4RI6A

Crystal structure of poplar glutathione transferase f1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
214
structure length
214
Chain Sequence
b'ATPVTIYGPPLSTAVSRVLATLIEKDVPFHLIPIDLSKGEQKKPEYLKIQPFGQVPAFKDESITLFESRAICRYICDKYADKGNKSLYGTDILSKANIDQWVETDGQTFGPPSGDLVHDLLFSSVPVDEALIKKNVDKLAKVLDIYEQKLGQTRFLAGDEFSFADLSHLPNGDYLVNSTDKGYLFTSRKNVNRWWTEISNRESWKKVLEMRKNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phi class glutathione transferase GSTF1
publication title The poplar Phi class glutathione transferase: expression, activity and structure of GSTF1.
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
molecule tags Transferase
total genus 80
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ri6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ri6A01
2EIRA 1F37A 5G30A 1MDIA 2OKAA 2LS5A 5DQSA 1VGLA 1OVNA 4GF0A 1R5PA 4PURA 3PGTA 5DQYA 3GSTA 4ZL8A 1EWXA 2LQQA 4AJ7A 4HJMA 3ZFLA 1XWGA 3KMOA 3I43A 5GAND 4G9HA 4OWYA 3BJ5A 2FUG2 1SYXA 4IQAA 3M9JA 5ECRB 2LUSA 3KTLA 5IO2A 4FYUA 2H30A 5HR0A 5BMUA 5D8IA 5ELGA 2HRNA 3IDVA 1PKWA 1TW9A 2WRTA 1GUMA 1SL0B 4F0CA 2CV4A 2A2SA 3GH6A 4YQMA 1XW9A 1M2AA 1WP0A 2VIMA 5AISA 4POLA 4WETA 1XWCA 5AIXA 3N9JA 3GHAA 1QQ2A 1M0UA 2JZTA 1FG4A 1JZDA 2Z9SA 2WZ9A 1XOBA 2IMIA 1T4YA 1EEJA 3ED3A 3NOFA 1QUWA 4DEJA 1VRSD 5FT3A 2HSMA 2GZPA 4ECCA 1PX7A 3ZFBA 5DBQA 9GSSA 5A4WA 5JWQB 1EP8A 2IWTA 4LLRA 1N8JA 2DIZA 4O32A 5IPGA 1PA3A 3IHQA 2K8SA 4OD7A 2VD1A 1Y6EA 4IVFA 4MP4A 4RQRA 5EY6A 3Q74A 5B8AA 3H1NA 2QGVA 2K8VA 5B7CA 2R37A 4MH2A 3ZMLA 2X8GA 5DVBA 1YZXA 1W4VA 3CYNA 3G9BA 5GAPD 3FZAA 1O6JA 3PR8A 1Z7PA 3HD5A 2B5EA 2B5XA 1G6WA 3GUSA 4AJ6A 5HR2A 2G0FA 1G7OA 5FWGA 3F3RA 5D9WA 1Z3EA 1MD3A 2N5FA 1A2JA 3NIVA 1ZL9A 2YPMA 3CTFA 3L0HA 5L71A 1K0CA 5IIZA 4MH3A 3I6AA 1PD21 3WYWA 1OC9A 3GTUA 2H1AA 2HE3A 2P5RA 1OC9B 2H74A 4O92A 2ES7A 3ZVJD 4EUYA 3KJYA 3TRXA 2GZZA 1G7EA 1EV9A 1S3CA 1TXXA 2CX3A 3RAZA 2RLIA 4ZL7A 1B4QA 3W6GA 3TJKA 2E0QA 2PGTA 1R4WA 3M0FA 5KN3A 3ZIVA 2GSRA 1U87A 4JU5A 2BTOT 2HSNB 5A4VA 2H6YA 2D2ZA 3HYPA 4KSMA 1PL2A 3Q6OA 1PN9A 2OE3A 4EVMA 3MNGA 4V2MA 3SWLA 2HI7A 4YQUA 3TDGA 4EF0A 3FR3A 1HD2A 3VPTA 5G5EA 1A8YA 1FVKA 1F3AA 4G19A 1UVZA 20GSA 3GA4A 3IA1A 5HFKA 3L78A 1ZZYA 2K9FA 1JZWA 2MZCA 2X8CA 3RHBA 3EMPA 2JACA 1ST9A 4POBA 3LG6A 2HRAA 1V57A 1B48A 3IAS2 4N0VA 1YDKA 2LJKA 2YJHA 2IL3A 1S3AA 4ECIA 1URMA 5DALB 2RUFA 3J7Yk 6GSYA 4EXJA 4JR6A 1LJRA 3VK9A 2EIOA 2RM5A 2LRNA 4J2FA 5CRDA 4J57E 4ZIJA 3FW2A 4HU7A 4G2EA 3I69A 1XVQA 5B6NA 3D22A 4X0XA 13GSA 1DSBA 2IMFA 4X43A 1GSUA 5D9TA 3VLNA 4IJ3A 2C0GA 4XIHA 2LEGA 4I97A 3F3QA 2O8VB 4MJBA 2HZFA 5KN1A 2MMNA 1K3LA 3HJMA 1X5EA 5F06A 2R6KA 3FY7A 2VOCA 3HXSA 4EDZA 5H5SA 2TRXA 4MF5A 5CAXA 2IMEA 3F63A 1GSYA 5ECOB 2L5LA 2B6MA 1N2AA 3BOAA 2RIIA 3A2XA 3IC4A 1ZYEA 1ZYQB 2M46A 3O3TA 2B7JA 2VL2A 2H66A 3LJRA 1U6TA 2B5YA 5GZZB 3F9UA 4JZQA 4F9ZA 1GTUA 2WDUA 4RUVA 3QOUA 1K0OA 3IV4A 3F6DA 1BQ7A 3G7JA 3IPZA 1YF1A 4BVYA 1X9SB 3LXTA 2L4QA 2GLRA 5ECNB 4I8BA 2WCIA 1YEXA 1F2EA 4AJ8A 4BVYB 1SKSB 1M9BA 2R5GA 2CA8A 4WEYA 3V1WA 3DMLA 2DJ3A 1O73A 1EV4A 4TRXA 3C1SA 3IC8A 5IMFA 1TI3A 1XVWA 3WGDA 3D5JA 1U3AA 3HKRA 1Z5YE 3K8NA 2YWIA 1V40A 1MDJA 3QAVA 3WGEA 5CP1A 1SYRA 4IGJA 1I5GA 3RDWA 1DUGA 2GGTA 1ZMAA 3LYKA 3MWHA 4D73B 1GSSA 2B3SA 3ZTLA 1SU9A 3J7Yb 3W8SA 3VPQA 3TKSC 4Z7XA 1MTCA 3DD3A 4XCSA 1KBNA 4MDCA 2PN8A 4LA1A 2G2QA 2H0HA 5DAKA 4WR4A 1M99A 4K1FA 4ULXA 4ZB6A 1E2YA 2H76A 2KOKA 3GNJA 3HJPA 3VURA 6GSUA 1H75A 3ERFA 2C3TA 3KMNA 4AGSA 1AC1A 4XS4B 2YJ7A 5D96A 4GSSA 2HRFA 3GL5A 1IYIA 1Z9HA 3LQ7A 1GNWA 2HZEA 3EURA 2V6OA 1ERVA 1Z7RA 1GTIA 2NTOA 4YAVA 2GSQA 3ME7A 5HQPA 1AXDA 2PWJA 1NHYA 1V98A 3D4TA 1A8LA 3EVIA 5ECMB 2AHEA 4PQHA 2AUVA 3WD6A 5D9VA 4KA0A 3FHKA 4DSSA 2FLSA 2CVDA 3TRQA 4MJCA 4N10A 1GSEA 2C4JA 3QAWA 1KNGA 2OE0A 3HA9A 1YQ1A 3GX8A 4POKA 3VI7A 1X9WB 1AQXA 5EPFA 4EE0A 3KP8A 4MCUA 4O7HA 1AQWA 4TR1B 2ZNMA 3GYKA 5HR3A 5CREA 4X1UA 4IQ1A 1JFUA 1SD9A 2LTKA 1FAAA 2IFQA 5AN1A 2XHFA 4N30A 1TOFA 3QAGA 3QCPA 11GSA 4L8EA 3EINA 2QSIA 4Q5NA 3IE3A 1YKAA 4HOJA 4V2NA 1PQNA 4JR4A 4ZBBA 2L59A 1LU4A 5EL8A 1I9DA 2ON7A 3D0ZA 2TRCP 1GL8A 4NXIA 2O87A 4BVXB 3U6VA 4K0NA 4E8HA 5H5QA 2PUKC 2YANA 1A0RP 3ZITA 2L5OA 4KCEA 2YZUA 1BG5A 1XFLA 1ZOFA 2FA8A 1T7PB 1RK4A 1SD8A 2FWGA 3GIXA 2GS3A 1E6BA 1GUKA 4KNDA 2GQLA 1AUCA 3TJBA 3HY2A 1ZGNA 5ECPB 4NAXA 4HEA2 3ZLPA 1Q4JA 3CSHA 3GKMA 3QPMA 1K3OA 1SK2A 3N5OA 4ACSA 5IMDA 3BBYA 4MF7A 3UEMA 1PL1A 2DJ1A 2AJQB 2ZCTA 2NBSA 1K0MA 4L5LA 4LMWA 4GLTA 5D73A 5ECLB 3UARA 5CRWA 1WOUA 1TU7A 2HLSA 5ECSA 2FA4A 4GXZA 1HQOA 1J08A 3D6IA 1T8EB 1V58A 3WT2A 2PBJA 1O8XA 1HYUA 2VL9A 3TKPA 5IOXA 1A23A 3L9UA 5CYYA 3GN3A 2A2RA 2YWNA 5DJLA 1M9AA 3HVXA 3IOSA 4I5QA 2H72A 2C1YA 2EC4A 2KP2A 2OBIA 1NSWA 2R3XA 2WGRA 4ZBDA 2OBKA 2J9HA 3LORA 4WF5A 4PXOA 4BL7B 3UIWA 1OYJA 3ZMKA 2MYGA 1YEPA 1EGRA 1VF1A 2FWHA 1K0DA 4ZILA 2O89A 1OC3A 3KGKA 4E8EA 1LBKA 3GKXA 2EIQA 5E4WA 1F9MA 2DJKA 1GNEA 2VCXA 5G2ZA 5C04A 1TU8A 3M3MA 2KLXA 2KP1A 1NW2A 2IPAA 2PU9C 4TXOB 1VF3A 2FNOA 5ECQB 5LCZA 1K0BA 4MABA 2XPEA 3GX0A 2XBIA 3D21A 4DSQA 2GT5A 2OA7A 4K7OA 3E3EA 2VCQA 4MLYA 3F4RA 1M7TA 1WWJA 1K0AA 4ZXGA 4NHWA 2L57A 2V1MA 4TR3A 5ABRA 2E2MA 2F3MA 5ECIB 5CO3A 18GSA 3LSZA 2NDOA 2R2JA 3TKSE 5CRGA 1PSQA 2H19A 3CRTA 4MPGA 4Q5QA 1TRSA 4YH2A 3GV1A 3IR4A 1YKCA 1GULA 2NVLA 2GT6A 3KCMA 3FR9A 3CSJA 2AYTA 2JSZA 1SK0A 3RPNA 4MMMA 1X0RA 1AQVA 4BPYA 3TKSA 3Q18A 1B4PA 4PUFC 3ZREA 1O85A 5A5KA 2K18A 3IAM2 2LSTA 3TKRA 4KE3A 4K0GA 4PX1A 3US3A 1V9WA 1PGTA 4KDUA 1K3YA 3IBHA 1T00A 4XRDA 3ZVJA 3Q19A 2CX4A 2YWOA 4EL1A 2V32A 4KDYA 4Q5FA 5DALA 4KUNA 2O85A 3O6TA 1Y25A 4BA7A 2GZYA 4IP1A 1A0FA 4EDYA 3APSA 4FYBA 3DEXA 5G1LA 3FZ5A 5LNKe 2ZUPA 2HNLA 3QD9A 3VWVA 1TTZA 3G7IA 3DKSA 3EU3A 1HNBA 3H8QA 4HQZA 5CNWA 5ENUA 2WULA 3EC3A 4ZL9A 2DJ0A 2HT9A 4HI7A 3F8UA 2BMXA 1A2LA 4HUAA 2GVPA 2X64A 3GL3A 3UOMA 2CT6A 2VAFA 3IXRA 1JLVA 4HZ4A 4P3YB 4NMUA 1WE0A 1UC7A 4MJAA 4IBPA 3BCKA 2IMKA 1YF0A 1O81A 2I1UA 2OACA 5J4UA 2DIYA 1XBSA 3C71A 4G0KA 4J56E 2RUEA 1TI1A 4KSOA 3GURA 4XHMA 4F03A 3R3EA 4FQUA 1XCCA 1PRXA 3EMXA 4RI6A 8GSSA 4TOPA 5DJMA 2O7KA 2MMAA 1X9MB 4F2IA 2RM6A 4HDEA 4PGTA 1SL2B 1O8WA 3GKKA 4NPBA 5IMCA 2V41A 4HQSA 2QC7A 2VM1A 2HXKA 2PVQA 2HRKB 3TOUA 2X8HA 2CZ3A 3VWXA 3A2WA 1T4ZA 3FR6A 5F0GA 2GTUA 4OO5A 4IKHA 3OR5A 2VCZA 1B9YC 1DBYA 1A24A 6GSXA 1M2BA 2L4CA 4TR0A 5H5RA 3UL3A 1GSQA 1XZOA 4NV5A 1OKTA 3VI5A 3ISOA 2KHPA 4GTUA 4KF9A 3ZZXA 1JZRA 4JE1A 3S9FA 4D73A 3HCZA 2H6ZA 2E7PA 1GLPA 2CVKA 1MDKA 5DCHA 1GP1A 2C3QA 5KN0A 2C0FA 1FB6A 1J0FA 2FGXA 4MZWA 1UN2A 4HU9A 1BX9A 5JCWA 4CDOA 3RBTA 2DJJA 2FY6A 4ZB8A 3LWAA 1ZCPA 2JSYA 2H1DA 4TW5A 3UMAA 4XS4A 5GSSA 4FH8A 1QK8A 3UAPA 5ELAA 4USSA 2VUPA 5IPHA 4JEDA 4YQVA 1GSFA 4MPFA 2LNTA 1C72A 1FHEA 16GSA 3GKNA 3LYPA 3RPPA 2AAWA 3M8NA 1TK5B 3R2QA 4I2TA 3JCML 1CQHA 3DWVA 4K7IA 3M1GA 1U88A 5KEJA 3L9SA 2H6XA 2H75A 3C73A 3P90A 3DRNA 1AAZA 3APOA 5ECHB 3GMFA 5INYA 2CVBA 3WT1A 3KEBA 2MBTA 2GSSA 5ID2B 5DDLA 1GRXA 4TR1A 4XS1A 3P8WA 1TK0B 1SKRB 5HR1A 1BYEA 1SJ6A 3DXBA 2VCTA 2FWFA 1SK1A 3EE2A 1GH2A 3HVSA 4HJ2A 4F82A 3HZ4A 4CHSA 2H73A 1ILOA 3A3TA 3KM6A 4TVEA 2XBQA 3L9VA 2P31A 2JZRA 4LMVA 1NHOA 3VWWA 1A2MA 4GQFA 5JWOB 4PUAA 2F51A 4N0ZA 2HQTA 4I2UA 1TDIA 4BVXA 2OJLA 3P7XA 3MAKA 4WR5A 7GSSA 2P0GA 2H01A 3EU4A 1XXUA 4IW9A 2WJUA 1ON4A 2DSAA 1EOGA 2NPBA 2FCHA 1YJ6A 2LJAA 3FK8A 2H0IA 1DE2A 1MD4A 1T1VA 1Q98A 4EKZA 3G7YA 1THOA 1XWBA 4WXTA 2C0EA 4NHZA 4WBRD 4ZB9A 5LD0A 3DVXA 2H1GA 3QMXA 2V6KA 1HNCA 3EYTA 3UBKA 3UJ1A 2JL4A 2C3NA 2FHEA 1SKWB 2DLXA 3C1RA 3HHVA 3HVVA 2WFCA 4IN0A 4TXVA 2VLVA 4IHUA 2WS2A 3IRAA 2OADA 4Q5RA 2P5QA 3LXZA 3GH9A 1XIYA 5HFIA 2AV4A 3CMIA 3ZL5A 3ERGA 5J41A 3KH7A 4GSTA 1G0TA 2F8AA 4PQIA 2VLUA 2B1LA 3GSSA 4OMVA 2F8FA 3HZ8A 3SBCA 5CRHA 3L4NA 1BEDA 1R26A 2H1BA 1KEBA 5J9BA 4MZBA 2YV9A 4HS1A 5FHIA 4KCAA 3CXGA 1NM3A 4WKWA 2XC2A 1GLQA 2CAQA 2HSMB 4BL7A 1BAYA 3DVWA 4WBJA 4PNFA 5JCGA 1PX6A 1TK8B 3MDKA 4OFNA 2I3YA 1TRVA 3A5WA 4BWSA 1KTEA 2VD0A 1JZOA 3UVHA 2VLTA 2F9SA 3QR6A 1AIUA 3TJGA 2DC5A 1AW9A 4MA9A 2X99A 2YZHA 4GRFA 2PPTA 3H93A 1XPVA 3QFBC 4KW6A 2I4AA 1VF2A 3RHCA 4TXOA 5IOWA 1SJZA 2H71A 4QQ7A 4JBBA 1MEKA 2VO4A 1FW1A 3U5RE 1SENA 2LRTA 4GCIA 2KUCA 4MK3A 5J9CA 4IP6A 2YCDA 2YNXA 4ISDA 5F8BA 2K6VA 1TRWA 3MSZA 5HFGA 4NWYA 3A2VA 2C80A 1XWAA 3ZIJA 5DCGA 4POMA 5D93A 1SJIA 3GTUB 1O7UA 4LL1B 5COHA 5ECKB 5IMVA 3CTGA 4YAPA 2REMA 4KGIA 5IMAA 2FWEA 6GSSA 2XPDA 3O76A 1WIKA 4N11A 3C8EA 4G0IA 2ON5A 4AF2A 3M9KA 1OAZA 1OE7A 2BJXA 3VFIA 3P2AA 2IJYA 3BD2A 2YN1A 4TR4A 3FYGA 5F05A 1TRUA 2DMMA 3WGXA 2JU5A 1GUHA 1U3IA 6GSWA 3PPUA 2GQKA 4QL7A 5JCUA 2AB6A 1OKDA 4OFTA 2IIYA 4EO3A 3KZQA 2DJ2A 2M80A 1J9BA 2LQOA 1FVJA 3CBUA 4TN8A 4JRRA 4XTSA 4OCFA 5AIVA 5GSTA 14GSA 1GSDA 4HZ2A 3ZRDA 1FOVA 2PERA 3E9JB 3GFKA 3H4KA 3TB2A 3TRPA 1VF4A 1H4OA 1WJKA 4FYCA 2C8UA 1B8XA 3DYRA 10GSA 4ECBA 4K2DA 2C0DA 2ALBA 1WMJA 4ML6A 2JADA 3KD0A 4LL4B 4ILFA 2IMDA 1XOAA 4O5RA 1TP9A 4IELA 1FB0A 1FO5A 4WF4A 3KIJA 4ZBAA 2FD3A 1IYHA 3AY8A 3PH9A 1R7HA 3UVTA 1Z6NA 4V1Ag 4RI7A 3C7MA 2LNSA 1X5DA 2A4VA 5A4UA 4L0WA 3KP9A 1RW1A 2PMTA 5EVOA 4MJEA 4XS6A 3EWLA 1DE1A 5IQYA 3LEFA 3D4MA 4ML1A 3IK7A 4QL9A 2I81A 2GSTA 5C00A 2HRKA 1JHBA 4FIWA 5IMZA 1TKDB 4L5OA 1OC8A 2CZ2A 1Z6MA 2CQ9A 2B7KA 3E0UA 4XRAA 3TKQA 4GWRA 4CW9A 1USBA 1RQMA 2H8LA 22GSA 2LV3A 5IO0A 4OO4A 2YV7A 2J23A 4NV2A 1T3BA 2UZ8A 3FZ4A 2MBSA 3HJOA 3QDNA 4MF6A 2DBCA 3F0IA 1M2DA 4DSRA 5B6MA 1GTBA 3FEUA 3CSIA 4V1Ap 2MMZA 2GQMA 5KN2A 1EOHA 4DVCA 5G31A 2YWMA 1WRYA 4TKYA 2CAIA 3VWUA 4GSNA 4V2LA 1TJDA 2VL3A 2H70A 3F4SA 5IM9A 19GSA 1EGOA 1F3BA 1F6MC 3BCIA 4IS0A 1BJXA 4G0LA 6GSVA 4OCEA 1QFNA 2I9HA 3GRXA 4PTSA 3ERWA 1PKZA 4FO5A 2PVOC 3FZ9A 1B9XC 1HNAA 2L6DA 2YP6A 1YY7A 5G5FA 1QXHA 2M72A 3TJJA 3TJFA 4KX4A 4I6XA 1GTAA 4KH7A 3FRCA 4G10A 5DAKB 4EC0A 4ID0A 1QGVA 2N5BA 3APQA 3TGZA 3CRUA 3F4TA 4KB3A 5J5NA 2LJRA 2LKUA 2HSHA 3TCOA 4PNGA 3H79A 2HYXA 12GSA 3HDCA 1ERUA 3W8JA 4K7NA 2L6CA 2HSYA 2V2GA 1XWKA 2WB9A 4ECJA 1X5CA 1THXA 4OFMA 3LFLA 4BWQA 2HZEB 3NZNA 2YOIA 4F0BA 5ID2A 2TIRA 5E59A 1OE8A 5JWRB 2HFDA 4H86A 4KAEA 5AGYA 1UA5A 3UBLA 2H0GA 4K6XA 5G1KA 4K9ZA 1ERTA 1EEMA 1GWCA 4MZCA 3TOTA 2JZSA 1JLWA 3F6FA 3KH9A 1XW6A 17GSA 4K8MA 3TUEA 3DIEA 2OE1A 4DSSB 2B1KA 5B8BA 4KDXA 2DMLA 1EZKA 1K0NA 3QFAC 6GSTA 2R4VA 3ZYWA 2E2GA 3LGCA 5D9XA 1ERWA 1XW5A 1ACVA 4PQ1A 3KTBA 2LRCA 1ABAA 2VM2A 2GDRA 1V2AA 1W89A 1CQGA 1PMTA 4IJIA 4GQCA 2N5AA 1WPIA 1S3DA 5J3RA 3ME8A 1ML6A 3KXOA 2IN3A 2VL2C 2IFQB 3DGQA 1R5AA 2MMOA 3IK9A 2QKEA 2VCVA 4L0UA 1QMVA 5F07A 3I9V2 1G6YA 1EP7A 1SL1B 4RQXA 2VCWA 3FKFA 3PINA
chains in the Genus database with same CATH superfamily
2EIRA 1F37A 5G30A 1MDIA 2WZSA 2LS5A 2OKAA 5DQSA 1VGLA 1OVNA 4GF0A 1R5PA 4PURA 3PGTA 5DQYA 3GSTA 4ZL8A 1EWXA 2LQQA 4AJ7A 4HJMA 3RGBC 3ZFLA 1XWGA 3KMOA 3I43A 5GAND 4G9HA 4OWYA 3BJ5A 2FUG2 1SYXA 4IQAA 3M9JA 5ECRB 2LUSA 3KTLA 5IO2A 4FYUA 2H30A 5HR0A 5BMUA 5D8IA 3IHGA 5ELGA 2HRNA 4Z2RA 3IDVA 1PKWA 1TW9A 2WRTA 1GUMA 1SL0B 4F0CA 2CV4A 2A2SA 3GH6A 4YQMA 1XW9A 1M2AA 1WP0A 2VIMA 5AISA 4POLA 4WETA 1XWCA 5J4YA 5AIXA 3N9JA 3GHAA 1QQ2A 1M0UA 2JZTA 1FG4A 1JZDA 2Z9SA 2WZ9A 1XOBA 2IMIA 1T4YA 1EEJA 1S3RA 3ED3A 3NOFA 1QUWA 4DEJA 1VRSD 5FT3A 2HSMA 2GZPA 1TXUA 4ECCA 1PX7A 3ZFBA 5DBQA 9GSSA 5A4WA 5JWQB 1EP8A 2IWTA 4LLRA 1N8JA 2DIZA 4O32A 5IPGA 1PA3A 3IHQA 2K8SA 4OD7A 2VD1A 1Y6EA 4IVFA 4MP4A 4RQRA 5EY6A 3Q74A 5B8AA 3H1NA 2QGVA 2K8VA 5B7CA 2R37A 4MH2A 3ZMLA 2X8GA 5DVBA 1YZXA 1W4VA 3CYNA 3G9BA 5GAPD 3FZAA 1O6JA 3PR8A 1Z7PA 3HD5A 2B5EA 2B5XA 1G6WA 3GUSA 4AJ6A 5HR2A 2G0FA 1G7OA 5FWGA 3F3RA 5D9WA 1Z3EA 1MD3A 2N5FA 1A2JA 3NIVA 1ZL9A 2YPMA 3CTFA 3L0HA 5L71A 1K0CA 5IIZA 4MH3A 3I6AA 1PD21 3WYWA 1OC9A 3GTUA 2H1AA 2HE3A 4K5RA 2P5RA 1OC9B 2H74A 4O92A 2ES7A 3ZVJD 4EUYA 3KJYA 3TRXA 2GZZA 1G7EA 1EV9A 1S3CA 1TXXA 2CX3A 3RAZA 2RLIA 4ZL7A 1B4QA 3W6GA 3TJKA 2E0QA 2PGTA 1R4WA 3M0FA 2WVYA 5KN3A 3ZIVA 2GSRA 1U87A 4JU5A 2BTOT 2HSNB 5A4VA 2H6YA 2D2ZA 3HYPA 4KSMA 1PL2A 3Q6OA 1PN9A 4AKGA 2OE3A 2WW1A 4EVMA 3MNGA 4V2MA 3SWLA 2HI7A 4YQUA 3TDGA 4EF0A 3FR3A 1HD2A 5J47A 3VPTA 5G5EA 1A8YA 1FVKA 1F3AA 4G19A 1UVZA 20GSA 3GA4A 3IA1A 5HFKA 3L78A 2O5VA 1ZZYA 2K9FA 1JZWA 2MZCA 2X8CA 3RHBA 3EMPA 2JACA 1ST9A 4POBA 3LG6A 5BRTA 2HRAA 1V57A 1B48A 3IAS2 4N0VA 1YDKA 2LJKA 2YJHA 2IL3A 1S3AA 4ECIA 1URMA 5DALB 2RUFA 3J7Yk 6GSYA 4EXJA 4JR6A 1LJRA 3VK9A 2EIOA 2RM5A 2LRNA 4J2FA 5CRDA 4J57E 4ZIJA 3FW2A 4HU7A 4G2EA 3I69A 1XVQA 5B6NA 3D22A 4X0XA 13GSA 1DSBA 2IMFA 4AKHA 4X43A 1GSUA 5D9TA 3VLNA 4IJ3A 4PI0C 2C0GA 4XIHA 2LEGA 4I97A 3F3QA 2O8VB 4MJBA 2HZFA 5KN1A 2MMNA 1K3LA 3HJMA 1X5EA 5F06A 2R6KA 3FY7A 2VOCA 1SVLA 3HXSA 4EDZA 5H5SA 2TRXA 4O5UA 4MF5A 3HVNA 5CAXA 2IMEA 3F63A 1GSYA 5ECOB 2L5LA 2B6MA 3FMWA 1N2AA 3BOAA 2RIIA 3A2XA 3IC4A 1ZYEA 1ZYQB 2M46A 3O3TA 2B7JA 1I1IP 2VL2A 2H66A 3LJRA 1U6TA 2B5YA 3RFRC 5A34B 5GZZB 3F9UA 4JZQA 4F9ZA 1GTUA 2WDUA 4RUVA 3QOUA 1K0OA 3IV4A 4Z2TA 3F6DA 1BQ7A 3G7JA 3IPZA 1YF1A 4BVYA 1X9SB 3LXTA 2L4QA 2GLRA 5ECNB 4I8BA 2WCIA 2VKZG 1YEXA 1F2EA 4AJ8A 4BVYB 1SKSB 1M9BA 2R5GA 2CA8A 4WEYA 3V1WA 3DMLA 2DJ3A 1O73A 1EV4A 4TRXA 3C1SA 3IC8A 4E68A 5IMFA 2QA2A 1TI3A 1XVWA 3WGDA 3D5JA 2H1LA 1U3AA 3HKRA 1Z5YE 3K8NA 1PFOA 2YWIA 1V40A 1MDJA 3QAVA 3WGEA 5CP1A 1SYRA 4IGJA 1I5GA 3RDWA 1DUGA 2GGTA 1ZMAA 3LYKA 3MWHA 4D73B 1GSSA 2B3SA 3ZTLA 1SU9A 3J7Yb 3W8SA 3VPQA 3TKSC 2X4AA 4Z7XA 1MTCA 3DD3A 4XCSA 1KBNA 4MDCA 2PN8A 4LA1A 2G2QA 2H0HA 5DAKA 4WR4A 4X4JA 1M99A 4K1FA 2OT3A 4ULXA 4ZB6A 1E2YA 2H76A 2KOKA 3GNJA 3HJPA 3VURA 6GSUA 1H75A 3ERFA 2C3TA 3KMNA 4AGSA 1AC1A 4XS4B 2YJ7A 5D96A 4GSSA 2HRFA 3GL5A 1IYIA 1Z9HA 3LQ7A 1GNWA 2HZEA 3EURA 2V6OA 1ERVA 1Z7RA 1GTIA 2NTOA 4YAVA 2GSQA 3ME7A 5HQPA 1AXDA 2PWJA 1NHYA 1V98A 3D4TA 1A8LA 3EVIA 5ECMB 2AHEA 4PQHA 2AUVA 3EPTA 3WD6A 5D9VA 4KA0A 3FHKA 4DSSA 2FLSA 2CVDA 3TRQA 2EFDA 4MJCA 4N10A 1GSEA 2C4JA 3QAWA 1KNGA 2OE0A 3HA9A 1YQ1A 3GX8A 4POKA 4FXYP 3VI7A 1X9WB 5KOWA 1AQXA 5EPFA 4EE0A 3KP8A 4MCUA 4O7HA 1AQWA 4TR1B 2ZNMA 3GYKA 5HR3A 5CREA 4X1UA 4IQ1A 1JFUA 1SD9A 2LTKA 1FAAA 2IFQA 5AN1A 2XHFA 4N30A 1TOFA 3QAGA 3QCPA 3MIXA 11GSA 4L8EA 3EINA 2QSIA 4Q5NA 1SVOA 3IE3A 1YKAA 2O3EA 4HOJA 4V2NA 1PQNA 4JR4A 4ZBBA 2L59A 1LU4A 5EL8A 1I9DA 2ON7A 3D0ZA 2TRCP 1GL8A 4NXIA 2O87A 4BVXB 5J40A 3U6VA 4K0NA 4E8HA 5H5QA 2PUKC 2YANA 1A0RP 3ZITA 2L5OA 4KCEA 2YZUA 1BG5A 1XFLA 1ZOFA 2FA8A 1T7PB 4PI2C 1RK4A 1ZYNA 1SD8A 2FWGA 3GIXA 2GS3A 1E6BA 1GUKA 4KNDA 2GQLA 1AUCA 3TJBA 3HY2A 1ZGNA 5ECPB 4NAXA 4HEA2 3ZLPA 1Q4JA 3CSHA 3GKMA 3QPMA 1K3OA 1SK2A 3N5OA 4ACSA 5IMDA 3BBYA 4MF7A 3UEMA 1PL1A 2DJ1A 2AJQB 2ZCTA 2NBSA 1K0MA 4L5LA 4LMWA 4GLTA 5D73A 5ECLB 3UARA 5CRWA 1WOUA 1TU7A 2HLSA 1N25A 5ECSA 2FA4A 4GXZA 1HQOA 1J08A 3D6IA 1T8EB 1V58A 3WT2A 2PBJA 1O8XA 1HYUA 2VL9A 3TKPA 5IOXA 1A23A 3L9UA 5CYYA 3GN3A 2WVZA 2A2RA 2YWNA 5DJLA 1M9AA 1SVMA 3HVXA 3IOSA 4I5QA 2H72A 2C1YA 2EC4A 2KP2A 2OBIA 1NSWA 2R3XA 2WGRA 4ZBDA 2OBKA 2WW0A 2J9HA 3LORA 4WF5A 1XG8A 4PXOA 4BL7B 3UIWA 1OYJA 3ZMKA 2MYGA 4ZB7A 1YEPA 1EGRA 1VF1A 2FWHA 1K0DA 4ZILA 2O89A 1OC3A 3KGKA 4E8EA 1LBKA 1FOHA 3GKXA 2EIQA 5E4WA 1F9MA 2DJKA 1GNEA 2VCXA 5G2ZA 4GDFA 5C04A 1TU8A 3M3MA 2KLXA 4K5SA 2KP1A 1NW2A 2IPAA 2PU9C 4TXOB 1VF3A 2FNOA 5ECQB 5LCZA 1K0BA 4MABA 2XPEA 3GX0A 2XBIA 3D21A 4DSQA 2GT5A 2OA7A 3E3EA 2VCQA 4K7OA 4MLYA 3F4RA 1M7TA 1WWJA 1K0AA 4ZXGA 4NHWA 5A5HB 2L57A 2V1MA 4TR3A 5ABRA 2E2MA 2F3MA 5ECIB 5CO3A 2EFHA 18GSA 3LSZA 2NDOA 2R2JA 3TKSE 5CRGA 1PSQA 2HSNA 3CRTA 2H19A 4MPGA 4Q5QA 1M3JA 1TRSA 4YH2A 3GV1A 3IR4A 1YKCA 3HMJG 1GULA 2NVLA 2GT6A 3KCMA 3FR9A 4QMKA 3CSJA 2AYTA 2JSZA 1SK0A 3RPNA 4MMMA 1X0RA 1AQVA 4BPYA 3TKSA 3Q18A 1B4PA 4PUFC 3ZREA 1O85A 5A5KA 2K18A 3IAM2 2LSTA 3TKRA 4KE3A 4K0GA 4PX1A 3US3A 1V9WA 1PGTA 4KDUA 1K3YA 3IBHA 1T00A 4XRDA 2X49A 3ZVJA 3Q19A 2CX4A 2YWOA 4EL1A 2V32A 4KDYA 4YKGA 4Q5FA 5DALA 2EFEA 4KUNA 2O85A 3O6TA 1Y25A 4BA7A 2GZYA 4IP1A 1A0FA 4EDYA 3APSA 4FYBA 3DEXA 5G1LA 4N3ZA 3FZ5A 5LNKe 2ZUPA 2HNLA 3QD9A 3VWVA 4BIKA 2DKIA 2WVXB 1TTZA 3G7IA 3DKSA 3EU3A 1HNBA 3H8QA 4HQZA 5CNWA 5ENUA 2WULA 3EC3A 4ZL9A 5A1NB 2DJ0A 2HT9A 4HI7A 3F8UA 2BMXA 1A2LA 4HUAA 2GVPA 2X64A 3GL3A 3UOMA 2CT6A 2VAFA 3IXRA 1JLVA 4HZ4A 4P3YB 4NMUA 1WE0A 5KOXA 1UC7A 4MJAA 4IBPA 3BCKA 2IMKA 1YF0A 1O81A 2WW2A 2I1UA 2OACA 5J4UA 2DIYA 1XBSA 3C71A 4G0KA 4J56E 2RUEA 1TI1A 4KSOA 3GURA 4XHMA 5A34A 4F03A 3R3EA 4FQUA 1XCCA 1PRXA 3EMXA 4RI6A 8GSSA 4TOPA 5DJMA 2O7KA 2MMAA 1X9MB 4F2IA 2EFCA 2RM6A 4HDEA 4PGTA 1SL2B 1O8WA 3GKKA 4NPBA 5IMCA 2V41A 4HQSA 2QC7A 2VM1A 2HXKA 1S4BP 2PVQA 2HRKB 3TOUA 2X8HA 2CZ3A 3VWXA 3A2WA 1T4ZA 3FR6A 5F0GA 2GTUA 4OO5A 4IKHA 3OR5A 2VCZA 4W66A 1B9YC 1DBYA 1A24A 6GSXA 1M2BA 2L4CA 4TR0A 5H5RA 3UL3A 1GSQA 1XZOA 4NV5A 1OKTA 3VI5A 3ISOA 2KHPA 4GTUA 4KF9A 3ZZXA 1JZRA 1PN0A 4JE1A 3S9FA 4D73A 3HCZA 2H6ZA 2E7PA 1GLPA 4AI6A 2CVKA 1MDKA 5DCHA 1GP1A 2C3QA 5KN0A 2C0FA 1FB6A 1J0FA 2FGXA 4MZWA 1UN2A 4HU9A 1BX9A 5JCWA 4CDOA 3RBTA 2DJJA 2FY6A 4ZB8A 3LWAA 1ZCPA 2A2PA 2JSYA 2H1DA 4TW5A 3UMAA 4XS4A 5GSSA 4FH8A 1QK8A 3UAPA 5ELAA 4USSA 2VUPA 5IPHA 4JEDA 4YQVA 1GSFA 4MPFA 2LNTA 1C72A 1FHEA 16GSA 3GKNA 3CWGA 4CY6A 3LYPA 3RPPA 2AAWA 3M8NA 1TK5B 3R2QA 4I2TA 3JCML 1CQHA 3DWVA 4K7IA 3M1GA 1U88A 5KEJA 3L9SA 2H6XA 2H75A 3C73A 3P90A 3DRNA 1AAZA 3APOA 5ECHB 3GMFA 5INYA 2CVBA 3WT1A 3KEBA 1BF5A 2MBTA 2GSSA 2A4HA 5ID2B 5DDLA 1GRXA 4TR1A 4K2XA 4XS1A 3P8WA 1TK0B 1SKRB 5HR1A 1BYEA 1SJ6A 3DXBA 2VCTA 2FWFA 1SK1A 3EE2A 1GH2A 3HVSA 4HJ2A 4F82A 3HZ4A 4CHSA 2H73A 1ILOA 3A3TA 3KM6A 4TVEA 2XBQA 3L9VA 2P31A 2JZRA 4LMVA 1NHOA 3VWWA 1A2MA 4GQFA 5JWOB 4PUAA 2F51A 4N0ZA 2HQTA 4I2UA 1TDIA 4BVXA 2OJLA 3P7XA 3MAKA 4WR5A 7GSSA 2P0GA 2H01A 3EU4A 1XXUA 4IW9A 3A5IA 2WJUA 1ON4A 2DSAA 4PHZC 4EIQA 4A5PA 1EOGA 2NPBA 2FCHA 1YJ6A 2LJAA 3FK8A 2H0IA 1DE2A 1MD4A 1T1VA 1Q98A 4EKZA 3G7YA 1THOA 1XWBA 4WXTA 2C0EA 4NHZA 4WBRD 4ZB9A 5LD0A 3DVXA 2H1GA 3QMXA 2V6KA 1HNCA 4AKIA 3EYTA 3UBKA 3UJ1A 2JL4A 2C3NA 2FHEA 1SKWB 2DLXA 3C1RA 3HHVA 3HVVA 2WFCA 4IN0A 4TXVA 2VLVA 4IHUA 2WS2A 3IRAA 2OADA 4Q5RA 2P5QA 3LXZA 3GH9A 1XIYA 5HFIA 5BMUB 2AV4A 1YEWC 3CMIA 3ZL5A 3ERGA 5J41A 3KH7A 4GSTA 1G0TA 2F8AA 4PQIA 2VLUA 2B1LA 3GSSA 4OMVA 2F8FA 3HZ8A 3SBCA 5CRHA 3L4NA 1BEDA 1R26A 2H1BA 1KEBA 3TU3B 5J9BA 4MZBA 2YV9A 4HS1A 5FHIA 4KCAA 2WW3A 3CXGA 1NM3A 4WKWA 2XC2A 1GLQA 2CAQA 2HSMB 4BL7A 1BAYA 3DVWA 4WBJA 4PNFA 5JCGA 2R0CA 1PX6A 1TK8B 3MDKA 4OFNA 2I3YA 1TRVA 3A5WA 4BWSA 1KTEA 2VD0A 1JZOA 3UVHA 2VLTA 2F9SA 3QR6A 1AIUA 3TJGA 4CY8A 2DC5A 1AW9A 4MA9A 2X99A 2YZHA 4GRFA 2PPTA 3H93A 1XPVA 3QFBC 4EIPA 4KW6A 2I4AA 1VF2A 3RHCA 4TXOA 5IOWA 1SJZA 2H71A 4QQ7A 4JBBA 1MEKA 2VO4A 1FW1A 3U5RE 1SENA 2LRTA 4GCIA 2KUCA 4MK3A 5J9CA 4IP6A 2YCDA 2YNXA 4ISDA 5F8BA 5A5HA 2K6VA 1TRWA 3MSZA 5HFGA 4NWYA 3A2VA 2C80A 1XWAA 3ZIJA 5DCGA 4POMA 5D93A 1SJIA 3GTUB 1O7UA 4LL1B 5COHA 5ECKB 5IMVA 3CTGA 4YAPA 2REMA 4KGIA 5IMAA 2FWEA 6GSSA 2XPDA 3O76A 1WIKA 4N11A 3C8EA 4G0IA 2ON5A 4AF2A 3M9KA 1OAZA 1OE7A 2BJXA 3VFIA 3P2AA 2IJYA 3BD2A 2YN1A 4TR4A 3FYGA 5F05A 1TRUA 2DMMA 3WGXA 2JU5A 1GUHA 1U3IA 3LW9A 6GSWA 3PPUA 2GQKA 4QL7A 5JCUA 2AB6A 1OKDA 4OFTA 2IIYA 4EO3A 3KZQA 2DJ2A 2M80A 1J9BA 2LQOA 1FVJA 3CBUA 4TN8A 4JRRA 4XTSA 4OCFA 5AIVA 5GSTA 14GSA 1GSDA 4HZ2A 3ZRDA 2WVXA 1FOVA 2PERA 3E9JB 3GFKA 3H4KA 3TB2A 3TRPA 1VF4A 1H4OA 1WJKA 4FYCA 2C8UA 1B8XA 5A1NA 3DYRA 10GSA 4ECBA 4K2DA 2C0DA 2ALBA 1WMJA 4ML6A 2JADA 3KD0A 4LL4B 4ILFA 2IMDA 1XOAA 4O5RA 1TP9A 4IELA 2QA1A 1FB0A 1FO5A 4WF4A 3KIJA 4ZBAA 2FD3A 1IYHA 3AY8A 3PH9A 1R7HA 3UVTA 1Z6NA 4V1Ag 4RI7A 3C7MA 2LNSA 1X5DA 2A4VA 5A4UA 4L0WA 3KP9A 1RW1A 2PMTA 5EVOA 4MJEA 4XS6A 3EWLA 1DE1A 5IQYA 3LEFA 4ICYA 3D4MA 4ML1A 3IK7A 4QL9A 2I81A 2GSTA 5C00A 2HRKA 1JHBA 4FIWA 5IMZA 1TKDB 4L5OA 3CHXC 1OC8A 2CZ2A 1Z6MA 2R0GA 2CQ9A 2B7KA 1Y1UA 3E0UA 4XRAA 3TKQA 4GWRA 4CW9A 1USBA 1RQMA 2H8LA 22GSA 2LV3A 5IO0A 1ZYPA 2UV8G 4OO4A 4G01A 2YV7A 2J23A 4NV2A 1T3BA 2UZ8A 3FZ4A 2MBSA 3HJOA 3QDNA 4MF6A 2DBCA 3F0IA 1M2DA 4DSRA 5B6MA 1GTBA 3FEUA 3CSIA 4V1Ap 2MMZA 2GQMA 5KN2A 3CQFA 1EOHA 4DVCA 5G31A 2YWMA 1WRYA 4TKYA 2CAIA 3VWUA 4GSNA 4V2LA 1TJDA 2VL3A 2H70A 3F4SA 5IM9A 19GSA 1EGOA 1F3BA 1F6MC 3BCIA 4IS0A 1BJXA 4G0LA 6GSVA 4HSCX 4OCEA 1QFNA 2I9HA 3GRXA 3MYDA 4PTSA 3ERWA 1PKZA 4FO5A 2PVOC 3FZ9A 1B9XC 1HNAA 2L6DA 2YP6A 4Z2UA 1YY7A 5G5FA 1QXHA 2M72A 3TJJA 3TJFA 4KX4A 4I6XA 1GTAA 4KH7A 3FRCA 4G10A 5DAKB 4EC0A 4ID0A 1QGVA 4MNNA 2N5BA 3APQA 3TGZA 3CRUA 3F4TA 4KB3A 5J5NA 2LJRA 2LKUA 2HSHA 4O5QA 3TCOA 4PNGA 3H79A 2HYXA 12GSA 3HDCA 1ERUA 3W8JA 4K7NA 2L6CA 2HSYA 2V2GA 1XWKA 2WB9A 4ECJA 1X5CA 1THXA 4OFMA 3LFLA 1BG1A 4BWQA 2HZEB 3NZNA 2YOIA 4F0BA 5ID2A 2TIRA 5E59A 1OE8A 5JWRB 2HFDA 4H86A 4KAEA 5AGYA 1UA5A 3UBLA 2H0GA 4K6XA 5G1KA 4K9ZA 1ERTA 1EEMA 1GWCA 4MZCA 2O36A 1M3IA 3TOTA 2JZSA 1JLWA 3F6FA 3KH9A 1XW6A 17GSA 2R0PA 2DKHA 4K8MA 3TUEA 3DIEA 2OE1A 4DSSB 2B1KA 5B8BA 4KDXA 2DMLA 1EZKA 1K0NA 3QFAC 6GSTA 2R4VA 3ZYWA 2E2GA 3LGCA 5D9XA 1ERWA 1XW5A 4YKFA 1ACVA 4PQ1A 3KTBA 2LRCA 1ABAA 2VM2A 2GDRA 1V2AA 1W89A 1CQGA 1PMTA 4IJIA 4GQCA 2N5AA 1WPIA 1S3DA 5J3RA 3ME8A 5J4VA 1ML6A 3KXOA 2IN3A 2VL2C 2IFQB 3DGQA 1R5AA 2MMOA 3IK9A 2QKEA 2VCVA 1YVLA 4AKXB 4L0UA 1QMVA 5F07A 3I9V2 1G6YA 1EP7A 1SL1B 4RQXA 2VCWA 3FKFA 3PINA
chains in the Genus database with same CATH topology
2EIRA 1F37A 5G30A 1MDIA 2OKAA 2LS5A 5DQSA 1VGLA 1OVNA 4GF0A 1R5PA 4PURA 3PGTA 5DQYA 3GSTA 4ZL8A 1EWXA 2LQQA 4AJ7A 4HJMA 3ZFLA 1XWGA 3KMOA 3I43A 5GAND 4G9HA 4OWYA 3BJ5A 2FUG2 1SYXA 4IQAA 3M9JA 5ECRB 2LUSA 3KTLA 5IO2A 4FYUA 2H30A 5HR0A 5BMUA 5D8IA 3IHGA 5ELGA 2HRNA 4Z2RA 3IDVA 1PKWA 1TW9A 2WRTA 1GUMA 1SL0B 4F0CA 2CV4A 2A2SA 3GH6A 4YQMA 1XW9A 1M2AA 1WP0A 2VIMA 5AISA 4POLA 4WETA 1XWCA 5J4YA 5AIXA 3N9JA 3GHAA 1QQ2A 1M0UA 2JZTA 1FG4A 1JZDA 2Z9SA 2WZ9A 1XOBA 2IMIA 1T4YA 1EEJA 3ED3A 3NOFA 1QUWA 4DEJA 1VRSD 5FT3A 2HSMA 2GZPA 1TXUA 4ECCA 1PX7A 3ZFBA 5DBQA 9GSSA 5A4WA 5JWQB 1EP8A 2IWTA 4LLRA 1N8JA 2DIZA 4O32A 5IPGA 1PA3A 3IHQA 2K8SA 4OD7A 2VD1A 1Y6EA 4IVFA 4MP4A 4RQRA 5EY6A 3Q74A 5B8AA 3H1NA 2QGVA 2K8VA 5B7CA 2R37A 4MH2A 3ZMLA 2X8GA 5DVBA 1YZXA 1W4VA 3CYNA 3G9BA 5GAPD 3FZAA 1O6JA 3PR8A 1Z7PA 3HD5A 2B5EA 2B5XA 1G6WA 3GUSA 4AJ6A 5HR2A 2G0FA 1G7OA 5FWGA 3F3RA 5D9WA 1Z3EA 1MD3A 2N5FA 1A2JA 3NIVA 1ZL9A 2YPMA 3CTFA 3L0HA 5L71A 1K0CA 5IIZA 4MH3A 3I6AA 1PD21 3WYWA 1OC9A 3GTUA 2H1AA 2HE3A 4K5RA 2P5RA 1OC9B 2H74A 4O92A 2ES7A 3ZVJD 4EUYA 3KJYA 3TRXA 2GZZA 1G7EA 1EV9A 1S3CA 1TXXA 2CX3A 3RAZA 2RLIA 4ZL7A 1B4QA 3W6GA 3TJKA 2E0QA 2PGTA 1R4WA 3M0FA 5KN3A 3ZIVA 2GSRA 1U87A 4JU5A 2BTOT 2HSNB 5A4VA 2H6YA 2D2ZA 3HYPA 4KSMA 1PL2A 3Q6OA 1PN9A 4AKGA 2OE3A 4EVMA 3MNGA 4V2MA 3SWLA 2HI7A 4YQUA 3TDGA 4EF0A 3FR3A 1HD2A 5J47A 3VPTA 5G5EA 1A8YA 1FVKA 1F3AA 4G19A 1UVZA 20GSA 3GA4A 3IA1A 5HFKA 3L78A 2O5VA 1ZZYA 2K9FA 1JZWA 2MZCA 2X8CA 3RHBA 3EMPA 2JACA 1ST9A 4POBA 3LG6A 5BRTA 2HRAA 1V57A 1B48A 3IAS2 4N0VA 1YDKA 2LJKA 2YJHA 2IL3A 1S3AA 4ECIA 1URMA 5DALB 2RUFA 3J7Yk 6GSYA 4EXJA 4JR6A 1LJRA 3VK9A 2EIOA 2RM5A 2LRNA 4J2FA 5CRDA 4J57E 4ZIJA 3FW2A 4HU7A 4G2EA 3I69A 1XVQA 5B6NA 3D22A 4X0XA 13GSA 1DSBA 2IMFA 4AKHA 4X43A 1GSUA 5D9TA 3VLNA 4IJ3A 2C0GA 4XIHA 2LEGA 4I97A 3F3QA 2O8VB 4MJBA 2HZFA 5KN1A 2MMNA 1K3LA 3HJMA 1X5EA 5F06A 2R6KA 3FY7A 2VOCA 1SVLA 3HXSA 4EDZA 5H5SA 2TRXA 4O5UA 4MF5A 5CAXA 2IMEA 3F63A 1GSYA 5ECOB 2L5LA 2B6MA 3FMWA 1N2AA 3BOAA 2RIIA 3A2XA 3IC4A 1ZYEA 1ZYQB 2M46A 3O3TA 2B7JA 2VL2A 2H66A 3LJRA 1U6TA 2B5YA 5A34B 5GZZB 3F9UA 4JZQA 4F9ZA 1GTUA 2WDUA 4RUVA 3QOUA 1K0OA 3IV4A 4Z2TA 3F6DA 1BQ7A 3G7JA 3IPZA 1YF1A 4BVYA 1X9SB 3LXTA 2L4QA 2GLRA 5ECNB 4I8BA 2WCIA 2VKZG 1YEXA 1F2EA 4AJ8A 4BVYB 1SKSB 1M9BA 2R5GA 2CA8A 4WEYA 3V1WA 3DMLA 2DJ3A 1O73A 1EV4A 4TRXA 3C1SA 3IC8A 4E68A 5IMFA 2QA2A 1TI3A 1XVWA 3WGDA 3D5JA 2H1LA 1U3AA 3HKRA 1Z5YE 3K8NA 2YWIA 1V40A 1MDJA 3QAVA 3WGEA 5CP1A 1SYRA 4IGJA 1I5GA 3RDWA 1DUGA 2GGTA 1ZMAA 3LYKA 3MWHA 4D73B 1GSSA 2B3SA 3ZTLA 1SU9A 3J7Yb 3W8SA 3VPQA 3TKSC 2X4AA 4Z7XA 1MTCA 3DD3A 4XCSA 1KBNA 4MDCA 2PN8A 4LA1A 2G2QA 2H0HA 5DAKA 4WR4A 4X4JA 1M99A 4K1FA 2OT3A 4ULXA 4ZB6A 1E2YA 2H76A 2KOKA 3GNJA 3HJPA 3VURA 6GSUA 1H75A 3ERFA 2C3TA 3KMNA 4AGSA 1AC1A 4XS4B 2YJ7A 5D96A 4GSSA 2HRFA 3GL5A 1IYIA 1Z9HA 3LQ7A 1GNWA 2HZEA 3EURA 2V6OA 1ERVA 1Z7RA 1GTIA 2NTOA 4YAVA 2GSQA 3ME7A 5HQPA 1AXDA 2PWJA 1NHYA 1V98A 3D4TA 1A8LA 3EVIA 5ECMB 2AHEA 4PQHA 2AUVA 3EPTA 3WD6A 5D9VA 4KA0A 3FHKA 4DSSA 2FLSA 2CVDA 3TRQA 2EFDA 4MJCA 4N10A 1GSEA 2C4JA 3QAWA 1KNGA 2OE0A 3HA9A 1YQ1A 3GX8A 4POKA 3VI7A 1X9WB 5KOWA 1AQXA 5EPFA 4EE0A 3KP8A 4MCUA 4O7HA 1AQWA 4TR1B 2ZNMA 3GYKA 5HR3A 5CREA 4X1UA 4IQ1A 1JFUA 1SD9A 2LTKA 1FAAA 2IFQA 5AN1A 2XHFA 4N30A 1TOFA 3QAGA 3QCPA 3MIXA 11GSA 4L8EA 3EINA 2QSIA 4Q5NA 1SVOA 3IE3A 1YKAA 4HOJA 4V2NA 1PQNA 4JR4A 4ZBBA 2L59A 1LU4A 5EL8A 1I9DA 2ON7A 3D0ZA 2TRCP 1GL8A 4NXIA 2O87A 4BVXB 5J40A 3U6VA 4K0NA 4E8HA 5H5QA 2PUKC 2YANA 1A0RP 3ZITA 2L5OA 4KCEA 2YZUA 1BG5A 1XFLA 1ZOFA 2FA8A 1T7PB 1RK4A 1ZYNA 1SD8A 2FWGA 3GIXA 2GS3A 1E6BA 1GUKA 4KNDA 2GQLA 1AUCA 3TJBA 3HY2A 1ZGNA 5ECPB 4NAXA 4HEA2 3ZLPA 1Q4JA 3CSHA 3GKMA 3QPMA 1K3OA 1SK2A 3N5OA 4ACSA 5IMDA 3BBYA 4MF7A 3UEMA 1PL1A 2DJ1A 2AJQB 2ZCTA 2NBSA 1K0MA 4L5LA 4LMWA 4GLTA 5D73A 5ECLB 3UARA 5CRWA 1WOUA 1TU7A 2HLSA 1N25A 5ECSA 2FA4A 4GXZA 1HQOA 1J08A 3D6IA 1T8EB 1V58A 3WT2A 2PBJA 1O8XA 1HYUA 2VL9A 3TKPA 5IOXA 1A23A 3L9UA 5CYYA 3GN3A 2A2RA 2YWNA 5DJLA 1M9AA 1SVMA 3HVXA 3IOSA 4I5QA 2H72A 2C1YA 2EC4A 2KP2A 2OBIA 1NSWA 2R3XA 2WGRA 4ZBDA 2OBKA 2J9HA 3LORA 4WF5A 4PXOA 4BL7B 3UIWA 1OYJA 3ZMKA 2MYGA 4ZB7A 1YEPA 1EGRA 1VF1A 2FWHA 1K0DA 4ZILA 2O89A 1OC3A 3KGKA 4E8EA 1LBKA 1FOHA 3GKXA 2EIQA 5E4WA 1F9MA 2DJKA 1GNEA 2VCXA 5G2ZA 4GDFA 5C04A 1TU8A 3M3MA 2KLXA 4K5SA 2KP1A 1NW2A 2IPAA 2PU9C 4TXOB 1VF3A 2FNOA 5ECQB 5LCZA 1K0BA 4MABA 2XPEA 3GX0A 2XBIA 3D21A 4DSQA 2GT5A 2OA7A 3E3EA 2VCQA 4K7OA 4MLYA 3F4RA 1M7TA 1WWJA 1K0AA 4ZXGA 4NHWA 5A5HB 2L57A 2V1MA 4TR3A 5ABRA 2E2MA 2F3MA 5ECIB 5CO3A 2EFHA 18GSA 3LSZA 2NDOA 2R2JA 3TKSE 5CRGA 1PSQA 2HSNA 3CRTA 2H19A 4MPGA 4Q5QA 1TRSA 4YH2A 3GV1A 3IR4A 1YKCA 3HMJG 1GULA 2NVLA 2GT6A 3KCMA 3FR9A 4QMKA 3CSJA 2AYTA 2JSZA 1SK0A 3RPNA 4MMMA 1X0RA 1AQVA 4BPYA 3TKSA 3Q18A 1B4PA 4PUFC 3ZREA 1O85A 5A5KA 2K18A 3IAM2 2LSTA 3TKRA 4KE3A 4K0GA 4PX1A 3US3A 1V9WA 1PGTA 4KDUA 1K3YA 3IBHA 1T00A 4XRDA 2X49A 3ZVJA 3Q19A 2CX4A 2YWOA 4EL1A 2V32A 4KDYA 4YKGA 4Q5FA 5DALA 2EFEA 4KUNA 2O85A 3O6TA 1Y25A 4BA7A 2GZYA 4IP1A 1A0FA 4EDYA 3APSA 4FYBA 3DEXA 5G1LA 4N3ZA 3FZ5A 5LNKe 2ZUPA 2HNLA 3QD9A 3VWVA 2DKIA 1TTZA 3G7IA 3DKSA 3EU3A 1HNBA 3H8QA 4HQZA 5CNWA 5ENUA 2WULA 3EC3A 4ZL9A 5A1NB 2DJ0A 2HT9A 4HI7A 3F8UA 2BMXA 1A2LA 4HUAA 2GVPA 2X64A 3GL3A 3UOMA 2CT6A 2VAFA 3IXRA 1JLVA 4HZ4A 4P3YB 4NMUA 1WE0A 5KOXA 1UC7A 4MJAA 4IBPA 3BCKA 2IMKA 1YF0A 1O81A 2I1UA 2OACA 5J4UA 2DIYA 1XBSA 3C71A 4G0KA 4J56E 2RUEA 1TI1A 4KSOA 3GURA 4XHMA 5A34A 4F03A 3R3EA 4FQUA 1XCCA 1PRXA 3EMXA 4RI6A 8GSSA 4TOPA 5DJMA 2O7KA 2MMAA 1X9MB 4F2IA 2EFCA 2RM6A 4HDEA 4PGTA 1SL2B 1O8WA 3GKKA 4NPBA 5IMCA 2V41A 4HQSA 2QC7A 2VM1A 2HXKA 2PVQA 2HRKB 3TOUA 2X8HA 2CZ3A 3VWXA 3A2WA 1T4ZA 3FR6A 5F0GA 2GTUA 4OO5A 4IKHA 3OR5A 2VCZA 4W66A 1B9YC 1DBYA 1A24A 6GSXA 1M2BA 2L4CA 4TR0A 5H5RA 3UL3A 1GSQA 1XZOA 4NV5A 1OKTA 3VI5A 3ISOA 2KHPA 4GTUA 4KF9A 3ZZXA 1JZRA 1PN0A 4JE1A 3S9FA 4D73A 3HCZA 2H6ZA 2E7PA 1GLPA 4AI6A 2CVKA 1MDKA 5DCHA 1GP1A 2C3QA 5KN0A 2C0FA 1FB6A 1J0FA 2FGXA 4MZWA 1UN2A 4HU9A 1BX9A 5JCWA 4CDOA 3RBTA 2DJJA 2FY6A 4ZB8A 3LWAA 1ZCPA 2A2PA 2JSYA 2H1DA 4TW5A 3UMAA 4XS4A 5GSSA 4FH8A 1QK8A 3UAPA 5ELAA 4USSA 2VUPA 5IPHA 4JEDA 4YQVA 1GSFA 4MPFA 2LNTA 1C72A 1FHEA 16GSA 3GKNA 3CWGA 4CY6A 3LYPA 3RPPA 2AAWA 3M8NA 1TK5B 3R2QA 4I2TA 3JCML 1CQHA 3DWVA 4K7IA 3M1GA 1U88A 5KEJA 3L9SA 2H6XA 2H75A 3C73A 3P90A 3DRNA 1AAZA 3APOA 5ECHB 3GMFA 5INYA 2CVBA 3WT1A 3KEBA 1BF5A 2MBTA 2GSSA 2A4HA 5ID2B 5DDLA 1GRXA 4TR1A 4K2XA 4XS1A 3P8WA 1TK0B 1SKRB 5HR1A 1BYEA 1SJ6A 3DXBA 2VCTA 2FWFA 1SK1A 3EE2A 1GH2A 3HVSA 4HJ2A 4F82A 3HZ4A 4CHSA 2H73A 1ILOA 3A3TA 3KM6A 4TVEA 2XBQA 3L9VA 2P31A 2JZRA 4LMVA 1NHOA 3VWWA 1A2MA 4GQFA 5JWOB 4PUAA 2F51A 4N0ZA 2HQTA 4I2UA 1TDIA 4BVXA 2OJLA 3P7XA 3MAKA 4WR5A 7GSSA 2P0GA 2H01A 3EU4A 1XXUA 4IW9A 3A5IA 2WJUA 1ON4A 2DSAA 4EIQA 4A5PA 1EOGA 2NPBA 2FCHA 1YJ6A 2LJAA 3FK8A 2H0IA 1DE2A 1MD4A 1T1VA 1Q98A 4EKZA 3G7YA 1THOA 1XWBA 4WXTA 2C0EA 4NHZA 4WBRD 4ZB9A 5LD0A 3DVXA 2H1GA 3QMXA 2V6KA 1HNCA 4AKIA 3EYTA 3UBKA 3UJ1A 2JL4A 2C3NA 2FHEA 1SKWB 2DLXA 3C1RA 3HHVA 3HVVA 2WFCA 4IN0A 4TXVA 2VLVA 4IHUA 2WS2A 3IRAA 2OADA 4Q5RA 2P5QA 3LXZA 3GH9A 1XIYA 5HFIA 5BMUB 2AV4A 3CMIA 3ZL5A 3ERGA 5J41A 3KH7A 4GSTA 1G0TA 2F8AA 4PQIA 2VLUA 2B1LA 3GSSA 4OMVA 2F8FA 3HZ8A 3SBCA 5CRHA 3L4NA 1BEDA 1R26A 2H1BA 1KEBA 3TU3B 5J9BA 4MZBA 2YV9A 4HS1A 5FHIA 4KCAA 3CXGA 1NM3A 4WKWA 2XC2A 1GLQA 2CAQA 2HSMB 4BL7A 1BAYA 3DVWA 4WBJA 4PNFA 5JCGA 2R0CA 1PX6A 1TK8B 3MDKA 4OFNA 2I3YA 1TRVA 3A5WA 4BWSA 1KTEA 2VD0A 1JZOA 3UVHA 2VLTA 2F9SA 3QR6A 1AIUA 3TJGA 4CY8A 2DC5A 1AW9A 4MA9A 2X99A 2YZHA 4GRFA 2PPTA 3H93A 1XPVA 3QFBC 4EIPA 4KW6A 2I4AA 1VF2A 3RHCA 4TXOA 5IOWA 1SJZA 2H71A 4QQ7A 4JBBA 1MEKA 2VO4A 1FW1A 3U5RE 1SENA 2LRTA 4GCIA 2KUCA 4MK3A 5J9CA 4IP6A 2YCDA 2YNXA 4ISDA 5F8BA 5A5HA 2K6VA 1TRWA 3MSZA 5HFGA 4NWYA 3A2VA 2C80A 1XWAA 3ZIJA 5DCGA 4POMA 5D93A 1SJIA 3GTUB 1O7UA 4LL1B 5COHA 5ECKB 5IMVA 3CTGA 4YAPA 2REMA 4KGIA 5IMAA 2FWEA 6GSSA 2XPDA 3O76A 1WIKA 4N11A 3C8EA 4G0IA 2ON5A 4AF2A 3M9KA 1OAZA 1OE7A 2BJXA 3VFIA 3P2AA 2IJYA 3BD2A 2YN1A 4TR4A 3FYGA 5F05A 1TRUA 2DMMA 3WGXA 2JU5A 1GUHA 1U3IA 3LW9A 6GSWA 3PPUA 2GQKA 4QL7A 5JCUA 2AB6A 1OKDA 4OFTA 2IIYA 4EO3A 3KZQA 2DJ2A 2M80A 1J9BA 2LQOA 1FVJA 3CBUA 4TN8A 4JRRA 4XTSA 4OCFA 5AIVA 5GSTA 14GSA 1GSDA 4HZ2A 3ZRDA 1FOVA 2PERA 3E9JB 3GFKA 3H4KA 3TB2A 3TRPA 1VF4A 1H4OA 1WJKA 4FYCA 2C8UA 1B8XA 5A1NA 3DYRA 10GSA 4ECBA 4K2DA 2C0DA 2ALBA 1WMJA 4ML6A 2JADA 3KD0A 4LL4B 4ILFA 2IMDA 1XOAA 4O5RA 1TP9A 4IELA 2QA1A 1FB0A 1FO5A 4WF4A 3KIJA 4ZBAA 2FD3A 1IYHA 3AY8A 3PH9A 1R7HA 3UVTA 1Z6NA 4V1Ag 4RI7A 3C7MA 2LNSA 1X5DA 2A4VA 5A4UA 4L0WA 3KP9A 1RW1A 2PMTA 5EVOA 4MJEA 4XS6A 3EWLA 1DE1A 5IQYA 3LEFA 4ICYA 3D4MA 4ML1A 3IK7A 4QL9A 2I81A 2GSTA 5C00A 2HRKA 1JHBA 4FIWA 5IMZA 1TKDB 4L5OA 1OC8A 2CZ2A 1Z6MA 2R0GA 2CQ9A 2B7KA 1Y1UA 3E0UA 4XRAA 3TKQA 4GWRA 4CW9A 1USBA 1RQMA 2H8LA 22GSA 2LV3A 5IO0A 1ZYPA 2UV8G 4OO4A 4G01A 2YV7A 2J23A 4NV2A 1T3BA 2UZ8A 3FZ4A 2MBSA 3HJOA 3QDNA 4MF6A 2DBCA 3F0IA 1M2DA 4DSRA 5B6MA 1GTBA 3FEUA 3CSIA 4V1Ap 2MMZA 2GQMA 5KN2A 1EOHA 4DVCA 5G31A 2YWMA 1WRYA 4TKYA 2CAIA 3VWUA 4GSNA 4V2LA 1TJDA 2VL3A 2H70A 3F4SA 5IM9A 19GSA 1EGOA 1F3BA 1F6MC 3BCIA 4IS0A 1BJXA 4G0LA 6GSVA 4OCEA 1QFNA 2I9HA 3GRXA 3MYDA 4PTSA 3ERWA 1PKZA 4FO5A 2PVOC 3FZ9A 1B9XC 1HNAA 2L6DA 2YP6A 4Z2UA 1YY7A 5G5FA 1QXHA 2M72A 3TJJA 3TJFA 4KX4A 4I6XA 1GTAA 4KH7A 3FRCA 4G10A 5DAKB 4EC0A 4ID0A 1QGVA 4MNNA 2N5BA 3APQA 3TGZA 3CRUA 3F4TA 4KB3A 5J5NA 2LJRA 2LKUA 2HSHA 4O5QA 3TCOA 4PNGA 3H79A 2HYXA 12GSA 3HDCA 1ERUA 3W8JA 4K7NA 2L6CA 2HSYA 2V2GA 1XWKA 2WB9A 4ECJA 1X5CA 1THXA 4OFMA 3LFLA 1BG1A 4BWQA 2HZEB 3NZNA 2YOIA 4F0BA 5ID2A 2TIRA 5E59A 1OE8A 5JWRB 2HFDA 4H86A 4KAEA 5AGYA 1UA5A 3UBLA 2H0GA 4K6XA 5G1KA 4K9ZA 1ERTA 1EEMA 1GWCA 4MZCA 3TOTA 2JZSA 1JLWA 3F6FA 3KH9A 1XW6A 17GSA 2R0PA 2DKHA 4K8MA 3TUEA 3DIEA 2OE1A 4DSSB 2B1KA 5B8BA 4KDXA 2DMLA 1EZKA 1K0NA 3QFAC 6GSTA 2R4VA 3ZYWA 2E2GA 3LGCA 5D9XA 1ERWA 1XW5A 4YKFA 1ACVA 4PQ1A 3KTBA 2LRCA 1ABAA 2VM2A 2GDRA 1V2AA 1W89A 1CQGA 1PMTA 4IJIA 4GQCA 2N5AA 1WPIA 1S3DA 5J3RA 3ME8A 5J4VA 1ML6A 3KXOA 2IN3A 2VL2C 2IFQB 3DGQA 1R5AA 2MMOA 3IK9A 2QKEA 2VCVA 1YVLA 4AKXB 4L0UA 1QMVA 5F07A 3I9V2 1G6YA 1EP7A 1SL1B 4RQXA 2VCWA 3FKFA 3PINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIR A;  1F37 A;  5G30 A;  1MDI A;  2OKA A;  2LS5 A;  5DQS A;  1VGL A;  1OVN A;  4GF0 A;  1R5P A;  4PUR A;  3PGT A;  5DQY A;  3GST A;  4ZL8 A;  1EWX A;  2LQQ A;  4AJ7 A;  4HJM A;  3ZFL A;  1XWG A;  3KMO A;  3I43 A;  5GAN D;  4G9H A;  4OWY A;  3BJ5 A;  2FUG 2;  1SYX A;  4IQA A;  3M9J A;  5ECR B;  2LUS A;  3KTL A;  5IO2 A;  4FYU A;  2H30 A;  5HR0 A;  5BMU A;  5D8I A;  5ELG A;  2HRN A;  3IDV A;  1PKW A;  1TW9 A;  2WRT A;  1GUM A;  1SL0 B;  4F0C A;  2CV4 A;  2A2S A;  3GH6 A;  4YQM A;  1XW9 A;  1M2A A;  1WP0 A;  2VIM A;  5AIS A;  4POL A;  4WET A;  1XWC A;  5AIX A;  3N9J A;  3GHA A;  1QQ2 A;  1M0U A;  2JZT A;  1FG4 A;  1JZD A;  2Z9S A;  2WZ9 A;  1XOB A;  2IMI A;  1T4Y A;  1EEJ A;  3ED3 A;  3NOF A;  1QUW A;  4DEJ A;  1VRS D;  5FT3 A;  2HSM A;  2GZP A;  4ECC A;  1PX7 A;  3ZFB A;  5DBQ A;  9GSS A;  5A4W A;  5JWQ B;  1EP8 A;  2IWT A;  4LLR A;  1N8J A;  2DIZ A;  4O32 A;  5IPG A;  1PA3 A;  3IHQ A;  2K8S A;  4OD7 A;  2VD1 A;  1Y6E A;  4IVF A;  4MP4 A;  4RQR A;  5EY6 A;  3Q74 A;  5B8A A;  3H1N A;  2QGV A;  2K8V A;  5B7C A;  2R37 A;  4MH2 A;  3ZML A;  2X8G A;  5DVB A;  1YZX A;  1W4V A;  3CYN A;  3G9B A;  5GAP D;  3FZA A;  1O6J A;  3PR8 A;  1Z7P A;  3HD5 A;  2B5E A;  2B5X A;  1G6W A;  3GUS A;  4AJ6 A;  5HR2 A;  2G0F A;  1G7O A;  5FWG A;  3F3R A;  5D9W A;  1Z3E A;  1MD3 A;  2N5F A;  1A2J A;  3NIV A;  1ZL9 A;  2YPM A;  3CTF A;  3L0H A;  5L71 A;  1K0C A;  5IIZ A;  4MH3 A;  3I6A A;  1PD2 1;  3WYW A;  1OC9 A;  3GTU A;  2H1A A;  2HE3 A;  2P5R A;  1OC9 B;  2H74 A;  4O92 A;  2ES7 A;  3ZVJ D;  4EUY A;  3KJY A;  3TRX A;  2GZZ A;  1G7E A;  1EV9 A;  1S3C A;  1TXX A;  2CX3 A;  3RAZ A;  2RLI A;  4ZL7 A;  1B4Q A;  3W6G A;  3TJK A;  2E0Q A;  2PGT A;  1R4W A;  3M0F A;  5KN3 A;  3ZIV A;  2GSR A;  1U87 A;  4JU5 A;  2BTO T;  2HSN B;  5A4V A;  2H6Y A;  2D2Z A;  3HYP A;  4KSM A;  1PL2 A;  3Q6O A;  1PN9 A;  2OE3 A;  4EVM A;  3MNG A;  4V2M A;  3SWL A;  2HI7 A;  4YQU A;  3TDG A;  4EF0 A;  3FR3 A;  1HD2 A;  3VPT A;  5G5E A;  1A8Y A;  1FVK A;  1F3A A;  4G19 A;  1UVZ A;  20GS A;  3GA4 A;  3IA1 A;  5HFK A;  3L78 A;  1ZZY A;  2K9F A;  1JZW A;  2MZC A;  2X8C A;  3RHB A;  3EMP A;  2JAC A;  1ST9 A;  4POB A;  3LG6 A;  2HRA A;  1V57 A;  1B48 A;  3IAS 2;  4N0V A;  1YDK A;  2LJK A;  2YJH A;  2IL3 A;  1S3A A;  4ECI A;  1URM A;  5DAL B;  2RUF A;  3J7Y k;  6GSY A;  4EXJ A;  4JR6 A;  1LJR A;  3VK9 A;  2EIO A;  2RM5 A;  2LRN A;  4J2F A;  5CRD A;  4J57 E;  4ZIJ A;  3FW2 A;  4HU7 A;  4G2E A;  3I69 A;  1XVQ A;  5B6N A;  3D22 A;  4X0X A;  13GS A;  1DSB A;  2IMF A;  4X43 A;  1GSU A;  5D9T A;  3VLN A;  4IJ3 A;  2C0G A;  4XIH A;  2LEG A;  4I97 A;  3F3Q A;  2O8V B;  4MJB A;  2HZF A;  5KN1 A;  2MMN A;  1K3L A;  3HJM A;  1X5E A;  5F06 A;  2R6K A;  3FY7 A;  2VOC A;  3HXS A;  4EDZ A;  5H5S A;  2TRX A;  4MF5 A;  5CAX A;  2IME A;  3F63 A;  1GSY A;  5ECO B;  2L5L A;  2B6M A;  1N2A A;  3BOA A;  2RII A;  3A2X A;  3IC4 A;  1ZYE A;  1ZYQ B;  2M46 A;  3O3T A;  2B7J A;  2VL2 A;  2H66 A;  3LJR A;  1U6T A;  2B5Y A;  5GZZ B;  3F9U A;  4JZQ A;  4F9Z A;  1GTU A;  2WDU A;  4RUV A;  3QOU A;  1K0O A;  3IV4 A;  3F6D A;  1BQ7 A;  3G7J A;  3IPZ A;  1YF1 A;  4BVY A;  1X9S B;  3LXT A;  2L4Q A;  2GLR A;  5ECN B;  4I8B A;  2WCI A;  1YEX A;  1F2E A;  4AJ8 A;  4BVY B;  1SKS B;  1M9B A;  2R5G A;  2CA8 A;  4WEY A;  3V1W A;  3DML A;  2DJ3 A;  1O73 A;  1EV4 A;  4TRX A;  3C1S A;  3IC8 A;  5IMF A;  1TI3 A;  1XVW A;  3WGD A;  3D5J A;  1U3A A;  3HKR A;  1Z5Y E;  3K8N A;  2YWI A;  1V40 A;  1MDJ A;  3QAV A;  3WGE A;  5CP1 A;  1SYR A;  4IGJ A;  1I5G A;  3RDW A;  1DUG A;  2GGT A;  1ZMA A;  3LYK A;  3MWH A;  4D73 B;  1GSS A;  2B3S A;  3ZTL A;  1SU9 A;  3J7Y b;  3W8S A;  3VPQ A;  3TKS C;  4Z7X A;  1MTC A;  3DD3 A;  4XCS A;  1KBN A;  4MDC A;  2PN8 A;  4LA1 A;  2G2Q A;  2H0H A;  5DAK A;  4WR4 A;  1M99 A;  4K1F A;  4ULX A;  4ZB6 A;  1E2Y A;  2H76 A;  2KOK A;  3GNJ A;  3HJP A;  3VUR A;  6GSU A;  1H75 A;  3ERF A;  2C3T A;  3KMN A;  4AGS A;  1AC1 A;  4XS4 B;  2YJ7 A;  5D96 A;  4GSS A;  2HRF A;  3GL5 A;  1IYI A;  1Z9H A;  3LQ7 A;  1GNW A;  2HZE A;  3EUR A;  2V6O A;  1ERV A;  1Z7R A;  1GTI A;  2NTO A;  4YAV A;  2GSQ A;  3ME7 A;  5HQP A;  1AXD A;  2PWJ A;  1NHY A;  1V98 A;  3D4T A;  1A8L A;  3EVI A;  5ECM B;  2AHE A;  4PQH A;  2AUV A;  3WD6 A;  5D9V A;  4KA0 A;  3FHK A;  4DSS A;  2FLS A;  2CVD A;  3TRQ A;  4MJC A;  4N10 A;  1GSE A;  2C4J A;  3QAW A;  1KNG A;  2OE0 A;  3HA9 A;  1YQ1 A;  3GX8 A;  4POK A;  3VI7 A;  1X9W B;  1AQX A;  5EPF A;  4EE0 A;  3KP8 A;  4MCU A;  4O7H A;  1AQW A;  4TR1 B;  2ZNM A;  3GYK A;  5HR3 A;  5CRE A;  4X1U A;  4IQ1 A;  1JFU A;  1SD9 A;  2LTK A;  1FAA A;  2IFQ A;  5AN1 A;  2XHF A;  4N30 A;  1TOF A;  3QAG A;  3QCP A;  11GS A;  4L8E A;  3EIN A;  2QSI A;  4Q5N A;  3IE3 A;  1YKA A;  4HOJ A;  4V2N A;  1PQN A;  4JR4 A;  4ZBB A;  2L59 A;  1LU4 A;  5EL8 A;  1I9D A;  2ON7 A;  3D0Z A;  2TRC P;  1GL8 A;  4NXI A;  2O87 A;  4BVX B;  3U6V A;  4K0N A;  4E8H A;  5H5Q A;  2PUK C;  2YAN A;  1A0R P;  3ZIT A;  2L5O A;  4KCE A;  2YZU A;  1BG5 A;  1XFL A;  1ZOF A;  2FA8 A;  1T7P B;  1RK4 A;  1SD8 A;  2FWG A;  3GIX A;  2GS3 A;  1E6B A;  1GUK A;  4KND A;  2GQL A;  1AUC A;  3TJB A;  3HY2 A;  1ZGN A;  5ECP B;  4NAX A;  4HEA 2;  3ZLP A;  1Q4J A;  3CSH A;  3GKM A;  3QPM A;  1K3O A;  1SK2 A;  3N5O A;  4ACS A;  5IMD A;  3BBY A;  4MF7 A;  3UEM A;  1PL1 A;  2DJ1 A;  2AJQ B;  2ZCT A;  2NBS A;  1K0M A;  4L5L A;  4LMW A;  4GLT A;  5D73 A;  5ECL B;  3UAR A;  5CRW A;  1WOU A;  1TU7 A;  2HLS A;  5ECS A;  2FA4 A;  4GXZ A;  1HQO A;  1J08 A;  3D6I A;  1T8E B;  1V58 A;  3WT2 A;  2PBJ A;  1O8X A;  1HYU A;  2VL9 A;  3TKP A;  5IOX A;  1A23 A;  3L9U A;  5CYY A;  3GN3 A;  2A2R A;  2YWN A;  5DJL A;  1M9A A;  3HVX A;  3IOS A;  4I5Q A;  2H72 A;  2C1Y A;  2EC4 A;  2KP2 A;  2OBI A;  1NSW A;  2R3X A;  2WGR A;  4ZBD A;  2OBK A;  2J9H A;  3LOR A;  4WF5 A;  4PXO A;  4BL7 B;  3UIW A;  1OYJ A;  3ZMK A;  2MYG A;  1YEP A;  1EGR A;  1VF1 A;  2FWH A;  1K0D A;  4ZIL A;  2O89 A;  1OC3 A;  3KGK A;  4E8E A;  1LBK A;  3GKX A;  2EIQ A;  5E4W A;  1F9M A;  2DJK A;  1GNE A;  2VCX A;  5G2Z A;  5C04 A;  1TU8 A;  3M3M A;  2KLX A;  2KP1 A;  1NW2 A;  2IPA A;  2PU9 C;  4TXO B;  1VF3 A;  2FNO A;  5ECQ B;  5LCZ A;  1K0B A;  4MAB A;  2XPE A;  3GX0 A;  2XBI A;  3D21 A;  4DSQ A;  2GT5 A;  2OA7 A;  4K7O A;  3E3E A;  2VCQ A;  4MLY A;  3F4R A;  1M7T A;  1WWJ A;  1K0A A;  4ZXG A;  4NHW A;  2L57 A;  2V1M A;  4TR3 A;  5ABR A;  2E2M A;  2F3M A;  5ECI B;  5CO3 A;  18GS A;  3LSZ A;  2NDO A;  2R2J A;  3TKS E;  5CRG A;  1PSQ A;  2H19 A;  3CRT A;  4MPG A;  4Q5Q A;  1TRS A;  4YH2 A;  3GV1 A;  3IR4 A;  1YKC A;  1GUL A;  2NVL A;  2GT6 A;  3KCM A;  3FR9 A;  3CSJ A;  2AYT A;  2JSZ A;  1SK0 A;  3RPN A;  4MMM A;  1X0R A;  1AQV A;  4BPY A;  3TKS A;  3Q18 A;  1B4P A;  4PUF C;  3ZRE A;  1O85 A;  5A5K A;  2K18 A;  3IAM 2;  2LST A;  3TKR A;  4KE3 A;  4K0G A;  4PX1 A;  3US3 A;  1V9W A;  1PGT A;  4KDU A;  1K3Y A;  3IBH A;  1T00 A;  4XRD A;  3ZVJ A;  3Q19 A;  2CX4 A;  2YWO A;  4EL1 A;  2V32 A;  4KDY A;  4Q5F A;  5DAL A;  4KUN A;  2O85 A;  3O6T A;  1Y25 A;  4BA7 A;  2GZY A;  4IP1 A;  1A0F A;  4EDY A;  3APS A;  4FYB A;  3DEX A;  5G1L A;  3FZ5 A;  5LNK e;  2ZUP A;  2HNL A;  3QD9 A;  3VWV A;  1TTZ A;  3G7I A;  3DKS A;  3EU3 A;  1HNB A;  3H8Q A;  4HQZ A;  5CNW A;  5ENU A;  2WUL A;  3EC3 A;  4ZL9 A;  2DJ0 A;  2HT9 A;  4HI7 A;  3F8U A;  2BMX A;  1A2L A;  4HUA A;  2GVP A;  2X64 A;  3GL3 A;  3UOM A;  2CT6 A;  2VAF A;  3IXR A;  1JLV A;  4HZ4 A;  4P3Y B;  4NMU A;  1WE0 A;  1UC7 A;  4MJA A;  4IBP A;  3BCK A;  2IMK A;  1YF0 A;  1O81 A;  2I1U A;  2OAC A;  5J4U A;  2DIY A;  1XBS A;  3C71 A;  4G0K A;  4J56 E;  2RUE A;  1TI1 A;  4KSO A;  3GUR A;  4XHM A;  4F03 A;  3R3E A;  4FQU A;  1XCC A;  1PRX A;  3EMX A;  4RI6 A;  8GSS A;  4TOP A;  5DJM A;  2O7K A;  2MMA A;  1X9M B;  4F2I A;  2RM6 A;  4HDE A;  4PGT A;  1SL2 B;  1O8W A;  3GKK A;  4NPB A;  5IMC A;  2V41 A;  4HQS A;  2QC7 A;  2VM1 A;  2HXK A;  2PVQ A;  2HRK B;  3TOU A;  2X8H A;  2CZ3 A;  3VWX A;  3A2W A;  1T4Z A;  3FR6 A;  5F0G A;  2GTU A;  4OO5 A;  4IKH A;  3OR5 A;  2VCZ A;  1B9Y C;  1DBY A;  1A24 A;  6GSX A;  1M2B A;  2L4C A;  4TR0 A;  5H5R A;  3UL3 A;  1GSQ A;  1XZO A;  4NV5 A;  1OKT A;  3VI5 A;  3ISO A;  2KHP A;  4GTU A;  4KF9 A;  3ZZX A;  1JZR A;  4JE1 A;  3S9F A;  4D73 A;  3HCZ A;  2H6Z A;  2E7P A;  1GLP A;  2CVK A;  1MDK A;  5DCH A;  1GP1 A;  2C3Q A;  5KN0 A;  2C0F A;  1FB6 A;  1J0F A;  2FGX A;  4MZW A;  1UN2 A;  4HU9 A;  1BX9 A;  5JCW A;  4CDO A;  3RBT A;  2DJJ A;  2FY6 A;  4ZB8 A;  3LWA A;  1ZCP A;  2JSY A;  2H1D A;  4TW5 A;  3UMA A;  4XS4 A;  5GSS A;  4FH8 A;  1QK8 A;  3UAP A;  5ELA A;  4USS A;  2VUP A;  5IPH A;  4JED A;  4YQV A;  1GSF A;  4MPF A;  2LNT A;  1C72 A;  1FHE A;  16GS A;  3GKN A;  3LYP A;  3RPP A;  2AAW A;  3M8N A;  1TK5 B;  3R2Q A;  4I2T A;  3JCM L;  1CQH A;  3DWV A;  4K7I A;  3M1G A;  1U88 A;  5KEJ A;  3L9S A;  2H6X A;  2H75 A;  3C73 A;  3P90 A;  3DRN A;  1AAZ A;  3APO A;  5ECH B;  3GMF A;  5INY A;  2CVB A;  3WT1 A;  3KEB A;  2MBT A;  2GSS A;  5ID2 B;  5DDL A;  1GRX A;  4TR1 A;  4XS1 A;  3P8W A;  1TK0 B;  1SKR B;  5HR1 A;  1BYE A;  1SJ6 A;  3DXB A;  2VCT A;  2FWF A;  1SK1 A;  3EE2 A;  1GH2 A;  3HVS A;  4HJ2 A;  4F82 A;  3HZ4 A;  4CHS A;  2H73 A;  1ILO A;  3A3T A;  3KM6 A;  4TVE A;  2XBQ A;  3L9V A;  2P31 A;  2JZR A;  4LMV A;  1NHO A;  3VWW A;  1A2M A;  4GQF A;  5JWO B;  4PUA A;  2F51 A;  4N0Z A;  2HQT A;  4I2U A;  1TDI A;  4BVX A;  2OJL A;  3P7X A;  3MAK A;  4WR5 A;  7GSS A;  2P0G A;  2H01 A;  3EU4 A;  1XXU A;  4IW9 A;  2WJU A;  1ON4 A;  2DSA A;  1EOG A;  2NPB A;  2FCH A;  1YJ6 A;  2LJA A;  3FK8 A;  2H0I A;  1DE2 A;  1MD4 A;  1T1V A;  1Q98 A;  4EKZ A;  3G7Y A;  1THO A;  1XWB A;  4WXT A;  2C0E A;  4NHZ A;  4WBR D;  4ZB9 A;  5LD0 A;  3DVX A;  2H1G A;  3QMX A;  2V6K A;  1HNC A;  3EYT A;  3UBK A;  3UJ1 A;  2JL4 A;  2C3N A;  2FHE A;  1SKW B;  2DLX A;  3C1R A;  3HHV A;  3HVV A;  2WFC A;  4IN0 A;  4TXV A;  2VLV A;  4IHU A;  2WS2 A;  3IRA A;  2OAD A;  4Q5R A;  2P5Q A;  3LXZ A;  3GH9 A;  1XIY A;  5HFI A;  2AV4 A;  3CMI A;  3ZL5 A;  3ERG A;  5J41 A;  3KH7 A;  4GST A;  1G0T A;  2F8A A;  4PQI A;  2VLU A;  2B1L A;  3GSS A;  4OMV A;  2F8F A;  3HZ8 A;  3SBC A;  5CRH A;  3L4N A;  1BED A;  1R26 A;  2H1B A;  1KEB A;  5J9B A;  4MZB A;  2YV9 A;  4HS1 A;  5FHI A;  4KCA A;  3CXG A;  1NM3 A;  4WKW A;  2XC2 A;  1GLQ A;  2CAQ A;  2HSM B;  4BL7 A;  1BAY A;  3DVW A;  4WBJ A;  4PNF A;  5JCG A;  1PX6 A;  1TK8 B;  3MDK A;  4OFN A;  2I3Y A;  1TRV A;  3A5W A;  4BWS A;  1KTE A;  2VD0 A;  1JZO A;  3UVH A;  2VLT A;  2F9S A;  3QR6 A;  1AIU A;  3TJG A;  2DC5 A;  1AW9 A;  4MA9 A;  2X99 A;  2YZH A;  4GRF A;  2PPT A;  3H93 A;  1XPV A;  3QFB C;  4KW6 A;  2I4A A;  1VF2 A;  3RHC A;  4TXO A;  5IOW A;  1SJZ A;  2H71 A;  4QQ7 A;  4JBB A;  1MEK A;  2VO4 A;  1FW1 A;  3U5R E;  1SEN A;  2LRT A;  4GCI A;  2KUC A;  4MK3 A;  5J9C A;  4IP6 A;  2YCD A;  2YNX A;  4ISD A;  5F8B A;  2K6V A;  1TRW A;  3MSZ A;  5HFG A;  4NWY A;  3A2V A;  2C80 A;  1XWA A;  3ZIJ A;  5DCG A;  4POM A;  5D93 A;  1SJI A;  3GTU B;  1O7U A;  4LL1 B;  5COH A;  5ECK B;  5IMV A;  3CTG A;  4YAP A;  2REM A;  4KGI A;  5IMA A;  2FWE A;  6GSS A;  2XPD A;  3O76 A;  1WIK A;  4N11 A;  3C8E A;  4G0I A;  2ON5 A;  4AF2 A;  3M9K A;  1OAZ A;  1OE7 A;  2BJX A;  3VFI A;  3P2A A;  2IJY A;  3BD2 A;  2YN1 A;  4TR4 A;  3FYG A;  5F05 A;  1TRU A;  2DMM A;  3WGX A;  2JU5 A;  1GUH A;  1U3I A;  6GSW A;  3PPU A;  2GQK A;  4QL7 A;  5JCU A;  2AB6 A;  1OKD A;  4OFT A;  2IIY A;  4EO3 A;  3KZQ A;  2DJ2 A;  2M80 A;  1J9B A;  2LQO A;  1FVJ A;  3CBU A;  4TN8 A;  4JRR A;  4XTS A;  4OCF A;  5AIV A;  5GST A;  14GS A;  1GSD A;  4HZ2 A;  3ZRD A;  1FOV A;  2PER A;  3E9J B;  3GFK A;  3H4K A;  3TB2 A;  3TRP A;  1VF4 A;  1H4O A;  1WJK A;  4FYC A;  2C8U A;  1B8X A;  3DYR A;  10GS A;  4ECB A;  4K2D A;  2C0D A;  2ALB A;  1WMJ A;  4ML6 A;  2JAD A;  3KD0 A;  4LL4 B;  4ILF A;  2IMD A;  1XOA A;  4O5R A;  1TP9 A;  4IEL A;  1FB0 A;  1FO5 A;  4WF4 A;  3KIJ A;  4ZBA A;  2FD3 A;  1IYH A;  3AY8 A;  3PH9 A;  1R7H A;  3UVT A;  1Z6N A;  4V1A g;  4RI7 A;  3C7M A;  2LNS A;  1X5D A;  2A4V A;  5A4U A;  4L0W A;  3KP9 A;  1RW1 A;  2PMT A;  5EVO A;  4MJE A;  4XS6 A;  3EWL A;  1DE1 A;  5IQY A;  3LEF A;  3D4M A;  4ML1 A;  3IK7 A;  4QL9 A;  2I81 A;  2GST A;  5C00 A;  2HRK A;  1JHB A;  4FIW A;  5IMZ A;  1TKD B;  4L5O A;  1OC8 A;  2CZ2 A;  1Z6M A;  2CQ9 A;  2B7K A;  3E0U A;  4XRA A;  3TKQ A;  4GWR A;  4CW9 A;  1USB A;  1RQM A;  2H8L A;  22GS A;  2LV3 A;  5IO0 A;  4OO4 A;  2YV7 A;  2J23 A;  4NV2 A;  1T3B A;  2UZ8 A;  3FZ4 A;  2MBS A;  3HJO A;  3QDN A;  4MF6 A;  2DBC A;  3F0I A;  1M2D A;  4DSR A;  5B6M A;  1GTB A;  3FEU A;  3CSI A;  4V1A p;  2MMZ A;  2GQM A;  5KN2 A;  1EOH A;  4DVC A;  5G31 A;  2YWM A;  1WRY A;  4TKY A;  2CAI A;  3VWU A;  4GSN A;  4V2L A;  1TJD A;  2VL3 A;  2H70 A;  3F4S A;  5IM9 A;  19GS A;  1EGO A;  1F3B A;  1F6M C;  3BCI A;  4IS0 A;  1BJX A;  4G0L A;  6GSV A;  4OCE A;  1QFN A;  2I9H A;  3GRX A;  4PTS A;  3ERW A;  1PKZ A;  4FO5 A;  2PVO C;  3FZ9 A;  1B9X C;  1HNA A;  2L6D A;  2YP6 A;  1YY7 A;  5G5F A;  1QXH A;  2M72 A;  3TJJ A;  3TJF A;  4KX4 A;  4I6X A;  1GTA A;  4KH7 A;  3FRC A;  4G10 A;  5DAK B;  4EC0 A;  4ID0 A;  1QGV A;  2N5B A;  3APQ A;  3TGZ A;  3CRU A;  3F4T A;  4KB3 A;  5J5N A;  2LJR A;  2LKU A;  2HSH A;  3TCO A;  4PNG A;  3H79 A;  2HYX A;  12GS A;  3HDC A;  1ERU A;  3W8J A;  4K7N A;  2L6C A;  2HSY A;  2V2G A;  1XWK A;  2WB9 A;  4ECJ A;  1X5C A;  1THX A;  4OFM A;  3LFL A;  4BWQ A;  2HZE B;  3NZN A;  2YOI A;  4F0B A;  5ID2 A;  2TIR A;  5E59 A;  1OE8 A;  5JWR B;  2HFD A;  4H86 A;  4KAE A;  5AGY A;  1UA5 A;  3UBL A;  2H0G A;  4K6X A;  5G1K A;  4K9Z A;  1ERT A;  1EEM A;  1GWC A;  4MZC A;  3TOT A;  2JZS A;  1JLW A;  3F6F A;  3KH9 A;  1XW6 A;  17GS A;  4K8M A;  3TUE A;  3DIE A;  2OE1 A;  4DSS B;  2B1K A;  5B8B A;  4KDX A;  2DML A;  1EZK A;  1K0N A;  3QFA C;  6GST A;  2R4V A;  3ZYW A;  2E2G A;  3LGC A;  5D9X A;  1ERW A;  1XW5 A;  1ACV A;  4PQ1 A;  3KTB A;  2LRC A;  1ABA A;  2VM2 A;  2GDR A;  1V2A A;  1W89 A;  1CQG A;  1PMT A;  4IJI A;  4GQC A;  2N5A A;  1WPI A;  1S3D A;  5J3R A;  3ME8 A;  1ML6 A;  3KXO A;  2IN3 A;  2VL2 C;  2IFQ B;  3DGQ A;  1R5A A;  2MMO A;  3IK9 A;  2QKE A;  2VCV A;  4L0U A;  1QMV A;  5F07 A;  3I9V 2;  1G6Y A;  1EP7 A;  1SL1 B;  4RQX A;  2VCW A;  3FKF A;  3PIN A; 
#chains in the Genus database with same CATH topology
 2EIR A;  1F37 A;  5G30 A;  1MDI A;  2WZS A;  2LS5 A;  2OKA A;  5DQS A;  1VGL A;  1OVN A;  4GF0 A;  1R5P A;  4PUR A;  3PGT A;  5DQY A;  3GST A;  4ZL8 A;  1EWX A;  2LQQ A;  4AJ7 A;  4HJM A;  3RGB C;  3ZFL A;  1XWG A;  3KMO A;  3I43 A;  5GAN D;  4G9H A;  4OWY A;  3BJ5 A;  2FUG 2;  1SYX A;  4IQA A;  3M9J A;  5ECR B;  2LUS A;  3KTL A;  5IO2 A;  4FYU A;  2H30 A;  5HR0 A;  5BMU A;  5D8I A;  3IHG A;  5ELG A;  2HRN A;  4Z2R A;  3IDV A;  1PKW A;  1TW9 A;  2WRT A;  1GUM A;  1SL0 B;  4F0C A;  2CV4 A;  2A2S A;  3GH6 A;  4YQM A;  1XW9 A;  1M2A A;  1WP0 A;  2VIM A;  5AIS A;  4POL A;  4WET A;  1XWC A;  5J4Y A;  5AIX A;  3N9J A;  3GHA A;  1QQ2 A;  1M0U A;  2JZT A;  1FG4 A;  1JZD A;  2Z9S A;  2WZ9 A;  1XOB A;  2IMI A;  1T4Y A;  1EEJ A;  1S3R A;  3ED3 A;  3NOF A;  1QUW A;  4DEJ A;  1VRS D;  5FT3 A;  2HSM A;  2GZP A;  1TXU A;  4ECC A;  1PX7 A;  3ZFB A;  5DBQ A;  9GSS A;  5A4W A;  5JWQ B;  1EP8 A;  2IWT A;  4LLR A;  1N8J A;  2DIZ A;  4O32 A;  5IPG A;  1PA3 A;  3IHQ A;  2K8S A;  4OD7 A;  2VD1 A;  1Y6E A;  4IVF A;  4MP4 A;  4RQR A;  5EY6 A;  3Q74 A;  5B8A A;  3H1N A;  2QGV A;  2K8V A;  5B7C A;  2R37 A;  4MH2 A;  3ZML A;  2X8G A;  5DVB A;  1YZX A;  1W4V A;  3CYN A;  3G9B A;  5GAP D;  3FZA A;  1O6J A;  3PR8 A;  1Z7P A;  3HD5 A;  2B5E A;  2B5X A;  1G6W A;  3GUS A;  4AJ6 A;  5HR2 A;  2G0F A;  1G7O A;  5FWG A;  3F3R A;  5D9W A;  1Z3E A;  1MD3 A;  2N5F A;  1A2J A;  3NIV A;  1ZL9 A;  2YPM A;  3CTF A;  3L0H A;  5L71 A;  1K0C A;  5IIZ A;  4MH3 A;  3I6A A;  1PD2 1;  3WYW A;  1OC9 A;  3GTU A;  2H1A A;  2HE3 A;  4K5R A;  2P5R A;  1OC9 B;  2H74 A;  4O92 A;  2ES7 A;  3ZVJ D;  4EUY A;  3KJY A;  3TRX A;  2GZZ A;  1G7E A;  1EV9 A;  1S3C A;  1TXX A;  2CX3 A;  3RAZ A;  2RLI A;  4ZL7 A;  1B4Q A;  3W6G A;  3TJK A;  2E0Q A;  2PGT A;  1R4W A;  3M0F A;  2WVY A;  5KN3 A;  3ZIV A;  2GSR A;  1U87 A;  4JU5 A;  2BTO T;  2HSN B;  5A4V A;  2H6Y A;  2D2Z A;  3HYP A;  4KSM A;  1PL2 A;  3Q6O A;  1PN9 A;  4AKG A;  2OE3 A;  2WW1 A;  4EVM A;  3MNG A;  4V2M A;  3SWL A;  2HI7 A;  4YQU A;  3TDG A;  4EF0 A;  3FR3 A;  1HD2 A;  5J47 A;  3VPT A;  5G5E A;  1A8Y A;  1FVK A;  1F3A A;  4G19 A;  1UVZ A;  20GS A;  3GA4 A;  3IA1 A;  5HFK A;  3L78 A;  2O5V A;  1ZZY A;  2K9F A;  1JZW A;  2MZC A;  2X8C A;  3RHB A;  3EMP A;  2JAC A;  1ST9 A;  4POB A;  3LG6 A;  5BRT A;  2HRA A;  1V57 A;  1B48 A;  3IAS 2;  4N0V A;  1YDK A;  2LJK A;  2YJH A;  2IL3 A;  1S3A A;  4ECI A;  1URM A;  5DAL B;  2RUF A;  3J7Y k;  6GSY A;  4EXJ A;  4JR6 A;  1LJR A;  3VK9 A;  2EIO A;  2RM5 A;  2LRN A;  4J2F A;  5CRD A;  4J57 E;  4ZIJ A;  3FW2 A;  4HU7 A;  4G2E A;  3I69 A;  1XVQ A;  5B6N A;  3D22 A;  4X0X A;  13GS A;  1DSB A;  2IMF A;  4AKH A;  4X43 A;  1GSU A;  5D9T A;  3VLN A;  4IJ3 A;  4PI0 C;  2C0G A;  4XIH A;  2LEG A;  4I97 A;  3F3Q A;  2O8V B;  4MJB A;  2HZF A;  5KN1 A;  2MMN A;  1K3L A;  3HJM A;  1X5E A;  5F06 A;  2R6K A;  3FY7 A;  2VOC A;  1SVL A;  3HXS A;  4EDZ A;  5H5S A;  2TRX A;  4O5U A;  4MF5 A;  3HVN A;  5CAX A;  2IME A;  3F63 A;  1GSY A;  5ECO B;  2L5L A;  2B6M A;  3FMW A;  1N2A A;  3BOA A;  2RII A;  3A2X A;  3IC4 A;  1ZYE A;  1ZYQ B;  2M46 A;  3O3T A;  2B7J A;  1I1I P;  2VL2 A;  2H66 A;  3LJR A;  1U6T A;  2B5Y A;  3RFR C;  5A34 B;  5GZZ B;  3F9U A;  4JZQ A;  4F9Z A;  1GTU A;  2WDU A;  4RUV A;  3QOU A;  1K0O A;  3IV4 A;  4Z2T A;  3F6D A;  1BQ7 A;  3G7J A;  3IPZ A;  1YF1 A;  4BVY A;  1X9S B;  3LXT A;  2L4Q A;  2GLR A;  5ECN B;  4I8B A;  2WCI A;  2VKZ G;  1YEX A;  1F2E A;  4AJ8 A;  4BVY B;  1SKS B;  1M9B A;  2R5G A;  2CA8 A;  4WEY A;  3V1W A;  3DML A;  2DJ3 A;  1O73 A;  1EV4 A;  4TRX A;  3C1S A;  3IC8 A;  4E68 A;  5IMF A;  2QA2 A;  1TI3 A;  1XVW A;  3WGD A;  3D5J A;  2H1L A;  1U3A A;  3HKR A;  1Z5Y E;  3K8N A;  1PFO A;  2YWI A;  1V40 A;  1MDJ A;  3QAV A;  3WGE A;  5CP1 A;  1SYR A;  4IGJ A;  1I5G A;  3RDW A;  1DUG A;  2GGT A;  1ZMA A;  3LYK A;  3MWH A;  4D73 B;  1GSS A;  2B3S A;  3ZTL A;  1SU9 A;  3J7Y b;  3W8S A;  3VPQ A;  3TKS C;  2X4A A;  4Z7X A;  1MTC A;  3DD3 A;  4XCS A;  1KBN A;  4MDC A;  2PN8 A;  4LA1 A;  2G2Q A;  2H0H A;  5DAK A;  4WR4 A;  4X4J A;  1M99 A;  4K1F A;  2OT3 A;  4ULX A;  4ZB6 A;  1E2Y A;  2H76 A;  2KOK A;  3GNJ A;  3HJP A;  3VUR A;  6GSU A;  1H75 A;  3ERF A;  2C3T A;  3KMN A;  4AGS A;  1AC1 A;  4XS4 B;  2YJ7 A;  5D96 A;  4GSS A;  2HRF A;  3GL5 A;  1IYI A;  1Z9H A;  3LQ7 A;  1GNW A;  2HZE A;  3EUR A;  2V6O A;  1ERV A;  1Z7R A;  1GTI A;  2NTO A;  4YAV A;  2GSQ A;  3ME7 A;  5HQP A;  1AXD A;  2PWJ A;  1NHY A;  1V98 A;  3D4T A;  1A8L A;  3EVI A;  5ECM B;  2AHE A;  4PQH A;  2AUV A;  3EPT A;  3WD6 A;  5D9V A;  4KA0 A;  3FHK A;  4DSS A;  2FLS A;  2CVD A;  3TRQ A;  2EFD A;  4MJC A;  4N10 A;  1GSE A;  2C4J A;  3QAW A;  1KNG A;  2OE0 A;  3HA9 A;  1YQ1 A;  3GX8 A;  4POK A;  4FXY P;  3VI7 A;  1X9W B;  5KOW A;  1AQX A;  5EPF A;  4EE0 A;  3KP8 A;  4MCU A;  4O7H A;  1AQW A;  4TR1 B;  2ZNM A;  3GYK A;  5HR3 A;  5CRE A;  4X1U A;  4IQ1 A;  1JFU A;  1SD9 A;  2LTK A;  1FAA A;  2IFQ A;  5AN1 A;  2XHF A;  4N30 A;  1TOF A;  3QAG A;  3QCP A;  3MIX A;  11GS A;  4L8E A;  3EIN A;  2QSI A;  4Q5N A;  1SVO A;  3IE3 A;  1YKA A;  2O3E A;  4HOJ A;  4V2N A;  1PQN A;  4JR4 A;  4ZBB A;  2L59 A;  1LU4 A;  5EL8 A;  1I9D A;  2ON7 A;  3D0Z A;  2TRC P;  1GL8 A;  4NXI A;  2O87 A;  4BVX B;  5J40 A;  3U6V A;  4K0N A;  4E8H A;  5H5Q A;  2PUK C;  2YAN A;  1A0R P;  3ZIT A;  2L5O A;  4KCE A;  2YZU A;  1BG5 A;  1XFL A;  1ZOF A;  2FA8 A;  1T7P B;  4PI2 C;  1RK4 A;  1ZYN A;  1SD8 A;  2FWG A;  3GIX A;  2GS3 A;  1E6B A;  1GUK A;  4KND A;  2GQL A;  1AUC A;  3TJB A;  3HY2 A;  1ZGN A;  5ECP B;  4NAX A;  4HEA 2;  3ZLP A;  1Q4J A;  3CSH A;  3GKM A;  3QPM A;  1K3O A;  1SK2 A;  3N5O A;  4ACS A;  5IMD A;  3BBY A;  4MF7 A;  3UEM A;  1PL1 A;  2DJ1 A;  2AJQ B;  2ZCT A;  2NBS A;  1K0M A;  4L5L A;  4LMW A;  4GLT A;  5D73 A;  5ECL B;  3UAR A;  5CRW A;  1WOU A;  1TU7 A;  2HLS A;  1N25 A;  5ECS A;  2FA4 A;  4GXZ A;  1HQO A;  1J08 A;  3D6I A;  1T8E B;  1V58 A;  3WT2 A;  2PBJ A;  1O8X A;  1HYU A;  2VL9 A;  3TKP A;  5IOX A;  1A23 A;  3L9U A;  5CYY A;  3GN3 A;  2WVZ A;  2A2R A;  2YWN A;  5DJL A;  1M9A A;  1SVM A;  3HVX A;  3IOS A;  4I5Q A;  2H72 A;  2C1Y A;  2EC4 A;  2KP2 A;  2OBI A;  1NSW A;  2R3X A;  2WGR A;  4ZBD A;  2OBK A;  2WW0 A;  2J9H A;  3LOR A;  4WF5 A;  1XG8 A;  4PXO A;  4BL7 B;  3UIW A;  1OYJ A;  3ZMK A;  2MYG A;  4ZB7 A;  1YEP A;  1EGR A;  1VF1 A;  2FWH A;  1K0D A;  4ZIL A;  2O89 A;  1OC3 A;  3KGK A;  4E8E A;  1LBK A;  1FOH A;  3GKX A;  2EIQ A;  5E4W A;  1F9M A;  2DJK A;  1GNE A;  2VCX A;  5G2Z A;  4GDF A;  5C04 A;  1TU8 A;  3M3M A;  2KLX A;  4K5S A;  2KP1 A;  1NW2 A;  2IPA A;  2PU9 C;  4TXO B;  1VF3 A;  2FNO A;  5ECQ B;  5LCZ A;  1K0B A;  4MAB A;  2XPE A;  3GX0 A;  2XBI A;  3D21 A;  4DSQ A;  2GT5 A;  2OA7 A;  3E3E A;  2VCQ A;  4K7O A;  4MLY A;  3F4R A;  1M7T A;  1WWJ A;  1K0A A;  4ZXG A;  4NHW A;  5A5H B;  2L57 A;  2V1M A;  4TR3 A;  5ABR A;  2E2M A;  2F3M A;  5ECI B;  5CO3 A;  2EFH A;  18GS A;  3LSZ A;  2NDO A;  2R2J A;  3TKS E;  5CRG A;  1PSQ A;  2HSN A;  3CRT A;  2H19 A;  4MPG A;  4Q5Q A;  1M3J A;  1TRS A;  4YH2 A;  3GV1 A;  3IR4 A;  1YKC A;  3HMJ G;  1GUL A;  2NVL A;  2GT6 A;  3KCM A;  3FR9 A;  4QMK A;  3CSJ A;  2AYT A;  2JSZ A;  1SK0 A;  3RPN A;  4MMM A;  1X0R A;  1AQV A;  4BPY A;  3TKS A;  3Q18 A;  1B4P A;  4PUF C;  3ZRE A;  1O85 A;  5A5K A;  2K18 A;  3IAM 2;  2LST A;  3TKR A;  4KE3 A;  4K0G A;  4PX1 A;  3US3 A;  1V9W A;  1PGT A;  4KDU A;  1K3Y A;  3IBH A;  1T00 A;  4XRD A;  2X49 A;  3ZVJ A;  3Q19 A;  2CX4 A;  2YWO A;  4EL1 A;  2V32 A;  4KDY A;  4YKG A;  4Q5F A;  5DAL A;  2EFE A;  4KUN A;  2O85 A;  3O6T A;  1Y25 A;  4BA7 A;  2GZY A;  4IP1 A;  1A0F A;  4EDY A;  3APS A;  4FYB A;  3DEX A;  5G1L A;  4N3Z A;  3FZ5 A;  5LNK e;  2ZUP A;  2HNL A;  3QD9 A;  3VWV A;  4BIK A;  2DKI A;  2WVX B;  1TTZ A;  3G7I A;  3DKS A;  3EU3 A;  1HNB A;  3H8Q A;  4HQZ A;  5CNW A;  5ENU A;  2WUL A;  3EC3 A;  4ZL9 A;  5A1N B;  2DJ0 A;  2HT9 A;  4HI7 A;  3F8U A;  2BMX A;  1A2L A;  4HUA A;  2GVP A;  2X64 A;  3GL3 A;  3UOM A;  2CT6 A;  2VAF A;  3IXR A;  1JLV A;  4HZ4 A;  4P3Y B;  4NMU A;  1WE0 A;  5KOX A;  1UC7 A;  4MJA A;  4IBP A;  3BCK A;  2IMK A;  1YF0 A;  1O81 A;  2WW2 A;  2I1U A;  2OAC A;  5J4U A;  2DIY A;  1XBS A;  3C71 A;  4G0K A;  4J56 E;  2RUE A;  1TI1 A;  4KSO A;  3GUR A;  4XHM A;  5A34 A;  4F03 A;  3R3E A;  4FQU A;  1XCC A;  1PRX A;  3EMX A;  4RI6 A;  8GSS A;  4TOP A;  5DJM A;  2O7K A;  2MMA A;  1X9M B;  4F2I A;  2EFC A;  2RM6 A;  4HDE A;  4PGT A;  1SL2 B;  1O8W A;  3GKK A;  4NPB A;  5IMC A;  2V41 A;  4HQS A;  2QC7 A;  2VM1 A;  2HXK A;  1S4B P;  2PVQ A;  2HRK B;  3TOU A;  2X8H A;  2CZ3 A;  3VWX A;  3A2W A;  1T4Z A;  3FR6 A;  5F0G A;  2GTU A;  4OO5 A;  4IKH A;  3OR5 A;  2VCZ A;  4W66 A;  1B9Y C;  1DBY A;  1A24 A;  6GSX A;  1M2B A;  2L4C A;  4TR0 A;  5H5R A;  3UL3 A;  1GSQ A;  1XZO A;  4NV5 A;  1OKT A;  3VI5 A;  3ISO A;  2KHP A;  4GTU A;  4KF9 A;  3ZZX A;  1JZR A;  1PN0 A;  4JE1 A;  3S9F A;  4D73 A;  3HCZ A;  2H6Z A;  2E7P A;  1GLP A;  4AI6 A;  2CVK A;  1MDK A;  5DCH A;  1GP1 A;  2C3Q A;  5KN0 A;  2C0F A;  1FB6 A;  1J0F A;  2FGX A;  4MZW A;  1UN2 A;  4HU9 A;  1BX9 A;  5JCW A;  4CDO A;  3RBT A;  2DJJ A;  2FY6 A;  4ZB8 A;  3LWA A;  1ZCP A;  2A2P A;  2JSY A;  2H1D A;  4TW5 A;  3UMA A;  4XS4 A;  5GSS A;  4FH8 A;  1QK8 A;  3UAP A;  5ELA A;  4USS A;  2VUP A;  5IPH A;  4JED A;  4YQV A;  1GSF A;  4MPF A;  2LNT A;  1C72 A;  1FHE A;  16GS A;  3GKN A;  3CWG A;  4CY6 A;  3LYP A;  3RPP A;  2AAW A;  3M8N A;  1TK5 B;  3R2Q A;  4I2T A;  3JCM L;  1CQH A;  3DWV A;  4K7I A;  3M1G A;  1U88 A;  5KEJ A;  3L9S A;  2H6X A;  2H75 A;  3C73 A;  3P90 A;  3DRN A;  1AAZ A;  3APO A;  5ECH B;  3GMF A;  5INY A;  2CVB A;  3WT1 A;  3KEB A;  1BF5 A;  2MBT A;  2GSS A;  2A4H A;  5ID2 B;  5DDL A;  1GRX A;  4TR1 A;  4K2X A;  4XS1 A;  3P8W A;  1TK0 B;  1SKR B;  5HR1 A;  1BYE A;  1SJ6 A;  3DXB A;  2VCT A;  2FWF A;  1SK1 A;  3EE2 A;  1GH2 A;  3HVS A;  4HJ2 A;  4F82 A;  3HZ4 A;  4CHS A;  2H73 A;  1ILO A;  3A3T A;  3KM6 A;  4TVE A;  2XBQ A;  3L9V A;  2P31 A;  2JZR A;  4LMV A;  1NHO A;  3VWW A;  1A2M A;  4GQF A;  5JWO B;  4PUA A;  2F51 A;  4N0Z A;  2HQT A;  4I2U A;  1TDI A;  4BVX A;  2OJL A;  3P7X A;  3MAK A;  4WR5 A;  7GSS A;  2P0G A;  2H01 A;  3EU4 A;  1XXU A;  4IW9 A;  3A5I A;  2WJU A;  1ON4 A;  2DSA A;  4PHZ C;  4EIQ A;  4A5P A;  1EOG A;  2NPB A;  2FCH A;  1YJ6 A;  2LJA A;  3FK8 A;  2H0I A;  1DE2 A;  1MD4 A;  1T1V A;  1Q98 A;  4EKZ A;  3G7Y A;  1THO A;  1XWB A;  4WXT A;  2C0E A;  4NHZ A;  4WBR D;  4ZB9 A;  5LD0 A;  3DVX A;  2H1G A;  3QMX A;  2V6K A;  1HNC A;  4AKI A;  3EYT A;  3UBK A;  3UJ1 A;  2JL4 A;  2C3N A;  2FHE A;  1SKW B;  2DLX A;  3C1R A;  3HHV A;  3HVV A;  2WFC A;  4IN0 A;  4TXV A;  2VLV A;  4IHU A;  2WS2 A;  3IRA A;  2OAD A;  4Q5R A;  2P5Q A;  3LXZ A;  3GH9 A;  1XIY A;  5HFI A;  5BMU B;  2AV4 A;  1YEW C;  3CMI A;  3ZL5 A;  3ERG A;  5J41 A;  3KH7 A;  4GST A;  1G0T A;  2F8A A;  4PQI A;  2VLU A;  2B1L A;  3GSS A;  4OMV A;  2F8F A;  3HZ8 A;  3SBC A;  5CRH A;  3L4N A;  1BED A;  1R26 A;  2H1B A;  1KEB A;  3TU3 B;  5J9B A;  4MZB A;  2YV9 A;  4HS1 A;  5FHI A;  4KCA A;  2WW3 A;  3CXG A;  1NM3 A;  4WKW A;  2XC2 A;  1GLQ A;  2CAQ A;  2HSM B;  4BL7 A;  1BAY A;  3DVW A;  4WBJ A;  4PNF A;  5JCG A;  2R0C A;  1PX6 A;  1TK8 B;  3MDK A;  4OFN A;  2I3Y A;  1TRV A;  3A5W A;  4BWS A;  1KTE A;  2VD0 A;  1JZO A;  3UVH A;  2VLT A;  2F9S A;  3QR6 A;  1AIU A;  3TJG A;  4CY8 A;  2DC5 A;  1AW9 A;  4MA9 A;  2X99 A;  2YZH A;  4GRF A;  2PPT A;  3H93 A;  1XPV A;  3QFB C;  4EIP A;  4KW6 A;  2I4A A;  1VF2 A;  3RHC A;  4TXO A;  5IOW A;  1SJZ A;  2H71 A;  4QQ7 A;  4JBB A;  1MEK A;  2VO4 A;  1FW1 A;  3U5R E;  1SEN A;  2LRT A;  4GCI A;  2KUC A;  4MK3 A;  5J9C A;  4IP6 A;  2YCD A;  2YNX A;  4ISD A;  5F8B A;  5A5H A;  2K6V A;  1TRW A;  3MSZ A;  5HFG A;  4NWY A;  3A2V A;  2C80 A;  1XWA A;  3ZIJ A;  5DCG A;  4POM A;  5D93 A;  1SJI A;  3GTU B;  1O7U A;  4LL1 B;  5COH A;  5ECK B;  5IMV A;  3CTG A;  4YAP A;  2REM A;  4KGI A;  5IMA A;  2FWE A;  6GSS A;  2XPD A;  3O76 A;  1WIK A;  4N11 A;  3C8E A;  4G0I A;  2ON5 A;  4AF2 A;  3M9K A;  1OAZ A;  1OE7 A;  2BJX A;  3VFI A;  3P2A A;  2IJY A;  3BD2 A;  2YN1 A;  4TR4 A;  3FYG A;  5F05 A;  1TRU A;  2DMM A;  3WGX A;  2JU5 A;  1GUH A;  1U3I A;  3LW9 A;  6GSW A;  3PPU A;  2GQK A;  4QL7 A;  5JCU A;  2AB6 A;  1OKD A;  4OFT A;  2IIY A;  4EO3 A;  3KZQ A;  2DJ2 A;  2M80 A;  1J9B A;  2LQO A;  1FVJ A;  3CBU A;  4TN8 A;  4JRR A;  4XTS A;  4OCF A;  5AIV A;  5GST A;  14GS A;  1GSD A;  4HZ2 A;  3ZRD A;  2WVX A;  1FOV A;  2PER A;  3E9J B;  3GFK A;  3H4K A;  3TB2 A;  3TRP A;  1VF4 A;  1H4O A;  1WJK A;  4FYC A;  2C8U A;  1B8X A;  5A1N A;  3DYR A;  10GS A;  4ECB A;  4K2D A;  2C0D A;  2ALB A;  1WMJ A;  4ML6 A;  2JAD A;  3KD0 A;  4LL4 B;  4ILF A;  2IMD A;  1XOA A;  4O5R A;  1TP9 A;  4IEL A;  2QA1 A;  1FB0 A;  1FO5 A;  4WF4 A;  3KIJ A;  4ZBA A;  2FD3 A;  1IYH A;  3AY8 A;  3PH9 A;  1R7H A;  3UVT A;  1Z6N A;  4V1A g;  4RI7 A;  3C7M A;  2LNS A;  1X5D A;  2A4V A;  5A4U A;  4L0W A;  3KP9 A;  1RW1 A;  2PMT A;  5EVO A;  4MJE A;  4XS6 A;  3EWL A;  1DE1 A;  5IQY A;  3LEF A;  4ICY A;  3D4M A;  4ML1 A;  3IK7 A;  4QL9 A;  2I81 A;  2GST A;  5C00 A;  2HRK A;  1JHB A;  4FIW A;  5IMZ A;  1TKD B;  4L5O A;  3CHX C;  1OC8 A;  2CZ2 A;  1Z6M A;  2R0G A;  2CQ9 A;  2B7K A;  1Y1U A;  3E0U A;  4XRA A;  3TKQ A;  4GWR A;  4CW9 A;  1USB A;  1RQM A;  2H8L A;  22GS A;  2LV3 A;  5IO0 A;  1ZYP A;  2UV8 G;  4OO4 A;  4G01 A;  2YV7 A;  2J23 A;  4NV2 A;  1T3B A;  2UZ8 A;  3FZ4 A;  2MBS A;  3HJO A;  3QDN A;  4MF6 A;  2DBC A;  3F0I A;  1M2D A;  4DSR A;  5B6M A;  1GTB A;  3FEU A;  3CSI A;  4V1A p;  2MMZ A;  2GQM A;  5KN2 A;  3CQF A;  1EOH A;  4DVC A;  5G31 A;  2YWM A;  1WRY A;  4TKY A;  2CAI A;  3VWU A;  4GSN A;  4V2L A;  1TJD A;  2VL3 A;  2H70 A;  3F4S A;  5IM9 A;  19GS A;  1EGO A;  1F3B A;  1F6M C;  3BCI A;  4IS0 A;  1BJX A;  4G0L A;  6GSV A;  4HSC X;  4OCE A;  1QFN A;  2I9H A;  3GRX A;  3MYD A;  4PTS A;  3ERW A;  1PKZ A;  4FO5 A;  2PVO C;  3FZ9 A;  1B9X C;  1HNA A;  2L6D A;  2YP6 A;  4Z2U A;  1YY7 A;  5G5F A;  1QXH A;  2M72 A;  3TJJ A;  3TJF A;  4KX4 A;  4I6X A;  1GTA A;  4KH7 A;  3FRC A;  4G10 A;  5DAK B;  4EC0 A;  4ID0 A;  1QGV A;  4MNN A;  2N5B A;  3APQ A;  3TGZ A;  3CRU A;  3F4T A;  4KB3 A;  5J5N A;  2LJR A;  2LKU A;  2HSH A;  4O5Q A;  3TCO A;  4PNG A;  3H79 A;  2HYX A;  12GS A;  3HDC A;  1ERU A;  3W8J A;  4K7N A;  2L6C A;  2HSY A;  2V2G A;  1XWK A;  2WB9 A;  4ECJ A;  1X5C A;  1THX A;  4OFM A;  3LFL A;  1BG1 A;  4BWQ A;  2HZE B;  3NZN A;  2YOI A;  4F0B A;  5ID2 A;  2TIR A;  5E59 A;  1OE8 A;  5JWR B;  2HFD A;  4H86 A;  4KAE A;  5AGY A;  1UA5 A;  3UBL A;  2H0G A;  4K6X A;  5G1K A;  4K9Z A;  1ERT A;  1EEM A;  1GWC A;  4MZC A;  2O36 A;  1M3I A;  3TOT A;  2JZS A;  1JLW A;  3F6F A;  3KH9 A;  1XW6 A;  17GS A;  2R0P A;  2DKH A;  4K8M A;  3TUE A;  3DIE A;  2OE1 A;  4DSS B;  2B1K A;  5B8B A;  4KDX A;  2DML A;  1EZK A;  1K0N A;  3QFA C;  6GST A;  2R4V A;  3ZYW A;  2E2G A;  3LGC A;  5D9X A;  1ERW A;  1XW5 A;  4YKF A;  1ACV A;  4PQ1 A;  3KTB A;  2LRC A;  1ABA A;  2VM2 A;  2GDR A;  1V2A A;  1W89 A;  1CQG A;  1PMT A;  4IJI A;  4GQC A;  2N5A A;  1WPI A;  1S3D A;  5J3R A;  3ME8 A;  5J4V A;  1ML6 A;  3KXO A;  2IN3 A;  2VL2 C;  2IFQ B;  3DGQ A;  1R5A A;  2MMO A;  3IK9 A;  2QKE A;  2VCV A;  1YVL A;  4AKX B;  4L0U A;  1QMV A;  5F07 A;  3I9V 2;  1G6Y A;  1EP7 A;  1SL1 B;  4RQX A;  2VCW A;  3FKF A;  3PIN A; 
#chains in the Genus database with same CATH homology
 2EIR A;  1F37 A;  5G30 A;  1MDI A;  2OKA A;  2LS5 A;  5DQS A;  1VGL A;  1OVN A;  4GF0 A;  1R5P A;  4PUR A;  3PGT A;  5DQY A;  3GST A;  4ZL8 A;  1EWX A;  2LQQ A;  4AJ7 A;  4HJM A;  3ZFL A;  1XWG A;  3KMO A;  3I43 A;  5GAN D;  4G9H A;  4OWY A;  3BJ5 A;  2FUG 2;  1SYX A;  4IQA A;  3M9J A;  5ECR B;  2LUS A;  3KTL A;  5IO2 A;  4FYU A;  2H30 A;  5HR0 A;  5BMU A;  5D8I A;  3IHG A;  5ELG A;  2HRN A;  4Z2R A;  3IDV A;  1PKW A;  1TW9 A;  2WRT A;  1GUM A;  1SL0 B;  4F0C A;  2CV4 A;  2A2S A;  3GH6 A;  4YQM A;  1XW9 A;  1M2A A;  1WP0 A;  2VIM A;  5AIS A;  4POL A;  4WET A;  1XWC A;  5J4Y A;  5AIX A;  3N9J A;  3GHA A;  1QQ2 A;  1M0U A;  2JZT A;  1FG4 A;  1JZD A;  2Z9S A;  2WZ9 A;  1XOB A;  2IMI A;  1T4Y A;  1EEJ A;  3ED3 A;  3NOF A;  1QUW A;  4DEJ A;  1VRS D;  5FT3 A;  2HSM A;  2GZP A;  1TXU A;  4ECC A;  1PX7 A;  3ZFB A;  5DBQ A;  9GSS A;  5A4W A;  5JWQ B;  1EP8 A;  2IWT A;  4LLR A;  1N8J A;  2DIZ A;  4O32 A;  5IPG A;  1PA3 A;  3IHQ A;  2K8S A;  4OD7 A;  2VD1 A;  1Y6E A;  4IVF A;  4MP4 A;  4RQR A;  5EY6 A;  3Q74 A;  5B8A A;  3H1N A;  2QGV A;  2K8V A;  5B7C A;  2R37 A;  4MH2 A;  3ZML A;  2X8G A;  5DVB A;  1YZX A;  1W4V A;  3CYN A;  3G9B A;  5GAP D;  3FZA A;  1O6J A;  3PR8 A;  1Z7P A;  3HD5 A;  2B5E A;  2B5X A;  1G6W A;  3GUS A;  4AJ6 A;  5HR2 A;  2G0F A;  1G7O A;  5FWG A;  3F3R A;  5D9W A;  1Z3E A;  1MD3 A;  2N5F A;  1A2J A;  3NIV A;  1ZL9 A;  2YPM A;  3CTF A;  3L0H A;  5L71 A;  1K0C A;  5IIZ A;  4MH3 A;  3I6A A;  1PD2 1;  3WYW A;  1OC9 A;  3GTU A;  2H1A A;  2HE3 A;  4K5R A;  2P5R A;  1OC9 B;  2H74 A;  4O92 A;  2ES7 A;  3ZVJ D;  4EUY A;  3KJY A;  3TRX A;  2GZZ A;  1G7E A;  1EV9 A;  1S3C A;  1TXX A;  2CX3 A;  3RAZ A;  2RLI A;  4ZL7 A;  1B4Q A;  3W6G A;  3TJK A;  2E0Q A;  2PGT A;  1R4W A;  3M0F A;  5KN3 A;  3ZIV A;  2GSR A;  1U87 A;  4JU5 A;  2BTO T;  2HSN B;  5A4V A;  2H6Y A;  2D2Z A;  3HYP A;  4KSM A;  1PL2 A;  3Q6O A;  1PN9 A;  4AKG A;  2OE3 A;  4EVM A;  3MNG A;  4V2M A;  3SWL A;  2HI7 A;  4YQU A;  3TDG A;  4EF0 A;  3FR3 A;  1HD2 A;  5J47 A;  3VPT A;  5G5E A;  1A8Y A;  1FVK A;  1F3A A;  4G19 A;  1UVZ A;  20GS A;  3GA4 A;  3IA1 A;  5HFK A;  3L78 A;  2O5V A;  1ZZY A;  2K9F A;  1JZW A;  2MZC A;  2X8C A;  3RHB A;  3EMP A;  2JAC A;  1ST9 A;  4POB A;  3LG6 A;  5BRT A;  2HRA A;  1V57 A;  1B48 A;  3IAS 2;  4N0V A;  1YDK A;  2LJK A;  2YJH A;  2IL3 A;  1S3A A;  4ECI A;  1URM A;  5DAL B;  2RUF A;  3J7Y k;  6GSY A;  4EXJ A;  4JR6 A;  1LJR A;  3VK9 A;  2EIO A;  2RM5 A;  2LRN A;  4J2F A;  5CRD A;  4J57 E;  4ZIJ A;  3FW2 A;  4HU7 A;  4G2E A;  3I69 A;  1XVQ A;  5B6N A;  3D22 A;  4X0X A;  13GS A;  1DSB A;  2IMF A;  4AKH A;  4X43 A;  1GSU A;  5D9T A;  3VLN A;  4IJ3 A;  2C0G A;  4XIH A;  2LEG A;  4I97 A;  3F3Q A;  2O8V B;  4MJB A;  2HZF A;  5KN1 A;  2MMN A;  1K3L A;  3HJM A;  1X5E A;  5F06 A;  2R6K A;  3FY7 A;  2VOC A;  1SVL A;  3HXS A;  4EDZ A;  5H5S A;  2TRX A;  4O5U A;  4MF5 A;  5CAX A;  2IME A;  3F63 A;  1GSY A;  5ECO B;  2L5L A;  2B6M A;  3FMW A;  1N2A A;  3BOA A;  2RII A;  3A2X A;  3IC4 A;  1ZYE A;  1ZYQ B;  2M46 A;  3O3T A;  2B7J A;  2VL2 A;  2H66 A;  3LJR A;  1U6T A;  2B5Y A;  5A34 B;  5GZZ B;  3F9U A;  4JZQ A;  4F9Z A;  1GTU A;  2WDU A;  4RUV A;  3QOU A;  1K0O A;  3IV4 A;  4Z2T A;  3F6D A;  1BQ7 A;  3G7J A;  3IPZ A;  1YF1 A;  4BVY A;  1X9S B;  3LXT A;  2L4Q A;  2GLR A;  5ECN B;  4I8B A;  2WCI A;  2VKZ G;  1YEX A;  1F2E A;  4AJ8 A;  4BVY B;  1SKS B;  1M9B A;  2R5G A;  2CA8 A;  4WEY A;  3V1W A;  3DML A;  2DJ3 A;  1O73 A;  1EV4 A;  4TRX A;  3C1S A;  3IC8 A;  4E68 A;  5IMF A;  2QA2 A;  1TI3 A;  1XVW A;  3WGD A;  3D5J A;  2H1L A;  1U3A A;  3HKR A;  1Z5Y E;  3K8N A;  2YWI A;  1V40 A;  1MDJ A;  3QAV A;  3WGE A;  5CP1 A;  1SYR A;  4IGJ A;  1I5G A;  3RDW A;  1DUG A;  2GGT A;  1ZMA A;  3LYK A;  3MWH A;  4D73 B;  1GSS A;  2B3S A;  3ZTL A;  1SU9 A;  3J7Y b;  3W8S A;  3VPQ A;  3TKS C;  2X4A A;  4Z7X A;  1MTC A;  3DD3 A;  4XCS A;  1KBN A;  4MDC A;  2PN8 A;  4LA1 A;  2G2Q A;  2H0H A;  5DAK A;  4WR4 A;  4X4J A;  1M99 A;  4K1F A;  2OT3 A;  4ULX A;  4ZB6 A;  1E2Y A;  2H76 A;  2KOK A;  3GNJ A;  3HJP A;  3VUR A;  6GSU A;  1H75 A;  3ERF A;  2C3T A;  3KMN A;  4AGS A;  1AC1 A;  4XS4 B;  2YJ7 A;  5D96 A;  4GSS A;  2HRF A;  3GL5 A;  1IYI A;  1Z9H A;  3LQ7 A;  1GNW A;  2HZE A;  3EUR A;  2V6O A;  1ERV A;  1Z7R A;  1GTI A;  2NTO A;  4YAV A;  2GSQ A;  3ME7 A;  5HQP A;  1AXD A;  2PWJ A;  1NHY A;  1V98 A;  3D4T A;  1A8L A;  3EVI A;  5ECM B;  2AHE A;  4PQH A;  2AUV A;  3EPT A;  3WD6 A;  5D9V A;  4KA0 A;  3FHK A;  4DSS A;  2FLS A;  2CVD A;  3TRQ A;  2EFD A;  4MJC A;  4N10 A;  1GSE A;  2C4J A;  3QAW A;  1KNG A;  2OE0 A;  3HA9 A;  1YQ1 A;  3GX8 A;  4POK A;  3VI7 A;  1X9W B;  5KOW A;  1AQX A;  5EPF A;  4EE0 A;  3KP8 A;  4MCU A;  4O7H A;  1AQW A;  4TR1 B;  2ZNM A;  3GYK A;  5HR3 A;  5CRE A;  4X1U A;  4IQ1 A;  1JFU A;  1SD9 A;  2LTK A;  1FAA A;  2IFQ A;  5AN1 A;  2XHF A;  4N30 A;  1TOF A;  3QAG A;  3QCP A;  3MIX A;  11GS A;  4L8E A;  3EIN A;  2QSI A;  4Q5N A;  1SVO A;  3IE3 A;  1YKA A;  4HOJ A;  4V2N A;  1PQN A;  4JR4 A;  4ZBB A;  2L59 A;  1LU4 A;  5EL8 A;  1I9D A;  2ON7 A;  3D0Z A;  2TRC P;  1GL8 A;  4NXI A;  2O87 A;  4BVX B;  5J40 A;  3U6V A;  4K0N A;  4E8H A;  5H5Q A;  2PUK C;  2YAN A;  1A0R P;  3ZIT A;  2L5O A;  4KCE A;  2YZU A;  1BG5 A;  1XFL A;  1ZOF A;  2FA8 A;  1T7P B;  1RK4 A;  1ZYN A;  1SD8 A;  2FWG A;  3GIX A;  2GS3 A;  1E6B A;  1GUK A;  4KND A;  2GQL A;  1AUC A;  3TJB A;  3HY2 A;  1ZGN A;  5ECP B;  4NAX A;  4HEA 2;  3ZLP A;  1Q4J A;  3CSH A;  3GKM A;  3QPM A;  1K3O A;  1SK2 A;  3N5O A;  4ACS A;  5IMD A;  3BBY A;  4MF7 A;  3UEM A;  1PL1 A;  2DJ1 A;  2AJQ B;  2ZCT A;  2NBS A;  1K0M A;  4L5L A;  4LMW A;  4GLT A;  5D73 A;  5ECL B;  3UAR A;  5CRW A;  1WOU A;  1TU7 A;  2HLS A;  1N25 A;  5ECS A;  2FA4 A;  4GXZ A;  1HQO A;  1J08 A;  3D6I A;  1T8E B;  1V58 A;  3WT2 A;  2PBJ A;  1O8X A;  1HYU A;  2VL9 A;  3TKP A;  5IOX A;  1A23 A;  3L9U A;  5CYY A;  3GN3 A;  2A2R A;  2YWN A;  5DJL A;  1M9A A;  1SVM A;  3HVX A;  3IOS A;  4I5Q A;  2H72 A;  2C1Y A;  2EC4 A;  2KP2 A;  2OBI A;  1NSW A;  2R3X A;  2WGR A;  4ZBD A;  2OBK A;  2J9H A;  3LOR A;  4WF5 A;  4PXO A;  4BL7 B;  3UIW A;  1OYJ A;  3ZMK A;  2MYG A;  4ZB7 A;  1YEP A;  1EGR A;  1VF1 A;  2FWH A;  1K0D A;  4ZIL A;  2O89 A;  1OC3 A;  3KGK A;  4E8E A;  1LBK A;  1FOH A;  3GKX A;  2EIQ A;  5E4W A;  1F9M A;  2DJK A;  1GNE A;  2VCX A;  5G2Z A;  4GDF A;  5C04 A;  1TU8 A;  3M3M A;  2KLX A;  4K5S A;  2KP1 A;  1NW2 A;  2IPA A;  2PU9 C;  4TXO B;  1VF3 A;  2FNO A;  5ECQ B;  5LCZ A;  1K0B A;  4MAB A;  2XPE A;  3GX0 A;  2XBI A;  3D21 A;  4DSQ A;  2GT5 A;  2OA7 A;  3E3E A;  2VCQ A;  4K7O A;  4MLY A;  3F4R A;  1M7T A;  1WWJ A;  1K0A A;  4ZXG A;  4NHW A;  5A5H B;  2L57 A;  2V1M A;  4TR3 A;  5ABR A;  2E2M A;  2F3M A;  5ECI B;  5CO3 A;  2EFH A;  18GS A;  3LSZ A;  2NDO A;  2R2J A;  3TKS E;  5CRG A;  1PSQ A;  2HSN A;  3CRT A;  2H19 A;  4MPG A;  4Q5Q A;  1TRS A;  4YH2 A;  3GV1 A;  3IR4 A;  1YKC A;  3HMJ G;  1GUL A;  2NVL A;  2GT6 A;  3KCM A;  3FR9 A;  4QMK A;  3CSJ A;  2AYT A;  2JSZ A;  1SK0 A;  3RPN A;  4MMM A;  1X0R A;  1AQV A;  4BPY A;  3TKS A;  3Q18 A;  1B4P A;  4PUF C;  3ZRE A;  1O85 A;  5A5K A;  2K18 A;  3IAM 2;  2LST A;  3TKR A;  4KE3 A;  4K0G A;  4PX1 A;  3US3 A;  1V9W A;  1PGT A;  4KDU A;  1K3Y A;  3IBH A;  1T00 A;  4XRD A;  2X49 A;  3ZVJ A;  3Q19 A;  2CX4 A;  2YWO A;  4EL1 A;  2V32 A;  4KDY A;  4YKG A;  4Q5F A;  5DAL A;  2EFE A;  4KUN A;  2O85 A;  3O6T A;  1Y25 A;  4BA7 A;  2GZY A;  4IP1 A;  1A0F A;  4EDY A;  3APS A;  4FYB A;  3DEX A;  5G1L A;  4N3Z A;  3FZ5 A;  5LNK e;  2ZUP A;  2HNL A;  3QD9 A;  3VWV A;  2DKI A;  1TTZ A;  3G7I A;  3DKS A;  3EU3 A;  1HNB A;  3H8Q A;  4HQZ A;  5CNW A;  5ENU A;  2WUL A;  3EC3 A;  4ZL9 A;  5A1N B;  2DJ0 A;  2HT9 A;  4HI7 A;  3F8U A;  2BMX A;  1A2L A;  4HUA A;  2GVP A;  2X64 A;  3GL3 A;  3UOM A;  2CT6 A;  2VAF A;  3IXR A;  1JLV A;  4HZ4 A;  4P3Y B;  4NMU A;  1WE0 A;  5KOX A;  1UC7 A;  4MJA A;  4IBP A;  3BCK A;  2IMK A;  1YF0 A;  1O81 A;  2I1U A;  2OAC A;  5J4U A;  2DIY A;  1XBS A;  3C71 A;  4G0K A;  4J56 E;  2RUE A;  1TI1 A;  4KSO A;  3GUR A;  4XHM A;  5A34 A;  4F03 A;  3R3E A;  4FQU A;  1XCC A;  1PRX A;  3EMX A;  4RI6 A;  8GSS A;  4TOP A;  5DJM A;  2O7K A;  2MMA A;  1X9M B;  4F2I A;  2EFC A;  2RM6 A;  4HDE A;  4PGT A;  1SL2 B;  1O8W A;  3GKK A;  4NPB A;  5IMC A;  2V41 A;  4HQS A;  2QC7 A;  2VM1 A;  2HXK A;  2PVQ A;  2HRK B;  3TOU A;  2X8H A;  2CZ3 A;  3VWX A;  3A2W A;  1T4Z A;  3FR6 A;  5F0G A;  2GTU A;  4OO5 A;  4IKH A;  3OR5 A;  2VCZ A;  4W66 A;  1B9Y C;  1DBY A;  1A24 A;  6GSX A;  1M2B A;  2L4C A;  4TR0 A;  5H5R A;  3UL3 A;  1GSQ A;  1XZO A;  4NV5 A;  1OKT A;  3VI5 A;  3ISO A;  2KHP A;  4GTU A;  4KF9 A;  3ZZX A;  1JZR A;  1PN0 A;  4JE1 A;  3S9F A;  4D73 A;  3HCZ A;  2H6Z A;  2E7P A;  1GLP A;  4AI6 A;  2CVK A;  1MDK A;  5DCH A;  1GP1 A;  2C3Q A;  5KN0 A;  2C0F A;  1FB6 A;  1J0F A;  2FGX A;  4MZW A;  1UN2 A;  4HU9 A;  1BX9 A;  5JCW A;  4CDO A;  3RBT A;  2DJJ A;  2FY6 A;  4ZB8 A;  3LWA A;  1ZCP A;  2A2P A;  2JSY A;  2H1D A;  4TW5 A;  3UMA A;  4XS4 A;  5GSS A;  4FH8 A;  1QK8 A;  3UAP A;  5ELA A;  4USS A;  2VUP A;  5IPH A;  4JED A;  4YQV A;  1GSF A;  4MPF A;  2LNT A;  1C72 A;  1FHE A;  16GS A;  3GKN A;  3CWG A;  4CY6 A;  3LYP A;  3RPP A;  2AAW A;  3M8N A;  1TK5 B;  3R2Q A;  4I2T A;  3JCM L;  1CQH A;  3DWV A;  4K7I A;  3M1G A;  1U88 A;  5KEJ A;  3L9S A;  2H6X A;  2H75 A;  3C73 A;  3P90 A;  3DRN A;  1AAZ A;  3APO A;  5ECH B;  3GMF A;  5INY A;  2CVB A;  3WT1 A;  3KEB A;  1BF5 A;  2MBT A;  2GSS A;  2A4H A;  5ID2 B;  5DDL A;  1GRX A;  4TR1 A;  4K2X A;  4XS1 A;  3P8W A;  1TK0 B;  1SKR B;  5HR1 A;  1BYE A;  1SJ6 A;  3DXB A;  2VCT A;  2FWF A;  1SK1 A;  3EE2 A;  1GH2 A;  3HVS A;  4HJ2 A;  4F82 A;  3HZ4 A;  4CHS A;  2H73 A;  1ILO A;  3A3T A;  3KM6 A;  4TVE A;  2XBQ A;  3L9V A;  2P31 A;  2JZR A;  4LMV A;  1NHO A;  3VWW A;  1A2M A;  4GQF A;  5JWO B;  4PUA A;  2F51 A;  4N0Z A;  2HQT A;  4I2U A;  1TDI A;  4BVX A;  2OJL A;  3P7X A;  3MAK A;  4WR5 A;  7GSS A;  2P0G A;  2H01 A;  3EU4 A;  1XXU A;  4IW9 A;  3A5I A;  2WJU A;  1ON4 A;  2DSA A;  4EIQ A;  4A5P A;  1EOG A;  2NPB A;  2FCH A;  1YJ6 A;  2LJA A;  3FK8 A;  2H0I A;  1DE2 A;  1MD4 A;  1T1V A;  1Q98 A;  4EKZ A;  3G7Y A;  1THO A;  1XWB A;  4WXT A;  2C0E A;  4NHZ A;  4WBR D;  4ZB9 A;  5LD0 A;  3DVX A;  2H1G A;  3QMX A;  2V6K A;  1HNC A;  4AKI A;  3EYT A;  3UBK A;  3UJ1 A;  2JL4 A;  2C3N A;  2FHE A;  1SKW B;  2DLX A;  3C1R A;  3HHV A;  3HVV A;  2WFC A;  4IN0 A;  4TXV A;  2VLV A;  4IHU A;  2WS2 A;  3IRA A;  2OAD A;  4Q5R A;  2P5Q A;  3LXZ A;  3GH9 A;  1XIY A;  5HFI A;  5BMU B;  2AV4 A;  3CMI A;  3ZL5 A;  3ERG A;  5J41 A;  3KH7 A;  4GST A;  1G0T A;  2F8A A;  4PQI A;  2VLU A;  2B1L A;  3GSS A;  4OMV A;  2F8F A;  3HZ8 A;  3SBC A;  5CRH A;  3L4N A;  1BED A;  1R26 A;  2H1B A;  1KEB A;  3TU3 B;  5J9B A;  4MZB A;  2YV9 A;  4HS1 A;  5FHI A;  4KCA A;  3CXG A;  1NM3 A;  4WKW A;  2XC2 A;  1GLQ A;  2CAQ A;  2HSM B;  4BL7 A;  1BAY A;  3DVW A;  4WBJ A;  4PNF A;  5JCG A;  2R0C A;  1PX6 A;  1TK8 B;  3MDK A;  4OFN A;  2I3Y A;  1TRV A;  3A5W A;  4BWS A;  1KTE A;  2VD0 A;  1JZO A;  3UVH A;  2VLT A;  2F9S A;  3QR6 A;  1AIU A;  3TJG A;  4CY8 A;  2DC5 A;  1AW9 A;  4MA9 A;  2X99 A;  2YZH A;  4GRF A;  2PPT A;  3H93 A;  1XPV A;  3QFB C;  4EIP A;  4KW6 A;  2I4A A;  1VF2 A;  3RHC A;  4TXO A;  5IOW A;  1SJZ A;  2H71 A;  4QQ7 A;  4JBB A;  1MEK A;  2VO4 A;  1FW1 A;  3U5R E;  1SEN A;  2LRT A;  4GCI A;  2KUC A;  4MK3 A;  5J9C A;  4IP6 A;  2YCD A;  2YNX A;  4ISD A;  5F8B A;  5A5H A;  2K6V A;  1TRW A;  3MSZ A;  5HFG A;  4NWY A;  3A2V A;  2C80 A;  1XWA A;  3ZIJ A;  5DCG A;  4POM A;  5D93 A;  1SJI A;  3GTU B;  1O7U A;  4LL1 B;  5COH A;  5ECK B;  5IMV A;  3CTG A;  4YAP A;  2REM A;  4KGI A;  5IMA A;  2FWE A;  6GSS A;  2XPD A;  3O76 A;  1WIK A;  4N11 A;  3C8E A;  4G0I A;  2ON5 A;  4AF2 A;  3M9K A;  1OAZ A;  1OE7 A;  2BJX A;  3VFI A;  3P2A A;  2IJY A;  3BD2 A;  2YN1 A;  4TR4 A;  3FYG A;  5F05 A;  1TRU A;  2DMM A;  3WGX A;  2JU5 A;  1GUH A;  1U3I A;  3LW9 A;  6GSW A;  3PPU A;  2GQK A;  4QL7 A;  5JCU A;  2AB6 A;  1OKD A;  4OFT A;  2IIY A;  4EO3 A;  3KZQ A;  2DJ2 A;  2M80 A;  1J9B A;  2LQO A;  1FVJ A;  3CBU A;  4TN8 A;  4JRR A;  4XTS A;  4OCF A;  5AIV A;  5GST A;  14GS A;  1GSD A;  4HZ2 A;  3ZRD A;  1FOV A;  2PER A;  3E9J B;  3GFK A;  3H4K A;  3TB2 A;  3TRP A;  1VF4 A;  1H4O A;  1WJK A;  4FYC A;  2C8U A;  1B8X A;  5A1N A;  3DYR A;  10GS A;  4ECB A;  4K2D A;  2C0D A;  2ALB A;  1WMJ A;  4ML6 A;  2JAD A;  3KD0 A;  4LL4 B;  4ILF A;  2IMD A;  1XOA A;  4O5R A;  1TP9 A;  4IEL A;  2QA1 A;  1FB0 A;  1FO5 A;  4WF4 A;  3KIJ A;  4ZBA A;  2FD3 A;  1IYH A;  3AY8 A;  3PH9 A;  1R7H A;  3UVT A;  1Z6N A;  4V1A g;  4RI7 A;  3C7M A;  2LNS A;  1X5D A;  2A4V A;  5A4U A;  4L0W A;  3KP9 A;  1RW1 A;  2PMT A;  5EVO A;  4MJE A;  4XS6 A;  3EWL A;  1DE1 A;  5IQY A;  3LEF A;  4ICY A;  3D4M A;  4ML1 A;  3IK7 A;  4QL9 A;  2I81 A;  2GST A;  5C00 A;  2HRK A;  1JHB A;  4FIW A;  5IMZ A;  1TKD B;  4L5O A;  1OC8 A;  2CZ2 A;  1Z6M A;  2R0G A;  2CQ9 A;  2B7K A;  1Y1U A;  3E0U A;  4XRA A;  3TKQ A;  4GWR A;  4CW9 A;  1USB A;  1RQM A;  2H8L A;  22GS A;  2LV3 A;  5IO0 A;  1ZYP A;  2UV8 G;  4OO4 A;  4G01 A;  2YV7 A;  2J23 A;  4NV2 A;  1T3B A;  2UZ8 A;  3FZ4 A;  2MBS A;  3HJO A;  3QDN A;  4MF6 A;  2DBC A;  3F0I A;  1M2D A;  4DSR A;  5B6M A;  1GTB A;  3FEU A;  3CSI A;  4V1A p;  2MMZ A;  2GQM A;  5KN2 A;  1EOH A;  4DVC A;  5G31 A;  2YWM A;  1WRY A;  4TKY A;  2CAI A;  3VWU A;  4GSN A;  4V2L A;  1TJD A;  2VL3 A;  2H70 A;  3F4S A;  5IM9 A;  19GS A;  1EGO A;  1F3B A;  1F6M C;  3BCI A;  4IS0 A;  1BJX A;  4G0L A;  6GSV A;  4OCE A;  1QFN A;  2I9H A;  3GRX A;  3MYD A;  4PTS A;  3ERW A;  1PKZ A;  4FO5 A;  2PVO C;  3FZ9 A;  1B9X C;  1HNA A;  2L6D A;  2YP6 A;  4Z2U A;  1YY7 A;  5G5F A;  1QXH A;  2M72 A;  3TJJ A;  3TJF A;  4KX4 A;  4I6X A;  1GTA A;  4KH7 A;  3FRC A;  4G10 A;  5DAK B;  4EC0 A;  4ID0 A;  1QGV A;  4MNN A;  2N5B A;  3APQ A;  3TGZ A;  3CRU A;  3F4T A;  4KB3 A;  5J5N A;  2LJR A;  2LKU A;  2HSH A;  4O5Q A;  3TCO A;  4PNG A;  3H79 A;  2HYX A;  12GS A;  3HDC A;  1ERU A;  3W8J A;  4K7N A;  2L6C A;  2HSY A;  2V2G A;  1XWK A;  2WB9 A;  4ECJ A;  1X5C A;  1THX A;  4OFM A;  3LFL A;  1BG1 A;  4BWQ A;  2HZE B;  3NZN A;  2YOI A;  4F0B A;  5ID2 A;  2TIR A;  5E59 A;  1OE8 A;  5JWR B;  2HFD A;  4H86 A;  4KAE A;  5AGY A;  1UA5 A;  3UBL A;  2H0G A;  4K6X A;  5G1K A;  4K9Z A;  1ERT A;  1EEM A;  1GWC A;  4MZC A;  3TOT A;  2JZS A;  1JLW A;  3F6F A;  3KH9 A;  1XW6 A;  17GS A;  2R0P A;  2DKH A;  4K8M A;  3TUE A;  3DIE A;  2OE1 A;  4DSS B;  2B1K A;  5B8B A;  4KDX A;  2DML A;  1EZK A;  1K0N A;  3QFA C;  6GST A;  2R4V A;  3ZYW A;  2E2G A;  3LGC A;  5D9X A;  1ERW A;  1XW5 A;  4YKF A;  1ACV A;  4PQ1 A;  3KTB A;  2LRC A;  1ABA A;  2VM2 A;  2GDR A;  1V2A A;  1W89 A;  1CQG A;  1PMT A;  4IJI A;  4GQC A;  2N5A A;  1WPI A;  1S3D A;  5J3R A;  3ME8 A;  5J4V A;  1ML6 A;  3KXO A;  2IN3 A;  2VL2 C;  2IFQ B;  3DGQ A;  1R5A A;  2MMO A;  3IK9 A;  2QKE A;  2VCV A;  1YVL A;  4AKX B;  4L0U A;  1QMV A;  5F07 A;  3I9V 2;  1G6Y A;  1EP7 A;  1SL1 B;  4RQX A;  2VCW A;  3FKF A;  3PIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...