4RI6A

Crystal structure of poplar glutathione transferase f1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
214
structure length
214
Chain Sequence
ATPVTIYGPPLSTAVSRVLATLIEKDVPFHLIPIDLSKGEQKKPEYLKIQPFGQVPAFKDESITLFESRAICRYICDKYADKGNKSLYGTDILSKANIDQWVETDGQTFGPPSGDLVHDLLFSSVPVDEALIKKNVDKLAKVLDIYEQKLGQTRFLAGDEFSFADLSHLPNGDYLVNSTDKGYLFTSRKNVNRWWTEISNRESWKKVLEMRKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phi class glutathione transferase GSTF1
publication title The poplar Phi class glutathione transferase: expression, activity and structure of GSTF1.
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
molecule tags Transferase
total genus 80
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ri6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ri6A01
2E0QA 4I5QA 6GSYA 3F4RA 3WT2A 4K2DA 5CRGA 4EE0A 2L4CA 2I1UA 1TRSA 3IXRA 3C1RA 2GQKA 5F0GA 2R4VA 4IQAA 16GSA 4KSOA 3TRXA 1HD2A 1WRYA 2FA4A 2VM2A 1GH2A 3VPQA 3QPMA 4FO5A 3IHQA 2XBIA 2P0GA 1SJZA 3LXZA 1QQ2A 2CVDA 2CX3A 4MJAA 3KJYA 2L59A 3GURA 2YWIA 3SWLA 1WE0A 4J56E 4DSSB 1MDKA 3QAWA 2GLRA 3LQ7A 3FR9A 3LXTA 1YF0A 2H0GA 2VCVA 3GL3A 1T7PB 3MNGA 2VIMA 3A2WA 5ECRB 2C0FA 2J23A 4PQ1A 4G19A 3KD0A 4FYUA 2H70A 1GULA 5J41A 4KE3A 4XRDA 4G10A 1WJKA 4WF4A 1PX7A 1TW9A 4KDYA 3TB2A 4P3YB 2C3NA 3DXBA 1A0RP 3RHCA 4F9ZA 1A0FA 1BEDA 2VL9A 2OACA 3CBUA 1GSFA 2NTOA 4RUVA 2H30A 1T8EB 2VL3A 1AIUA 3F6DA 1QFNA 1DBYA 4LLRA 4WR4A 3HVVA 2K8SA 1TK0B 4HZ4A 3TJFA 4G0KA 4V1Ap 2A2SA 2GSSA 1O8WA 1K0OA 4MH2A 3GHAA 1R26A 2R3XA 2NDOA 3F9UA 1U87A 2GZZA 2YPMA 4EF0A 2MZCA 2CZ2A 4TXOA 3KMNA 1Z6MA 4FH8A 1EP7A 5HR2A 5GSSA 3U6VA 3DVXA 2CVBA 2LTKA 5IMFA 4IJIA 5ECMB 3Q19A 2KOKA 3GN3A 5IQYA 4OMVA 2YANA 4HQZA 6GSWA 3IRAA 4IGJA 3UAPA 2V6KA 1A2LA 1XCCA 4G2EA 4BVYA 2P31A 1EOHA 4IVFA 1UVZA 2VCZA 5DALB 1U3AA 5HR1A 4MJCA 4KB3A 2YV9A 1FAAA 1F6MC 1GNEA 1F3BA 2EC4A 18GSA 5ENUA 4L5LA 3UVTA 4G0LA 3ZVJD 4ECJA 4DSSA 4IELA 5ECLB 5G1LA 1XPVA 2FHEA 3RDWA 2ON7A 2PWJA 5DBQA 4NWYA 3DIEA 1GTUA 5AIVA 4ZB9A 5ELAA 4OO5A 1EP8A 1XW9A 1BYEA 3ZITA 2EIQA 6GSTA 4LL1B 3UVHA 3FZ4A 2VLVA 2DBCA 2VAFA 2HZEA 3HZ4A 1V58A 5HQPA 3D4MA 3CYNA 3Q6OA 1QUWA 4ZL9A 2R6KA 2DC5A 4D73A 1A8LA 3EINA 2PVQA 5B7CA 1URMA 2YJ7A 2H1AA 1G6YA 2QSIA 4X1UA 1HNBA 4HDEA 5DJLA 3H8QA 1GLPA 5G2ZA 2B1KA 1ZL9A 5EY6A 1PKWA 2H66A 2O85A 4XCSA 2GGTA 1ZZYA 4HJ2A 2DJ0A 1OC9A 3GSSA 3M1GA 4O7HA 5LD0A 3A3TA 5ECIB 3ERFA 1KTEA 4POLA 4OCEA 3O6TA 2NVLA 2ES7A 1PQNA 4MF7A 2DJ1A 4V2LA 2GZPA 4ZBBA 3HVXA 3HDCA 4X43A 2F9SA 4ML1A 3GV1A 2PUKC 1B8XA 5CAXA 1XFLA 1R5PA 3KXOA 1VF1A 1V57A 1I5GA 4CHSA 2ON5A 5ID2B 4XHMA 3WD6A 3G9BA 3CTFA 3ED3A 5KEJA 1YEPA 5DVBA 1XWBA 3LFLA 1DSBA 4WKWA 2H75A 2DJ2A 2O8VB 4DVCA 4JBBA 2MMZA 4MABA 4OCFA 2LQOA 2XBQA 3N5OA 4AF2A 3KP9A 2WGRA 4F03A 2HE3A 3PH9A 1SK0A 2H1DA 2A4VA 3IK7A 2DMMA 2CAQA 4EUYA 5IMVA 2AHEA 1O6JA 5GAND 4K0GA 1YEXA 1VF3A 1TU8A 2GQLA 3C71A 3E3EA 3DEXA 2XPEA 1SD9A 5J5NA 2HLSA 1RQMA 3M8NA 2H01A 1SKSB 4KSMA 4ML6A 1RW1A 1T4ZA 5GAPD 2MBTA 1EEJA 4KW6A 3ZZXA 2VM1A 4EVMA 1U6TA 1GSDA 1O85A 4N0VA 5H5QA 3CXGA 2RUEA 1PX6A 4I97A 3KTBA 4KDUA 2IPAA 3HCZA 4WR5A 2YWMA 5D9TA 3QOUA 2OKAA 5GZZB 2VL2C 1XOAA 3TJKA 2L5LA 4XS1A 4TR4A 1XIYA 4OFTA 5G1KA 1O8XA 3HJPA 3TJBA 4OO4A 4WBRD 3CSHA 2IIYA 3GX8A 4ZILA 2LJKA 4NHWA 5DCGA 4AJ8A 2KUCA 3EURA 3I9V2 1JZWA 4DSRA 1FVKA 2C0EA 2JL4A 4GLTA 2VL2A 2YN1A 3IBHA 3GNJA 1GLQA 3ZYWA 1XOBA 3ZIJA 4ISDA 3MSZA 5CNWA 2LRCA 3J7Yb 4JR4A 1YKAA 1XWKA 3TJJA 4MZWA 2H0HA 2LJAA 1T1VA 5J4UA 2RUFA 2O7KA 1E6BA 2D2ZA 4QQ7A 4HQSA 4GSNA 4I2UA 1GL8A 3MDKA 3PGTA 2B1LA 5ID2A 4NMUA 2DIYA 4LMVA 1SL0B 3GUSA 4IW9A 19GSA 4E8EA 1V2AA 3QAVA 1HQOA 1OVNA 5LNKe 3C7MA 4BL7B 1V9WA 4GQCA 4TR0A 4AGSA 1M9BA 3F6FA 2WCIA 2LS5A 4MDCA 3DWVA 2IN3A 3VWWA 3S9FA 2IMFA 4EDZA 4IJ3A 4KX4A 3L9VA 3VLNA 4V1Ag 1HYUA 4L0UA 1DUGA 3HKRA 4XS4A 1PSQA 1JZRA 3NIVA 1WPIA 3PINA 2REMA 1X5CA 1KEBA 3WGXA 3M3MA 3APOA 4BVXA 3KCMA 1F3AA 2I3YA 3P7XA 1U3IA 4PQIA 4NPBA 1M2DA 4TKYA 1DE2A 5BMUA 2B7JA 2XHFA 2PERA 5DAKA 2GQMA 1OE7A 3A5WA 1FHEA 1TTZA 2X8HA 4FYCA 4JU5A 2HFDA 2K6VA 4TR3A 2DSAA 2O89A 1A24A 3KH7A 1G0TA 1QGVA 3ZRDA 4IP6A 3GRXA 2B5YA 5DQYA 4JZQA 1K0BA 2FWEA 1EGOA 2X99A 4F2IA 4TW5A 4TR1B 3ZL5A 3Q18A 4BVYB 3EYTA 2O87A 4YAPA 2VLTA 2EIOA 1B4PA 4HJMA 2N5BA 4IHUA 4YH2A 3TKPA 1Z6NA 3HVSA 1MTCA 3P90A 1ZOFA 3FR6A 2I81A 4KCAA 3TJGA 2DJ3A 1LJRA 4J2FA 2V6OA 3G7YA 2CQ9A 2TIRA 2YNXA 1K3YA 3PPUA 3CTGA 2YZUA 2V2GA 2B7KA 2P5QA 1ERVA 3QR6A 5KN1A 1X5DA 3WYWA 1XBSA 3GFKA 2H19A 1GUKA 2N5AA 2HYXA 5FWGA 4WF5A 4KF9A 3F4SA 2WS2A 4YQVA 2K8VA 4BL7A 1N8JA 3FZAA 3L9SA 2AJQB 1B9YC 2QC7A 3GSTA 14GSA 2VD1A 2HZEB 3QFBC 4Q5FA 4MZCA 5ECHB 1Z7PA 4PUAA 4D73B 3Q74A 4N11A 1K0DA 2HRKA 4Z7XA 4KH7A 1PL2A 1VF4A 4ECBA 5IOXA 3FKFA 1XW6A 4IP1A 5HR0A 1T3BA 2C0DA 1PN9A 1G7OA 3RHBA 3KH9A 1ST9A 1ON4A 3TKSC 13GSA 2M46A 4AJ7A 3LEFA 3QD9A 5EVOA 1OC9B 3D22A 3NZNA 4BPYA 2IJYA 4Q5NA 3QFAC 2DIZA 1J08A 1GSYA 2BMXA 4K6XA 4HEA2 3TKSA 1TI3A 2MMOA 1W89A 2IMKA 1X0RA 3EMPA 5H5SA 8GSSA 5HR3A 3APQA 4PTSA 2OA7A 3AY8A 4ECCA 2MMAA 1BAYA 2WJUA 4USSA 3W6GA 5G5EA 4DEJA 3HHVA 4TR1A 4HI7A 1FB0A 1ZCPA 5G31A 4FQUA 1K0CA 1KBNA 2FD3A 2AUVA 1FG4A 1AW9A 5ECSA 3UIWA 3TOTA 2FWGA 2OJLA 1T4YA 4V2NA 3L9UA 4ILFA 1ERTA 1M9AA 3DRNA 2PMTA 1UC7A 3LWAA 2WDUA 4ID0A 2KHPA 2H6YA 2RIIA 1XWGA 2HRAA 1FW1A 3TKQA 1UN2A 10GSA 4L5OA 5J3RA 1SJIA 1O81A 5KN2A 2LRNA 4PX1A 4WBJA 2HRFA 2FA8A 2GT5A 4K0NA 2H6ZA 2IMEA 1AAZA 3FYGA 3ZMKA 3HJOA 4NXIA 3HZ8A 4G0IA 4QL7A 2FUG2 2TRXA 2WULA 4XRAA 4HU7A 5C00A 1K0AA 2X64A 3M0FA 3EMXA 4K7IA 3DGQA 1OYJA 3FHKA 4PXOA 3GKMA 2WB9A 3QCPA 5IOWA 4KNDA 2V41A 4GCIA 3O76A 1XW5A 2OBIA 3EWLA 2LNTA 4HU9A 1SYXA 3BOAA 4NHZA 1F37A 1DE1A 1JZOA 3KM6A 1AC1A 1WIKA 2VLUA 4TXVA 4BWQA 1TK5B 1Z3EA 2AYTA 2YWNA 5C04A 5G5FA 2C4JA 2FWFA 3ME8A 5CREA 2FCHA 3GKXA 3D0ZA 3D6IA 1AQVA 4KAEA 3FY7A 3GA4A 3PR8A 1GSSA 4Q5RA 6GSSA 4K7OA 4TRXA 1JHBA 1JFUA 2HRNA 2LSTA 4MH3A 1Z9HA 3KTLA 3D4TA 11GSA 3VPTA 1PRXA 5JCUA 2XC2A 1Q4JA 4WEYA 1S3AA 3RBTA 4MCUA 2GSRA 1B9XC 1QMVA 2RLIA 1RK4A 3C8EA 4PGTA 3APSA 3LGCA 1JZDA 1OKTA 4EKZA 1ZMAA 5D93A 1TRUA 2YV7A 4I8BA 3HA9A 4NV5A 2QGVA 2OE1A 2VUPA 2AV4A 3VI5A 2M72A 1M0UA 22GSA 3C73A 2E7PA 4LMWA 4MPGA 5DQSA 2JZSA 5E4WA 2NBSA 1K3OA 4ZBAA 4HS1A 4XS4B 5IMZA 1K0MA 3BD2A 3ERWA 5J9CA 1LBKA 4ACSA 4EXJA 1EOGA 2IFQA 4BVXB 5HFIA 2XPDA 1EV4A 3ZLPA 4IS0A 1Y25A 1YKCA 1GTIA 2YWOA 1OAZA 1USBA 5DAKB 2L6DA 1SKRB 1QXHA 4I6XA 4AJ6A 3EVIA 4GRFA 4POBA 2QKEA 3F3RA 2WRTA 20GSA 1PGTA 4MLYA 4N30A 1Q98A 1Y6EA 1NW2A 4ZB6A 2X8GA 4POKA 3VWVA 5D8IA 5G30A 2LEGA 2IMDA 1ZYQB 1NSWA 4IN0A 3R2QA 1GRXA 3FR3A 1ILOA 3H1NA 2HT9A 2L6CA 4DSQA 4YAVA 3IC8A 5DDLA 4K8MA 5J9BA 1M99A 3C1SA 1VF2A 1GP1A 3ZREA 1GTBA 3FW2A 3MWHA 1ACVA 1YDKA 3IC4A 5F06A 1AUCA 4MF6A 2FNOA 2C8UA 5EPFA 1TRWA 2IMIA 5IPHA 3IA1A 4FYBA 2GVPA 5B8BA 3HYPA 2VD0A 4XS6A 5F05A 3QAGA 3KGKA 3F63A 5F07A 1TI1A 1GUMA 3W8JA 5B6MA 1GUHA 3UEMA 2HI7A 5IIZA 1SENA 2JSYA 2K18A 2MMNA 2YZHA 4G9HA 3CRUA 2LRTA 1TRVA 2E2GA 1TXXA 5JCGA 1IYIA 1WOUA 4WXTA 5ECKB 3F8UA 3US3A 2HRKB 1MDJA 1BX9A 2C0GA 4HZ2A 7GSSA 4NV2A 2KLXA 1M2BA 2VCQA 4RI6A 3GH9A 4L8EA 3G7IA 1R4WA 3KIJA 1H4OA 1GNWA 2R5GA 2PBJA 3HY2A 1SJ6A 1OC3A 2LQQA 4JE1A 2YCDA 1V40A 4K9ZA 4RQRA 4L0WA 5CO3A 3R3EA 1R5AA 2JSZA 3VWUA 2PVOC 2R2JA 1F2EA 3FZ9A 3SBCA 12GSA 1TOFA 2F8AA 4OD7A 4K7NA 4BWSA 2OADA 5A4WA 3IR4A 2GTUA 2YJHA 1XWCA 2JZTA 5KN3A 2HSMB 6GSUA 3TKRA 3I69A 2JADA 4NAXA 1SL2B 3KP8A 3DD3A 4RI7A 2R37A 1MD4A 1BQ7A 1FVJA 5D73A 4F82A 3ME7A 4KA0A 4PUFC 1A23A 4ULXA 1S3DA 3UJ1A 3EE2A 1PD21 3UBLA 4TOPA 2WFCA 9GSSA 1TU7A 4O5RA 5JWQB 3ZFLA 4JEDA 3H4KA 3G7JA 3VWXA 4MJEA 4XTSA 2PU9C 5ELGA 3UBKA 3CRTA 4MPFA 3JCML 3UL3A 3FK8A 3F4TA 5IO0A 2GSTA 5IMAA 1WWJA 1ERWA 2K9FA 2DLXA 1EZKA 2FLSA 3E0UA 4IQ1A 5D9XA 2P5RA 2ALBA 2H8LA 2IL3A 2H1BA 4OFNA 4J57E 4OWYA 5LCZA 1XVWA 3VURA 1YY7A 4CDOA 3LYPA 5EL8A 2CX4A 1KNGA 2M80A 1O7UA 4EC0A 3LYKA 2L4QA 1OC8A 2G2QA 5F8BA 3KZQA 4K1FA 1XVQA 3TDGA 1GSQA 1HNAA 3F0IA 2Z9SA 3RPPA 4O32A 4CW9A 5D9VA 1JLVA 2ZNMA 3LG6A 3ISOA 1NM3A 3HJMA 1J0FA 2HNLA 1WP0A 3GKKA 3ZTLA 1Z7RA 3L0HA 4GSSA 3I6AA 3DVWA 3GH6A 2VCWA 3LORA 3D21A 1U88A 3GTUA 1BG5A 4YQMA 1QK8A 2V32A 5L71A 1X9MB 5ECNB 2GT6A 2FWHA 4F0BA 2F3MA 3TRPA 4IKHA 3UMAA 4PURA 4I2TA 4EDYA 2HQTA 1Z5YE 4Q5QA 4KGIA 1PMTA 1N2AA 3DKSA 2HSMA 4XIHA 3TRQA 2C80A 5CP1A 2H76A 4YQUA 4GQFA 5IMCA 2OE3A 1O73A 5H5RA 2GDRA 1EV9A 2ZCTA 3J7Yk 5IM9A 3UARA 3O3TA 3L78A 3FRCA 4HUAA 4LA1A 3IAM2 1TJDA 5INYA 5AIXA 2H74A 1SYRA 3EC3A 5CRWA 3ZMLA 3QMXA 2VO4A 2GZYA 2G0FA 4N0ZA 2IWTA 1X5EA 3EU4A 2MBSA 2EIRA 3E9JB 1SL1B 5CYYA 2LUSA 3A2VA 2AB6A 2VCTA 2UZ8A 1GSUA 1K0NA 5GSTA 3ERGA 1OKDA 1FB6A 1F9MA 1NHYA 2IFQB 1UA5A 3P8WA 1BJXA 1NHOA 1PL1A 3BCIA 4TN8A 5DCHA 4EL1A 3I43A 1PKZA 4FIWA 3IDVA 3GL5A 3U5RE 2BTOT 4JR6A 5CRHA 3L4NA 2I4AA 2J9HA 4GF0A 1G6WA 2L5OA 3LJRA 1V98A 5B6NA 5A4UA 1W4VA 4E8HA 4KCEA 4RQXA 1THXA 4TVEA 3TCOA 5JCWA 2CZ3A 4MJBA 5A5KA 1ABAA 4MK3A 1YJ6A 4WETA 2C3QA 4ZIJA 2B6MA 1TDIA 2TRCP 1G7EA 2B3SA 1PA3A 3GIXA 5D96A 5AN1A 2HSYA 1S3CA 6GSVA 2RM5A 1TKDB 1CQGA 1VRSD 5DJMA 2B5EA 3CSIA 2V1MA 3QDNA 1TK8B 2H72A 5HFKA 4PNFA 3RAZA 3LSZA 1M7TA 2HSNB 5IPGA 2MYGA 2OE0A 1TP9A 1VGLA 2CA8A 1GWCA 2CAIA 1OE8A 3MAKA 1AQXA 1J9BA 5ECOB 4LL4B 3M9KA 2LV3A 3VFIA 2X8CA 3OR5A 17GSA 1AQWA 2CVKA 3DYRA 3CSJA 4MZBA 3WGEA 3TKSE 1JLWA 4ZB8A 2KP2A 5DALA 1R7HA 3VI7A 4GSTA 1FOVA 3W8SA 5ECQB 3IV4A 1ZYEA 1B48A 4PQHA 4ZBDA 5KN0A 2H1GA 1CQHA 4JRRA 1ZGNA 2LNSA 5IO2A 4BA7A 1YZXA 3ZFBA 1XXUA 4KUNA 3GMFA 3GX0A 4QL9A 2F51A 5FHIA 2CV4A 1EWXA 3HXSA 2LJRA 1A8YA 1SK1A 1LU4A 1SU9A 2LKUA 2AAWA 1EEMA 4V2MA 5JWRB 4GXZA 3IAS2 3KEBA 3ZVJA 4F0CA 1K3LA 3TOUA 3M9JA 2PN8A 2BJXA 2RM6A 4O92A 3IOSA 5JWOB 3NOFA 2H71A 2HSHA 5D9WA 2B5XA 1ERUA 1IYHA 1SK2A 5A4VA 1FO5A 2PPTA 2FGXA 1XWAA 2VCXA 2OBKA 1A2JA 5ABRA 2L57A 2HZFA 2JU5A 2VOCA 2PGTA 1SKWB 2KP1A 4ZXGA 3TUEA 5CRDA 1THOA 1B4QA 3H79A 1GSEA 2H73A 5E59A 1MD3A 3IPZA 2GSQA 5FT3A 3RPNA 3DMLA 2DJKA 1H75A 1T00A 4MP4A 1MDIA 2F8FA 3VK9A 4MF5A 4HOJA 2YP6A 2DMLA 4ZL8A 2FY6A 1MEKA 1GTAA 2C3TA 3WGDA 3IE3A 1EGRA 2CT6A 5COHA 5B8AA 1YF1A 4N10A 1I9DA 3WT1A 1X9WB 4IBPA 1XZOA 1ML6A 2JACA 3BJ5A 3TGZA 3H93A 1X9SB 2NPBA 1YQ1A 3FZ5A 1AXDA 3UOMA 2I9HA 2DJJA 5ECPB 3CMIA 3IK9A 4X0XA 4EO3A 2C1YA 3A2XA 3FEUA 3EU3A 2H6XA 3N9JA 1M2AA 5AISA 3GTUB 3BBYA 6GSXA 4H86A 3V1WA 2H0IA 4POMA 2YOIA 1C72A 3BCKA 4GWRA 1A2MA 2E2MA 3P2AA 3GYKA 4MMMA 2WZ9A 3KMOA 4KDXA 5AGYA 2ZUPA 2GS3A 4OFMA 5HFGA 1HNCA 1SD8A 1WMJA 3K8NA 2N5FA 3GKNA 4ZL7A 3F3QA 3HD5A 4PNGA 4ECIA 4MA9A 2A2RA 4GTUA 2HXKA 3D5JA 2JZRA 4TXOB 5IMDA 3ZIVA 1E2YA
chains in the Genus database with same CATH superfamily
2E0QA 4I5QA 6GSYA 3F4RA 3WT2A 4K2DA 5CRGA 4EE0A 2L4CA 2I1UA 1TRSA 3IXRA 3C1RA 2GQKA 5F0GA 2R4VA 4IQAA 16GSA 4KSOA 3TRXA 1HD2A 1WRYA 3RGBC 2FA4A 2VM2A 1GH2A 3VPQA 3QPMA 4FO5A 3IHQA 2XBIA 2P0GA 1SJZA 3LXZA 1QQ2A 2CVDA 2CX3A 4MJAA 3KJYA 2L59A 3GURA 2YWIA 3SWLA 1WE0A 4J56E 5J47A 4DSSB 1MDKA 1YEWC 3QAWA 2GLRA 1Y1UA 3LQ7A 3FR9A 3LXTA 1YF0A 2H0GA 2VCVA 3GL3A 1T7PB 3MNGA 2VIMA 3A2WA 5ECRB 2C0FA 2J23A 4PQ1A 4G19A 3KD0A 4FYUA 2H70A 1GULA 5J41A 4KE3A 4XRDA 4G10A 1WJKA 4WF4A 1PX7A 1TW9A 4KDYA 3TB2A 4P3YB 2C3NA 3DXBA 1A0RP 3RHCA 4F9ZA 1A0FA 1BEDA 2VL9A 2OACA 3CBUA 1GSFA 2NTOA 4RUVA 2H30A 1T8EB 2VL3A 1AIUA 3F6DA 1QFNA 1DBYA 3TU3B 4LLRA 4WR4A 3HVVA 2K8SA 1TK0B 4HZ4A 3TJFA 4G0KA 4V1Ap 2A2SA 2GSSA 1O8WA 1K0OA 4MH2A 3GHAA 1R26A 3EPTA 2R3XA 2NDOA 3F9UA 1U87A 2GZZA 2YPMA 4EF0A 2MZCA 2CZ2A 2X4AA 4TXOA 3KMNA 1Z6MA 4FH8A 1EP7A 5HR2A 5GSSA 3U6VA 3DVXA 2CVBA 2LTKA 5IMFA 4IJIA 5ECMB 3Q19A 2KOKA 3GN3A 5IQYA 4OMVA 2YANA 4HQZA 6GSWA 3IRAA 4IGJA 3UAPA 2V6KA 1A2LA 1XCCA 4G2EA 4BVYA 2P31A 1EOHA 4IVFA 1UVZA 3RFRC 2VCZA 5DALB 1U3AA 5HR1A 4MJCA 4KB3A 2YV9A 2WVXB 1FAAA 1F6MC 1GNEA 1F3BA 2EC4A 18GSA 5ENUA 4L5LA 4QMKA 3UVTA 4G0LA 3ZVJD 4ECJA 4DSSA 4IELA 5ECLB 5G1LA 1XPVA 2FHEA 3RDWA 2ON7A 2PWJA 5DBQA 4NWYA 3DIEA 1GTUA 5AIVA 4ZB9A 5ELAA 4OO5A 1EP8A 4AI6A 4CY6A 4E68A 1XW9A 1BYEA 3ZITA 2EIQA 6GSTA 4LL1B 3UVHA 4AKGA 3FZ4A 2VLVA 2DBCA 2VAFA 2HZEA 3HZ4A 1PN0A 1V58A 5HQPA 3D4MA 3CYNA 3Q6OA 1BG1A 1QUWA 4ZL9A 2R6KA 2DC5A 4D73A 1A8LA 3EINA 2PVQA 5B7CA 3CQFA 1URMA 2YJ7A 2H1AA 1G6YA 2QSIA 4X1UA 1HNBA 4HDEA 5DJLA 3H8QA 1GLPA 5G2ZA 2B1KA 1ZL9A 5EY6A 1PKWA 2H66A 2O85A 4XCSA 2GGTA 1ZZYA 4HJ2A 2DJ0A 1OC9A 3GSSA 2O5VA 3M1GA 4O7HA 5LD0A 3A3TA 5ECIB 3ERFA 1KTEA 4POLA 4OCEA 3O6TA 2NVLA 2ES7A 1PQNA 4MF7A 5A1NB 2DJ1A 4V2LA 2GZPA 4ZBBA 3HVXA 3HDCA 4X43A 2F9SA 4ML1A 3GV1A 2PUKC 1B8XA 4O5QA 5CAXA 1XFLA 1R5PA 3KXOA 1VF1A 1V57A 1I5GA 4CHSA 2ON5A 5ID2B 4XHMA 3WD6A 3ED3A 3G9BA 3CTFA 5KEJA 1YEPA 5DVBA 1XWBA 3LFLA 1DSBA 4WKWA 2H75A 1YVLA 2DJ2A 2O8VB 4DVCA 4JBBA 2MMZA 1SVLA 4MABA 4OCFA 1PFOA 2LQOA 2XBQA 5J40A 3N5OA 4AF2A 2WW3A 3KP9A 2WGRA 4F03A 2HE3A 3PH9A 2WVXA 1SK0A 2H1DA 2A4VA 3IK7A 2DMMA 2CAQA 4EUYA 5IMVA 2AHEA 1O6JA 5GAND 4K0GA 1YEXA 1VF3A 1TU8A 2GQLA 3C71A 3E3EA 3DEXA 2XPEA 1TXUA 1SD9A 5J5NA 2HLSA 1RQMA 3M8NA 2H01A 1SKSB 4KSMA 4ML6A 1RW1A 1T4ZA 5GAPD 2MBTA 1EEJA 2X49A 4KW6A 3ZZXA 2VM1A 4EVMA 1U6TA 1GSDA 1O85A 4N0VA 5H5QA 3CXGA 2RUEA 2R0PA 1PX6A 4I97A 3KTBA 4KDUA 2IPAA 3HCZA 4WR5A 2YWMA 5D9TA 3QOUA 2WVYA 2OKAA 5GZZB 2EFEA 2VL2C 1XOAA 3TJKA 2L5LA 4XS1A 4TR4A 1XIYA 4OFTA 5G1KA 1O8XA 3HJPA 3TJBA 4OO4A 4WBRD 3CSHA 2IIYA 3GX8A 4ZILA 2LJKA 4NHWA 5DCGA 4AJ8A 2KUCA 3EURA 3I9V2 1JZWA 4DSRA 1FVKA 2C0EA 2JL4A 4GLTA 2VL2A 2YN1A 3IBHA 3GNJA 1GLQA 3ZYWA 1XOBA 3ZIJA 4ISDA 3MSZA 4A5PA 5CNWA 2LRCA 3J7Yb 4JR4A 1YKAA 1XWKA 5J4YA 3TJJA 4MZWA 2H0HA 2LJAA 1T1VA 5A1NA 5J4UA 2RUFA 2O7KA 1E6BA 1S3RA 2D2ZA 4QQ7A 4HQSA 4GSNA 4I2UA 1GL8A 1M3IA 3MDKA 3PGTA 2B1LA 5ID2A 4NMUA 2DIYA 4LMVA 4CY8A 1SL0B 3GUSA 4IW9A 19GSA 4E8EA 1V2AA 3QAVA 1HQOA 1OVNA 5LNKe 3C7MA 4BL7B 1V9WA 4GQCA 4TR0A 4AGSA 1M9BA 3F6FA 4X4JA 4N3ZA 2WCIA 2LS5A 4MDCA 3DWVA 2IN3A 3VWWA 3S9FA 2IMFA 4EDZA 4IJ3A 4KX4A 3L9VA 3VLNA 4V1Ag 1HYUA 4L0UA 1DUGA 3HKRA 4XS4A 2R0GA 1PSQA 4MNNA 1JZRA 3NIVA 1WPIA 3PINA 2REMA 1X5CA 1KEBA 3WGXA 3M3MA 3APOA 4BVXA 3KCMA 1F3AA 2I3YA 3P7XA 1U3IA 4PQIA 4NPBA 4EIQA 1M2DA 4TKYA 1DE2A 5BMUA 2B7JA 2XHFA 2PERA 5DAKA 2GQMA 1OE7A 3A5WA 1FHEA 1TTZA 2X8HA 4FYCA 4JU5A 2HFDA 2K6VA 2H1LA 4TR3A 2DSAA 2O89A 1A24A 3KH7A 4ZB7A 1G0TA 1QGVA 3ZRDA 4IP6A 3GRXA 2B5YA 5DQYA 4JZQA 1K0BA 2FWEA 1EGOA 2X99A 4F2IA 4TW5A 4TR1B 3ZL5A 3Q18A 4BVYB 3EYTA 2O87A 4YAPA 2VLTA 2EIOA 1B4PA 4HJMA 2N5BA 4IHUA 4YH2A 3TKPA 1SVOA 1Z6NA 3HVSA 1MTCA 3P90A 1ZOFA 3FR6A 2I81A 4KCAA 3TJGA 2DJ3A 1LJRA 4J2FA 2V6OA 3G7YA 2CQ9A 2TIRA 2YNXA 1K3YA 3PPUA 3CTGA 2YZUA 2V2GA 2B7KA 2P5QA 1ERVA 2QA2A 3QR6A 5KN1A 1X5DA 3WYWA 1XBSA 3GFKA 2WW1A 2H19A 1GUKA 2N5AA 2HYXA 5FWGA 4WF5A 4KF9A 2DKHA 3F4SA 2WS2A 4YQVA 2K8VA 4BL7A 1N8JA 3FZAA 3L9SA 2AJQB 1B9YC 2QC7A 3GSTA 14GSA 2VD1A 2HZEB 3QFBC 4Q5FA 4MZCA 5ECHB 1Z7PA 4PUAA 4D73B 3Q74A 4EIPA 4N11A 1K0DA 2HRKA 4Z7XA 4KH7A 1PL2A 1VF4A 4ECBA 5IOXA 3FKFA 1XW6A 4IP1A 5HR0A 1T3BA 2C0DA 1PN9A 1G7OA 3RHBA 3KH9A 1ST9A 1ON4A 3TKSC 13GSA 2M46A 4AJ7A 3LEFA 3QD9A 5EVOA 2EFHA 1OC9B 3D22A 3NZNA 4BPYA 2IJYA 4Q5NA 3QFAC 2DIZA 1J08A 1GSYA 2BMXA 4K6XA 4HEA2 3TKSA 1TI3A 2MMOA 1W89A 1M3JA 2IMKA 1X0RA 3EMPA 5H5SA 8GSSA 5HR3A 3APQA 4K2XA 3HMJG 4PTSA 2OA7A 3AY8A 4ECCA 2MMAA 1BAYA 2WJUA 4USSA 3W6GA 5G5EA 4DEJA 3HHVA 4TR1A 4HI7A 1FB0A 1ZCPA 5G31A 4FQUA 1ZYNA 1K0CA 1KBNA 2FD3A 2AUVA 1FG4A 1AW9A 5ECSA 3UIWA 4K5RA 3TOTA 2FWGA 2OJLA 1T4YA 4V2NA 3L9UA 4ILFA 1ERTA 1M9AA 3DRNA 2PMTA 1UC7A 3LWAA 2WDUA 4ID0A 2KHPA 2H6YA 2RIIA 4Z2UA 1XWGA 2HRAA 1FW1A 3TKQA 1UN2A 10GSA 4L5OA 5J3RA 1SJIA 1O81A 5KN2A 2LRNA 4PX1A 4WBJA 2HRFA 2FA8A 2GT5A 4K0NA 2H6ZA 2IMEA 2WVZA 1AAZA 3FYGA 3ZMKA 3HJOA 4NXIA 2WW2A 3HZ8A 4G0IA 1SVMA 4QL7A 1I1IP 2FUG2 2TRXA 2WULA 4XRAA 4HU7A 5A5HA 5C00A 1K0AA 2X64A 3M0FA 3EMXA 4K7IA 3DGQA 5BRTA 1OYJA 3FHKA 4PXOA 3GKMA 2WB9A 3QCPA 5IOWA 4KNDA 2V41A 4GCIA 3O76A 1XW5A 2OBIA 3EWLA 2LNTA 4HU9A 1SYXA 3BOAA 4NHZA 1F37A 2EFDA 1DE1A 1JZOA 3KM6A 1AC1A 1WIKA 2VLUA 4TXVA 4BWQA 1TK5B 1Z3EA 2AYTA 2YWNA 5C04A 5G5FA 2C4JA 2FWFA 3ME8A 5CREA 2FCHA 3GKXA 3D0ZA 3D6IA 1AQVA 4KAEA 3FY7A 3GA4A 3PR8A 1GSSA 4Q5RA 6GSSA 4K7OA 4TRXA 1JHBA 1JFUA 2HRNA 2LSTA 4MH3A 1Z9HA 3KTLA 3D4TA 11GSA 3VPTA 1PRXA 5JCUA 2XC2A 1Q4JA 4WEYA 1S3AA 3RBTA 4MCUA 2GSRA 1B9XC 1QMVA 2RLIA 1RK4A 3C8EA 4PGTA 3APSA 3LGCA 1JZDA 2DKIA 4O5UA 1OKTA 4EKZA 2WW0A 1ZMAA 5KOXA 5D93A 1TRUA 2YV7A 4I8BA 3HA9A 4NV5A 2QGVA 2OE1A 2VUPA 2AV4A 3VI5A 2M72A 1M0UA 22GSA 3C73A 2E7PA 4LMWA 4MPGA 5DQSA 2JZSA 5E4WA 2NBSA 1K3OA 4ZBAA 4HS1A 4XS4B 5IMZA 1K0MA 3BD2A 3ERWA 5J9CA 4GDFA 1LBKA 4ACSA 4EXJA 1EOGA 2IFQA 4BVXB 4PI0C 5HFIA 2XPDA 1EV4A 3ZLPA 4IS0A 1Y25A 1YKCA 1GTIA 2YWOA 5BMUB 1OAZA 1USBA 5DAKB 2A2PA 2L6DA 1SKRB 1QXHA 4I6XA 4AJ6A 3EVIA 4GRFA 4POBA 2QKEA 3F3RA 2EFCA 2WRTA 20GSA 1PGTA 4MLYA 4N30A 5J4VA 1Q98A 1Y6EA 1NW2A 4ZB6A 2X8GA 4POKA 3VWVA 5D8IA 5G30A 1XG8A 2LEGA 2IMDA 1ZYQB 1NSWA 4IN0A 3R2QA 1GRXA 3FR3A 1ILOA 3H1NA 2HT9A 4AKHA 2L6CA 4DSQA 4YAVA 3IC8A 5DDLA 4K8MA 5J9BA 1M99A 3C1SA 1VF2A 1GP1A 3ZREA 1GTBA 3FW2A 3MWHA 1ACVA 1YDKA 3IC4A 5F06A 1AUCA 4MF6A 2FNOA 2C8UA 5EPFA 1TRWA 2IMIA 5IPHA 3IA1A 4FYBA 2GVPA 5B8BA 3HYPA 2VD0A 4XS6A 5F05A 3QAGA 3KGKA 3F63A 5F07A 1TI1A 1GUMA 3W8JA 5B6MA 1GUHA 3UEMA 2HI7A 5IIZA 1SENA 2JSYA 2K18A 2MMNA 2YZHA 4G9HA 3CRUA 2LRTA 2R0CA 1TRVA 2E2GA 1TXXA 5JCGA 1IYIA 1WOUA 4WXTA 5ECKB 3F8UA 3US3A 2HRKB 1MDJA 1BX9A 2C0GA 4HZ2A 7GSSA 4NV2A 2KLXA 1M2BA 2VCQA 4RI6A 3GH9A 4L8EA 3G7IA 1R4WA 3KIJA 1H4OA 1GNWA 2R5GA 2PBJA 3HY2A 1SJ6A 1OC3A 2LQQA 4JE1A 2YCDA 1V40A 4K9ZA 4RQRA 4L0WA 5CO3A 3R3EA 1R5AA 2JSZA 3VWUA 2PVOC 2R2JA 1F2EA 3FZ9A 3SBCA 12GSA 2VKZG 1TOFA 2F8AA 4OD7A 4K7NA 4BWSA 2OADA 5A4WA 3IR4A 2GTUA 2YJHA 1XWCA 2JZTA 5KN3A 2HSMB 2WZSA 6GSUA 3TKRA 3I69A 2JADA 4NAXA 1SL2B 3KP8A 3DD3A 4RI7A 2R37A 1MD4A 1BQ7A 1FVJA 5D73A 4F82A 3ME7A 4KA0A 4PUFC 1A23A 4ULXA 1S3DA 3UJ1A 3EE2A 1PD21 3A5IA 3UBLA 4TOPA 2WFCA 9GSSA 1TU7A 4O5RA 5JWQB 3ZFLA 4JEDA 3H4KA 3G7JA 3VWXA 4MJEA 4XTSA 2PU9C 5ELGA 3UBKA 3CRTA 4MPFA 3JCML 3UL3A 3FK8A 3F4TA 5IO0A 2GSTA 5IMAA 1WWJA 1ERWA 2K9FA 2DLXA 1EZKA 2FLSA 3E0UA 4IQ1A 5D9XA 2P5RA 2ALBA 2H8LA 2IL3A 2H1BA 4OFNA 4J57E 4OWYA 5LCZA 1XVWA 4PHZC 3VURA 1YY7A 4CDOA 3LYPA 5EL8A 2CX4A 1KNGA 2M80A 1O7UA 4EC0A 3LYKA 2L4QA 5A5HB 1OC8A 3HVNA 2G2QA 5F8BA 4AKIA 3KZQA 4K1FA 1XVQA 3TDGA 1GSQA 1HNAA 2OT3A 3F0IA 2Z9SA 3RPPA 4O32A 4CW9A 5D9VA 4K5SA 1JLVA 2ZNMA 3LG6A 3ISOA 1NM3A 3HJMA 1J0FA 2HNLA 1WP0A 3GKKA 5A34A 3ZTLA 1Z7RA 3L0HA 4GSSA 3I6AA 3DVWA 3GH6A 2VCWA 3LORA 3D21A 1U88A 3GTUA 1BG5A 4YQMA 1QK8A 2V32A 5L71A 1X9MB 5ECNB 2GT6A 2FWHA 4F0BA 2F3MA 3TRPA 4IKHA 3UMAA 4PURA 4AKXB 4I2TA 4EDYA 2HQTA 1Z5YE 4Q5QA 4KGIA 1PMTA 1N2AA 3DKSA 2HSMA 4XIHA 3TRQA 2C80A 5CP1A 2H76A 4YQUA 4GQFA 3CWGA 5IMCA 2OE3A 1O73A 5H5RA 2A4HA 2GDRA 1EV9A 2ZCTA 3J7Yk 5IM9A 3UARA 3O3TA 3L78A 3FRCA 4HUAA 4LA1A 4PI2C 3IAM2 1TJDA 5INYA 5AIXA 2H74A 1SYRA 3EC3A 4Z2RA 5CRWA 3ZMLA 3QMXA 3CHXC 2VO4A 2GZYA 2G0FA 4N0ZA 2IWTA 1X5EA 3EU4A 2MBSA 2EIRA 3E9JB 1SL1B 5CYYA 2LUSA 3A2VA 2AB6A 2VCTA 2UZ8A 1GSUA 1K0NA 5GSTA 3ERGA 1OKDA 1FB6A 1F9MA 1NHYA 2IFQB 1UA5A 3P8WA 1BJXA 1NHOA 3LW9A 1PL1A 3BCIA 4TN8A 5DCHA 2O36A 4EL1A 1N25A 3I43A 1PKZA 4FIWA 3IDVA 3GL5A 4HSCX 3U5RE 2BTOT 4JR6A 5CRHA 3L4NA 2I4AA 4YKFA 2J9HA 4GF0A 1G6WA 2L5OA 3LJRA 1V98A 5B6NA 5A4UA 1W4VA 4E8HA 4KCEA 4RQXA 1THXA 4TVEA 4YKGA 1S4BP 3TCOA 5JCWA 2CZ3A 4MJBA 5A5KA 1ABAA 4MK3A 1YJ6A 4WETA 2C3QA 4ZIJA 2B6MA 3IHGA 1TDIA 2TRCP 1G7EA 2B3SA 1PA3A 3GIXA 5D96A 5AN1A 2HSYA 1S3CA 6GSVA 2RM5A 1TKDB 1CQGA 1VRSD 5DJMA 2B5EA 3CSIA 2V1MA 3QDNA 1TK8B 2H72A 5HFKA 4PNFA 3RAZA 3LSZA 1M7TA 2HSNB 5IPGA 2MYGA 2OE0A 1TP9A 1VGLA 2CA8A 1GWCA 2CAIA 1OE8A 3MAKA 1ZYPA 4FXYP 1AQXA 1J9BA 5ECOB 4LL4B 3M9KA 2LV3A 3VFIA 2X8CA 3OR5A 3MIXA 17GSA 1AQWA 2CVKA 3DYRA 3CSJA 4MZBA 3WGEA 3TKSE 1JLWA 4ZB8A 2KP2A 5DALA 1R7HA 3VI7A 4GSTA 2UV8G 1FOVA 3W8SA 5ECQB 3IV4A 1ZYEA 1B48A 4PQHA 2O3EA 4ZBDA 5KN0A 2H1GA 1CQHA 4JRRA 1ZGNA 2LNSA 5IO2A 4BA7A 1YZXA 3ZFBA 1XXUA 4KUNA 3GMFA 3GX0A 4QL9A 2F51A 5FHIA 1FOHA 2CV4A 1EWXA 3HXSA 2LJRA 1A8YA 1SK1A 1LU4A 1SU9A 2LKUA 4W66A 2AAWA 1EEMA 4V2MA 5JWRB 4GXZA 3IAS2 3KEBA 3ZVJA 4F0CA 1K3LA 3TOUA 3M9JA 2PN8A 2BJXA 2RM6A 4O92A 3IOSA 2QA1A 5JWOB 3NOFA 2H71A 2HSHA 5D9WA 2B5XA 1ERUA 1IYHA 1SK2A 5A4VA 1FO5A 2PPTA 2FGXA 1XWAA 2VCXA 2OBKA 1A2JA 5ABRA 2L57A 2HZFA 2JU5A 2VOCA 2PGTA 1SKWB 4G01A 2HSNA 2KP1A 4ZXGA 3FMWA 3TUEA 5CRDA 1THOA 1B4QA 3H79A 1GSEA 2H73A 5E59A 1MD3A 3IPZA 2GSQA 5FT3A 3RPNA 3DMLA 2DJKA 1H75A 1T00A 4MP4A 1MDIA 2F8FA 3VK9A 4MF5A 4HOJA 2YP6A 2DMLA 4ZL8A 2FY6A 1MEKA 1GTAA 2C3TA 3WGDA 3IE3A 1EGRA 2CT6A 5COHA 4BIKA 5KOWA 5B8AA 1YF1A 4N10A 1I9DA 3WT1A 1X9WB 4IBPA 1XZOA 1ML6A 2JACA 3BJ5A 3TGZA 3H93A 1X9SB 2NPBA 1YQ1A 3FZ5A 1AXDA 3UOMA 2I9HA 2DJJA 5ECPB 5A34B 3CMIA 3IK9A 4X0XA 4EO3A 2C1YA 3A2XA 3FEUA 3EU3A 2H6XA 3N9JA 1BF5A 1M2AA 5AISA 3GTUB 3BBYA 6GSXA 4H86A 3V1WA 4Z2TA 2H0IA 4POMA 3MYDA 2YOIA 1C72A 3BCKA 4GWRA 1A2MA 2E2MA 3P2AA 3GYKA 4MMMA 2WZ9A 3KMOA 4KDXA 5AGYA 2ZUPA 2GS3A 4OFMA 5HFGA 1HNCA 1SD8A 1WMJA 3K8NA 4ICYA 2N5FA 3GKNA 4ZL7A 3F3QA 3HD5A 4PNGA 4ECIA 4MA9A 2A2RA 4GTUA 2HXKA 3D5JA 2JZRA 4TXOB 5IMDA 3ZIVA 1E2YA
chains in the Genus database with same CATH topology
2E0QA 4I5QA 6GSYA 3F4RA 3WT2A 4K2DA 5CRGA 4EE0A 2L4CA 2I1UA 1TRSA 3IXRA 3C1RA 2GQKA 5F0GA 2R4VA 4IQAA 16GSA 4KSOA 3TRXA 1HD2A 1WRYA 2FA4A 2VM2A 1GH2A 3VPQA 3QPMA 4FO5A 3IHQA 2XBIA 2P0GA 1SJZA 3LXZA 1QQ2A 2CVDA 2CX3A 4MJAA 3KJYA 2L59A 3GURA 2YWIA 3SWLA 1WE0A 4J56E 5J47A 4DSSB 1MDKA 3QAWA 2GLRA 1Y1UA 3LQ7A 3FR9A 3LXTA 1YF0A 2H0GA 2VCVA 3GL3A 1T7PB 3MNGA 2VIMA 3A2WA 5ECRB 2C0FA 2J23A 4PQ1A 4G19A 3KD0A 4FYUA 2H70A 1GULA 5J41A 4KE3A 4XRDA 4G10A 1WJKA 4WF4A 1PX7A 1TW9A 4KDYA 3TB2A 4P3YB 2C3NA 3DXBA 1A0RP 3RHCA 4F9ZA 1A0FA 1BEDA 2VL9A 2OACA 3CBUA 1GSFA 2NTOA 4RUVA 2H30A 1T8EB 2VL3A 1AIUA 3F6DA 1QFNA 1DBYA 3TU3B 4LLRA 4WR4A 3HVVA 2K8SA 1TK0B 4HZ4A 3TJFA 4G0KA 4V1Ap 2A2SA 2GSSA 1O8WA 1K0OA 4MH2A 3GHAA 1R26A 3EPTA 2R3XA 2NDOA 3F9UA 1U87A 2GZZA 2YPMA 4EF0A 2MZCA 2CZ2A 2X4AA 4TXOA 3KMNA 1Z6MA 4FH8A 1EP7A 5HR2A 5GSSA 3U6VA 3DVXA 2CVBA 2LTKA 5IMFA 4IJIA 5ECMB 3Q19A 2KOKA 3GN3A 5IQYA 4OMVA 2YANA 4HQZA 6GSWA 3IRAA 4IGJA 3UAPA 2V6KA 1A2LA 1XCCA 4G2EA 4BVYA 2P31A 1EOHA 4IVFA 1UVZA 2VCZA 5DALB 1U3AA 5HR1A 4MJCA 4KB3A 2YV9A 1FAAA 1F6MC 1GNEA 1F3BA 2EC4A 18GSA 5ENUA 4L5LA 4QMKA 3UVTA 4G0LA 3ZVJD 4ECJA 4DSSA 4IELA 5ECLB 5G1LA 1XPVA 2FHEA 3RDWA 2ON7A 2PWJA 5DBQA 4NWYA 3DIEA 1GTUA 5AIVA 4ZB9A 5ELAA 4OO5A 1EP8A 4AI6A 4CY6A 4E68A 1XW9A 1BYEA 3ZITA 2EIQA 6GSTA 4LL1B 3UVHA 4AKGA 3FZ4A 2VLVA 2DBCA 2VAFA 2HZEA 3HZ4A 1PN0A 1V58A 5HQPA 3D4MA 3CYNA 3Q6OA 1BG1A 1QUWA 4ZL9A 2R6KA 2DC5A 4D73A 1A8LA 3EINA 2PVQA 5B7CA 1URMA 2YJ7A 2H1AA 1G6YA 2QSIA 4X1UA 1HNBA 4HDEA 5DJLA 3H8QA 1GLPA 5G2ZA 2B1KA 1ZL9A 5EY6A 1PKWA 2H66A 2O85A 4XCSA 2GGTA 1ZZYA 4HJ2A 2DJ0A 1OC9A 3GSSA 2O5VA 3M1GA 4O7HA 5LD0A 3A3TA 5ECIB 3ERFA 1KTEA 4POLA 4OCEA 3O6TA 2NVLA 2ES7A 1PQNA 4MF7A 5A1NB 2DJ1A 4V2LA 2GZPA 4ZBBA 3HVXA 3HDCA 4X43A 2F9SA 4ML1A 3GV1A 2PUKC 1B8XA 4O5QA 5CAXA 1XFLA 1R5PA 3KXOA 1VF1A 1V57A 1I5GA 4CHSA 2ON5A 5ID2B 4XHMA 3WD6A 3ED3A 3G9BA 3CTFA 5KEJA 1YEPA 5DVBA 1XWBA 3LFLA 1DSBA 4WKWA 2H75A 1YVLA 2DJ2A 2O8VB 4DVCA 4JBBA 2MMZA 1SVLA 4MABA 4OCFA 2LQOA 2XBQA 5J40A 3N5OA 4AF2A 3KP9A 2WGRA 4F03A 2HE3A 3PH9A 1SK0A 2H1DA 2A4VA 3IK7A 2DMMA 2CAQA 4EUYA 5IMVA 2AHEA 1O6JA 5GAND 4K0GA 1YEXA 1VF3A 1TU8A 2GQLA 3C71A 3E3EA 3DEXA 2XPEA 1TXUA 1SD9A 5J5NA 2HLSA 1RQMA 3M8NA 2H01A 1SKSB 4KSMA 4ML6A 1RW1A 1T4ZA 5GAPD 2MBTA 1EEJA 2X49A 4KW6A 3ZZXA 2VM1A 4EVMA 1U6TA 1GSDA 1O85A 4N0VA 5H5QA 3CXGA 2RUEA 2R0PA 1PX6A 4I97A 3KTBA 4KDUA 2IPAA 3HCZA 4WR5A 2YWMA 5D9TA 3QOUA 2OKAA 5GZZB 2EFEA 2VL2C 1XOAA 3TJKA 2L5LA 4XS1A 4TR4A 1XIYA 4OFTA 5G1KA 1O8XA 3HJPA 3TJBA 4OO4A 4WBRD 3CSHA 2IIYA 3GX8A 4ZILA 2LJKA 4NHWA 5DCGA 4AJ8A 2KUCA 3EURA 3I9V2 1JZWA 4DSRA 1FVKA 2C0EA 2JL4A 4GLTA 2VL2A 2YN1A 3IBHA 3GNJA 1GLQA 3ZYWA 1XOBA 3ZIJA 4ISDA 3MSZA 4A5PA 5CNWA 2LRCA 3J7Yb 4JR4A 1YKAA 1XWKA 5J4YA 3TJJA 4MZWA 2H0HA 2LJAA 1T1VA 5A1NA 5J4UA 2RUFA 2O7KA 1E6BA 2D2ZA 4QQ7A 4HQSA 4GSNA 4I2UA 1GL8A 3MDKA 3PGTA 2B1LA 5ID2A 4NMUA 2DIYA 4LMVA 4CY8A 1SL0B 3GUSA 4IW9A 19GSA 4E8EA 1V2AA 3QAVA 1HQOA 1OVNA 5LNKe 3C7MA 4BL7B 1V9WA 4GQCA 4TR0A 4AGSA 1M9BA 3F6FA 4X4JA 4N3ZA 2WCIA 2LS5A 4MDCA 3DWVA 2IN3A 3VWWA 3S9FA 2IMFA 4EDZA 4IJ3A 4KX4A 3L9VA 3VLNA 4V1Ag 1HYUA 4L0UA 1DUGA 3HKRA 4XS4A 2R0GA 1PSQA 4MNNA 1JZRA 3NIVA 1WPIA 3PINA 2REMA 1X5CA 1KEBA 3WGXA 3M3MA 3APOA 4BVXA 3KCMA 1F3AA 2I3YA 3P7XA 1U3IA 4PQIA 4NPBA 4EIQA 1M2DA 4TKYA 1DE2A 5BMUA 2B7JA 2XHFA 2PERA 5DAKA 2GQMA 1OE7A 3A5WA 1FHEA 1TTZA 2X8HA 4FYCA 4JU5A 2HFDA 2K6VA 2H1LA 4TR3A 2DSAA 2O89A 1A24A 3KH7A 4ZB7A 1G0TA 1QGVA 3ZRDA 4IP6A 3GRXA 2B5YA 5DQYA 4JZQA 1K0BA 2FWEA 1EGOA 2X99A 4F2IA 4TW5A 4TR1B 3ZL5A 3Q18A 4BVYB 3EYTA 2O87A 4YAPA 2VLTA 2EIOA 1B4PA 4HJMA 2N5BA 4IHUA 4YH2A 3TKPA 1SVOA 1Z6NA 3HVSA 1MTCA 3P90A 1ZOFA 3FR6A 2I81A 4KCAA 3TJGA 2DJ3A 1LJRA 4J2FA 2V6OA 3G7YA 2CQ9A 2TIRA 2YNXA 1K3YA 3PPUA 3CTGA 2YZUA 2V2GA 2B7KA 2P5QA 1ERVA 2QA2A 3QR6A 5KN1A 1X5DA 3WYWA 1XBSA 3GFKA 2H19A 1GUKA 2N5AA 2HYXA 5FWGA 4WF5A 4KF9A 2DKHA 3F4SA 2WS2A 4YQVA 2K8VA 4BL7A 1N8JA 3FZAA 3L9SA 2AJQB 1B9YC 2QC7A 3GSTA 14GSA 2VD1A 2HZEB 3QFBC 4Q5FA 4MZCA 5ECHB 1Z7PA 4PUAA 4D73B 3Q74A 4EIPA 4N11A 1K0DA 2HRKA 4Z7XA 4KH7A 1PL2A 1VF4A 4ECBA 5IOXA 3FKFA 1XW6A 4IP1A 5HR0A 1T3BA 2C0DA 1PN9A 1G7OA 3RHBA 3KH9A 1ST9A 1ON4A 3TKSC 13GSA 2M46A 4AJ7A 3LEFA 3QD9A 5EVOA 2EFHA 1OC9B 3D22A 3NZNA 4BPYA 2IJYA 4Q5NA 3QFAC 2DIZA 1J08A 1GSYA 2BMXA 4K6XA 4HEA2 3TKSA 1TI3A 2MMOA 1W89A 2IMKA 1X0RA 3EMPA 5H5SA 8GSSA 5HR3A 3APQA 4K2XA 3HMJG 4PTSA 2OA7A 3AY8A 4ECCA 2MMAA 1BAYA 2WJUA 4USSA 3W6GA 5G5EA 4DEJA 3HHVA 4TR1A 4HI7A 1FB0A 1ZCPA 5G31A 4FQUA 1ZYNA 1K0CA 1KBNA 2FD3A 2AUVA 1FG4A 1AW9A 5ECSA 3UIWA 4K5RA 3TOTA 2FWGA 2OJLA 1T4YA 4V2NA 3L9UA 4ILFA 1ERTA 1M9AA 3DRNA 2PMTA 1UC7A 3LWAA 2WDUA 4ID0A 2KHPA 2H6YA 2RIIA 4Z2UA 1XWGA 2HRAA 1FW1A 3TKQA 1UN2A 10GSA 4L5OA 5J3RA 1SJIA 1O81A 5KN2A 2LRNA 4PX1A 4WBJA 2HRFA 2FA8A 2GT5A 4K0NA 2H6ZA 2IMEA 1AAZA 3FYGA 3ZMKA 3HJOA 4NXIA 3HZ8A 4G0IA 1SVMA 4QL7A 2FUG2 2TRXA 2WULA 4XRAA 4HU7A 5A5HA 5C00A 1K0AA 2X64A 3M0FA 3EMXA 4K7IA 3DGQA 5BRTA 1OYJA 3FHKA 4PXOA 3GKMA 2WB9A 3QCPA 5IOWA 4KNDA 2V41A 4GCIA 3O76A 1XW5A 2OBIA 3EWLA 2LNTA 4HU9A 1SYXA 3BOAA 4NHZA 1F37A 2EFDA 1DE1A 1JZOA 3KM6A 1AC1A 1WIKA 2VLUA 4TXVA 4BWQA 1TK5B 1Z3EA 2AYTA 2YWNA 5C04A 5G5FA 2C4JA 2FWFA 3ME8A 5CREA 2FCHA 3GKXA 3D0ZA 3D6IA 1AQVA 4KAEA 3FY7A 3GA4A 3PR8A 1GSSA 4Q5RA 6GSSA 4K7OA 4TRXA 1JHBA 1JFUA 2HRNA 2LSTA 4MH3A 1Z9HA 3KTLA 3D4TA 11GSA 3VPTA 1PRXA 5JCUA 2XC2A 1Q4JA 4WEYA 1S3AA 3RBTA 4MCUA 2GSRA 1B9XC 1QMVA 2RLIA 1RK4A 3C8EA 4PGTA 3APSA 3LGCA 1JZDA 2DKIA 4O5UA 1OKTA 4EKZA 1ZMAA 5KOXA 5D93A 1TRUA 2YV7A 4I8BA 3HA9A 4NV5A 2QGVA 2OE1A 2VUPA 2AV4A 3VI5A 2M72A 1M0UA 22GSA 3C73A 2E7PA 4LMWA 4MPGA 5DQSA 2JZSA 5E4WA 2NBSA 1K3OA 4ZBAA 4HS1A 4XS4B 5IMZA 1K0MA 3BD2A 3ERWA 5J9CA 4GDFA 1LBKA 4ACSA 4EXJA 1EOGA 2IFQA 4BVXB 5HFIA 2XPDA 1EV4A 3ZLPA 4IS0A 1Y25A 1YKCA 1GTIA 2YWOA 5BMUB 1OAZA 1USBA 5DAKB 2A2PA 2L6DA 1SKRB 1QXHA 4I6XA 4AJ6A 3EVIA 4GRFA 4POBA 2QKEA 3F3RA 2EFCA 2WRTA 20GSA 1PGTA 4MLYA 4N30A 5J4VA 1Q98A 1Y6EA 1NW2A 4ZB6A 2X8GA 4POKA 3VWVA 5D8IA 5G30A 2LEGA 2IMDA 1ZYQB 1NSWA 4IN0A 3R2QA 1GRXA 3FR3A 1ILOA 3H1NA 2HT9A 4AKHA 2L6CA 4DSQA 4YAVA 3IC8A 5DDLA 4K8MA 5J9BA 1M99A 3C1SA 1VF2A 1GP1A 3ZREA 1GTBA 3FW2A 3MWHA 1ACVA 1YDKA 3IC4A 5F06A 1AUCA 4MF6A 2FNOA 2C8UA 5EPFA 1TRWA 2IMIA 5IPHA 3IA1A 4FYBA 2GVPA 5B8BA 3HYPA 2VD0A 4XS6A 5F05A 3QAGA 3KGKA 3F63A 5F07A 1TI1A 1GUMA 3W8JA 5B6MA 1GUHA 3UEMA 2HI7A 5IIZA 1SENA 2JSYA 2K18A 2MMNA 2YZHA 4G9HA 3CRUA 2LRTA 2R0CA 1TRVA 2E2GA 1TXXA 5JCGA 1IYIA 1WOUA 4WXTA 5ECKB 3F8UA 3US3A 2HRKB 1MDJA 1BX9A 2C0GA 4HZ2A 7GSSA 4NV2A 2KLXA 1M2BA 2VCQA 4RI6A 3GH9A 4L8EA 3G7IA 1R4WA 3KIJA 1H4OA 1GNWA 2R5GA 2PBJA 3HY2A 1SJ6A 1OC3A 2LQQA 4JE1A 2YCDA 1V40A 4K9ZA 4RQRA 4L0WA 5CO3A 3R3EA 1R5AA 2JSZA 3VWUA 2PVOC 2R2JA 1F2EA 3FZ9A 3SBCA 12GSA 2VKZG 1TOFA 2F8AA 4OD7A 4K7NA 4BWSA 2OADA 5A4WA 3IR4A 2GTUA 2YJHA 1XWCA 2JZTA 5KN3A 2HSMB 6GSUA 3TKRA 3I69A 2JADA 4NAXA 1SL2B 3KP8A 3DD3A 4RI7A 2R37A 1MD4A 1BQ7A 1FVJA 5D73A 4F82A 3ME7A 4KA0A 4PUFC 1A23A 4ULXA 1S3DA 3UJ1A 3EE2A 1PD21 3A5IA 3UBLA 4TOPA 2WFCA 9GSSA 1TU7A 4O5RA 5JWQB 3ZFLA 4JEDA 3H4KA 3G7JA 3VWXA 4MJEA 4XTSA 2PU9C 5ELGA 3UBKA 3CRTA 4MPFA 3JCML 3UL3A 3FK8A 3F4TA 5IO0A 2GSTA 5IMAA 1WWJA 1ERWA 2K9FA 2DLXA 1EZKA 2FLSA 3E0UA 4IQ1A 5D9XA 2P5RA 2ALBA 2H8LA 2IL3A 2H1BA 4OFNA 4J57E 4OWYA 5LCZA 1XVWA 3VURA 1YY7A 4CDOA 3LYPA 5EL8A 2CX4A 1KNGA 2M80A 1O7UA 4EC0A 3LYKA 2L4QA 5A5HB 1OC8A 2G2QA 5F8BA 4AKIA 3KZQA 4K1FA 1XVQA 3TDGA 1GSQA 1HNAA 2OT3A 3F0IA 2Z9SA 3RPPA 4O32A 4CW9A 5D9VA 4K5SA 1JLVA 2ZNMA 3LG6A 3ISOA 1NM3A 3HJMA 1J0FA 2HNLA 1WP0A 3GKKA 5A34A 3ZTLA 1Z7RA 3L0HA 4GSSA 3I6AA 3DVWA 3GH6A 2VCWA 3LORA 3D21A 1U88A 3GTUA 1BG5A 4YQMA 1QK8A 2V32A 5L71A 1X9MB 5ECNB 2GT6A 2FWHA 4F0BA 2F3MA 3TRPA 4IKHA 3UMAA 4PURA 4AKXB 4I2TA 4EDYA 2HQTA 1Z5YE 4Q5QA 4KGIA 1PMTA 1N2AA 3DKSA 2HSMA 4XIHA 3TRQA 2C80A 5CP1A 2H76A 4YQUA 4GQFA 3CWGA 5IMCA 2OE3A 1O73A 5H5RA 2A4HA 2GDRA 1EV9A 2ZCTA 3J7Yk 5IM9A 3UARA 3O3TA 3L78A 3FRCA 4HUAA 4LA1A 3IAM2 1TJDA 5INYA 5AIXA 2H74A 1SYRA 3EC3A 4Z2RA 5CRWA 3ZMLA 3QMXA 2VO4A 2GZYA 2G0FA 4N0ZA 2IWTA 1X5EA 3EU4A 2MBSA 2EIRA 3E9JB 1SL1B 5CYYA 2LUSA 3A2VA 2AB6A 2VCTA 2UZ8A 1GSUA 1K0NA 5GSTA 3ERGA 1OKDA 1FB6A 1F9MA 1NHYA 2IFQB 1UA5A 3P8WA 1BJXA 1NHOA 3LW9A 1PL1A 3BCIA 4TN8A 5DCHA 4EL1A 1N25A 3I43A 1PKZA 4FIWA 3IDVA 3GL5A 3U5RE 2BTOT 4JR6A 5CRHA 3L4NA 2I4AA 4YKFA 2J9HA 4GF0A 1G6WA 2L5OA 3LJRA 1V98A 5B6NA 5A4UA 1W4VA 4E8HA 4KCEA 4RQXA 1THXA 4TVEA 4YKGA 3TCOA 5JCWA 2CZ3A 4MJBA 5A5KA 1ABAA 4MK3A 1YJ6A 4WETA 2C3QA 4ZIJA 2B6MA 3IHGA 1TDIA 2TRCP 1G7EA 2B3SA 1PA3A 3GIXA 5D96A 5AN1A 2HSYA 1S3CA 6GSVA 2RM5A 1TKDB 1CQGA 1VRSD 5DJMA 2B5EA 3CSIA 2V1MA 3QDNA 1TK8B 2H72A 5HFKA 4PNFA 3RAZA 3LSZA 1M7TA 2HSNB 5IPGA 2MYGA 2OE0A 1TP9A 1VGLA 2CA8A 1GWCA 2CAIA 1OE8A 3MAKA 1ZYPA 1AQXA 1J9BA 5ECOB 4LL4B 3M9KA 2LV3A 3VFIA 2X8CA 3OR5A 3MIXA 17GSA 1AQWA 2CVKA 3DYRA 3CSJA 4MZBA 3WGEA 3TKSE 1JLWA 4ZB8A 2KP2A 5DALA 1R7HA 3VI7A 4GSTA 2UV8G 1FOVA 3W8SA 5ECQB 3IV4A 1ZYEA 1B48A 4PQHA 4ZBDA 5KN0A 2H1GA 1CQHA 4JRRA 1ZGNA 2LNSA 5IO2A 4BA7A 1YZXA 3ZFBA 1XXUA 4KUNA 3GMFA 3GX0A 4QL9A 2F51A 5FHIA 1FOHA 2CV4A 1EWXA 3HXSA 2LJRA 1A8YA 1SK1A 1LU4A 1SU9A 2LKUA 4W66A 2AAWA 1EEMA 4V2MA 5JWRB 4GXZA 3IAS2 3KEBA 3ZVJA 4F0CA 1K3LA 3TOUA 3M9JA 2PN8A 2BJXA 2RM6A 4O92A 3IOSA 2QA1A 5JWOB 3NOFA 2H71A 2HSHA 5D9WA 2B5XA 1ERUA 1IYHA 1SK2A 5A4VA 1FO5A 2PPTA 2FGXA 1XWAA 2VCXA 2OBKA 1A2JA 5ABRA 2L57A 2HZFA 2JU5A 2VOCA 2PGTA 1SKWB 4G01A 2HSNA 2KP1A 4ZXGA 3FMWA 3TUEA 5CRDA 1THOA 1B4QA 3H79A 1GSEA 2H73A 5E59A 1MD3A 3IPZA 2GSQA 5FT3A 3RPNA 3DMLA 2DJKA 1H75A 1T00A 4MP4A 1MDIA 2F8FA 3VK9A 4MF5A 4HOJA 2YP6A 2DMLA 4ZL8A 2FY6A 1MEKA 1GTAA 2C3TA 3WGDA 3IE3A 1EGRA 2CT6A 5COHA 5KOWA 5B8AA 1YF1A 4N10A 1I9DA 3WT1A 1X9WB 4IBPA 1XZOA 1ML6A 2JACA 3BJ5A 3TGZA 3H93A 1X9SB 2NPBA 1YQ1A 3FZ5A 1AXDA 3UOMA 2I9HA 2DJJA 5ECPB 5A34B 3CMIA 3IK9A 4X0XA 4EO3A 2C1YA 3A2XA 3FEUA 3EU3A 2H6XA 3N9JA 1BF5A 1M2AA 5AISA 3GTUB 3BBYA 6GSXA 4H86A 3V1WA 4Z2TA 2H0IA 4POMA 3MYDA 2YOIA 1C72A 3BCKA 4GWRA 1A2MA 2E2MA 3P2AA 3GYKA 4MMMA 2WZ9A 3KMOA 4KDXA 5AGYA 2ZUPA 2GS3A 4OFMA 5HFGA 1HNCA 1SD8A 1WMJA 3K8NA 4ICYA 2N5FA 3GKNA 4ZL7A 3F3QA 3HD5A 4PNGA 4ECIA 4MA9A 2A2RA 4GTUA 2HXKA 3D5JA 2JZRA 4TXOB 5IMDA 3ZIVA 1E2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E0Q A;  4I5Q A;  6GSY A;  3F4R A;  3WT2 A;  4K2D A;  5CRG A;  4EE0 A;  2L4C A;  2I1U A;  1TRS A;  3IXR A;  3C1R A;  2GQK A;  5F0G A;  2R4V A;  4IQA A;  16GS A;  4KSO A;  3TRX A;  1HD2 A;  1WRY A;  2FA4 A;  2VM2 A;  1GH2 A;  3VPQ A;  3QPM A;  4FO5 A;  3IHQ A;  2XBI A;  2P0G A;  1SJZ A;  3LXZ A;  1QQ2 A;  2CVD A;  2CX3 A;  4MJA A;  3KJY A;  2L59 A;  3GUR A;  2YWI A;  3SWL A;  1WE0 A;  4J56 E;  4DSS B;  1MDK A;  3QAW A;  2GLR A;  3LQ7 A;  3FR9 A;  3LXT A;  1YF0 A;  2H0G A;  2VCV A;  3GL3 A;  1T7P B;  3MNG A;  2VIM A;  3A2W A;  5ECR B;  2C0F A;  2J23 A;  4PQ1 A;  4G19 A;  3KD0 A;  4FYU A;  2H70 A;  1GUL A;  5J41 A;  4KE3 A;  4XRD A;  4G10 A;  1WJK A;  4WF4 A;  1PX7 A;  1TW9 A;  4KDY A;  3TB2 A;  4P3Y B;  2C3N A;  3DXB A;  1A0R P;  3RHC A;  4F9Z A;  1A0F A;  1BED A;  2VL9 A;  2OAC A;  3CBU A;  1GSF A;  2NTO A;  4RUV A;  2H30 A;  1T8E B;  2VL3 A;  1AIU A;  3F6D A;  1QFN A;  1DBY A;  4LLR A;  4WR4 A;  3HVV A;  2K8S A;  1TK0 B;  4HZ4 A;  3TJF A;  4G0K A;  4V1A p;  2A2S A;  2GSS A;  1O8W A;  1K0O A;  4MH2 A;  3GHA A;  1R26 A;  2R3X A;  2NDO A;  3F9U A;  1U87 A;  2GZZ A;  2YPM A;  4EF0 A;  2MZC A;  2CZ2 A;  4TXO A;  3KMN A;  1Z6M A;  4FH8 A;  1EP7 A;  5HR2 A;  5GSS A;  3U6V A;  3DVX A;  2CVB A;  2LTK A;  5IMF A;  4IJI A;  5ECM B;  3Q19 A;  2KOK A;  3GN3 A;  5IQY A;  4OMV A;  2YAN A;  4HQZ A;  6GSW A;  3IRA A;  4IGJ A;  3UAP A;  2V6K A;  1A2L A;  1XCC A;  4G2E A;  4BVY A;  2P31 A;  1EOH A;  4IVF A;  1UVZ A;  2VCZ A;  5DAL B;  1U3A A;  5HR1 A;  4MJC A;  4KB3 A;  2YV9 A;  1FAA A;  1F6M C;  1GNE A;  1F3B A;  2EC4 A;  18GS A;  5ENU A;  4L5L A;  3UVT A;  4G0L A;  3ZVJ D;  4ECJ A;  4DSS A;  4IEL A;  5ECL B;  5G1L A;  1XPV A;  2FHE A;  3RDW A;  2ON7 A;  2PWJ A;  5DBQ A;  4NWY A;  3DIE A;  1GTU A;  5AIV A;  4ZB9 A;  5ELA A;  4OO5 A;  1EP8 A;  1XW9 A;  1BYE A;  3ZIT A;  2EIQ A;  6GST A;  4LL1 B;  3UVH A;  3FZ4 A;  2VLV A;  2DBC A;  2VAF A;  2HZE A;  3HZ4 A;  1V58 A;  5HQP A;  3D4M A;  3CYN A;  3Q6O A;  1QUW A;  4ZL9 A;  2R6K A;  2DC5 A;  4D73 A;  1A8L A;  3EIN A;  2PVQ A;  5B7C A;  1URM A;  2YJ7 A;  2H1A A;  1G6Y A;  2QSI A;  4X1U A;  1HNB A;  4HDE A;  5DJL A;  3H8Q A;  1GLP A;  5G2Z A;  2B1K A;  1ZL9 A;  5EY6 A;  1PKW A;  2H66 A;  2O85 A;  4XCS A;  2GGT A;  1ZZY A;  4HJ2 A;  2DJ0 A;  1OC9 A;  3GSS A;  3M1G A;  4O7H A;  5LD0 A;  3A3T A;  5ECI B;  3ERF A;  1KTE A;  4POL A;  4OCE A;  3O6T A;  2NVL A;  2ES7 A;  1PQN A;  4MF7 A;  2DJ1 A;  4V2L A;  2GZP A;  4ZBB A;  3HVX A;  3HDC A;  4X43 A;  2F9S A;  4ML1 A;  3GV1 A;  2PUK C;  1B8X A;  5CAX A;  1XFL A;  1R5P A;  3KXO A;  1VF1 A;  1V57 A;  1I5G A;  4CHS A;  2ON5 A;  5ID2 B;  4XHM A;  3WD6 A;  3G9B A;  3CTF A;  3ED3 A;  5KEJ A;  1YEP A;  5DVB A;  1XWB A;  3LFL A;  1DSB A;  4WKW A;  2H75 A;  2DJ2 A;  2O8V B;  4DVC A;  4JBB A;  2MMZ A;  4MAB A;  4OCF A;  2LQO A;  2XBQ A;  3N5O A;  4AF2 A;  3KP9 A;  2WGR A;  4F03 A;  2HE3 A;  3PH9 A;  1SK0 A;  2H1D A;  2A4V A;  3IK7 A;  2DMM A;  2CAQ A;  4EUY A;  5IMV A;  2AHE A;  1O6J A;  5GAN D;  4K0G A;  1YEX A;  1VF3 A;  1TU8 A;  2GQL A;  3C71 A;  3E3E A;  3DEX A;  2XPE A;  1SD9 A;  5J5N A;  2HLS A;  1RQM A;  3M8N A;  2H01 A;  1SKS B;  4KSM A;  4ML6 A;  1RW1 A;  1T4Z A;  5GAP D;  2MBT A;  1EEJ A;  4KW6 A;  3ZZX A;  2VM1 A;  4EVM A;  1U6T A;  1GSD A;  1O85 A;  4N0V A;  5H5Q A;  3CXG A;  2RUE A;  1PX6 A;  4I97 A;  3KTB A;  4KDU A;  2IPA A;  3HCZ A;  4WR5 A;  2YWM A;  5D9T A;  3QOU A;  2OKA A;  5GZZ B;  2VL2 C;  1XOA A;  3TJK A;  2L5L A;  4XS1 A;  4TR4 A;  1XIY A;  4OFT A;  5G1K A;  1O8X A;  3HJP A;  3TJB A;  4OO4 A;  4WBR D;  3CSH A;  2IIY A;  3GX8 A;  4ZIL A;  2LJK A;  4NHW A;  5DCG A;  4AJ8 A;  2KUC A;  3EUR A;  3I9V 2;  1JZW A;  4DSR A;  1FVK A;  2C0E A;  2JL4 A;  4GLT A;  2VL2 A;  2YN1 A;  3IBH A;  3GNJ A;  1GLQ A;  3ZYW A;  1XOB A;  3ZIJ A;  4ISD A;  3MSZ A;  5CNW A;  2LRC A;  3J7Y b;  4JR4 A;  1YKA A;  1XWK A;  3TJJ A;  4MZW A;  2H0H A;  2LJA A;  1T1V A;  5J4U A;  2RUF A;  2O7K A;  1E6B A;  2D2Z A;  4QQ7 A;  4HQS A;  4GSN A;  4I2U A;  1GL8 A;  3MDK A;  3PGT A;  2B1L A;  5ID2 A;  4NMU A;  2DIY A;  4LMV A;  1SL0 B;  3GUS A;  4IW9 A;  19GS A;  4E8E A;  1V2A A;  3QAV A;  1HQO A;  1OVN A;  5LNK e;  3C7M A;  4BL7 B;  1V9W A;  4GQC A;  4TR0 A;  4AGS A;  1M9B A;  3F6F A;  2WCI A;  2LS5 A;  4MDC A;  3DWV A;  2IN3 A;  3VWW A;  3S9F A;  2IMF A;  4EDZ A;  4IJ3 A;  4KX4 A;  3L9V A;  3VLN A;  4V1A g;  1HYU A;  4L0U A;  1DUG A;  3HKR A;  4XS4 A;  1PSQ A;  1JZR A;  3NIV A;  1WPI A;  3PIN A;  2REM A;  1X5C A;  1KEB A;  3WGX A;  3M3M A;  3APO A;  4BVX A;  3KCM A;  1F3A A;  2I3Y A;  3P7X A;  1U3I A;  4PQI A;  4NPB A;  1M2D A;  4TKY A;  1DE2 A;  5BMU A;  2B7J A;  2XHF A;  2PER A;  5DAK A;  2GQM A;  1OE7 A;  3A5W A;  1FHE A;  1TTZ A;  2X8H A;  4FYC A;  4JU5 A;  2HFD A;  2K6V A;  4TR3 A;  2DSA A;  2O89 A;  1A24 A;  3KH7 A;  1G0T A;  1QGV A;  3ZRD A;  4IP6 A;  3GRX A;  2B5Y A;  5DQY A;  4JZQ A;  1K0B A;  2FWE A;  1EGO A;  2X99 A;  4F2I A;  4TW5 A;  4TR1 B;  3ZL5 A;  3Q18 A;  4BVY B;  3EYT A;  2O87 A;  4YAP A;  2VLT A;  2EIO A;  1B4P A;  4HJM A;  2N5B A;  4IHU A;  4YH2 A;  3TKP A;  1Z6N A;  3HVS A;  1MTC A;  3P90 A;  1ZOF A;  3FR6 A;  2I81 A;  4KCA A;  3TJG A;  2DJ3 A;  1LJR A;  4J2F A;  2V6O A;  3G7Y A;  2CQ9 A;  2TIR A;  2YNX A;  1K3Y A;  3PPU A;  3CTG A;  2YZU A;  2V2G A;  2B7K A;  2P5Q A;  1ERV A;  3QR6 A;  5KN1 A;  1X5D A;  3WYW A;  1XBS A;  3GFK A;  2H19 A;  1GUK A;  2N5A A;  2HYX A;  5FWG A;  4WF5 A;  4KF9 A;  3F4S A;  2WS2 A;  4YQV A;  2K8V A;  4BL7 A;  1N8J A;  3FZA A;  3L9S A;  2AJQ B;  1B9Y C;  2QC7 A;  3GST A;  14GS A;  2VD1 A;  2HZE B;  3QFB C;  4Q5F A;  4MZC A;  5ECH B;  1Z7P A;  4PUA A;  4D73 B;  3Q74 A;  4N11 A;  1K0D A;  2HRK A;  4Z7X A;  4KH7 A;  1PL2 A;  1VF4 A;  4ECB A;  5IOX A;  3FKF A;  1XW6 A;  4IP1 A;  5HR0 A;  1T3B A;  2C0D A;  1PN9 A;  1G7O A;  3RHB A;  3KH9 A;  1ST9 A;  1ON4 A;  3TKS C;  13GS A;  2M46 A;  4AJ7 A;  3LEF A;  3QD9 A;  5EVO A;  1OC9 B;  3D22 A;  3NZN A;  4BPY A;  2IJY A;  4Q5N A;  3QFA C;  2DIZ A;  1J08 A;  1GSY A;  2BMX A;  4K6X A;  4HEA 2;  3TKS A;  1TI3 A;  2MMO A;  1W89 A;  2IMK A;  1X0R A;  3EMP A;  5H5S A;  8GSS A;  5HR3 A;  3APQ A;  4PTS A;  2OA7 A;  3AY8 A;  4ECC A;  2MMA A;  1BAY A;  2WJU A;  4USS A;  3W6G A;  5G5E A;  4DEJ A;  3HHV A;  4TR1 A;  4HI7 A;  1FB0 A;  1ZCP A;  5G31 A;  4FQU A;  1K0C A;  1KBN A;  2FD3 A;  2AUV A;  1FG4 A;  1AW9 A;  5ECS A;  3UIW A;  3TOT A;  2FWG A;  2OJL A;  1T4Y A;  4V2N A;  3L9U A;  4ILF A;  1ERT A;  1M9A A;  3DRN A;  2PMT A;  1UC7 A;  3LWA A;  2WDU A;  4ID0 A;  2KHP A;  2H6Y A;  2RII A;  1XWG A;  2HRA A;  1FW1 A;  3TKQ A;  1UN2 A;  10GS A;  4L5O A;  5J3R A;  1SJI A;  1O81 A;  5KN2 A;  2LRN A;  4PX1 A;  4WBJ A;  2HRF A;  2FA8 A;  2GT5 A;  4K0N A;  2H6Z A;  2IME A;  1AAZ A;  3FYG A;  3ZMK A;  3HJO A;  4NXI A;  3HZ8 A;  4G0I A;  4QL7 A;  2FUG 2;  2TRX A;  2WUL A;  4XRA A;  4HU7 A;  5C00 A;  1K0A A;  2X64 A;  3M0F A;  3EMX A;  4K7I A;  3DGQ A;  1OYJ A;  3FHK A;  4PXO A;  3GKM A;  2WB9 A;  3QCP A;  5IOW A;  4KND A;  2V41 A;  4GCI A;  3O76 A;  1XW5 A;  2OBI A;  3EWL A;  2LNT A;  4HU9 A;  1SYX A;  3BOA A;  4NHZ A;  1F37 A;  1DE1 A;  1JZO A;  3KM6 A;  1AC1 A;  1WIK A;  2VLU A;  4TXV A;  4BWQ A;  1TK5 B;  1Z3E A;  2AYT A;  2YWN A;  5C04 A;  5G5F A;  2C4J A;  2FWF A;  3ME8 A;  5CRE A;  2FCH A;  3GKX A;  3D0Z A;  3D6I A;  1AQV A;  4KAE A;  3FY7 A;  3GA4 A;  3PR8 A;  1GSS A;  4Q5R A;  6GSS A;  4K7O A;  4TRX A;  1JHB A;  1JFU A;  2HRN A;  2LST A;  4MH3 A;  1Z9H A;  3KTL A;  3D4T A;  11GS A;  3VPT A;  1PRX A;  5JCU A;  2XC2 A;  1Q4J A;  4WEY A;  1S3A A;  3RBT A;  4MCU A;  2GSR A;  1B9X C;  1QMV A;  2RLI A;  1RK4 A;  3C8E A;  4PGT A;  3APS A;  3LGC A;  1JZD A;  1OKT A;  4EKZ A;  1ZMA A;  5D93 A;  1TRU A;  2YV7 A;  4I8B A;  3HA9 A;  4NV5 A;  2QGV A;  2OE1 A;  2VUP A;  2AV4 A;  3VI5 A;  2M72 A;  1M0U A;  22GS A;  3C73 A;  2E7P A;  4LMW A;  4MPG A;  5DQS A;  2JZS A;  5E4W A;  2NBS A;  1K3O A;  4ZBA A;  4HS1 A;  4XS4 B;  5IMZ A;  1K0M A;  3BD2 A;  3ERW A;  5J9C A;  1LBK A;  4ACS A;  4EXJ A;  1EOG A;  2IFQ A;  4BVX B;  5HFI A;  2XPD A;  1EV4 A;  3ZLP A;  4IS0 A;  1Y25 A;  1YKC A;  1GTI A;  2YWO A;  1OAZ A;  1USB A;  5DAK B;  2L6D A;  1SKR B;  1QXH A;  4I6X A;  4AJ6 A;  3EVI A;  4GRF A;  4POB A;  2QKE A;  3F3R A;  2WRT A;  20GS A;  1PGT A;  4MLY A;  4N30 A;  1Q98 A;  1Y6E A;  1NW2 A;  4ZB6 A;  2X8G A;  4POK A;  3VWV A;  5D8I A;  5G30 A;  2LEG A;  2IMD A;  1ZYQ B;  1NSW A;  4IN0 A;  3R2Q A;  1GRX A;  3FR3 A;  1ILO A;  3H1N A;  2HT9 A;  2L6C A;  4DSQ A;  4YAV A;  3IC8 A;  5DDL A;  4K8M A;  5J9B A;  1M99 A;  3C1S A;  1VF2 A;  1GP1 A;  3ZRE A;  1GTB A;  3FW2 A;  3MWH A;  1ACV A;  1YDK A;  3IC4 A;  5F06 A;  1AUC A;  4MF6 A;  2FNO A;  2C8U A;  5EPF A;  1TRW A;  2IMI A;  5IPH A;  3IA1 A;  4FYB A;  2GVP A;  5B8B A;  3HYP A;  2VD0 A;  4XS6 A;  5F05 A;  3QAG A;  3KGK A;  3F63 A;  5F07 A;  1TI1 A;  1GUM A;  3W8J A;  5B6M A;  1GUH A;  3UEM A;  2HI7 A;  5IIZ A;  1SEN A;  2JSY A;  2K18 A;  2MMN A;  2YZH A;  4G9H A;  3CRU A;  2LRT A;  1TRV A;  2E2G A;  1TXX A;  5JCG A;  1IYI A;  1WOU A;  4WXT A;  5ECK B;  3F8U A;  3US3 A;  2HRK B;  1MDJ A;  1BX9 A;  2C0G A;  4HZ2 A;  7GSS A;  4NV2 A;  2KLX A;  1M2B A;  2VCQ A;  4RI6 A;  3GH9 A;  4L8E A;  3G7I A;  1R4W A;  3KIJ A;  1H4O A;  1GNW A;  2R5G A;  2PBJ A;  3HY2 A;  1SJ6 A;  1OC3 A;  2LQQ A;  4JE1 A;  2YCD A;  1V40 A;  4K9Z A;  4RQR A;  4L0W A;  5CO3 A;  3R3E A;  1R5A A;  2JSZ A;  3VWU A;  2PVO C;  2R2J A;  1F2E A;  3FZ9 A;  3SBC A;  12GS A;  1TOF A;  2F8A A;  4OD7 A;  4K7N A;  4BWS A;  2OAD A;  5A4W A;  3IR4 A;  2GTU A;  2YJH A;  1XWC A;  2JZT A;  5KN3 A;  2HSM B;  6GSU A;  3TKR A;  3I69 A;  2JAD A;  4NAX A;  1SL2 B;  3KP8 A;  3DD3 A;  4RI7 A;  2R37 A;  1MD4 A;  1BQ7 A;  1FVJ A;  5D73 A;  4F82 A;  3ME7 A;  4KA0 A;  4PUF C;  1A23 A;  4ULX A;  1S3D A;  3UJ1 A;  3EE2 A;  1PD2 1;  3UBL A;  4TOP A;  2WFC A;  9GSS A;  1TU7 A;  4O5R A;  5JWQ B;  3ZFL A;  4JED A;  3H4K A;  3G7J A;  3VWX A;  4MJE A;  4XTS A;  2PU9 C;  5ELG A;  3UBK A;  3CRT A;  4MPF A;  3JCM L;  3UL3 A;  3FK8 A;  3F4T A;  5IO0 A;  2GST A;  5IMA A;  1WWJ A;  1ERW A;  2K9F A;  2DLX A;  1EZK A;  2FLS A;  3E0U A;  4IQ1 A;  5D9X A;  2P5R A;  2ALB A;  2H8L A;  2IL3 A;  2H1B A;  4OFN A;  4J57 E;  4OWY A;  5LCZ A;  1XVW A;  3VUR A;  1YY7 A;  4CDO A;  3LYP A;  5EL8 A;  2CX4 A;  1KNG A;  2M80 A;  1O7U A;  4EC0 A;  3LYK A;  2L4Q A;  1OC8 A;  2G2Q A;  5F8B A;  3KZQ A;  4K1F A;  1XVQ A;  3TDG A;  1GSQ A;  1HNA A;  3F0I A;  2Z9S A;  3RPP A;  4O32 A;  4CW9 A;  5D9V A;  1JLV A;  2ZNM A;  3LG6 A;  3ISO A;  1NM3 A;  3HJM A;  1J0F A;  2HNL A;  1WP0 A;  3GKK A;  3ZTL A;  1Z7R A;  3L0H A;  4GSS A;  3I6A A;  3DVW A;  3GH6 A;  2VCW A;  3LOR A;  3D21 A;  1U88 A;  3GTU A;  1BG5 A;  4YQM A;  1QK8 A;  2V32 A;  5L71 A;  1X9M B;  5ECN B;  2GT6 A;  2FWH A;  4F0B A;  2F3M A;  3TRP A;  4IKH A;  3UMA A;  4PUR A;  4I2T A;  4EDY A;  2HQT A;  1Z5Y E;  4Q5Q A;  4KGI A;  1PMT A;  1N2A A;  3DKS A;  2HSM A;  4XIH A;  3TRQ A;  2C80 A;  5CP1 A;  2H76 A;  4YQU A;  4GQF A;  5IMC A;  2OE3 A;  1O73 A;  5H5R A;  2GDR A;  1EV9 A;  2ZCT A;  3J7Y k;  5IM9 A;  3UAR A;  3O3T A;  3L78 A;  3FRC A;  4HUA A;  4LA1 A;  3IAM 2;  1TJD A;  5INY A;  5AIX A;  2H74 A;  1SYR A;  3EC3 A;  5CRW A;  3ZML A;  3QMX A;  2VO4 A;  2GZY A;  2G0F A;  4N0Z A;  2IWT A;  1X5E A;  3EU4 A;  2MBS A;  2EIR A;  3E9J B;  1SL1 B;  5CYY A;  2LUS A;  3A2V A;  2AB6 A;  2VCT A;  2UZ8 A;  1GSU A;  1K0N A;  5GST A;  3ERG A;  1OKD A;  1FB6 A;  1F9M A;  1NHY A;  2IFQ B;  1UA5 A;  3P8W A;  1BJX A;  1NHO A;  1PL1 A;  3BCI A;  4TN8 A;  5DCH A;  4EL1 A;  3I43 A;  1PKZ A;  4FIW A;  3IDV A;  3GL5 A;  3U5R E;  2BTO T;  4JR6 A;  5CRH A;  3L4N A;  2I4A A;  2J9H A;  4GF0 A;  1G6W A;  2L5O A;  3LJR A;  1V98 A;  5B6N A;  5A4U A;  1W4V A;  4E8H A;  4KCE A;  4RQX A;  1THX A;  4TVE A;  3TCO A;  5JCW A;  2CZ3 A;  4MJB A;  5A5K A;  1ABA A;  4MK3 A;  1YJ6 A;  4WET A;  2C3Q A;  4ZIJ A;  2B6M A;  1TDI A;  2TRC P;  1G7E A;  2B3S A;  1PA3 A;  3GIX A;  5D96 A;  5AN1 A;  2HSY A;  1S3C A;  6GSV A;  2RM5 A;  1TKD B;  1CQG A;  1VRS D;  5DJM A;  2B5E A;  3CSI A;  2V1M A;  3QDN A;  1TK8 B;  2H72 A;  5HFK A;  4PNF A;  3RAZ A;  3LSZ A;  1M7T A;  2HSN B;  5IPG A;  2MYG A;  2OE0 A;  1TP9 A;  1VGL A;  2CA8 A;  1GWC A;  2CAI A;  1OE8 A;  3MAK A;  1AQX A;  1J9B A;  5ECO B;  4LL4 B;  3M9K A;  2LV3 A;  3VFI A;  2X8C A;  3OR5 A;  17GS A;  1AQW A;  2CVK A;  3DYR A;  3CSJ A;  4MZB A;  3WGE A;  3TKS E;  1JLW A;  4ZB8 A;  2KP2 A;  5DAL A;  1R7H A;  3VI7 A;  4GST A;  1FOV A;  3W8S A;  5ECQ B;  3IV4 A;  1ZYE A;  1B48 A;  4PQH A;  4ZBD A;  5KN0 A;  2H1G A;  1CQH A;  4JRR A;  1ZGN A;  2LNS A;  5IO2 A;  4BA7 A;  1YZX A;  3ZFB A;  1XXU A;  4KUN A;  3GMF A;  3GX0 A;  4QL9 A;  2F51 A;  5FHI A;  2CV4 A;  1EWX A;  3HXS A;  2LJR A;  1A8Y A;  1SK1 A;  1LU4 A;  1SU9 A;  2LKU A;  2AAW A;  1EEM A;  4V2M A;  5JWR B;  4GXZ A;  3IAS 2;  3KEB A;  3ZVJ A;  4F0C A;  1K3L A;  3TOU A;  3M9J A;  2PN8 A;  2BJX A;  2RM6 A;  4O92 A;  3IOS A;  5JWO B;  3NOF A;  2H71 A;  2HSH A;  5D9W A;  2B5X A;  1ERU A;  1IYH A;  1SK2 A;  5A4V A;  1FO5 A;  2PPT A;  2FGX A;  1XWA A;  2VCX A;  2OBK A;  1A2J A;  5ABR A;  2L57 A;  2HZF A;  2JU5 A;  2VOC A;  2PGT A;  1SKW B;  2KP1 A;  4ZXG A;  3TUE A;  5CRD A;  1THO A;  1B4Q A;  3H79 A;  1GSE A;  2H73 A;  5E59 A;  1MD3 A;  3IPZ A;  2GSQ A;  5FT3 A;  3RPN A;  3DML A;  2DJK A;  1H75 A;  1T00 A;  4MP4 A;  1MDI A;  2F8F A;  3VK9 A;  4MF5 A;  4HOJ A;  2YP6 A;  2DML A;  4ZL8 A;  2FY6 A;  1MEK A;  1GTA A;  2C3T A;  3WGD A;  3IE3 A;  1EGR A;  2CT6 A;  5COH A;  5B8A A;  1YF1 A;  4N10 A;  1I9D A;  3WT1 A;  1X9W B;  4IBP A;  1XZO A;  1ML6 A;  2JAC A;  3BJ5 A;  3TGZ A;  3H93 A;  1X9S B;  2NPB A;  1YQ1 A;  3FZ5 A;  1AXD A;  3UOM A;  2I9H A;  2DJJ A;  5ECP B;  3CMI A;  3IK9 A;  4X0X A;  4EO3 A;  2C1Y A;  3A2X A;  3FEU A;  3EU3 A;  2H6X A;  3N9J A;  1M2A A;  5AIS A;  3GTU B;  3BBY A;  6GSX A;  4H86 A;  3V1W A;  2H0I A;  4POM A;  2YOI A;  1C72 A;  3BCK A;  4GWR A;  1A2M A;  2E2M A;  3P2A A;  3GYK A;  4MMM A;  2WZ9 A;  3KMO A;  4KDX A;  5AGY A;  2ZUP A;  2GS3 A;  4OFM A;  5HFG A;  1HNC A;  1SD8 A;  1WMJ A;  3K8N A;  2N5F A;  3GKN A;  4ZL7 A;  3F3Q A;  3HD5 A;  4PNG A;  4ECI A;  4MA9 A;  2A2R A;  4GTU A;  2HXK A;  3D5J A;  2JZR A;  4TXO B;  5IMD A;  3ZIV A;  1E2Y A; 
#chains in the Genus database with same CATH topology
 2E0Q A;  4I5Q A;  6GSY A;  3F4R A;  3WT2 A;  4K2D A;  5CRG A;  4EE0 A;  2L4C A;  2I1U A;  1TRS A;  3IXR A;  3C1R A;  2GQK A;  5F0G A;  2R4V A;  4IQA A;  16GS A;  4KSO A;  3TRX A;  1HD2 A;  1WRY A;  3RGB C;  2FA4 A;  2VM2 A;  1GH2 A;  3VPQ A;  3QPM A;  4FO5 A;  3IHQ A;  2XBI A;  2P0G A;  1SJZ A;  3LXZ A;  1QQ2 A;  2CVD A;  2CX3 A;  4MJA A;  3KJY A;  2L59 A;  3GUR A;  2YWI A;  3SWL A;  1WE0 A;  4J56 E;  5J47 A;  4DSS B;  1MDK A;  1YEW C;  3QAW A;  2GLR A;  1Y1U A;  3LQ7 A;  3FR9 A;  3LXT A;  1YF0 A;  2H0G A;  2VCV A;  3GL3 A;  1T7P B;  3MNG A;  2VIM A;  3A2W A;  5ECR B;  2C0F A;  2J23 A;  4PQ1 A;  4G19 A;  3KD0 A;  4FYU A;  2H70 A;  1GUL A;  5J41 A;  4KE3 A;  4XRD A;  4G10 A;  1WJK A;  4WF4 A;  1PX7 A;  1TW9 A;  4KDY A;  3TB2 A;  4P3Y B;  2C3N A;  3DXB A;  1A0R P;  3RHC A;  4F9Z A;  1A0F A;  1BED A;  2VL9 A;  2OAC A;  3CBU A;  1GSF A;  2NTO A;  4RUV A;  2H30 A;  1T8E B;  2VL3 A;  1AIU A;  3F6D A;  1QFN A;  1DBY A;  3TU3 B;  4LLR A;  4WR4 A;  3HVV A;  2K8S A;  1TK0 B;  4HZ4 A;  3TJF A;  4G0K A;  4V1A p;  2A2S A;  2GSS A;  1O8W A;  1K0O A;  4MH2 A;  3GHA A;  1R26 A;  3EPT A;  2R3X A;  2NDO A;  3F9U A;  1U87 A;  2GZZ A;  2YPM A;  4EF0 A;  2MZC A;  2CZ2 A;  2X4A A;  4TXO A;  3KMN A;  1Z6M A;  4FH8 A;  1EP7 A;  5HR2 A;  5GSS A;  3U6V A;  3DVX A;  2CVB A;  2LTK A;  5IMF A;  4IJI A;  5ECM B;  3Q19 A;  2KOK A;  3GN3 A;  5IQY A;  4OMV A;  2YAN A;  4HQZ A;  6GSW A;  3IRA A;  4IGJ A;  3UAP A;  2V6K A;  1A2L A;  1XCC A;  4G2E A;  4BVY A;  2P31 A;  1EOH A;  4IVF A;  1UVZ A;  3RFR C;  2VCZ A;  5DAL B;  1U3A A;  5HR1 A;  4MJC A;  4KB3 A;  2YV9 A;  2WVX B;  1FAA A;  1F6M C;  1GNE A;  1F3B A;  2EC4 A;  18GS A;  5ENU A;  4L5L A;  4QMK A;  3UVT A;  4G0L A;  3ZVJ D;  4ECJ A;  4DSS A;  4IEL A;  5ECL B;  5G1L A;  1XPV A;  2FHE A;  3RDW A;  2ON7 A;  2PWJ A;  5DBQ A;  4NWY A;  3DIE A;  1GTU A;  5AIV A;  4ZB9 A;  5ELA A;  4OO5 A;  1EP8 A;  4AI6 A;  4CY6 A;  4E68 A;  1XW9 A;  1BYE A;  3ZIT A;  2EIQ A;  6GST A;  4LL1 B;  3UVH A;  4AKG A;  3FZ4 A;  2VLV A;  2DBC A;  2VAF A;  2HZE A;  3HZ4 A;  1PN0 A;  1V58 A;  5HQP A;  3D4M A;  3CYN A;  3Q6O A;  1BG1 A;  1QUW A;  4ZL9 A;  2R6K A;  2DC5 A;  4D73 A;  1A8L A;  3EIN A;  2PVQ A;  5B7C A;  3CQF A;  1URM A;  2YJ7 A;  2H1A A;  1G6Y A;  2QSI A;  4X1U A;  1HNB A;  4HDE A;  5DJL A;  3H8Q A;  1GLP A;  5G2Z A;  2B1K A;  1ZL9 A;  5EY6 A;  1PKW A;  2H66 A;  2O85 A;  4XCS A;  2GGT A;  1ZZY A;  4HJ2 A;  2DJ0 A;  1OC9 A;  3GSS A;  2O5V A;  3M1G A;  4O7H A;  5LD0 A;  3A3T A;  5ECI B;  3ERF A;  1KTE A;  4POL A;  4OCE A;  3O6T A;  2NVL A;  2ES7 A;  1PQN A;  4MF7 A;  5A1N B;  2DJ1 A;  4V2L A;  2GZP A;  4ZBB A;  3HVX A;  3HDC A;  4X43 A;  2F9S A;  4ML1 A;  3GV1 A;  2PUK C;  1B8X A;  4O5Q A;  5CAX A;  1XFL A;  1R5P A;  3KXO A;  1VF1 A;  1V57 A;  1I5G A;  4CHS A;  2ON5 A;  5ID2 B;  4XHM A;  3WD6 A;  3ED3 A;  3G9B A;  3CTF A;  5KEJ A;  1YEP A;  5DVB A;  1XWB A;  3LFL A;  1DSB A;  4WKW A;  2H75 A;  1YVL A;  2DJ2 A;  2O8V B;  4DVC A;  4JBB A;  2MMZ A;  1SVL A;  4MAB A;  4OCF A;  1PFO A;  2LQO A;  2XBQ A;  5J40 A;  3N5O A;  4AF2 A;  2WW3 A;  3KP9 A;  2WGR A;  4F03 A;  2HE3 A;  3PH9 A;  2WVX A;  1SK0 A;  2H1D A;  2A4V A;  3IK7 A;  2DMM A;  2CAQ A;  4EUY A;  5IMV A;  2AHE A;  1O6J A;  5GAN D;  4K0G A;  1YEX A;  1VF3 A;  1TU8 A;  2GQL A;  3C71 A;  3E3E A;  3DEX A;  2XPE A;  1TXU A;  1SD9 A;  5J5N A;  2HLS A;  1RQM A;  3M8N A;  2H01 A;  1SKS B;  4KSM A;  4ML6 A;  1RW1 A;  1T4Z A;  5GAP D;  2MBT A;  1EEJ A;  2X49 A;  4KW6 A;  3ZZX A;  2VM1 A;  4EVM A;  1U6T A;  1GSD A;  1O85 A;  4N0V A;  5H5Q A;  3CXG A;  2RUE A;  2R0P A;  1PX6 A;  4I97 A;  3KTB A;  4KDU A;  2IPA A;  3HCZ A;  4WR5 A;  2YWM A;  5D9T A;  3QOU A;  2WVY A;  2OKA A;  5GZZ B;  2EFE A;  2VL2 C;  1XOA A;  3TJK A;  2L5L A;  4XS1 A;  4TR4 A;  1XIY A;  4OFT A;  5G1K A;  1O8X A;  3HJP A;  3TJB A;  4OO4 A;  4WBR D;  3CSH A;  2IIY A;  3GX8 A;  4ZIL A;  2LJK A;  4NHW A;  5DCG A;  4AJ8 A;  2KUC A;  3EUR A;  3I9V 2;  1JZW A;  4DSR A;  1FVK A;  2C0E A;  2JL4 A;  4GLT A;  2VL2 A;  2YN1 A;  3IBH A;  3GNJ A;  1GLQ A;  3ZYW A;  1XOB A;  3ZIJ A;  4ISD A;  3MSZ A;  4A5P A;  5CNW A;  2LRC A;  3J7Y b;  4JR4 A;  1YKA A;  1XWK A;  5J4Y A;  3TJJ A;  4MZW A;  2H0H A;  2LJA A;  1T1V A;  5A1N A;  5J4U A;  2RUF A;  2O7K A;  1E6B A;  1S3R A;  2D2Z A;  4QQ7 A;  4HQS A;  4GSN A;  4I2U A;  1GL8 A;  1M3I A;  3MDK A;  3PGT A;  2B1L A;  5ID2 A;  4NMU A;  2DIY A;  4LMV A;  4CY8 A;  1SL0 B;  3GUS A;  4IW9 A;  19GS A;  4E8E A;  1V2A A;  3QAV A;  1HQO A;  1OVN A;  5LNK e;  3C7M A;  4BL7 B;  1V9W A;  4GQC A;  4TR0 A;  4AGS A;  1M9B A;  3F6F A;  4X4J A;  4N3Z A;  2WCI A;  2LS5 A;  4MDC A;  3DWV A;  2IN3 A;  3VWW A;  3S9F A;  2IMF A;  4EDZ A;  4IJ3 A;  4KX4 A;  3L9V A;  3VLN A;  4V1A g;  1HYU A;  4L0U A;  1DUG A;  3HKR A;  4XS4 A;  2R0G A;  1PSQ A;  4MNN A;  1JZR A;  3NIV A;  1WPI A;  3PIN A;  2REM A;  1X5C A;  1KEB A;  3WGX A;  3M3M A;  3APO A;  4BVX A;  3KCM A;  1F3A A;  2I3Y A;  3P7X A;  1U3I A;  4PQI A;  4NPB A;  4EIQ A;  1M2D A;  4TKY A;  1DE2 A;  5BMU A;  2B7J A;  2XHF A;  2PER A;  5DAK A;  2GQM A;  1OE7 A;  3A5W A;  1FHE A;  1TTZ A;  2X8H A;  4FYC A;  4JU5 A;  2HFD A;  2K6V A;  2H1L A;  4TR3 A;  2DSA A;  2O89 A;  1A24 A;  3KH7 A;  4ZB7 A;  1G0T A;  1QGV A;  3ZRD A;  4IP6 A;  3GRX A;  2B5Y A;  5DQY A;  4JZQ A;  1K0B A;  2FWE A;  1EGO A;  2X99 A;  4F2I A;  4TW5 A;  4TR1 B;  3ZL5 A;  3Q18 A;  4BVY B;  3EYT A;  2O87 A;  4YAP A;  2VLT A;  2EIO A;  1B4P A;  4HJM A;  2N5B A;  4IHU A;  4YH2 A;  3TKP A;  1SVO A;  1Z6N A;  3HVS A;  1MTC A;  3P90 A;  1ZOF A;  3FR6 A;  2I81 A;  4KCA A;  3TJG A;  2DJ3 A;  1LJR A;  4J2F A;  2V6O A;  3G7Y A;  2CQ9 A;  2TIR A;  2YNX A;  1K3Y A;  3PPU A;  3CTG A;  2YZU A;  2V2G A;  2B7K A;  2P5Q A;  1ERV A;  2QA2 A;  3QR6 A;  5KN1 A;  1X5D A;  3WYW A;  1XBS A;  3GFK A;  2WW1 A;  2H19 A;  1GUK A;  2N5A A;  2HYX A;  5FWG A;  4WF5 A;  4KF9 A;  2DKH A;  3F4S A;  2WS2 A;  4YQV A;  2K8V A;  4BL7 A;  1N8J A;  3FZA A;  3L9S A;  2AJQ B;  1B9Y C;  2QC7 A;  3GST A;  14GS A;  2VD1 A;  2HZE B;  3QFB C;  4Q5F A;  4MZC A;  5ECH B;  1Z7P A;  4PUA A;  4D73 B;  3Q74 A;  4EIP A;  4N11 A;  1K0D A;  2HRK A;  4Z7X A;  4KH7 A;  1PL2 A;  1VF4 A;  4ECB A;  5IOX A;  3FKF A;  1XW6 A;  4IP1 A;  5HR0 A;  1T3B A;  2C0D A;  1PN9 A;  1G7O A;  3RHB A;  3KH9 A;  1ST9 A;  1ON4 A;  3TKS C;  13GS A;  2M46 A;  4AJ7 A;  3LEF A;  3QD9 A;  5EVO A;  2EFH A;  1OC9 B;  3D22 A;  3NZN A;  4BPY A;  2IJY A;  4Q5N A;  3QFA C;  2DIZ A;  1J08 A;  1GSY A;  2BMX A;  4K6X A;  4HEA 2;  3TKS A;  1TI3 A;  2MMO A;  1W89 A;  1M3J A;  2IMK A;  1X0R A;  3EMP A;  5H5S A;  8GSS A;  5HR3 A;  3APQ A;  4K2X A;  3HMJ G;  4PTS A;  2OA7 A;  3AY8 A;  4ECC A;  2MMA A;  1BAY A;  2WJU A;  4USS A;  3W6G A;  5G5E A;  4DEJ A;  3HHV A;  4TR1 A;  4HI7 A;  1FB0 A;  1ZCP A;  5G31 A;  4FQU A;  1ZYN A;  1K0C A;  1KBN A;  2FD3 A;  2AUV A;  1FG4 A;  1AW9 A;  5ECS A;  3UIW A;  4K5R A;  3TOT A;  2FWG A;  2OJL A;  1T4Y A;  4V2N A;  3L9U A;  4ILF A;  1ERT A;  1M9A A;  3DRN A;  2PMT A;  1UC7 A;  3LWA A;  2WDU A;  4ID0 A;  2KHP A;  2H6Y A;  2RII A;  4Z2U A;  1XWG A;  2HRA A;  1FW1 A;  3TKQ A;  1UN2 A;  10GS A;  4L5O A;  5J3R A;  1SJI A;  1O81 A;  5KN2 A;  2LRN A;  4PX1 A;  4WBJ A;  2HRF A;  2FA8 A;  2GT5 A;  4K0N A;  2H6Z A;  2IME A;  2WVZ A;  1AAZ A;  3FYG A;  3ZMK A;  3HJO A;  4NXI A;  2WW2 A;  3HZ8 A;  4G0I A;  1SVM A;  4QL7 A;  1I1I P;  2FUG 2;  2TRX A;  2WUL A;  4XRA A;  4HU7 A;  5A5H A;  5C00 A;  1K0A A;  2X64 A;  3M0F A;  3EMX A;  4K7I A;  3DGQ A;  5BRT A;  1OYJ A;  3FHK A;  4PXO A;  3GKM A;  2WB9 A;  3QCP A;  5IOW A;  4KND A;  2V41 A;  4GCI A;  3O76 A;  1XW5 A;  2OBI A;  3EWL A;  2LNT A;  4HU9 A;  1SYX A;  3BOA A;  4NHZ A;  1F37 A;  2EFD A;  1DE1 A;  1JZO A;  3KM6 A;  1AC1 A;  1WIK A;  2VLU A;  4TXV A;  4BWQ A;  1TK5 B;  1Z3E A;  2AYT A;  2YWN A;  5C04 A;  5G5F A;  2C4J A;  2FWF A;  3ME8 A;  5CRE A;  2FCH A;  3GKX A;  3D0Z A;  3D6I A;  1AQV A;  4KAE A;  3FY7 A;  3GA4 A;  3PR8 A;  1GSS A;  4Q5R A;  6GSS A;  4K7O A;  4TRX A;  1JHB A;  1JFU A;  2HRN A;  2LST A;  4MH3 A;  1Z9H A;  3KTL A;  3D4T A;  11GS A;  3VPT A;  1PRX A;  5JCU A;  2XC2 A;  1Q4J A;  4WEY A;  1S3A A;  3RBT A;  4MCU A;  2GSR A;  1B9X C;  1QMV A;  2RLI A;  1RK4 A;  3C8E A;  4PGT A;  3APS A;  3LGC A;  1JZD A;  2DKI A;  4O5U A;  1OKT A;  4EKZ A;  2WW0 A;  1ZMA A;  5KOX A;  5D93 A;  1TRU A;  2YV7 A;  4I8B A;  3HA9 A;  4NV5 A;  2QGV A;  2OE1 A;  2VUP A;  2AV4 A;  3VI5 A;  2M72 A;  1M0U A;  22GS A;  3C73 A;  2E7P A;  4LMW A;  4MPG A;  5DQS A;  2JZS A;  5E4W A;  2NBS A;  1K3O A;  4ZBA A;  4HS1 A;  4XS4 B;  5IMZ A;  1K0M A;  3BD2 A;  3ERW A;  5J9C A;  4GDF A;  1LBK A;  4ACS A;  4EXJ A;  1EOG A;  2IFQ A;  4BVX B;  4PI0 C;  5HFI A;  2XPD A;  1EV4 A;  3ZLP A;  4IS0 A;  1Y25 A;  1YKC A;  1GTI A;  2YWO A;  5BMU B;  1OAZ A;  1USB A;  5DAK B;  2A2P A;  2L6D A;  1SKR B;  1QXH A;  4I6X A;  4AJ6 A;  3EVI A;  4GRF A;  4POB A;  2QKE A;  3F3R A;  2EFC A;  2WRT A;  20GS A;  1PGT A;  4MLY A;  4N30 A;  5J4V A;  1Q98 A;  1Y6E A;  1NW2 A;  4ZB6 A;  2X8G A;  4POK A;  3VWV A;  5D8I A;  5G30 A;  1XG8 A;  2LEG A;  2IMD A;  1ZYQ B;  1NSW A;  4IN0 A;  3R2Q A;  1GRX A;  3FR3 A;  1ILO A;  3H1N A;  2HT9 A;  4AKH A;  2L6C A;  4DSQ A;  4YAV A;  3IC8 A;  5DDL A;  4K8M A;  5J9B A;  1M99 A;  3C1S A;  1VF2 A;  1GP1 A;  3ZRE A;  1GTB A;  3FW2 A;  3MWH A;  1ACV A;  1YDK A;  3IC4 A;  5F06 A;  1AUC A;  4MF6 A;  2FNO A;  2C8U A;  5EPF A;  1TRW A;  2IMI A;  5IPH A;  3IA1 A;  4FYB A;  2GVP A;  5B8B A;  3HYP A;  2VD0 A;  4XS6 A;  5F05 A;  3QAG A;  3KGK A;  3F63 A;  5F07 A;  1TI1 A;  1GUM A;  3W8J A;  5B6M A;  1GUH A;  3UEM A;  2HI7 A;  5IIZ A;  1SEN A;  2JSY A;  2K18 A;  2MMN A;  2YZH A;  4G9H A;  3CRU A;  2LRT A;  2R0C A;  1TRV A;  2E2G A;  1TXX A;  5JCG A;  1IYI A;  1WOU A;  4WXT A;  5ECK B;  3F8U A;  3US3 A;  2HRK B;  1MDJ A;  1BX9 A;  2C0G A;  4HZ2 A;  7GSS A;  4NV2 A;  2KLX A;  1M2B A;  2VCQ A;  4RI6 A;  3GH9 A;  4L8E A;  3G7I A;  1R4W A;  3KIJ A;  1H4O A;  1GNW A;  2R5G A;  2PBJ A;  3HY2 A;  1SJ6 A;  1OC3 A;  2LQQ A;  4JE1 A;  2YCD A;  1V40 A;  4K9Z A;  4RQR A;  4L0W A;  5CO3 A;  3R3E A;  1R5A A;  2JSZ A;  3VWU A;  2PVO C;  2R2J A;  1F2E A;  3FZ9 A;  3SBC A;  12GS A;  2VKZ G;  1TOF A;  2F8A A;  4OD7 A;  4K7N A;  4BWS A;  2OAD A;  5A4W A;  3IR4 A;  2GTU A;  2YJH A;  1XWC A;  2JZT A;  5KN3 A;  2HSM B;  2WZS A;  6GSU A;  3TKR A;  3I69 A;  2JAD A;  4NAX A;  1SL2 B;  3KP8 A;  3DD3 A;  4RI7 A;  2R37 A;  1MD4 A;  1BQ7 A;  1FVJ A;  5D73 A;  4F82 A;  3ME7 A;  4KA0 A;  4PUF C;  1A23 A;  4ULX A;  1S3D A;  3UJ1 A;  3EE2 A;  1PD2 1;  3A5I A;  3UBL A;  4TOP A;  2WFC A;  9GSS A;  1TU7 A;  4O5R A;  5JWQ B;  3ZFL A;  4JED A;  3H4K A;  3G7J A;  3VWX A;  4MJE A;  4XTS A;  2PU9 C;  5ELG A;  3UBK A;  3CRT A;  4MPF A;  3JCM L;  3UL3 A;  3FK8 A;  3F4T A;  5IO0 A;  2GST A;  5IMA A;  1WWJ A;  1ERW A;  2K9F A;  2DLX A;  1EZK A;  2FLS A;  3E0U A;  4IQ1 A;  5D9X A;  2P5R A;  2ALB A;  2H8L A;  2IL3 A;  2H1B A;  4OFN A;  4J57 E;  4OWY A;  5LCZ A;  1XVW A;  4PHZ C;  3VUR A;  1YY7 A;  4CDO A;  3LYP A;  5EL8 A;  2CX4 A;  1KNG A;  2M80 A;  1O7U A;  4EC0 A;  3LYK A;  2L4Q A;  5A5H B;  1OC8 A;  3HVN A;  2G2Q A;  5F8B A;  4AKI A;  3KZQ A;  4K1F A;  1XVQ A;  3TDG A;  1GSQ A;  1HNA A;  2OT3 A;  3F0I A;  2Z9S A;  3RPP A;  4O32 A;  4CW9 A;  5D9V A;  4K5S A;  1JLV A;  2ZNM A;  3LG6 A;  3ISO A;  1NM3 A;  3HJM A;  1J0F A;  2HNL A;  1WP0 A;  3GKK A;  5A34 A;  3ZTL A;  1Z7R A;  3L0H A;  4GSS A;  3I6A A;  3DVW A;  3GH6 A;  2VCW A;  3LOR A;  3D21 A;  1U88 A;  3GTU A;  1BG5 A;  4YQM A;  1QK8 A;  2V32 A;  5L71 A;  1X9M B;  5ECN B;  2GT6 A;  2FWH A;  4F0B A;  2F3M A;  3TRP A;  4IKH A;  3UMA A;  4PUR A;  4AKX B;  4I2T A;  4EDY A;  2HQT A;  1Z5Y E;  4Q5Q A;  4KGI A;  1PMT A;  1N2A A;  3DKS A;  2HSM A;  4XIH A;  3TRQ A;  2C80 A;  5CP1 A;  2H76 A;  4YQU A;  4GQF A;  3CWG A;  5IMC A;  2OE3 A;  1O73 A;  5H5R A;  2A4H A;  2GDR A;  1EV9 A;  2ZCT A;  3J7Y k;  5IM9 A;  3UAR A;  3O3T A;  3L78 A;  3FRC A;  4HUA A;  4LA1 A;  4PI2 C;  3IAM 2;  1TJD A;  5INY A;  5AIX A;  2H74 A;  1SYR A;  3EC3 A;  4Z2R A;  5CRW A;  3ZML A;  3QMX A;  3CHX C;  2VO4 A;  2GZY A;  2G0F A;  4N0Z A;  2IWT A;  1X5E A;  3EU4 A;  2MBS A;  2EIR A;  3E9J B;  1SL1 B;  5CYY A;  2LUS A;  3A2V A;  2AB6 A;  2VCT A;  2UZ8 A;  1GSU A;  1K0N A;  5GST A;  3ERG A;  1OKD A;  1FB6 A;  1F9M A;  1NHY A;  2IFQ B;  1UA5 A;  3P8W A;  1BJX A;  1NHO A;  3LW9 A;  1PL1 A;  3BCI A;  4TN8 A;  5DCH A;  2O36 A;  4EL1 A;  1N25 A;  3I43 A;  1PKZ A;  4FIW A;  3IDV A;  3GL5 A;  4HSC X;  3U5R E;  2BTO T;  4JR6 A;  5CRH A;  3L4N A;  2I4A A;  4YKF A;  2J9H A;  4GF0 A;  1G6W A;  2L5O A;  3LJR A;  1V98 A;  5B6N A;  5A4U A;  1W4V A;  4E8H A;  4KCE A;  4RQX A;  1THX A;  4TVE A;  4YKG A;  1S4B P;  3TCO A;  5JCW A;  2CZ3 A;  4MJB A;  5A5K A;  1ABA A;  4MK3 A;  1YJ6 A;  4WET A;  2C3Q A;  4ZIJ A;  2B6M A;  3IHG A;  1TDI A;  2TRC P;  1G7E A;  2B3S A;  1PA3 A;  3GIX A;  5D96 A;  5AN1 A;  2HSY A;  1S3C A;  6GSV A;  2RM5 A;  1TKD B;  1CQG A;  1VRS D;  5DJM A;  2B5E A;  3CSI A;  2V1M A;  3QDN A;  1TK8 B;  2H72 A;  5HFK A;  4PNF A;  3RAZ A;  3LSZ A;  1M7T A;  2HSN B;  5IPG A;  2MYG A;  2OE0 A;  1TP9 A;  1VGL A;  2CA8 A;  1GWC A;  2CAI A;  1OE8 A;  3MAK A;  1ZYP A;  4FXY P;  1AQX A;  1J9B A;  5ECO B;  4LL4 B;  3M9K A;  2LV3 A;  3VFI A;  2X8C A;  3OR5 A;  3MIX A;  17GS A;  1AQW A;  2CVK A;  3DYR A;  3CSJ A;  4MZB A;  3WGE A;  3TKS E;  1JLW A;  4ZB8 A;  2KP2 A;  5DAL A;  1R7H A;  3VI7 A;  4GST A;  2UV8 G;  1FOV A;  3W8S A;  5ECQ B;  3IV4 A;  1ZYE A;  1B48 A;  4PQH A;  2O3E A;  4ZBD A;  5KN0 A;  2H1G A;  1CQH A;  4JRR A;  1ZGN A;  2LNS A;  5IO2 A;  4BA7 A;  1YZX A;  3ZFB A;  1XXU A;  4KUN A;  3GMF A;  3GX0 A;  4QL9 A;  2F51 A;  5FHI A;  1FOH A;  2CV4 A;  1EWX A;  3HXS A;  2LJR A;  1A8Y A;  1SK1 A;  1LU4 A;  1SU9 A;  2LKU A;  4W66 A;  2AAW A;  1EEM A;  4V2M A;  5JWR B;  4GXZ A;  3IAS 2;  3KEB A;  3ZVJ A;  4F0C A;  1K3L A;  3TOU A;  3M9J A;  2PN8 A;  2BJX A;  2RM6 A;  4O92 A;  3IOS A;  2QA1 A;  5JWO B;  3NOF A;  2H71 A;  2HSH A;  5D9W A;  2B5X A;  1ERU A;  1IYH A;  1SK2 A;  5A4V A;  1FO5 A;  2PPT A;  2FGX A;  1XWA A;  2VCX A;  2OBK A;  1A2J A;  5ABR A;  2L57 A;  2HZF A;  2JU5 A;  2VOC A;  2PGT A;  1SKW B;  4G01 A;  2HSN A;  2KP1 A;  4ZXG A;  3FMW A;  3TUE A;  5CRD A;  1THO A;  1B4Q A;  3H79 A;  1GSE A;  2H73 A;  5E59 A;  1MD3 A;  3IPZ A;  2GSQ A;  5FT3 A;  3RPN A;  3DML A;  2DJK A;  1H75 A;  1T00 A;  4MP4 A;  1MDI A;  2F8F A;  3VK9 A;  4MF5 A;  4HOJ A;  2YP6 A;  2DML A;  4ZL8 A;  2FY6 A;  1MEK A;  1GTA A;  2C3T A;  3WGD A;  3IE3 A;  1EGR A;  2CT6 A;  5COH A;  4BIK A;  5KOW A;  5B8A A;  1YF1 A;  4N10 A;  1I9D A;  3WT1 A;  1X9W B;  4IBP A;  1XZO A;  1ML6 A;  2JAC A;  3BJ5 A;  3TGZ A;  3H93 A;  1X9S B;  2NPB A;  1YQ1 A;  3FZ5 A;  1AXD A;  3UOM A;  2I9H A;  2DJJ A;  5ECP B;  5A34 B;  3CMI A;  3IK9 A;  4X0X A;  4EO3 A;  2C1Y A;  3A2X A;  3FEU A;  3EU3 A;  2H6X A;  3N9J A;  1BF5 A;  1M2A A;  5AIS A;  3GTU B;  3BBY A;  6GSX A;  4H86 A;  3V1W A;  4Z2T A;  2H0I A;  4POM A;  3MYD A;  2YOI A;  1C72 A;  3BCK A;  4GWR A;  1A2M A;  2E2M A;  3P2A A;  3GYK A;  4MMM A;  2WZ9 A;  3KMO A;  4KDX A;  5AGY A;  2ZUP A;  2GS3 A;  4OFM A;  5HFG A;  1HNC A;  1SD8 A;  1WMJ A;  3K8N A;  4ICY A;  2N5F A;  3GKN A;  4ZL7 A;  3F3Q A;  3HD5 A;  4PNG A;  4ECI A;  4MA9 A;  2A2R A;  4GTU A;  2HXK A;  3D5J A;  2JZR A;  4TXO B;  5IMD A;  3ZIV A;  1E2Y A; 
#chains in the Genus database with same CATH homology
 2E0Q A;  4I5Q A;  6GSY A;  3F4R A;  3WT2 A;  4K2D A;  5CRG A;  4EE0 A;  2L4C A;  2I1U A;  1TRS A;  3IXR A;  3C1R A;  2GQK A;  5F0G A;  2R4V A;  4IQA A;  16GS A;  4KSO A;  3TRX A;  1HD2 A;  1WRY A;  2FA4 A;  2VM2 A;  1GH2 A;  3VPQ A;  3QPM A;  4FO5 A;  3IHQ A;  2XBI A;  2P0G A;  1SJZ A;  3LXZ A;  1QQ2 A;  2CVD A;  2CX3 A;  4MJA A;  3KJY A;  2L59 A;  3GUR A;  2YWI A;  3SWL A;  1WE0 A;  4J56 E;  5J47 A;  4DSS B;  1MDK A;  3QAW A;  2GLR A;  1Y1U A;  3LQ7 A;  3FR9 A;  3LXT A;  1YF0 A;  2H0G A;  2VCV A;  3GL3 A;  1T7P B;  3MNG A;  2VIM A;  3A2W A;  5ECR B;  2C0F A;  2J23 A;  4PQ1 A;  4G19 A;  3KD0 A;  4FYU A;  2H70 A;  1GUL A;  5J41 A;  4KE3 A;  4XRD A;  4G10 A;  1WJK A;  4WF4 A;  1PX7 A;  1TW9 A;  4KDY A;  3TB2 A;  4P3Y B;  2C3N A;  3DXB A;  1A0R P;  3RHC A;  4F9Z A;  1A0F A;  1BED A;  2VL9 A;  2OAC A;  3CBU A;  1GSF A;  2NTO A;  4RUV A;  2H30 A;  1T8E B;  2VL3 A;  1AIU A;  3F6D A;  1QFN A;  1DBY A;  3TU3 B;  4LLR A;  4WR4 A;  3HVV A;  2K8S A;  1TK0 B;  4HZ4 A;  3TJF A;  4G0K A;  4V1A p;  2A2S A;  2GSS A;  1O8W A;  1K0O A;  4MH2 A;  3GHA A;  1R26 A;  3EPT A;  2R3X A;  2NDO A;  3F9U A;  1U87 A;  2GZZ A;  2YPM A;  4EF0 A;  2MZC A;  2CZ2 A;  2X4A A;  4TXO A;  3KMN A;  1Z6M A;  4FH8 A;  1EP7 A;  5HR2 A;  5GSS A;  3U6V A;  3DVX A;  2CVB A;  2LTK A;  5IMF A;  4IJI A;  5ECM B;  3Q19 A;  2KOK A;  3GN3 A;  5IQY A;  4OMV A;  2YAN A;  4HQZ A;  6GSW A;  3IRA A;  4IGJ A;  3UAP A;  2V6K A;  1A2L A;  1XCC A;  4G2E A;  4BVY A;  2P31 A;  1EOH A;  4IVF A;  1UVZ A;  2VCZ A;  5DAL B;  1U3A A;  5HR1 A;  4MJC A;  4KB3 A;  2YV9 A;  1FAA A;  1F6M C;  1GNE A;  1F3B A;  2EC4 A;  18GS A;  5ENU A;  4L5L A;  4QMK A;  3UVT A;  4G0L A;  3ZVJ D;  4ECJ A;  4DSS A;  4IEL A;  5ECL B;  5G1L A;  1XPV A;  2FHE A;  3RDW A;  2ON7 A;  2PWJ A;  5DBQ A;  4NWY A;  3DIE A;  1GTU A;  5AIV A;  4ZB9 A;  5ELA A;  4OO5 A;  1EP8 A;  4AI6 A;  4CY6 A;  4E68 A;  1XW9 A;  1BYE A;  3ZIT A;  2EIQ A;  6GST A;  4LL1 B;  3UVH A;  4AKG A;  3FZ4 A;  2VLV A;  2DBC A;  2VAF A;  2HZE A;  3HZ4 A;  1PN0 A;  1V58 A;  5HQP A;  3D4M A;  3CYN A;  3Q6O A;  1BG1 A;  1QUW A;  4ZL9 A;  2R6K A;  2DC5 A;  4D73 A;  1A8L A;  3EIN A;  2PVQ A;  5B7C A;  1URM A;  2YJ7 A;  2H1A A;  1G6Y A;  2QSI A;  4X1U A;  1HNB A;  4HDE A;  5DJL A;  3H8Q A;  1GLP A;  5G2Z A;  2B1K A;  1ZL9 A;  5EY6 A;  1PKW A;  2H66 A;  2O85 A;  4XCS A;  2GGT A;  1ZZY A;  4HJ2 A;  2DJ0 A;  1OC9 A;  3GSS A;  2O5V A;  3M1G A;  4O7H A;  5LD0 A;  3A3T A;  5ECI B;  3ERF A;  1KTE A;  4POL A;  4OCE A;  3O6T A;  2NVL A;  2ES7 A;  1PQN A;  4MF7 A;  5A1N B;  2DJ1 A;  4V2L A;  2GZP A;  4ZBB A;  3HVX A;  3HDC A;  4X43 A;  2F9S A;  4ML1 A;  3GV1 A;  2PUK C;  1B8X A;  4O5Q A;  5CAX A;  1XFL A;  1R5P A;  3KXO A;  1VF1 A;  1V57 A;  1I5G A;  4CHS A;  2ON5 A;  5ID2 B;  4XHM A;  3WD6 A;  3ED3 A;  3G9B A;  3CTF A;  5KEJ A;  1YEP A;  5DVB A;  1XWB A;  3LFL A;  1DSB A;  4WKW A;  2H75 A;  1YVL A;  2DJ2 A;  2O8V B;  4DVC A;  4JBB A;  2MMZ A;  1SVL A;  4MAB A;  4OCF A;  2LQO A;  2XBQ A;  5J40 A;  3N5O A;  4AF2 A;  3KP9 A;  2WGR A;  4F03 A;  2HE3 A;  3PH9 A;  1SK0 A;  2H1D A;  2A4V A;  3IK7 A;  2DMM A;  2CAQ A;  4EUY A;  5IMV A;  2AHE A;  1O6J A;  5GAN D;  4K0G A;  1YEX A;  1VF3 A;  1TU8 A;  2GQL A;  3C71 A;  3E3E A;  3DEX A;  2XPE A;  1TXU A;  1SD9 A;  5J5N A;  2HLS A;  1RQM A;  3M8N A;  2H01 A;  1SKS B;  4KSM A;  4ML6 A;  1RW1 A;  1T4Z A;  5GAP D;  2MBT A;  1EEJ A;  2X49 A;  4KW6 A;  3ZZX A;  2VM1 A;  4EVM A;  1U6T A;  1GSD A;  1O85 A;  4N0V A;  5H5Q A;  3CXG A;  2RUE A;  2R0P A;  1PX6 A;  4I97 A;  3KTB A;  4KDU A;  2IPA A;  3HCZ A;  4WR5 A;  2YWM A;  5D9T A;  3QOU A;  2OKA A;  5GZZ B;  2EFE A;  2VL2 C;  1XOA A;  3TJK A;  2L5L A;  4XS1 A;  4TR4 A;  1XIY A;  4OFT A;  5G1K A;  1O8X A;  3HJP A;  3TJB A;  4OO4 A;  4WBR D;  3CSH A;  2IIY A;  3GX8 A;  4ZIL A;  2LJK A;  4NHW A;  5DCG A;  4AJ8 A;  2KUC A;  3EUR A;  3I9V 2;  1JZW A;  4DSR A;  1FVK A;  2C0E A;  2JL4 A;  4GLT A;  2VL2 A;  2YN1 A;  3IBH A;  3GNJ A;  1GLQ A;  3ZYW A;  1XOB A;  3ZIJ A;  4ISD A;  3MSZ A;  4A5P A;  5CNW A;  2LRC A;  3J7Y b;  4JR4 A;  1YKA A;  1XWK A;  5J4Y A;  3TJJ A;  4MZW A;  2H0H A;  2LJA A;  1T1V A;  5A1N A;  5J4U A;  2RUF A;  2O7K A;  1E6B A;  2D2Z A;  4QQ7 A;  4HQS A;  4GSN A;  4I2U A;  1GL8 A;  3MDK A;  3PGT A;  2B1L A;  5ID2 A;  4NMU A;  2DIY A;  4LMV A;  4CY8 A;  1SL0 B;  3GUS A;  4IW9 A;  19GS A;  4E8E A;  1V2A A;  3QAV A;  1HQO A;  1OVN A;  5LNK e;  3C7M A;  4BL7 B;  1V9W A;  4GQC A;  4TR0 A;  4AGS A;  1M9B A;  3F6F A;  4X4J A;  4N3Z A;  2WCI A;  2LS5 A;  4MDC A;  3DWV A;  2IN3 A;  3VWW A;  3S9F A;  2IMF A;  4EDZ A;  4IJ3 A;  4KX4 A;  3L9V A;  3VLN A;  4V1A g;  1HYU A;  4L0U A;  1DUG A;  3HKR A;  4XS4 A;  2R0G A;  1PSQ A;  4MNN A;  1JZR A;  3NIV A;  1WPI A;  3PIN A;  2REM A;  1X5C A;  1KEB A;  3WGX A;  3M3M A;  3APO A;  4BVX A;  3KCM A;  1F3A A;  2I3Y A;  3P7X A;  1U3I A;  4PQI A;  4NPB A;  4EIQ A;  1M2D A;  4TKY A;  1DE2 A;  5BMU A;  2B7J A;  2XHF A;  2PER A;  5DAK A;  2GQM A;  1OE7 A;  3A5W A;  1FHE A;  1TTZ A;  2X8H A;  4FYC A;  4JU5 A;  2HFD A;  2K6V A;  2H1L A;  4TR3 A;  2DSA A;  2O89 A;  1A24 A;  3KH7 A;  4ZB7 A;  1G0T A;  1QGV A;  3ZRD A;  4IP6 A;  3GRX A;  2B5Y A;  5DQY A;  4JZQ A;  1K0B A;  2FWE A;  1EGO A;  2X99 A;  4F2I A;  4TW5 A;  4TR1 B;  3ZL5 A;  3Q18 A;  4BVY B;  3EYT A;  2O87 A;  4YAP A;  2VLT A;  2EIO A;  1B4P A;  4HJM A;  2N5B A;  4IHU A;  4YH2 A;  3TKP A;  1SVO A;  1Z6N A;  3HVS A;  1MTC A;  3P90 A;  1ZOF A;  3FR6 A;  2I81 A;  4KCA A;  3TJG A;  2DJ3 A;  1LJR A;  4J2F A;  2V6O A;  3G7Y A;  2CQ9 A;  2TIR A;  2YNX A;  1K3Y A;  3PPU A;  3CTG A;  2YZU A;  2V2G A;  2B7K A;  2P5Q A;  1ERV A;  2QA2 A;  3QR6 A;  5KN1 A;  1X5D A;  3WYW A;  1XBS A;  3GFK A;  2H19 A;  1GUK A;  2N5A A;  2HYX A;  5FWG A;  4WF5 A;  4KF9 A;  2DKH A;  3F4S A;  2WS2 A;  4YQV A;  2K8V A;  4BL7 A;  1N8J A;  3FZA A;  3L9S A;  2AJQ B;  1B9Y C;  2QC7 A;  3GST A;  14GS A;  2VD1 A;  2HZE B;  3QFB C;  4Q5F A;  4MZC A;  5ECH B;  1Z7P A;  4PUA A;  4D73 B;  3Q74 A;  4EIP A;  4N11 A;  1K0D A;  2HRK A;  4Z7X A;  4KH7 A;  1PL2 A;  1VF4 A;  4ECB A;  5IOX A;  3FKF A;  1XW6 A;  4IP1 A;  5HR0 A;  1T3B A;  2C0D A;  1PN9 A;  1G7O A;  3RHB A;  3KH9 A;  1ST9 A;  1ON4 A;  3TKS C;  13GS A;  2M46 A;  4AJ7 A;  3LEF A;  3QD9 A;  5EVO A;  2EFH A;  1OC9 B;  3D22 A;  3NZN A;  4BPY A;  2IJY A;  4Q5N A;  3QFA C;  2DIZ A;  1J08 A;  1GSY A;  2BMX A;  4K6X A;  4HEA 2;  3TKS A;  1TI3 A;  2MMO A;  1W89 A;  2IMK A;  1X0R A;  3EMP A;  5H5S A;  8GSS A;  5HR3 A;  3APQ A;  4K2X A;  3HMJ G;  4PTS A;  2OA7 A;  3AY8 A;  4ECC A;  2MMA A;  1BAY A;  2WJU A;  4USS A;  3W6G A;  5G5E A;  4DEJ A;  3HHV A;  4TR1 A;  4HI7 A;  1FB0 A;  1ZCP A;  5G31 A;  4FQU A;  1ZYN A;  1K0C A;  1KBN A;  2FD3 A;  2AUV A;  1FG4 A;  1AW9 A;  5ECS A;  3UIW A;  4K5R A;  3TOT A;  2FWG A;  2OJL A;  1T4Y A;  4V2N A;  3L9U A;  4ILF A;  1ERT A;  1M9A A;  3DRN A;  2PMT A;  1UC7 A;  3LWA A;  2WDU A;  4ID0 A;  2KHP A;  2H6Y A;  2RII A;  4Z2U A;  1XWG A;  2HRA A;  1FW1 A;  3TKQ A;  1UN2 A;  10GS A;  4L5O A;  5J3R A;  1SJI A;  1O81 A;  5KN2 A;  2LRN A;  4PX1 A;  4WBJ A;  2HRF A;  2FA8 A;  2GT5 A;  4K0N A;  2H6Z A;  2IME A;  1AAZ A;  3FYG A;  3ZMK A;  3HJO A;  4NXI A;  3HZ8 A;  4G0I A;  1SVM A;  4QL7 A;  2FUG 2;  2TRX A;  2WUL A;  4XRA A;  4HU7 A;  5A5H A;  5C00 A;  1K0A A;  2X64 A;  3M0F A;  3EMX A;  4K7I A;  3DGQ A;  5BRT A;  1OYJ A;  3FHK A;  4PXO A;  3GKM A;  2WB9 A;  3QCP A;  5IOW A;  4KND A;  2V41 A;  4GCI A;  3O76 A;  1XW5 A;  2OBI A;  3EWL A;  2LNT A;  4HU9 A;  1SYX A;  3BOA A;  4NHZ A;  1F37 A;  2EFD A;  1DE1 A;  1JZO A;  3KM6 A;  1AC1 A;  1WIK A;  2VLU A;  4TXV A;  4BWQ A;  1TK5 B;  1Z3E A;  2AYT A;  2YWN A;  5C04 A;  5G5F A;  2C4J A;  2FWF A;  3ME8 A;  5CRE A;  2FCH A;  3GKX A;  3D0Z A;  3D6I A;  1AQV A;  4KAE A;  3FY7 A;  3GA4 A;  3PR8 A;  1GSS A;  4Q5R A;  6GSS A;  4K7O A;  4TRX A;  1JHB A;  1JFU A;  2HRN A;  2LST A;  4MH3 A;  1Z9H A;  3KTL A;  3D4T A;  11GS A;  3VPT A;  1PRX A;  5JCU A;  2XC2 A;  1Q4J A;  4WEY A;  1S3A A;  3RBT A;  4MCU A;  2GSR A;  1B9X C;  1QMV A;  2RLI A;  1RK4 A;  3C8E A;  4PGT A;  3APS A;  3LGC A;  1JZD A;  2DKI A;  4O5U A;  1OKT A;  4EKZ A;  1ZMA A;  5KOX A;  5D93 A;  1TRU A;  2YV7 A;  4I8B A;  3HA9 A;  4NV5 A;  2QGV A;  2OE1 A;  2VUP A;  2AV4 A;  3VI5 A;  2M72 A;  1M0U A;  22GS A;  3C73 A;  2E7P A;  4LMW A;  4MPG A;  5DQS A;  2JZS A;  5E4W A;  2NBS A;  1K3O A;  4ZBA A;  4HS1 A;  4XS4 B;  5IMZ A;  1K0M A;  3BD2 A;  3ERW A;  5J9C A;  4GDF A;  1LBK A;  4ACS A;  4EXJ A;  1EOG A;  2IFQ A;  4BVX B;  5HFI A;  2XPD A;  1EV4 A;  3ZLP A;  4IS0 A;  1Y25 A;  1YKC A;  1GTI A;  2YWO A;  5BMU B;  1OAZ A;  1USB A;  5DAK B;  2A2P A;  2L6D A;  1SKR B;  1QXH A;  4I6X A;  4AJ6 A;  3EVI A;  4GRF A;  4POB A;  2QKE A;  3F3R A;  2EFC A;  2WRT A;  20GS A;  1PGT A;  4MLY A;  4N30 A;  5J4V A;  1Q98 A;  1Y6E A;  1NW2 A;  4ZB6 A;  2X8G A;  4POK A;  3VWV A;  5D8I A;  5G30 A;  2LEG A;  2IMD A;  1ZYQ B;  1NSW A;  4IN0 A;  3R2Q A;  1GRX A;  3FR3 A;  1ILO A;  3H1N A;  2HT9 A;  4AKH A;  2L6C A;  4DSQ A;  4YAV A;  3IC8 A;  5DDL A;  4K8M A;  5J9B A;  1M99 A;  3C1S A;  1VF2 A;  1GP1 A;  3ZRE A;  1GTB A;  3FW2 A;  3MWH A;  1ACV A;  1YDK A;  3IC4 A;  5F06 A;  1AUC A;  4MF6 A;  2FNO A;  2C8U A;  5EPF A;  1TRW A;  2IMI A;  5IPH A;  3IA1 A;  4FYB A;  2GVP A;  5B8B A;  3HYP A;  2VD0 A;  4XS6 A;  5F05 A;  3QAG A;  3KGK A;  3F63 A;  5F07 A;  1TI1 A;  1GUM A;  3W8J A;  5B6M A;  1GUH A;  3UEM A;  2HI7 A;  5IIZ A;  1SEN A;  2JSY A;  2K18 A;  2MMN A;  2YZH A;  4G9H A;  3CRU A;  2LRT A;  2R0C A;  1TRV A;  2E2G A;  1TXX A;  5JCG A;  1IYI A;  1WOU A;  4WXT A;  5ECK B;  3F8U A;  3US3 A;  2HRK B;  1MDJ A;  1BX9 A;  2C0G A;  4HZ2 A;  7GSS A;  4NV2 A;  2KLX A;  1M2B A;  2VCQ A;  4RI6 A;  3GH9 A;  4L8E A;  3G7I A;  1R4W A;  3KIJ A;  1H4O A;  1GNW A;  2R5G A;  2PBJ A;  3HY2 A;  1SJ6 A;  1OC3 A;  2LQQ A;  4JE1 A;  2YCD A;  1V40 A;  4K9Z A;  4RQR A;  4L0W A;  5CO3 A;  3R3E A;  1R5A A;  2JSZ A;  3VWU A;  2PVO C;  2R2J A;  1F2E A;  3FZ9 A;  3SBC A;  12GS A;  2VKZ G;  1TOF A;  2F8A A;  4OD7 A;  4K7N A;  4BWS A;  2OAD A;  5A4W A;  3IR4 A;  2GTU A;  2YJH A;  1XWC A;  2JZT A;  5KN3 A;  2HSM B;  6GSU A;  3TKR A;  3I69 A;  2JAD A;  4NAX A;  1SL2 B;  3KP8 A;  3DD3 A;  4RI7 A;  2R37 A;  1MD4 A;  1BQ7 A;  1FVJ A;  5D73 A;  4F82 A;  3ME7 A;  4KA0 A;  4PUF C;  1A23 A;  4ULX A;  1S3D A;  3UJ1 A;  3EE2 A;  1PD2 1;  3A5I A;  3UBL A;  4TOP A;  2WFC A;  9GSS A;  1TU7 A;  4O5R A;  5JWQ B;  3ZFL A;  4JED A;  3H4K A;  3G7J A;  3VWX A;  4MJE A;  4XTS A;  2PU9 C;  5ELG A;  3UBK A;  3CRT A;  4MPF A;  3JCM L;  3UL3 A;  3FK8 A;  3F4T A;  5IO0 A;  2GST A;  5IMA A;  1WWJ A;  1ERW A;  2K9F A;  2DLX A;  1EZK A;  2FLS A;  3E0U A;  4IQ1 A;  5D9X A;  2P5R A;  2ALB A;  2H8L A;  2IL3 A;  2H1B A;  4OFN A;  4J57 E;  4OWY A;  5LCZ A;  1XVW A;  3VUR A;  1YY7 A;  4CDO A;  3LYP A;  5EL8 A;  2CX4 A;  1KNG A;  2M80 A;  1O7U A;  4EC0 A;  3LYK A;  2L4Q A;  5A5H B;  1OC8 A;  2G2Q A;  5F8B A;  4AKI A;  3KZQ A;  4K1F A;  1XVQ A;  3TDG A;  1GSQ A;  1HNA A;  2OT3 A;  3F0I A;  2Z9S A;  3RPP A;  4O32 A;  4CW9 A;  5D9V A;  4K5S A;  1JLV A;  2ZNM A;  3LG6 A;  3ISO A;  1NM3 A;  3HJM A;  1J0F A;  2HNL A;  1WP0 A;  3GKK A;  5A34 A;  3ZTL A;  1Z7R A;  3L0H A;  4GSS A;  3I6A A;  3DVW A;  3GH6 A;  2VCW A;  3LOR A;  3D21 A;  1U88 A;  3GTU A;  1BG5 A;  4YQM A;  1QK8 A;  2V32 A;  5L71 A;  1X9M B;  5ECN B;  2GT6 A;  2FWH A;  4F0B A;  2F3M A;  3TRP A;  4IKH A;  3UMA A;  4PUR A;  4AKX B;  4I2T A;  4EDY A;  2HQT A;  1Z5Y E;  4Q5Q A;  4KGI A;  1PMT A;  1N2A A;  3DKS A;  2HSM A;  4XIH A;  3TRQ A;  2C80 A;  5CP1 A;  2H76 A;  4YQU A;  4GQF A;  3CWG A;  5IMC A;  2OE3 A;  1O73 A;  5H5R A;  2A4H A;  2GDR A;  1EV9 A;  2ZCT A;  3J7Y k;  5IM9 A;  3UAR A;  3O3T A;  3L78 A;  3FRC A;  4HUA A;  4LA1 A;  3IAM 2;  1TJD A;  5INY A;  5AIX A;  2H74 A;  1SYR A;  3EC3 A;  4Z2R A;  5CRW A;  3ZML A;  3QMX A;  2VO4 A;  2GZY A;  2G0F A;  4N0Z A;  2IWT A;  1X5E A;  3EU4 A;  2MBS A;  2EIR A;  3E9J B;  1SL1 B;  5CYY A;  2LUS A;  3A2V A;  2AB6 A;  2VCT A;  2UZ8 A;  1GSU A;  1K0N A;  5GST A;  3ERG A;  1OKD A;  1FB6 A;  1F9M A;  1NHY A;  2IFQ B;  1UA5 A;  3P8W A;  1BJX A;  1NHO A;  3LW9 A;  1PL1 A;  3BCI A;  4TN8 A;  5DCH A;  4EL1 A;  1N25 A;  3I43 A;  1PKZ A;  4FIW A;  3IDV A;  3GL5 A;  3U5R E;  2BTO T;  4JR6 A;  5CRH A;  3L4N A;  2I4A A;  4YKF A;  2J9H A;  4GF0 A;  1G6W A;  2L5O A;  3LJR A;  1V98 A;  5B6N A;  5A4U A;  1W4V A;  4E8H A;  4KCE A;  4RQX A;  1THX A;  4TVE A;  4YKG A;  3TCO A;  5JCW A;  2CZ3 A;  4MJB A;  5A5K A;  1ABA A;  4MK3 A;  1YJ6 A;  4WET A;  2C3Q A;  4ZIJ A;  2B6M A;  3IHG A;  1TDI A;  2TRC P;  1G7E A;  2B3S A;  1PA3 A;  3GIX A;  5D96 A;  5AN1 A;  2HSY A;  1S3C A;  6GSV A;  2RM5 A;  1TKD B;  1CQG A;  1VRS D;  5DJM A;  2B5E A;  3CSI A;  2V1M A;  3QDN A;  1TK8 B;  2H72 A;  5HFK A;  4PNF A;  3RAZ A;  3LSZ A;  1M7T A;  2HSN B;  5IPG A;  2MYG A;  2OE0 A;  1TP9 A;  1VGL A;  2CA8 A;  1GWC A;  2CAI A;  1OE8 A;  3MAK A;  1ZYP A;  1AQX A;  1J9B A;  5ECO B;  4LL4 B;  3M9K A;  2LV3 A;  3VFI A;  2X8C A;  3OR5 A;  3MIX A;  17GS A;  1AQW A;  2CVK A;  3DYR A;  3CSJ A;  4MZB A;  3WGE A;  3TKS E;  1JLW A;  4ZB8 A;  2KP2 A;  5DAL A;  1R7H A;  3VI7 A;  4GST A;  2UV8 G;  1FOV A;  3W8S A;  5ECQ B;  3IV4 A;  1ZYE A;  1B48 A;  4PQH A;  4ZBD A;  5KN0 A;  2H1G A;  1CQH A;  4JRR A;  1ZGN A;  2LNS A;  5IO2 A;  4BA7 A;  1YZX A;  3ZFB A;  1XXU A;  4KUN A;  3GMF A;  3GX0 A;  4QL9 A;  2F51 A;  5FHI A;  1FOH A;  2CV4 A;  1EWX A;  3HXS A;  2LJR A;  1A8Y A;  1SK1 A;  1LU4 A;  1SU9 A;  2LKU A;  4W66 A;  2AAW A;  1EEM A;  4V2M A;  5JWR B;  4GXZ A;  3IAS 2;  3KEB A;  3ZVJ A;  4F0C A;  1K3L A;  3TOU A;  3M9J A;  2PN8 A;  2BJX A;  2RM6 A;  4O92 A;  3IOS A;  2QA1 A;  5JWO B;  3NOF A;  2H71 A;  2HSH A;  5D9W A;  2B5X A;  1ERU A;  1IYH A;  1SK2 A;  5A4V A;  1FO5 A;  2PPT A;  2FGX A;  1XWA A;  2VCX A;  2OBK A;  1A2J A;  5ABR A;  2L57 A;  2HZF A;  2JU5 A;  2VOC A;  2PGT A;  1SKW B;  4G01 A;  2HSN A;  2KP1 A;  4ZXG A;  3FMW A;  3TUE A;  5CRD A;  1THO A;  1B4Q A;  3H79 A;  1GSE A;  2H73 A;  5E59 A;  1MD3 A;  3IPZ A;  2GSQ A;  5FT3 A;  3RPN A;  3DML A;  2DJK A;  1H75 A;  1T00 A;  4MP4 A;  1MDI A;  2F8F A;  3VK9 A;  4MF5 A;  4HOJ A;  2YP6 A;  2DML A;  4ZL8 A;  2FY6 A;  1MEK A;  1GTA A;  2C3T A;  3WGD A;  3IE3 A;  1EGR A;  2CT6 A;  5COH A;  5KOW A;  5B8A A;  1YF1 A;  4N10 A;  1I9D A;  3WT1 A;  1X9W B;  4IBP A;  1XZO A;  1ML6 A;  2JAC A;  3BJ5 A;  3TGZ A;  3H93 A;  1X9S B;  2NPB A;  1YQ1 A;  3FZ5 A;  1AXD A;  3UOM A;  2I9H A;  2DJJ A;  5ECP B;  5A34 B;  3CMI A;  3IK9 A;  4X0X A;  4EO3 A;  2C1Y A;  3A2X A;  3FEU A;  3EU3 A;  2H6X A;  3N9J A;  1BF5 A;  1M2A A;  5AIS A;  3GTU B;  3BBY A;  6GSX A;  4H86 A;  3V1W A;  4Z2T A;  2H0I A;  4POM A;  3MYD A;  2YOI A;  1C72 A;  3BCK A;  4GWR A;  1A2M A;  2E2M A;  3P2A A;  3GYK A;  4MMM A;  2WZ9 A;  3KMO A;  4KDX A;  5AGY A;  2ZUP A;  2GS3 A;  4OFM A;  5HFG A;  1HNC A;  1SD8 A;  1WMJ A;  3K8N A;  4ICY A;  2N5F A;  3GKN A;  4ZL7 A;  3F3Q A;  3HD5 A;  4PNG A;  4ECI A;  4MA9 A;  2A2R A;  4GTU A;  2HXK A;  3D5J A;  2JZR A;  4TXO B;  5IMD A;  3ZIV A;  1E2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...