 3EAXA 3NMEA 3O4TA 2GWOA 4JMJA 3EB1A 3MOWA 1XRIA 3QCIA 1G4WR 1XM2A 3QCGA 2A3KA 2I5XA 3V0HA 2VEUA 1YTWA 5BZXA 1C85A 3ZMQA 5KACA 3AWFA 2CM7A 5KA8A 4RI5A 4RDDA 3BLUA 4JMKA 2QBPA 2PT0A 2CMCA 1G1GA 2F6TA 5KA3A 3I80A 1Q6JA 2I6IA 3OMHA 4J51A 2CFVA 2FJNA 1A5YA 1FPRA 1LYVA 2I42A 2BGDA 1Q6SA 4NYHA 1T49A 1RXDA 2F70A 1PYNA 1WAXA 2CM3A 3F9BA 1J4XA 3V0DA 3CM3A 2H4GA 2P6XA 1YN9A 2F46A 4R0TA 1MKPA 2E0TA 2R0BA 3ZM2A 1LQFA 2BIJA 2OZ5A 5K23A 1Q6MA 3O3LA 2NLKA 1XBOA 3A5JA 3QCNA 4QBEA 1GWZA 4GE5A 2H03A 1OEUA 5HDEA 5BZZA 2PBNA 4BJOA 4D3PA 2PI7A 2HC1A 3MMJA 2J16B 2PSZA 2F6YA 3CWEA 4R30A 3QCFA 2OUDA 4H1OA 4HJPA 1NO6A 4OHIA 1KAVA 2Q47A 3D1HA 1G1HA 2QDMA 3EMUA 2FJMA 2B49A 3QCHA 2AZRA 1C86A 1PTUA 2C7SA 4WU2A 4HJQA 2RF6A 5KABA 2QDCA 2BV5A 2CNGA 1JF7A 2P4DA 3RO1A 2CMAA 1U26A 1OEVA 2OC3A 1U25A 4IKCA 3O4UA 2GJTA 3S3FA 4YAAA 4QUMA 4WTYA 3GXGA 1EENA 4DGXA 4DGPA 2M3VA 2FH7A 2CNFA 1T4JA 1D5RA 4KYQA 2PQ5A 4RHGA 2I6OA 3V0JA 4OHHA 4RH5A 2SHPA 2QBQA 3ZM1A 1Q6NA 3H2XA 4H34A 5K25A 4QUNA 1Q6PA 1L8GA 1G4US 1JLNA 3D1OA 1KAKA 3I7ZA 1Q6TA 2BGEA 1ONYA 2CM2A 4OHLA 5MMZB 2HCMA 4S0GA 3BM8A 2ESBA 3I36A 3BRHA 1ECVA 1G7GA 2Y96A 2H02A 4GE6A 4JBCA 3S3EA 1PXHA 3V0GA 4OHEA 1ZC0A 2OOQA 1YTSA 4ICZA 3RGQA 3RGOA 2AHSA 3D9CA 2NV5A 4HRFA 4GRYA 2QBSA 4ERCA 2JJDA 5K22A 5IBSA 4B04A 3N0AA 1YTNA 2H4KA 2NT7A 4OHDA 2HY3A 3F99A 3U96A 5K9WA 5IBMA 3D42A 4BPCA 4D3QA 5J8RA 1C87A 2ZN7A 2HNQA 1L8KA 3QCEA 1QZ0A 5EHPA 4ZI4A 2GP0A 4WOHA 1G1FA 4RI4A 5BX1A 1PH0A 2VEXA 5LXQB 1NWLA 2HXPA 1QXKA 2BZLA 2C46A 4Z6BA 1NNYA 4RKKA 3O4SA 2B4PA 3ZM3A 1C88A 1YFOA 3ZM0A 1PTVA 3QCJA 2B07A 1ZCKA 1I57A 1OETA 1OHEA 2H4VA 2F6WA 4JNBA 2NT2A 2I3UA 4ZN5A 2Y2FA 4Y14A 1YZ4A 2B3OA 4GE2A 5AWXA 3QCDA 2I4HA 4R0SA 1SUGA 3SR9A 1V3AA 1WRMA 3EZZA 4Y2EA 2I75A 2I3RA 3QCKA 1WCHA 4PYHA 4RH9A 3GXHA 4NX8A 4ZRTA 3A5KA 3F41A 2H04A 1BZHA 2VEYA 2Q05A 2HVLA 3QCMA 1OEMX 3RZ2A 4AZ1A 4GRZA 3D1QA 3LJ8A 2PA5A 3S4EA 3QKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YPT A;  2QEP A;  5KA0 A;  2J17 A;  2CMB A;  2I6M A;  3S3K A;  2VEV A;  4GS0 A;  3OLR A;  4YR8 B;  4MBB A;  2F6F A;  5KAD A;  2MBC A;  4GFV A;  2CNH A;  1ONZ A;  1C84 A;  1AAX A;  4PVG A;  2NZ6 A;  2WGP A;  5M43 A;  2NTA A;  1GFY A;  1XXP A;  2QBR A;  1YGU A;  1LAR A;  2HB1 A;  5KA2 A;  4QAP A;  2HC2 A;  1XXV A;  4TVV A;  1P15 A;  2B4U A;  1ZCL A;  2IMG A;  1OEO X;  4NWF A;  4KI9 A;  3B7O A;  4I8N A;  2I4E A;  4D3R A;  5I6V A;  2I1Y A;  3EU0 A;  5EHR A;  3S3H A;  2J16 A;  1YWF A;  4KYR A;  2B4O A;  1BZC A;  1VHR A;  4NWG A;  3BLT A;  2YDU A;  4GWF A;  4GFU A;  5KA7 A;  1ZZW A;  1I9T A;  2CM8 A;  2CNI A;  3PS5 A;  5KAA A;  3AWE A;  1EEO A;  2F6V A;  2B4S A;  1PA1 A;  1OHD A;  2QCT A;  3ZMP A;  1R6H A;  2I6J A;  1OES A;  2QDP A;  2ZMM A;  1C83 A;  3O5X A;  1YGR A;  2I4G A;  3MOZ A;  3V0I A;  1G7F A;  3F81 A;  1BZJ A;  2G59 A;  2A8B A;  2VEW A;  5GTJ A;  3QCL A;  3V0E A;  1NL9 A;  1RPM A;  3F9A A;  5BUG A;  3D44 A;  2HNP A;  2G6Z A;  3S4O A;  1NWE A;  5K9V A;  4WU3 A;  5K24 A;  2F6Z A;  1OHC A;  1I9S A;  2CNE A;  1NZ7 A;  3M4U A;  4QBW A;  1Q1M A;  3V0F A;  1PA9 A;  1M3G A;  5KA1 A;  3QCB A;  1FQ1 A;  1U24 A;  3QCC A;  1T48 A;  3AWG A;  2CJZ A;  2F71 A;  1PTY A;  1X24 A;  3ZV2 A;  3SME A;  1PTT A;  2I6P A;  5KA4 A;  5KA9 A;  4NND A;  2DXP A;  2QCJ A;  4QAH A;  1FPZ A;  3QKQ A;  3EAX A;  3NME A;  3O4T A;  2GWO A;  4JMJ A;  3EB1 A;  3MOW A;  1XRI A;  3QCI A;  1G4W R;  1XM2 A;  3QCG A;  2A3K A;  2I5X A;  3V0H A;  2VEU A;  1YTW A;  5BZX A;  1C85 A;  3ZMQ A;  5KAC A;  3AWF A;  2CM7 A;  5KA8 A;  4RI5 A;  4RDD A;  3BLU A;  4JMK A;  2QBP A;  2PT0 A;  2CMC A;  1G1G A;  2F6T A;  5KA3 A;  3I80 A;  1Q6J A;  2I6I A;  3OMH A;  4J51 A;  2CFV A;  2FJN A;  1A5Y A;  1FPR A;  1LYV A;  2I42 A;  2BGD A;  1Q6S A;  4NYH A;  1T49 A;  1RXD A;  2F70 A;  1PYN A;  1WAX A;  2CM3 A;  3F9B A;  1J4X A;  3V0D A;  3CM3 A;  2H4G A;  2P6X A;  1YN9 A;  2F46 A;  4R0T A;  1MKP A;  2E0T A;  2R0B A;  3ZM2 A;  1LQF A;  2BIJ A;  2OZ5 A;  5K23 A;  1Q6M A;  3O3L A;  2NLK A;  1XBO A;  3A5J A;  3QCN A;  4QBE A;  1GWZ A;  4GE5 A;  2H03 A;  1OEU A;  5HDE A;  5BZZ A;  2PBN A;  4BJO A;  4D3P A;  2PI7 A;  2HC1 A;  3MMJ A;  2J16 B;  2PSZ A;  2F6Y A;  3CWE A;  4R30 A;  3QCF A;  2OUD A;  4H1O A;  4HJP A;  1NO6 A;  4OHI A;  1KAV A;  2Q47 A;  3D1H A;  1G1H A;  2QDM A;  3EMU A;  2FJM A;  2B49 A;  3QCH A;  2AZR A;  1C86 A;  1PTU A;  2C7S A;  4WU2 A;  4HJQ A;  2RF6 A;  5KAB A;  2QDC A;  2BV5 A;  2CNG A;  1JF7 A;  2P4D A;  3RO1 A;  2CMA A;  1U26 A;  1OEV A;  2OC3 A;  1U25 A;  4IKC A;  3O4U A;  2GJT A;  3S3F A;  4YAA A;  4QUM A;  4WTY A;  3GXG A;  1EEN A;  4DGX A;  4DGP A;  2M3V A;  2FH7 A;  2CNF A;  1T4J A;  1D5R A;  4KYQ A;  2PQ5 A;  4RHG A;  2I6O A;  3V0J A;  4OHH A;  4RH5 A;  2SHP A;  2QBQ A;  3ZM1 A;  1Q6N A;  3H2X A;  4H34 A;  5K25 A;  4QUN A;  1Q6P A;  1L8G A;  1G4U S;  1JLN A;  3D1O A;  1KAK A;  3I7Z A;  1Q6T A;  2BGE A;  1ONY A;  2CM2 A;  4OHL A;  5MMZ B;  2HCM A;  4S0G A;  3BM8 A;  2ESB A;  3I36 A;  3BRH A;  1ECV A;  1G7G A;  2Y96 A;  2H02 A;  4GE6 A;  4JBC A;  3S3E A;  1PXH A;  3V0G A;  4OHE A;  1ZC0 A;  2OOQ A;  1YTS A;  4ICZ A;  3RGQ A;  3RGO A;  2AHS A;  3D9C A;  2NV5 A;  4HRF A;  4GRY A;  2QBS A;  4ERC A;  2JJD A;  5K22 A;  5IBS A;  4B04 A;  3N0A A;  1YTN A;  2H4K A;  2NT7 A;  4OHD A;  2HY3 A;  3F99 A;  3U96 A;  5K9W A;  5IBM A;  3D42 A;  4BPC A;  4D3Q A;  5J8R A;  1C87 A;  2ZN7 A;  2HNQ A;  1L8K A;  3QCE A;  1QZ0 A;  5EHP A;  4ZI4 A;  2GP0 A;  4WOH A;  1G1F A;  4RI4 A;  5BX1 A;  1PH0 A;  2VEX A;  5LXQ B;  1NWL A;  2HXP A;  1QXK A;  2BZL A;  2C46 A;  4Z6B A;  1NNY A;  4RKK A;  3O4S A;  2B4P A;  3ZM3 A;  1C88 A;  1YFO A;  3ZM0 A;  1PTV A;  3QCJ A;  2B07 A;  1ZCK A;  1I57 A;  1OET A;  1OHE A;  2H4V A;  2F6W A;  4JNB A;  2NT2 A;  2I3U A;  4ZN5 A;  2Y2F A;  4Y14 A;  1YZ4 A;  2B3O A;  4GE2 A;  5AWX A;  3QCD A;  2I4H A;  4R0S A;  1SUG A;  3SR9 A;  1V3A A;  1WRM A;  3EZZ A;  4Y2E A;  2I75 A;  2I3R A;  3QCK A;  1WCH A;  4PYH A;  4RH9 A;  3GXH A;  4NX8 A;  4ZRT A;  3A5K A;  3F41 A;  2H04 A;  1BZH A;  2VEY A;  2Q05 A;  2HVL A;  3QCM A;  1OEM X;  3RZ2 A;  4AZ1 A;  4GRZ A;  3D1Q A;  3LJ8 A;  2PA5 A;  3S4E A;  3QKP A; 
#chains in the Genus database with same CATH topology
 1YPT A;  2QEP A;  5KA0 A;  2J17 A;  2GC6 A;  2CMB A;  2I6M A;  3S3K A;  2VEV A;  2GCB A;  4GS0 A;  3OLR A;  4YR8 B;  4MBB A;  2F6F A;  3PYZ A;  5KAD A;  2MBC A;  4GFV A;  2CNH A;  1ONZ A;  1C84 A;  1AAX A;  4PVG A;  2UUO A;  2VTE A;  2NZ6 A;  2WGP A;  1J6U A;  5M43 A;  2NTA A;  1GFY A;  1XXP A;  4HV4 A;  2QBR A;  1YGU A;  2VOS A;  4CVM A;  1LAR A;  2HB1 A;  5KA2 A;  1W78 A;  4QAP A;  2HC2 A;  1XXV A;  4TVV A;  1EEH A;  1P15 A;  4C12 A;  1E8C A;  2B4U A;  1ZCL A;  2IMG A;  1OEO X;  4NWF A;  2WTZ A;  4KI9 A;  3B7O A;  4I8N A;  2I4E A;  4D3R A;  4UAG A;  5I6V A;  2I1Y A;  3EU0 A;  5EHR A;  3S3H A;  2J16 A;  1YWF A;  4KYR A;  2B4O A;  1BZC A;  1VHR A;  4NWG A;  3BLT A;  2YDU A;  4GWF A;  4GFU A;  5KA7 A;  1ZZW A;  1I9T A;  2CM8 A;  2CNI A;  3PS5 A;  5KAA A;  3AWE A;  1EEO A;  2F6V A;  2B4S A;  1PA1 A;  1OHD A;  2QCT A;  3ZMP A;  1R6H A;  2I6J A;  1OES A;  2QDP A;  2ZMM A;  1C83 A;  3O5X A;  1YGR A;  2I4G A;  3MOZ A;  3V0I A;  1G7F A;  3F81 A;  3ZM6 A;  1BZJ A;  2G59 A;  2A8B A;  2VEW A;  5GTJ A;  3QCL A;  3V0E A;  3HN7 A;  1NL9 A;  1RPM A;  1W7K A;  2Y67 A;  3F9A A;  5BUG A;  3D44 A;  3N2A A;  2HNP A;  2G6Z A;  3S4O A;  1NWE A;  5K9V A;  4WU3 A;  2Y68 A;  5K24 A;  2F6Z A;  1OHC A;  1I9S A;  2VOR A;  2CNE A;  1NZ7 A;  3M4U A;  4QBW A;  4C13 A;  1Q1M A;  3V0F A;  1PA9 A;  1M3G A;  5KA1 A;  3QCB A;  1FQ1 A;  1U24 A;  3QCC A;  1T48 A;  3AWG A;  2CJZ A;  2F71 A;  2VTD A;  1PTY A;  1X24 A;  3ZV2 A;  3SME A;  1PTT A;  2I6P A;  5KA4 A;  5KA9 A;  4NND A;  2DXP A;  2QCJ A;  4QAH A;  1FPZ A;  3QKQ A;  3EAX A;  3NME A;  3O4T A;  2GWO A;  4JMJ A;  3EB1 A;  3MOW A;  1XRI A;  3QCI A;  1G4W R;  1XM2 A;  3QCG A;  2A3K A;  2I5X A;  3V0H A;  2VEU A;  1P3D A;  1YTW A;  5BZX A;  1C85 A;  3ZMQ A;  4CVL A;  5KAC A;  3AWF A;  2CM7 A;  5KA8 A;  4RI5 A;  4RDD A;  3BLU A;  4JMK A;  1JBW A;  2QBP A;  2PT0 A;  2CMC A;  1G1G A;  1JBV A;  2F6T A;  5KA3 A;  3I80 A;  5A5E A;  1Q6J A;  2I6I A;  3OMH A;  4J51 A;  2CFV A;  2FJN A;  1A5Y A;  1FPR A;  1LYV A;  2I42 A;  2BGD A;  1Q6S A;  4NYH A;  1FGS A;  1T49 A;  1RXD A;  2F70 A;  1PYN A;  1WAX A;  2CM3 A;  3F9B A;  1J4X A;  3V0D A;  3CM3 A;  2H4G A;  2P6X A;  1YN9 A;  2F46 A;  4R0T A;  2AM2 A;  1MKP A;  2E0T A;  2R0B A;  3ZM5 A;  3ZM2 A;  1LQF A;  2BIJ A;  2OZ5 A;  5K23 A;  1Q6M A;  3O3L A;  2NLK A;  1XBO A;  3A5J A;  3QCN A;  4QBE A;  1GWZ A;  2Y1O A;  4GE5 A;  2H03 A;  1OEU A;  5HDE A;  5BZZ A;  2PBN A;  4BJO A;  4D3P A;  3NRS A;  3ZL8 A;  2PI7 A;  2HC1 A;  3MMJ A;  2J16 B;  2PSZ A;  2F6Y A;  3CWE A;  4R30 A;  3QCF A;  2OUD A;  4H1O A;  4HJP A;  1NO6 A;  4OHI A;  1KAV A;  2Q47 A;  4QF5 A;  3D1H A;  1G1H A;  2QDM A;  3EMU A;  2FJM A;  2B49 A;  3QCH A;  2AZR A;  1GG4 A;  1C86 A;  1PTU A;  2C7S A;  4WU2 A;  4HJQ A;  2RF6 A;  5KAB A;  2QDC A;  2BV5 A;  2CNG A;  1JF7 A;  2P4D A;  3RO1 A;  2CMA A;  1U26 A;  1OEV A;  2OC3 A;  1U25 A;  4IKC A;  3O4U A;  2GJT A;  3S3F A;  4YAA A;  4QUM A;  4WTY A;  1UAG A;  2UAG A;  2XPC A;  3GXG A;  1EEN A;  4DGX A;  4DGP A;  2M3V A;  2FH7 A;  2CNF A;  1T4J A;  1D5R A;  4KYQ A;  2PQ5 A;  4RHG A;  2I6O A;  3V0J A;  4OHH A;  4RH5 A;  2SHP A;  2QBQ A;  3ZM1 A;  1Q6N A;  3H2X A;  4H34 A;  5K25 A;  4QUN A;  1Q6P A;  1L8G A;  2GC5 A;  1G4U S;  1JLN A;  3D1O A;  1KAK A;  3I7Z A;  1Q6T A;  2BGE A;  1ONY A;  2CM2 A;  3UAG A;  4OHL A;  4BUB A;  5MMZ B;  2HCM A;  4S0G A;  3MVN A;  3BM8 A;  2ESB A;  3I36 A;  3BRH A;  1ECV A;  2GCA A;  1G7G A;  2Y96 A;  1GQY A;  2JFF A;  2H02 A;  4GE6 A;  4JBC A;  3S3E A;  2X5O A;  1PXH A;  3V0G A;  4OHE A;  1ZC0 A;  2OOQ A;  1YTS A;  4ICZ A;  3RGQ A;  3RGO A;  2AHS A;  3D9C A;  2NV5 A;  4HRF A;  4GRY A;  2QBS A;  4ERC A;  2JJD A;  5K22 A;  2UUP A;  5IBS A;  4B04 A;  2Y66 A;  3N0A A;  1YTN A;  2H4K A;  2NT7 A;  4OHD A;  4ZIY A;  2HY3 A;  2XJA A;  3F99 A;  3U96 A;  5K9W A;  5IBM A;  3D42 A;  4BPC A;  4D3Q A;  4BUC A;  5J8R A;  1P31 A;  1C87 A;  2ZN7 A;  2HNQ A;  1L8K A;  3QCE A;  1QZ0 A;  5EHP A;  4ZI4 A;  2GP0 A;  4WOH A;  1G1F A;  4RI4 A;  5BX1 A;  1PH0 A;  2VEX A;  4QDI A;  2JFH A;  5LXQ B;  1NWL A;  1E0D A;  2HXP A;  1QXK A;  1GQQ A;  2BZL A;  2C46 A;  4Z6B A;  1NNY A;  4RKK A;  3O4S A;  2B4P A;  3ZM3 A;  1C88 A;  1YFO A;  3ZM0 A;  1PTV A;  3QCJ A;  2B07 A;  1ZCK A;  1I57 A;  1OET A;  1OHE A;  2H4V A;  2F6W A;  4JNB A;  2JFG A;  2NT2 A;  2I3U A;  4ZN5 A;  2Y2F A;  4Y14 A;  2AM1 A;  1YZ4 A;  2B3O A;  4GE2 A;  5AWX A;  3QCD A;  2WJP A;  2I4H A;  4R0S A;  1SUG A;  3SR9 A;  3LK7 A;  1V3A A;  1WRM A;  3QCZ A;  3EZZ A;  4Y2E A;  1O5Z A;  2I75 A;  2I3R A;  3QCK A;  1WCH A;  4CVK A;  4PYH A;  4RH9 A;  5A5F A;  3GXH A;  4NX8 A;  4ZRT A;  3A5K A;  3F41 A;  2H04 A;  1BZH A;  2VEY A;  2Q05 A;  2HVL A;  3QCM A;  1OEM X;  3RZ2 A;  4AZ1 A;  4GRZ A;  3D1Q A;  2F00 A;  3LJ8 A;  2PA5 A;  3S4E A;  3QKP A; 
#chains in the Genus database with same CATH homology
 1YPT A;  2QEP A;  5KA0 A;  2J17 A;  2CMB A;  2I6M A;  3S3K A;  2VEV A;  4GS0 A;  3OLR A;  4YR8 B;  4MBB A;  2F6F A;  5KAD A;  2MBC A;  4GFV A;  2CNH A;  1ONZ A;  1C84 A;  1AAX A;  4PVG A;  2NZ6 A;  2WGP A;  5M43 A;  2NTA A;  1GFY A;  1XXP A;  2QBR A;  1YGU A;  1LAR A;  2HB1 A;  5KA2 A;  4QAP A;  2HC2 A;  1XXV A;  4TVV A;  1P15 A;  2B4U A;  1ZCL A;  2IMG A;  1OEO X;  4NWF A;  4KI9 A;  3B7O A;  4I8N A;  2I4E A;  4D3R A;  5I6V A;  2I1Y A;  3EU0 A;  5EHR A;  3S3H A;  2J16 A;  1YWF A;  4KYR A;  2B4O A;  1BZC A;  1VHR A;  4NWG A;  3BLT A;  2YDU A;  4GWF A;  4GFU A;  5KA7 A;  1ZZW A;  1I9T A;  2CM8 A;  2CNI A;  3PS5 A;  5KAA A;  3AWE A;  1EEO A;  2F6V A;  2B4S A;  1PA1 A;  1OHD A;  2QCT A;  3ZMP A;  1R6H A;  2I6J A;  1OES A;  2QDP A;  2ZMM A;  1C83 A;  3O5X A;  1YGR A;  2I4G A;  3MOZ A;  3V0I A;  1G7F A;  3F81 A;  1BZJ A;  2G59 A;  2A8B A;  2VEW A;  5GTJ A;  3QCL A;  3V0E A;  1NL9 A;  1RPM A;  3F9A A;  5BUG A;  3D44 A;  2HNP A;  2G6Z A;  3S4O A;  1NWE A;  5K9V A;  4WU3 A;  5K24 A;  2F6Z A;  1OHC A;  1I9S A;  2CNE A;  1NZ7 A;  3M4U A;  4QBW A;  1Q1M A;  3V0F A;  1PA9 A;  1M3G A;  5KA1 A;  3QCB A;  1FQ1 A;  1U24 A;  3QCC A;  1T48 A;  3AWG A;  2CJZ A;  2F71 A;  1PTY A;  1X24 A;  3ZV2 A;  3SME A;  1PTT A;  2I6P A;  5KA4 A;  5KA9 A;  4NND A;  2DXP A;  2QCJ A;  4QAH A;  1FPZ A;  3QKQ A;  3EAX A;  3NME A;  3O4T A;  2GWO A;  4JMJ A;  3EB1 A;  3MOW A;  1XRI A;  3QCI A;  1G4W R;  1XM2 A;  3QCG A;  2A3K A;  2I5X A;  3V0H A;  2VEU A;  1YTW A;  5BZX A;  1C85 A;  3ZMQ A;  5KAC A;  3AWF A;  2CM7 A;  5KA8 A;  4RI5 A;  4RDD A;  3BLU A;  4JMK A;  2QBP A;  2PT0 A;  2CMC A;  1G1G A;  2F6T A;  5KA3 A;  3I80 A;  1Q6J A;  2I6I A;  3OMH A;  4J51 A;  2CFV A;  2FJN A;  1A5Y A;  1FPR A;  1LYV A;  2I42 A;  2BGD A;  1Q6S A;  4NYH A;  1T49 A;  1RXD A;  2F70 A;  1PYN A;  1WAX A;  2CM3 A;  3F9B A;  1J4X A;  3V0D A;  3CM3 A;  2H4G A;  2P6X A;  1YN9 A;  2F46 A;  4R0T A;  1MKP A;  2E0T A;  2R0B A;  3ZM2 A;  1LQF A;  2BIJ A;  2OZ5 A;  5K23 A;  1Q6M A;  3O3L A;  2NLK A;  1XBO A;  3A5J A;  3QCN A;  4QBE A;  1GWZ A;  4GE5 A;  2H03 A;  1OEU A;  5HDE A;  5BZZ A;  2PBN A;  4BJO A;  4D3P A;  2PI7 A;  2HC1 A;  3MMJ A;  2J16 B;  2PSZ A;  2F6Y A;  3CWE A;  4R30 A;  3QCF A;  2OUD A;  4H1O A;  4HJP A;  1NO6 A;  4OHI A;  1KAV A;  2Q47 A;  3D1H A;  1G1H A;  2QDM A;  3EMU A;  2FJM A;  2B49 A;  3QCH A;  2AZR A;  1C86 A;  1PTU A;  2C7S A;  4WU2 A;  4HJQ A;  2RF6 A;  5KAB A;  2QDC A;  2BV5 A;  2CNG A;  1JF7 A;  2P4D A;  3RO1 A;  2CMA A;  1U26 A;  1OEV A;  2OC3 A;  1U25 A;  4IKC A;  3O4U A;  2GJT A;  3S3F A;  4YAA A;  4QUM A;  4WTY A;  3GXG A;  1EEN A;  4DGX A;  4DGP A;  2M3V A;  2FH7 A;  2CNF A;  1T4J A;  1D5R A;  4KYQ A;  2PQ5 A;  4RHG A;  2I6O A;  3V0J A;  4OHH A;  4RH5 A;  2SHP A;  2QBQ A;  3ZM1 A;  1Q6N A;  3H2X A;  4H34 A;  5K25 A;  4QUN A;  1Q6P A;  1L8G A;  1G4U S;  1JLN A;  3D1O A;  1KAK A;  3I7Z A;  1Q6T A;  2BGE A;  1ONY A;  2CM2 A;  4OHL A;  5MMZ B;  2HCM A;  4S0G A;  3BM8 A;  2ESB A;  3I36 A;  3BRH A;  1ECV A;  1G7G A;  2Y96 A;  2H02 A;  4GE6 A;  4JBC A;  3S3E A;  1PXH A;  3V0G A;  4OHE A;  1ZC0 A;  2OOQ A;  1YTS A;  4ICZ A;  3RGQ A;  3RGO A;  2AHS A;  3D9C A;  2NV5 A;  4HRF A;  4GRY A;  2QBS A;  4ERC A;  2JJD A;  5K22 A;  5IBS A;  4B04 A;  3N0A A;  1YTN A;  2H4K A;  2NT7 A;  4OHD A;  2HY3 A;  3F99 A;  3U96 A;  5K9W A;  5IBM A;  3D42 A;  4BPC A;  4D3Q A;  5J8R A;  1C87 A;  2ZN7 A;  2HNQ A;  1L8K A;  3QCE A;  1QZ0 A;  5EHP A;  4ZI4 A;  2GP0 A;  4WOH A;  1G1F A;  4RI4 A;  5BX1 A;  1PH0 A;  2VEX A;  5LXQ B;  1NWL A;  2HXP A;  1QXK A;  2BZL A;  2C46 A;  4Z6B A;  1NNY A;  4RKK A;  3O4S A;  2B4P A;  3ZM3 A;  1C88 A;  1YFO A;  3ZM0 A;  1PTV A;  3QCJ A;  2B07 A;  1ZCK A;  1I57 A;  1OET A;  1OHE A;  2H4V A;  2F6W A;  4JNB A;  2NT2 A;  2I3U A;  4ZN5 A;  2Y2F A;  4Y14 A;  1YZ4 A;  2B3O A;  4GE2 A;  5AWX A;  3QCD A;  2I4H A;  4R0S A;  1SUG A;  3SR9 A;  1V3A A;  1WRM A;  3EZZ A;  4Y2E A;  2I75 A;  2I3R A;  3QCK A;  1WCH A;  4PYH A;  4RH9 A;  3GXH A;  4NX8 A;  4ZRT A;  3A5K A;  3F41 A;  2H04 A;  1BZH A;  2VEY A;  2Q05 A;  2HVL A;  3QCM A;  1OEM X;  3RZ2 A;  4AZ1 A;  4GRZ A;  3D1Q A;  3LJ8 A;  2PA5 A;  3S4E A;  3QKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...