4RI7A

Crystal structure of poplar glutathione transferase f1 mutant ser 13 cys
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
214
structure length
214
Chain Sequence
ATPVTIYGPPLCTAVSRVLATLIEKDVPFHLIPIDLSKGEQKKPEYLKIQPFGQVPAFKDESITLFESRAICRYICDKYADKGNKSLYGTDILSKANIDQWVETDGQTFGPPSGDLVHDLLFSSVPVDEALIKKNVDKLAKVLDIYEQKLGQTRFLAGDEFSFADLSHLPNGDYLVNSTDKGYLFTSRKNVNRWWTEISNRESWKKVLEMRKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The poplar Phi class glutathione transferase: expression, activity and structure of GSTF1.
pubmed doi rcsb
molecule keywords Phi class glutathione transferase GSTF1
molecule tags Transferase
source organism Populus tremula x populus tremuloides
total genus 80
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ri7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ri7A01
1G6YA 1GRXA 3ZFLA 2IFQB 3MAKA 2JZRA 2H8LA 3R2QA 4I6XA 2C0FA 3QAGA 5HFIA 3UBKA 1DUGA 3LXTA 2FWFA 1PN9A 4IS0A 3SBCA 2CV4A 2GLRA 1JZDA 3KMOA 5H5QA 1PQNA 3PPUA 2ON5A 3WYWA 4YAVA 1AQWA 4O5RA 4BWQA 5DCGA 3PINA 1PD21 2XHFA 5CAXA 3GKKA 3MNGA 4GQCA 3UMAA 1GSUA 2FA8A 1TRVA 2ES7A 3WT2A 2K6VA 3L9SA 3RBTA 1O85A 3KD0A 1LJRA 5COHA 4PURA 1M2DA 5C00A 2QGVA 2LUSA 3C1SA 4ZBAA 2NPBA 3C71A 2P5QA 2LRCA 2LTKA 3KTLA 1GSDA 5E4WA 3FYGA 4ILFA 4IQAA 5J4UA 4EKZA 2WDUA 2DLXA 2YZHA 1SJIA 2V41A 1J9BA 3LEFA 4JBBA 2VIMA 4MPFA 3IV4A 3PH9A 2R4VA 4KGIA 3BCIA 2GTUA 5JCGA 3IXRA 4IN0A 3HVSA 1X5CA 1MTCA 5DALA 2B6MA 5CNWA 4XRDA 1XXUA 2IPAA 3GKNA 4HZ2A 4HEA2 4WF5A 2O8VB 1F6MC 2LEGA 4MZBA 4NHWA 3RAZA 1SKWB 4KA0A 2I9HA 4GSTA 4ZBDA 1XZOA 5AISA 3TKSA 3DGQA 2PN8A 4AF2A 3SWLA 4TR3A 2VCWA 4GSNA 2H75A 2GZZA 1TRUA 4FO5A 1SYRA 3HA9A 1K0MA 1KNGA 1LBKA 5ID2B 2LRNA 4FYBA 1BQ7A 1CQGA 3D21A 2OADA 3CTGA 5IMCA 5IQYA 4K7NA 4HI7A 1GLQA 3ZVJA 4K6XA 2FD3A 1R4WA 2OJLA 1B4QA 2H66A 4I8BA 1QXHA 1MDJA 2N5FA 4KDYA 5G31A 2VLTA 4LL4B 4XS1A 4IW9A 1U6TA 1TDIA 5DBQA 13GSA 2B7KA 2KLXA 4POKA 1X5EA 3TRXA 4JU5A 3M9KA 5GSSA 3A5WA 3L9UA 4DEJA 3J7Yb 5ECRB 4EE0A 3D22A 4BA7A 1FB0A 3VI5A 3VPTA 1USBA 2C8UA 1MD4A 3NZNA 2CT6A 4GRFA 3UIWA 1WIKA 5G1KA 1URMA 5D9WA 3P90A 1GSFA 4XHMA 3D0ZA 3FKFA 5EL8A 2C1YA 3TKRA 1AQXA 3KXOA 1B4PA 3IK7A 3RHCA 2GDRA 1BX9A 4X0XA 1Z5YE 1V98A 4N30A 2REMA 2I81A 1GUKA 1SKSB 5DQYA 2VUPA 2MMNA 1ILOA 4NV5A 1GTIA 2H01A 4ID0A 5KN1A 1B8XA 4YH2A 3G7JA 3WGXA 2AUVA 3CSHA 3KP8A 3ZL5A 1PL1A 3D4MA 2BJXA 2C0DA 2NBSA 4N0VA 3FZ9A 2UZ8A 5CP1A 3C73A 1JZOA 3GIXA 6GSWA 1X0RA 3ZFBA 2HFDA 1SK1A 4BVXA 3VPQA 4GLTA 1KEBA 3I6AA 2IL3A 4YAPA 3IOSA 1FG4A 4TR4A 1JZRA 1TU8A 1M9BA 2DC5A 5GZZB 4K2DA 5CRDA 1NSWA 4MJCA 2HSMB 2YV9A 1PA3A 2WRTA 1Q4JA 2VL2C 1GULA 1XOAA 5J9CA 5ECPB 4IGJA 2IMIA 6GSTA 1U88A 2DIZA 5A5KA 5L71A 4RQXA 3UVHA 2VOCA 4ML1A 3DXBA 4X43A 4TXOB 2F9SA 1ERVA 3L4NA 2PERA 1XBSA 1SJ6A 5HFGA 1O6JA 2H1DA 2KP2A 1ST9A 2HYXA 1MDKA 4NV2A 1JLVA 3GSTA 2YV7A 4EL1A 3GRXA 5B6NA 1J0FA 6GSSA 3LXZA 4WBJA 4KAEA 1W89A 1ERWA 5GAND 1QUWA 4KCEA 3RHBA 4BPYA 4I97A 1K0OA 5IMZA 3ZRDA 3GTUB 4DVCA 3U5RE 4CW9A 4F9ZA 1G7EA 3TUEA 4LA1A 4DSSA 4ZL8A 2RLIA 2WCIA 3ZYWA 2WFCA 3ZVJD 2LQOA 18GSA 4L5LA 1XWCA 3GHAA 17GSA 2H6XA 1IYIA 1M2AA 5F8BA 1G6WA 3O3TA 5AN1A 1TTZA 1G7OA 2TRCP 5D73A 2V32A 4IQ1A 1FO5A 2MMZA 5J5NA 4L8EA 3KCMA 1WP0A 1RW1A 4IP1A 1ACVA 2N5AA 4PGTA 3W6GA 1V40A 4TW5A 5FWGA 4TXVA 2HSHA 4ZIJA 1XWBA 3EINA 3W8SA 19GSA 2V2GA 2F51A 1OE7A 2DJKA 4Q5QA 3C1RA 5B8AA 4EXJA 5JWQB 3ERFA 3UOMA 2L59A 1EZKA 5EVOA 2TRXA 5AGYA 1TI3A 3HZ4A 1YEPA 1XIYA 3J7Yk 4D73A 1XWGA 3OR5A 1JHBA 3TKSE 1T3BA 4XS4B 3D5JA 2E2GA 4ISDA 1K0BA 5DDLA 2B7JA 5IMVA 2GQKA 1A0FA 2QC7A 3V1WA 4IVFA 1VGLA 3HYPA 3TJGA 3NOFA 2MBSA 4MJAA 2O89A 1YF1A 1DE1A 3LGCA 3KGKA 1YKCA 3TOUA 5ECIB 4HJ2A 3QR6A 5D9TA 2PU9C 3H1NA 5DAKA 4Z7XA 5CRWA 2JZTA 5JWOB 3Q6OA 1Z6NA 5DCHA 1EV4A 1RQMA 1SL0B 4N0ZA 3HY2A 5G30A 2H70A 2GGTA 1HNAA 3EMXA 1A2MA 5D8IA 4KDUA 1C72A 1V57A 1T00A 3IA1A 2EIRA 3P7XA 5KN0A 3QPMA 1GL8A 2GQLA 3IHQA 3VURA 1THOA 2YP6A 4KSOA 1Q98A 1KTEA 3KH7A 2OE1A 1K0NA 3M9JA 4I2TA 3GKXA 4KDXA 5HFKA 2X64A 2H0HA 2L57A 1HYUA 5LNKe 4HS1A 2VLVA 4PNFA 1J08A 1SYXA 2IN3A 3BBYA 4IELA 2HLSA 5F05A 3TB2A 3L9VA 2MMAA 4V2NA 2JSZA 5F0GA 5IOXA 1WPIA 2GSTA 3GL3A 2HXKA 1GP1A 3DRNA 4QL9A 1TXXA 2HI7A 3WGDA 4GXZA 2NTOA 5J41A 4J56E 1NHOA 4POMA 1JLWA 2JZSA 2R6KA 1A0RP 1ZYEA 2YWMA 1PKZA 3ERWA 1THXA 4GF0A 1PRXA 3KH9A 4NXIA 3ZMLA 2AYTA 4I2UA 1TRWA 4L0UA 5HR0A 1V9WA 3WD6A 2VM2A 1JZWA 2MZCA 8GSSA 2JU5A 2XBIA 4F03A 2O87A 3A2VA 1ON4A 4V1Ap 3F6FA 3CSIA 1CQHA 4NWYA 2JSYA 4NPBA 2F8AA 4MCUA 3QFAC 5ECSA 4PTSA 4KE3A 2HRNA 5ECNB 1FOVA 3HD5A 3ZLPA 2PVOC 3I9V2 2IJYA 2VL2A 4H86A 1Y6EA 2YWOA 3VWWA 1SKRB 2FLSA 2AAWA 1M99A 3ZREA 3CXGA 4JRRA 2IFQA 1Z7PA 1B48A 1AAZA 1XVWA 2DJ0A 2LQQA 1T4ZA 2KOKA 4O7HA 4PXOA 5LCZA 2GQMA 2L6CA 1OAZA 1S3CA 4Q5RA 3IC4A 3QMXA 3TRPA 4V2LA 2OBKA 4HOJA 3M0FA 3G7IA 4TR1B 3A2XA 1VRSD 3HCZA 2IMEA 2WULA 1ZGNA 2H30A 3HVXA 20GSA 1F3AA 4K8MA 2R5GA 3QAVA 2YZUA 3P2AA 1SK2A 2YN1A 3F6DA 2HSNB 1WRYA 4K1FA 4TVEA 3HVVA 3IPZA 2B1LA 2H76A 4KF9A 3BCKA 4Q5NA 3UARA 2AV4A 5INYA 1Z3EA 3LSZA 2J9HA 3TOTA 1ZMAA 3EURA 4ACSA 4ECCA 4YQVA 5HR2A 1VF2A 2DJ1A 1U87A 3FR3A 3PGTA 3UAPA 2OE0A 4TKYA 1KBNA 1XVQA 3MSZA 2DSAA 2H0GA 4GWRA 1NHYA 2HRKA 4I5QA 3F9UA 4ZB6A 4YQUA 3EWLA 5E59A 5IMAA 1QMVA 2VM1A 4TRXA 3VK9A 1RK4A 4F0BA 1SJZA 2E0QA 2YCDA 2ON7A 4L5OA 2DBCA 1TRSA 2WB9A 1O7UA 2HZFA 1YDKA 1A8LA 2VD0A 4EO3A 4KSMA 1Y25A 4ZB9A 1HNBA 1TK0B 4WETA 3GH9A 3MWHA 1NW2A 1O8WA 2FY6A 4BL7B 3H79A 3KZQA 5IO2A 4BVYB 1OE8A 1GSYA 2FHEA 3M8NA 3EU4A 2CVKA 1YY7A 2VD1A 5KN2A 3TCOA 1AQVA 3HJPA 1GLPA 4FH8A 3ZIJA 5ID2A 4LMWA 4IJIA 3M3MA 3CRTA 2YANA 2EC4A 3H4KA 2X8HA 3UVTA 4MF5A 2HZEB 2X8CA 3IK9A 3DYRA 4FQUA 3IE3A 1XW5A 2V6KA 2P0GA 4KUNA 1GNWA 3GFKA 1N2AA 1GTAA 1EOHA 3MDKA 4YQMA 2MYGA 5KN3A 2G0FA 3FHKA 1O8XA 1OC9B 4GQFA 2GZYA 4E8HA 1SL2B 5GSTA 2XPDA 4ECBA 2J23A 1TK8B 1A24A 1OC3A 1B9XC 1XWKA 1Z7RA 1K3YA 2E2MA 2HT9A 5H5SA 4K0NA 4EVMA 2WJUA 5DVBA 4FYUA 3ZTLA 2GS3A 1XW9A 1AXDA 4PX1A 3IAM2 2RUFA 4AGSA 1T1VA 2YWIA 5CO3A 2VL9A 2BTOT 5B6MA 2PPTA 5BMUA 9GSSA 5JCUA 1T7PB 5IPHA 2WZ9A 1T4YA 22GSA 6GSXA 3CMIA 4TOPA 5CYYA 4X1UA 5GAPD 4USSA 5D96A 3S9FA 3LFLA 4KW6A 5G5FA 5ABRA 1GTUA 4PNGA 2B5XA 4L0WA 3QAWA 3LYPA 2DMLA 4QL7A 3O76A 2B3SA 1EGRA 3TKSC 1GTBA 1A2LA 3WGEA 5AIVA 1WWJA 3ERGA 2H19A 4XIHA 1IYHA 2FWHA 3HZ8A 2DJJA 3Q19A 2LS5A 4KX4A 5KEJA 2DMMA 2KUCA 3EE2A 2FWGA 4F2IA 1OKTA 3CSJA 3D6IA 4DSRA 3RDWA 1U3IA 2GT5A 4KB3A 5HR1A 1I9DA 2L5LA 3A2WA 4WXTA 5DJLA 1SD9A 2VCXA 3GX8A 1EGOA 4PUAA 2GZPA 2ZNMA 1PL2A 3HHVA 3I43A 4IP6A 3E0UA 3FW2A 2B1KA 4TXOA 3DKSA 4AJ7A 3DD3A 2CZ3A 2C4JA 4FIWA 4ZL7A 4DSQA 4TR0A 1K0AA 2C80A 2PMTA 2RIIA 1GWCA 1FVJA 1G0TA 4ML6A 5JCWA 1XPVA 3N5OA 3LYKA 3M1GA 3F63A 4HUAA 1NM3A 2P31A 4HDEA 3KTBA 2G2QA 3H93A 3PR8A 4MZWA 3F8UA 5CRGA 1BAYA 1Z6MA 2L5OA 4G0LA 1EEMA 1JFUA 2FA4A 5IPGA 3GTUA 4PUFC 2QKEA 1HNCA 2H1AA 3TGZA 4JZQA 4MP4A 4PQHA 4F0CA 3TJKA 3HDCA 1K0DA 4V1Ag 5C04A 2VCZA 3DIEA 1F9MA 1F3BA 1TP9A 4NAXA 16GSA 4ECIA 5IM9A 2C3TA 5A4VA 1K3LA 3F3QA 1PX7A 3ME7A 2H0IA 4MJBA 3KEBA 4MF7A 1BYEA 2ALBA 2RM5A 2LKUA 4HZ4A 5FHIA 3GYKA 2BMXA 3VI7A 3DVXA 2H6ZA 4JR4A 3LQ7A 2I3YA 5DJMA 2CVBA 3IDVA 3US3A 3KIJA 3FZAA 2XBQA 5IMFA 4O92A 2H6YA 1WOUA 1E6BA 3GSSA 2LNSA 4EF0A 2HSYA 4ZB8A 2LSTA 1MD3A 3F4TA 1TK5B 3ME8A 2K18A 4N11A 2L4CA 2YWNA 1WJKA 1K3OA 2CAQA 1OVNA 1WMJA 2R2JA 2A2SA 1I5GA 2DIYA 4HQZA 4G10A 3EMPA 4XCSA 1QGVA 3GNJA 5ECKB 3ZITA 1ERTA 2A4VA 2LRTA 2H72A 2O7KA 2FWEA 1AUCA 2OE3A 4QQ7A 11GSA 4J57E 5CREA 5D93A 2H1BA 5G5EA 2NDOA 1MDIA 4IHUA 4K7OA 1SU9A 2VO4A 2NVLA 1FW1A 5DALB 1PKWA 4AJ8A 1M9AA 2VCTA 2MBTA 5IOWA 1ZCPA 1S3AA 3K8NA 3CBUA 1EEJA 2OA7A 5D9VA 2CX3A 2VCQA 1EP8A 1V2AA 4WBRD 5D9XA 2A2RA 4G19A 4GCIA 4JR6A 1TJDA 2PUKC 1GSEA 3HKRA 5HR3A 4MH2A 2IMDA 4ULXA 2C3QA 2R3XA 3GUSA 3FEUA 4OMVA 4OCFA 2FGXA 1WE0A 1Z9HA 4IBPA 3CRUA 2AHEA 2VAFA 6GSUA 2CA8A 2I4AA 2JADA 2KP1A 5JWRB 1N8JA 3VWVA 12GSA 5FT3A 1FAAA 4WR4A 2RUEA 2X8GA 3Q18A 3FR9A 2HRKB 1TKDB 3DVWA 3CYNA 2ZCTA 1UN2A 5ECMB 1QK8A 3HJMA 3TKQA 2WS2A 2AJQB 2MMOA 2HE3A 2EIQA 4WKWA 3LWAA 4TN8A 1ML6A 5ECOB 3AY8A 3GMFA 5IIZA 1GUMA 4OO4A 3O6TA 1XW6A 3FK8A 1A23A 5ECHB 1M0UA 4RI7A 4MJEA 3TJBA 2PGTA 4JEDA 3F4SA 1YQ1A 4O32A 2CAIA 2LV3A 3FZ5A 4HQSA 3EC3A 4OFMA 4KCAA 2XC2A 2FNOA 2YNXA 1OKDA 1O81A 3TDGA 3QDNA 10GSA 4NHZA 1X5DA 3E9JB 3KP9A 3P8WA 4RI6A 4AJ6A 1FHEA 1F37A 2B5EA 1TI1A 2FCHA 3JCML 3BJ5A 1EV9A 1M7TA 1DSBA 4IKHA 4K0GA 5IO0A 4BWSA 4MDCA 3ZZXA 1AW9A 3VLNA 2GT6A 3EYTA 2PWJA 1YKAA 4BVXB 2IMKA 5DQSA 4LLRA 2LJAA 4F82A 1T8EB 4MPGA 3UL3A 4G2EA 4TR1A 2O85A 1ZL9A 2YPMA 1X9SB 1X9MB 3DMLA 5ENUA 5CRHA 5J9BA 1VF4A 1B9YC 4N10A 2GSSA 3APQA 2AB6A 2CQ9A 3LJRA 3R3EA 4OWYA 4GSSA 2IWTA 3A3TA 2H1GA 5G1LA 3IRAA 2GSRA 1SENA 1V58A 3RPPA 3IBHA 2C0EA 4EC0A 2B5YA 4ZBBA 4OO5A 3D4TA 3F4RA 1UC7A 2N5BA 2HNLA 4XRAA 5B7CA 2LJRA 2GSQA 1PSQA 1A8YA 4POLA 3HJOA 4HU7A 3IAS2 4FYCA 2F3MA 4EDZA 1K0CA 4ECJA 2YOIA 1TOFA 3EVIA 2C0GA 4MZCA 4OFNA 6GSVA 2I1UA 2EIOA 1AC1A 2V1MA 4MMMA 3BD2A 2OACA 1XCCA 4CHSA 1XWAA 3UEMA 1SD8A 1DBYA 1FB6A 5LD0A 4ZILA 3L0HA 4DSSB 3W8JA 1TU7A 3GN3A 2LJKA 2CZ2A 4WR5A 4G9HA 4MK3A 4LL1B 2M72A 2IMFA 3GH6A 4BL7A 1SL1B 4PQ1A 2HRFA 2R37A 4BVYA 5EPFA 3BOAA 3QFBC 3H8QA 3QCPA 4Q5FA 5F06A 3E3EA 4K7IA 4GTUA 4HJMA 4NMUA 1XFLA 2DJ3A 4EDYA 1R7HA 4XTSA 3KJYA 4LMVA 3TJFA 2H73A 2HZEA 1HQOA 1TW9A 3C7MA 1YZXA 2L4QA 2JL4A 4MA9A 4JE1A 3UJ1A 1DE2A 3NIVA 3UBLA 2DJ2A 2V6OA 6GSYA 5ECQB 1AIUA 4E8EA 3APSA 5HQPA 1OC9A 1OYJA 2KHPA 3FZ4A 2HSMA 1GH2A 1VF3A 3KM6A 1HD2A 4D73B 2TIRA 4J2FA 5F07A 3FRCA 4K9ZA 1R5PA 2YJHA 4G0IA 2ZUPA 4OD7A 4WF4A 5H5RA 3ISOA 4P3YB 3CTFA 1PX6A 1ERUA 3IR4A 1MEKA 1QQ2A 1O73A 1EWXA 4POBA 1GUHA 1R5AA 3L78A 3F0IA 2D2ZA 2M46A 3U6VA 2VCVA 1E2YA 2JACA 1ZOFA 5DAKB 7GSSA 1M2BA 2C3NA 3HXSA 3ZIVA 4CDOA 4MH3A 4ZXGA 3GV1A 2XPEA 4EUYA 3LORA 3TRQA 2QSIA 1LU4A 3FY7A 2K9FA 1F2EA 4WEYA 5EY6A 3VWUA 5ELAA 1PMTA 1GSQA 4KNDA 2FUG2 4RQRA 3QOUA 2Z9SA 2PBJA 1W4VA 1A2JA 3ED3A 1XOBA 1BEDA 1H4OA 3EU3A 2GVPA 4V2MA 4XS6A 5A4UA 1EOGA 3I69A 4KH7A 4IJ3A 4G0KA 3GURA 3G7YA 1H75A 4HU9A 2X99A 3C8EA 4MABA 1YEXA 4OCEA 3ZMKA 3DEXA 1QFNA 2IIYA 5B8BA 3Q74A 1YF0A 3RPNA 4PQIA 2L6DA 1S3DA 2P5RA 5IMDA 2CX4A 3APOA 5AIXA 1VF1A 5A4WA 4ZL9A 2E7PA 3TKPA 1ZZYA 1R26A 3N9JA 3QD9A 4MLYA 2VL3A 3F3RA 2VLUA 3IC8A 2K8VA 3DWVA 1GNEA 3WT1A 5J3RA 3VFIA 2F8FA 3G9BA 14GSA 3GKMA 2YJ7A 3GA4A 3FR6A 2H71A 3GL5A 3KMNA 1PGTA 2HQTA 1FVKA 1BJXA 1GSSA 1OC8A 3GX0A 4OFTA 1ABAA 2OKAA 2M80A 1ZYQB 2CVDA 2HRAA 5ELGA 2OBIA 4XS4A 1YJ6A 5G2ZA 1UVZA 1U3AA 1BG5A 1SK0A 2RM6A 1UA5A 4MF6A 2H74A 2K8SA 2LNTA 3LG6A 1EP7A 2WGRA 2PVQA 5ECLB 3TJJA 1X9WB 3VWXA 4RUVA
chains in the Genus database with same CATH superfamily
1G6YA 1GRXA 3ZFLA 2IFQB 3MAKA 2JZRA 2H8LA 3R2QA 4I6XA 2C0FA 3QAGA 5HFIA 3UBKA 2WW2A 2UV8G 1DUGA 3LXTA 2FWFA 1PN9A 4IS0A 3SBCA 2CV4A 2GLRA 1JZDA 3KMOA 5H5QA 1PQNA 3PPUA 2ON5A 3WYWA 4YAVA 1AQWA 1S3RA 4O5RA 4BWQA 5DCGA 2WVXA 3PINA 1PD21 2XHFA 3A5IA 5CAXA 3GKKA 3MNGA 4GQCA 3UMAA 1XG8A 1GSUA 2FA8A 1TRVA 2ES7A 3WT2A 2K6VA 3L9SA 3RBTA 1O85A 3KD0A 1LJRA 4Z2UA 5COHA 4PURA 1M2DA 4K2XA 5C00A 3FMWA 2QGVA 2LUSA 3C1SA 4ZBAA 2NPBA 3C71A 2P5QA 2LRCA 2LTKA 3KTLA 1GSDA 5E4WA 3FYGA 4ILFA 4IQAA 2EFHA 5J4UA 4EKZA 2WDUA 2DLXA 2YZHA 1SJIA 2V41A 1J9BA 3LEFA 4JBBA 2VIMA 4MPFA 3IV4A 3PH9A 2R4VA 4KGIA 3BCIA 2GTUA 5JCGA 3IXRA 5J4YA 4IN0A 3HVSA 1X5CA 1MTCA 5DALA 2B6MA 5CNWA 4XRDA 1XXUA 2IPAA 3GKNA 4HZ2A 4HEA2 4WF5A 2O8VB 1F6MC 2LEGA 4MZBA 4NHWA 3RAZA 1SKWB 4KA0A 2I9HA 4GSTA 4ZBDA 1XZOA 5AISA 3TKSA 3DGQA 2PN8A 4AF2A 3SWLA 4TR3A 2VCWA 4GSNA 2H75A 2GZZA 2EFEA 1TRUA 4FO5A 1SYRA 3HA9A 1K0MA 1KNGA 1LBKA 5ID2B 2LRNA 4FYBA 1BQ7A 1CQGA 3D21A 2OADA 3CTGA 5IMCA 5IQYA 4K7NA 4HI7A 1GLQA 2WZSA 3ZVJA 5J4VA 4K6XA 2FD3A 1R4WA 2OJLA 1B4QA 2H66A 4I8BA 1QXHA 1MDJA 2N5FA 4KDYA 5G31A 2VLTA 5A34B 4LL4B 4XS1A 4IW9A 1U6TA 1TDIA 5DBQA 13GSA 2B7KA 2KLXA 4POKA 1X5EA 3TRXA 4JU5A 3M9KA 5GSSA 2WW0A 3A5WA 3L9UA 4DEJA 3J7Yb 5ECRB 4EE0A 3D22A 4BA7A 1FB0A 3MYDA 3VI5A 3VPTA 4BIKA 1USBA 2C8UA 1MD4A 3NZNA 2CT6A 4GRFA 3UIWA 3RGBC 1WIKA 5G1KA 1URMA 2WW1A 5D9WA 3P90A 5A5HB 1GSFA 4XHMA 3D0ZA 3FKFA 5EL8A 2C1YA 3TKRA 1AQXA 3KXOA 1ZYNA 1B4PA 3IK7A 3RHCA 4AKXB 2GDRA 1BX9A 4X0XA 1Z5YE 5BMUB 1V98A 4N30A 1SVMA 2REMA 2I81A 1GUKA 1SKSB 5DQYA 2VUPA 2MMNA 1ILOA 4NV5A 1GTIA 2H01A 4ID0A 5KN1A 1B8XA 4YH2A 3G7JA 3WGXA 2AUVA 4AI6A 3CSHA 3KP8A 3ZL5A 1PL1A 3D4MA 2O3EA 2BJXA 2C0DA 2NBSA 4N0VA 3FZ9A 2UZ8A 5CP1A 3C73A 1JZOA 3GIXA 6GSWA 1X0RA 3ZFBA 2HFDA 1SK1A 4BVXA 3VPQA 4GLTA 1KEBA 3I6AA 2IL3A 4YAPA 3IOSA 1FG4A 4TR4A 1JZRA 1TU8A 1M9BA 2DC5A 5GZZB 4K2DA 5CRDA 1NSWA 4MJCA 2HSMB 2YV9A 1PA3A 2WRTA 1Q4JA 2VL2C 1GULA 1XOAA 5J9CA 5ECPB 4IGJA 2IMIA 6GSTA 1U88A 2DIZA 5A5KA 5L71A 4RQXA 3UVHA 2VOCA 4ML1A 3DXBA 4X43A 4TXOB 2F9SA 1ERVA 3L4NA 2PERA 1XBSA 1SJ6A 5HFGA 4Z2TA 1O6JA 5KOWA 2H1DA 2KP2A 1ST9A 2HYXA 1MDKA 4NV2A 1JLVA 3GSTA 2YV7A 4EL1A 2A4HA 3GRXA 5B6NA 1J0FA 6GSSA 3LXZA 4WBJA 4KAEA 1W89A 1ERWA 5GAND 1QUWA 4KCEA 3RHBA 4BPYA 4I97A 1K0OA 5IMZA 3ZRDA 3GTUB 4DVCA 3U5RE 2R0CA 4CW9A 5BRTA 4F9ZA 1G7EA 3TUEA 4LA1A 4DSSA 4ZL8A 2RLIA 2WCIA 3ZYWA 2WFCA 3ZVJD 2LQOA 18GSA 4L5LA 1XWCA 3GHAA 17GSA 2H6XA 1IYIA 1M2AA 5F8BA 1G6WA 3O3TA 5AN1A 1TTZA 1G7OA 2TRCP 5D73A 2V32A 2R0GA 4IQ1A 1FO5A 2MMZA 5J5NA 4L8EA 3KCMA 1WP0A 1RW1A 4IP1A 1ACVA 2N5AA 4PGTA 3W6GA 1V40A 4TW5A 5FWGA 4TXVA 2HSHA 4ZIJA 1XWBA 3EINA 3W8SA 19GSA 2V2GA 1S4BP 2F51A 1OE7A 2DJKA 4Q5QA 3C1RA 5B8AA 4EXJA 5JWQB 3ERFA 3UOMA 2L59A 1EZKA 5EVOA 2TRXA 5AGYA 1TI3A 3HZ4A 1YEPA 1XIYA 3J7Yk 4D73A 1XWGA 3OR5A 1JHBA 3TKSE 1T3BA 4XS4B 5A1NB 3D5JA 2E2GA 4ISDA 1K0BA 5DDLA 2B7JA 5IMVA 3HMJG 2GQKA 1A0FA 2QC7A 3V1WA 4IVFA 1VGLA 3HYPA 3TJGA 1TXUA 3NOFA 2MBSA 1I1IP 4MJAA 2O89A 1YF1A 1DE1A 3LGCA 3KGKA 1YKCA 3TOUA 5ECIB 3MIXA 4HJ2A 3QR6A 5D9TA 2PU9C 3H1NA 5DAKA 4Z7XA 5CRWA 2JZTA 5JWOB 3Q6OA 2WVXB 1Z6NA 5DCHA 1EV4A 1RQMA 1SL0B 4N0ZA 3HY2A 5G30A 2H70A 2GGTA 1HNAA 3EMXA 1A2MA 5D8IA 4KDUA 1C72A 1V57A 1T00A 3IA1A 2EIRA 3P7XA 5KN0A 3QPMA 1GL8A 2GQLA 3IHQA 3VURA 1THOA 2YP6A 4KSOA 1Q98A 1KTEA 5J47A 3KH7A 4G01A 2OE1A 1K0NA 3M9JA 4I2TA 3GKXA 4KDXA 2O36A 5HFKA 2X64A 2H0HA 2L57A 1HYUA 5LNKe 3IHGA 4HS1A 2VLVA 2X49A 4PNFA 1J08A 1SYXA 2IN3A 3BBYA 4IELA 2HLSA 5F05A 3TB2A 3L9VA 2MMAA 4V2NA 2JSZA 5F0GA 5IOXA 1WPIA 2GSTA 3GL3A 2HXKA 1GP1A 3DRNA 4QL9A 1TXXA 2HI7A 4K5SA 3WGDA 4GXZA 2NTOA 5J41A 4J56E 1NHOA 4POMA 1JLWA 2JZSA 2R6KA 1A0RP 1ZYEA 2YWMA 1PKZA 3ERWA 1THXA 4GF0A 1PRXA 3KH9A 4NXIA 4AKGA 3ZMLA 2AYTA 4I2UA 1TRWA 4L0UA 5HR0A 1V9WA 1YVLA 3WD6A 2VM2A 1JZWA 2MZCA 4AKIA 8GSSA 2JU5A 2XBIA 4F03A 2O87A 3A2VA 1ON4A 4V1Ap 3F6FA 3CSIA 1CQHA 4NWYA 2JSYA 4NPBA 2F8AA 4MCUA 3QFAC 5ECSA 4PTSA 4KE3A 2HRNA 5ECNB 1FOVA 3HD5A 3ZLPA 2PVOC 2WVYA 3I9V2 2IJYA 2VL2A 4H86A 1Y6EA 2EFCA 2YWOA 3VWWA 1SKRB 2FLSA 2AAWA 1M99A 3ZREA 3CXGA 4JRRA 2IFQA 1Z7PA 4CY8A 1B48A 1AAZA 1XVWA 2DJ0A 2LQQA 1T4ZA 1YEWC 2DKIA 2KOKA 4O7HA 4PXOA 5LCZA 2GQMA 2L6CA 1OAZA 1S3CA 4Q5RA 3IC4A 3QMXA 4O5UA 3TRPA 4V2LA 2OBKA 4HOJA 3M0FA 3G7IA 4TR1B 3A2XA 1VRSD 3HCZA 2IMEA 2WULA 1ZGNA 2H30A 3HVXA 20GSA 1F3AA 2R5GA 4K8MA 3QAVA 2YZUA 3P2AA 1SK2A 1BG1A 2YN1A 3F6DA 4PI2C 2HSNB 1WRYA 3RFRC 4K1FA 4TVEA 3HVVA 3IPZA 2B1LA 2H76A 4KF9A 3BCKA 4Q5NA 3UARA 2AV4A 5INYA 1Z3EA 3LSZA 2J9HA 3TOTA 1ZMAA 3EURA 4ACSA 4ECCA 4YQVA 5HR2A 1VF2A 2DJ1A 1U87A 3FR3A 3PGTA 3UAPA 2OE0A 4TKYA 1KBNA 1XVQA 3MSZA 2DSAA 2H0GA 4GWRA 1NHYA 2HRKA 4I5QA 3F9UA 4ZB6A 4YQUA 3EWLA 5E59A 5IMAA 1QMVA 2VM1A 4TRXA 3VK9A 1RK4A 4F0BA 1SJZA 2E0QA 2YCDA 2ON7A 4L5OA 2DBCA 1TRSA 2WB9A 1O7UA 2HZFA 1YDKA 1A8LA 2VD0A 4ZB7A 4EO3A 4KSMA 1Y25A 4ZB9A 1HNBA 1TK0B 4WETA 3GH9A 3MWHA 1NW2A 1O8WA 2FY6A 4BL7B 3H79A 3KZQA 5IO2A 4BVYB 1OE8A 1GSYA 2FHEA 3M8NA 3EU4A 2CVKA 1YY7A 2VD1A 4E68A 5KN2A 1SVOA 3TCOA 1AQVA 3HJPA 1GLPA 4FH8A 3ZIJA 5ID2A 4LMWA 4IJIA 3M3MA 3CRTA 2YANA 2EC4A 3H4KA 2X8HA 3UVTA 4MF5A 2HZEB 2X8CA 3IK9A 3DYRA 4FQUA 3IE3A 1XW5A 2V6KA 2P0GA 4KUNA 1GNWA 3GFKA 1N2AA 1GTAA 1EOHA 3MDKA 4YQMA 2MYGA 5KN3A 2G0FA 3FHKA 1O8XA 1OC9B 4GQFA 2GZYA 4E8HA 1SL2B 5GSTA 2XPDA 1SVLA 4ECBA 2J23A 1TK8B 1A24A 1OC3A 1B9XC 1XWKA 1Z7RA 1K3YA 2E2MA 2R0PA 2HT9A 5H5SA 4K0NA 4EVMA 2WJUA 5DVBA 4FYUA 3ZTLA 2GS3A 1XW9A 1AXDA 4PX1A 3IAM2 2RUFA 4AGSA 1T1VA 2YWIA 5CO3A 2VL9A 2BTOT 5B6MA 2PPTA 5BMUA 9GSSA 5JCUA 1T7PB 5IPHA 2WZ9A 1T4YA 22GSA 6GSXA 3CMIA 4TOPA 5CYYA 4X1UA 5GAPD 4USSA 5D96A 3S9FA 3LFLA 4KW6A 5G5FA 5ABRA 1GTUA 4PNGA 2B5XA 4L0WA 3QAWA 3LYPA 2DMLA 4QL7A 3O76A 2B3SA 1EGRA 3TKSC 1GTBA 1A2LA 3WGEA 5AIVA 5J40A 1WWJA 3ERGA 2H19A 4XIHA 1IYHA 2FWHA 3HZ8A 2DJJA 3Q19A 2LS5A 4KX4A 5KEJA 2DMMA 2KUCA 3EE2A 2FWGA 4F2IA 1OKTA 2DKHA 3CSJA 3D6IA 4DSRA 2QA2A 4CY6A 3RDWA 1U3IA 5KOXA 2GT5A 4KB3A 5HR1A 1I9DA 2L5LA 3A2WA 4WXTA 5DJLA 1SD9A 2VCXA 3GX8A 1N25A 1EGOA 4PUAA 2GZPA 2ZNMA 1PL2A 3HHVA 3I43A 4IP6A 3E0UA 3FW2A 2B1KA 4TXOA 3DKSA 4AJ7A 3DD3A 4A5PA 2CZ3A 2C4JA 4FIWA 4ZL7A 4DSQA 4TR0A 1K0AA 4MNNA 2C80A 2PMTA 2RIIA 1GWCA 1FVJA 1G0TA 4ML6A 5JCWA 1XPVA 3N5OA 3LYKA 3M1GA 4W66A 3F63A 4HUAA 1NM3A 2P31A 4HDEA 3KTBA 2G2QA 3H93A 3PR8A 4MZWA 3F8UA 5CRGA 1BAYA 1Z6MA 2L5OA 4G0LA 4PI0C 1EEMA 1JFUA 2FA4A 4QMKA 5IPGA 3GTUA 4PUFC 2QKEA 1HNCA 2H1AA 3TGZA 4JZQA 4MP4A 4PQHA 4F0CA 4GDFA 3TJKA 3HDCA 1K0DA 4V1Ag 4N3ZA 5C04A 2VCZA 3DIEA 1F9MA 1F3BA 1TP9A 4NAXA 16GSA 4ECIA 5IM9A 2C3TA 5A4VA 1K3LA 3F3QA 1PX7A 3ME7A 2H0IA 4MJBA 3KEBA 4MF7A 1BYEA 2ALBA 2RM5A 2LKUA 4HZ4A 5FHIA 3GYKA 2BMXA 3VI7A 3DVXA 2H6ZA 4JR4A 3LQ7A 2I3YA 2A2PA 5DJMA 2CVBA 3IDVA 3US3A 3KIJA 3FZAA 2XBQA 5IMFA 4O92A 2H6YA 1WOUA 1E6BA 3GSSA 2LNSA 4EF0A 2HSYA 4ZB8A 2LSTA 1MD3A 3F4TA 1TK5B 3ME8A 2K18A 4N11A 2L4CA 2WVZA 2YWNA 1WJKA 1K3OA 2CAQA 1OVNA 1WMJA 2R2JA 2A2SA 1I5GA 2DIYA 4HQZA 4G10A 3EMPA 4XCSA 1QGVA 5A1NA 5ECKB 3GNJA 3ZITA 1ERTA 2A4VA 4O5QA 2LRTA 2H72A 4PHZC 2O7KA 2FWEA 1AUCA 2OE3A 4QQ7A 11GSA 4J57E 5CREA 5D93A 2H1BA 5G5EA 2NDOA 1MDIA 4IHUA 4K7OA 1SU9A 2VO4A 2NVLA 3CQFA 1FW1A 4YKGA 5DALB 4EIPA 4AKHA 1PKWA 3CHXC 4AJ8A 1M9AA 2VCTA 2MBTA 5IOWA 1ZCPA 1S3AA 3K8NA 3CBUA 1EEJA 2OA7A 5D9VA 2CX3A 2VCQA 1EP8A 1V2AA 4WBRD 5D9XA 2A2RA 4G19A 4GCIA 4JR6A 1TJDA 2PUKC 1GSEA 3HKRA 5HR3A 4MH2A 2IMDA 4ULXA 2C3QA 2R3XA 3GUSA 3FEUA 4OMVA 4OCFA 2FGXA 1WE0A 1Z9HA 4IBPA 3CRUA 2H1LA 2AHEA 2VAFA 6GSUA 2CA8A 2I4AA 2JADA 2KP1A 5JWRB 1N8JA 3VWVA 12GSA 5FT3A 1FAAA 4WR4A 2RUEA 1BF5A 2X8GA 3LW9A 3Q18A 3FR9A 2HRKB 1TKDB 3DVWA 3CYNA 2ZCTA 1ZYPA 1UN2A 5ECMB 1QK8A 3HJMA 3TKQA 2WS2A 2AJQB 2MMOA 2HE3A 3CWGA 2EIQA 4WKWA 3LWAA 4TN8A 1ML6A 5ECOB 3AY8A 3GMFA 5IIZA 1GUMA 4OO4A 3O6TA 1XW6A 3FK8A 1A23A 5ECHB 1M0UA 4RI7A 4MJEA 3TJBA 2PGTA 4JEDA 3F4SA 1YQ1A 2WW3A 4O32A 2CAIA 2LV3A 2QA1A 3FZ5A 4HQSA 3EC3A 4FXYP 4OFMA 4YKFA 4KCAA 2XC2A 3HVNA 2FNOA 1M3IA 2YNXA 1OKDA 1O81A 3TDGA 3QDNA 10GSA 4NHZA 1X5DA 3E9JB 3KP9A 3P8WA 4RI6A 4AJ6A 1FHEA 1F37A 2B5EA 1TI1A 2FCHA 3JCML 3BJ5A 1EV9A 1M7TA 1DSBA 4IKHA 4K0GA 5IO0A 4BWSA 4MDCA 3ZZXA 1AW9A 3VLNA 2GT6A 3EYTA 2PWJA 1YKAA 4BVXB 2IMKA 5DQSA 4LLRA 2VKZG 2LJAA 4F82A 1T8EB 4MPGA 3UL3A 4G2EA 4TR1A 2O85A 1ZL9A 2YPMA 1X9SB 1X9MB 3TU3B 3DMLA 5ENUA 5CRHA 5J9BA 1VF4A 1B9YC 4N10A 2GSSA 3APQA 2O5VA 2HSNA 2AB6A 2CQ9A 3LJRA 3R3EA 4OWYA 4GSSA 2IWTA 3A3TA 2H1GA 5G1LA 3IRAA 2GSRA 1SENA 1V58A 3RPPA 3IBHA 2C0EA 4EC0A 2B5YA 4ZBBA 4OO5A 3D4TA 3F4RA 1UC7A 2N5BA 2HNLA 4XRAA 5B7CA 2LJRA 2GSQA 1PSQA 1A8YA 4POLA 3HJOA 4HU7A 1PN0A 3IAS2 4FYCA 2F3MA 4EDZA 1K0CA 4ECJA 2YOIA 1TOFA 3EVIA 2C0GA 4MZCA 4OFNA 6GSVA 2I1UA 2EIOA 1AC1A 2V1MA 4MMMA 5A34A 2OT3A 3BD2A 2OACA 1XCCA 4CHSA 1XWAA 3UEMA 1SD8A 1DBYA 1FB6A 5LD0A 4ZILA 3L0HA 4DSSB 3W8JA 1TU7A 3GN3A 2LJKA 2CZ2A 4WR5A 4G9HA 4MK3A 4ICYA 4LL1B 2M72A 4K5RA 4EIQA 2IMFA 3GH6A 4BL7A 1SL1B 4PQ1A 2HRFA 2R37A 5A5HA 4BVYA 5EPFA 3BOAA 3QFBC 3H8QA 3QCPA 4Q5FA 5F06A 3E3EA 1M3JA 4K7IA 4GTUA 4HJMA 4NMUA 1XFLA 2DJ3A 4EDYA 1R7HA 4XTSA 3KJYA 4LMVA 3TJFA 2H73A 2HZEA 1HQOA 1TW9A 3C7MA 1YZXA 1Y1UA 2L4QA 2JL4A 4MA9A 4JE1A 3UJ1A 1DE2A 3NIVA 3UBLA 2DJ2A 2V6OA 6GSYA 2X4AA 5ECQB 1AIUA 4E8EA 3APSA 5HQPA 4Z2RA 1OC9A 1OYJA 2KHPA 3FZ4A 2HSMA 1GH2A 1VF3A 3KM6A 1HD2A 4D73B 2TIRA 4J2FA 5F07A 3FRCA 4K9ZA 1R5PA 2YJHA 4G0IA 2ZUPA 4OD7A 4WF4A 5H5RA 3ISOA 4P3YB 3CTFA 1PX6A 1ERUA 3IR4A 1MEKA 1QQ2A 1O73A 1EWXA 4POBA 1GUHA 1R5AA 3L78A 3F0IA 2D2ZA 2M46A 1PFOA 3U6VA 2VCVA 1E2YA 2JACA 1ZOFA 5DAKB 7GSSA 1M2BA 2C3NA 3HXSA 3ZIVA 4CDOA 4MH3A 4ZXGA 3GV1A 2XPEA 4EUYA 3LORA 2EFDA 3TRQA 2QSIA 1LU4A 3FY7A 2K9FA 1F2EA 4WEYA 5EY6A 3VWUA 5ELAA 4HSCX 1PMTA 1GSQA 4KNDA 2FUG2 4RQRA 3QOUA 2Z9SA 2PBJA 1W4VA 1A2JA 3ED3A 3EPTA 1XOBA 1BEDA 1H4OA 3EU3A 2GVPA 4V2MA 4XS6A 5A4UA 1EOGA 3I69A 4KH7A 4IJ3A 4G0KA 3GURA 3G7YA 1H75A 4X4JA 1FOHA 4HU9A 2X99A 3C8EA 4MABA 1YEXA 4OCEA 3ZMKA 3DEXA 1QFNA 2IIYA 5B8BA 3Q74A 1YF0A 3RPNA 4PQIA 2L6DA 1S3DA 2P5RA 5IMDA 2CX4A 3APOA 5AIXA 1VF1A 5A4WA 4ZL9A 2E7PA 3TKPA 1ZZYA 1R26A 3N9JA 3QD9A 4MLYA 2VL3A 3F3RA 2VLUA 3IC8A 2K8VA 3DWVA 1GNEA 3WT1A 5J3RA 3VFIA 2F8FA 3G9BA 14GSA 3GKMA 2YJ7A 3GA4A 3FR6A 2H71A 3GL5A 3KMNA 1PGTA 2HQTA 1FVKA 1BJXA 1GSSA 1OC8A 3GX0A 4OFTA 1ABAA 2OKAA 2M80A 1ZYQB 2CVDA 2HRAA 5ELGA 2OBIA 4XS4A 1YJ6A 5G2ZA 1UVZA 1U3AA 1BG5A 1SK0A 2RM6A 1UA5A 4MF6A 2H74A 2K8SA 2LNTA 3LG6A 1EP7A 2WGRA 2PVQA 5ECLB 3TJJA 1X9WB 3VWXA 4RUVA
chains in the Genus database with same CATH topology
1G6YA 1GRXA 3ZFLA 2IFQB 3MAKA 2JZRA 2H8LA 3R2QA 4I6XA 2C0FA 3QAGA 5HFIA 3UBKA 2UV8G 1DUGA 3LXTA 2FWFA 1PN9A 4IS0A 3SBCA 2CV4A 2GLRA 1JZDA 3KMOA 5H5QA 1PQNA 3PPUA 2ON5A 3WYWA 4YAVA 1AQWA 4O5RA 4BWQA 5DCGA 3PINA 1PD21 2XHFA 3A5IA 5CAXA 3GKKA 3MNGA 4GQCA 3UMAA 1GSUA 2FA8A 1TRVA 2ES7A 3WT2A 2K6VA 3L9SA 3RBTA 1O85A 3KD0A 1LJRA 4Z2UA 5COHA 4PURA 1M2DA 4K2XA 5C00A 3FMWA 2QGVA 2LUSA 3C1SA 4ZBAA 2NPBA 3C71A 2P5QA 2LRCA 2LTKA 3KTLA 1GSDA 5E4WA 3FYGA 4ILFA 4IQAA 2EFHA 5J4UA 4EKZA 2WDUA 2DLXA 2YZHA 1SJIA 2V41A 1J9BA 3LEFA 4JBBA 2VIMA 4MPFA 3IV4A 3PH9A 2R4VA 4KGIA 3BCIA 2GTUA 5JCGA 3IXRA 5J4YA 4IN0A 3HVSA 1X5CA 1MTCA 5DALA 2B6MA 5CNWA 4XRDA 1XXUA 2IPAA 3GKNA 4HZ2A 4HEA2 4WF5A 2O8VB 1F6MC 2LEGA 4MZBA 4NHWA 3RAZA 1SKWB 4KA0A 2I9HA 4GSTA 4ZBDA 1XZOA 5AISA 3TKSA 3DGQA 2PN8A 4AF2A 3SWLA 4TR3A 2VCWA 4GSNA 2H75A 2GZZA 2EFEA 1TRUA 4FO5A 1SYRA 3HA9A 1K0MA 1KNGA 1LBKA 5ID2B 2LRNA 4FYBA 1BQ7A 1CQGA 3D21A 2OADA 3CTGA 5IMCA 5IQYA 4K7NA 4HI7A 1GLQA 3ZVJA 5J4VA 4K6XA 2FD3A 1R4WA 2OJLA 1B4QA 2H66A 4I8BA 1QXHA 1MDJA 2N5FA 4KDYA 5G31A 2VLTA 5A34B 4LL4B 4XS1A 4IW9A 1U6TA 1TDIA 5DBQA 13GSA 2B7KA 2KLXA 4POKA 1X5EA 3TRXA 4JU5A 3M9KA 5GSSA 3A5WA 3L9UA 4DEJA 3J7Yb 5ECRB 4EE0A 3D22A 4BA7A 1FB0A 3MYDA 3VI5A 3VPTA 1USBA 2C8UA 1MD4A 3NZNA 2CT6A 4GRFA 3UIWA 1WIKA 5G1KA 1URMA 5D9WA 3P90A 5A5HB 1GSFA 4XHMA 3D0ZA 3FKFA 5EL8A 2C1YA 3TKRA 1AQXA 3KXOA 1ZYNA 1B4PA 3IK7A 3RHCA 4AKXB 2GDRA 1BX9A 4X0XA 1Z5YE 5BMUB 1V98A 4N30A 1SVMA 2REMA 2I81A 1GUKA 1SKSB 5DQYA 2VUPA 2MMNA 1ILOA 4NV5A 1GTIA 2H01A 4ID0A 5KN1A 1B8XA 4YH2A 3G7JA 3WGXA 2AUVA 4AI6A 3CSHA 3KP8A 3ZL5A 1PL1A 3D4MA 2BJXA 2C0DA 2NBSA 4N0VA 3FZ9A 2UZ8A 5CP1A 3C73A 1JZOA 3GIXA 6GSWA 1X0RA 3ZFBA 2HFDA 1SK1A 4BVXA 3VPQA 4GLTA 1KEBA 3I6AA 2IL3A 4YAPA 3IOSA 1FG4A 4TR4A 1JZRA 1TU8A 1M9BA 2DC5A 5GZZB 4K2DA 5CRDA 1NSWA 4MJCA 2HSMB 2YV9A 1PA3A 2WRTA 1Q4JA 2VL2C 1GULA 1XOAA 5J9CA 5ECPB 4IGJA 2IMIA 6GSTA 1U88A 2DIZA 5A5KA 5L71A 4RQXA 3UVHA 2VOCA 4ML1A 3DXBA 4X43A 4TXOB 2F9SA 1ERVA 3L4NA 2PERA 1XBSA 1SJ6A 5HFGA 4Z2TA 1O6JA 5KOWA 2H1DA 2KP2A 1ST9A 2HYXA 1MDKA 4NV2A 1JLVA 3GSTA 2YV7A 4EL1A 2A4HA 3GRXA 5B6NA 1J0FA 6GSSA 3LXZA 4WBJA 4KAEA 1W89A 1ERWA 5GAND 1QUWA 4KCEA 3RHBA 4BPYA 4I97A 1K0OA 5IMZA 3ZRDA 3GTUB 4DVCA 3U5RE 2R0CA 4CW9A 5BRTA 4F9ZA 1G7EA 3TUEA 4LA1A 4DSSA 4ZL8A 2RLIA 2WCIA 3ZYWA 2WFCA 3ZVJD 2LQOA 18GSA 4L5LA 1XWCA 3GHAA 17GSA 2H6XA 1IYIA 1M2AA 5F8BA 1G6WA 3O3TA 5AN1A 1TTZA 1G7OA 2TRCP 5D73A 2V32A 2R0GA 4IQ1A 1FO5A 2MMZA 5J5NA 4L8EA 3KCMA 1WP0A 1RW1A 4IP1A 1ACVA 2N5AA 4PGTA 3W6GA 1V40A 4TW5A 5FWGA 4TXVA 2HSHA 4ZIJA 1XWBA 3EINA 3W8SA 19GSA 2V2GA 2F51A 1OE7A 2DJKA 4Q5QA 3C1RA 5B8AA 4EXJA 5JWQB 3ERFA 3UOMA 2L59A 1EZKA 5EVOA 2TRXA 5AGYA 1TI3A 3HZ4A 1YEPA 1XIYA 3J7Yk 4D73A 1XWGA 3OR5A 1JHBA 3TKSE 1T3BA 4XS4B 5A1NB 3D5JA 2E2GA 4ISDA 1K0BA 5DDLA 2B7JA 5IMVA 3HMJG 2GQKA 1A0FA 2QC7A 3V1WA 4IVFA 1VGLA 3HYPA 3TJGA 1TXUA 3NOFA 2MBSA 4MJAA 2O89A 1YF1A 1DE1A 3LGCA 3KGKA 1YKCA 3TOUA 5ECIB 3MIXA 4HJ2A 3QR6A 5D9TA 2PU9C 3H1NA 5DAKA 4Z7XA 5CRWA 2JZTA 5JWOB 3Q6OA 1Z6NA 5DCHA 1EV4A 1RQMA 1SL0B 4N0ZA 3HY2A 5G30A 2H70A 2GGTA 1HNAA 3EMXA 1A2MA 5D8IA 4KDUA 1C72A 1V57A 1T00A 3IA1A 2EIRA 3P7XA 5KN0A 3QPMA 1GL8A 2GQLA 3IHQA 3VURA 1THOA 2YP6A 4KSOA 1Q98A 1KTEA 5J47A 3KH7A 4G01A 2OE1A 1K0NA 3M9JA 4I2TA 3GKXA 4KDXA 5HFKA 2X64A 2H0HA 2L57A 1HYUA 5LNKe 3IHGA 4HS1A 2VLVA 2X49A 4PNFA 1J08A 1SYXA 2IN3A 3BBYA 4IELA 2HLSA 5F05A 3TB2A 3L9VA 2MMAA 4V2NA 2JSZA 5F0GA 5IOXA 1WPIA 2GSTA 3GL3A 2HXKA 1GP1A 3DRNA 4QL9A 1TXXA 2HI7A 4K5SA 3WGDA 4GXZA 2NTOA 5J41A 4J56E 1NHOA 4POMA 1JLWA 2JZSA 2R6KA 1A0RP 1ZYEA 2YWMA 1PKZA 3ERWA 1THXA 4GF0A 1PRXA 3KH9A 4NXIA 4AKGA 3ZMLA 2AYTA 4I2UA 1TRWA 4L0UA 5HR0A 1V9WA 1YVLA 3WD6A 2VM2A 1JZWA 2MZCA 4AKIA 8GSSA 2JU5A 2XBIA 4F03A 2O87A 3A2VA 1ON4A 4V1Ap 3F6FA 3CSIA 1CQHA 4NWYA 2JSYA 4NPBA 2F8AA 4MCUA 3QFAC 5ECSA 4PTSA 4KE3A 2HRNA 5ECNB 1FOVA 3HD5A 3ZLPA 2PVOC 3I9V2 2IJYA 2VL2A 4H86A 1Y6EA 2EFCA 2YWOA 3VWWA 1SKRB 2FLSA 2AAWA 1M99A 3ZREA 3CXGA 4JRRA 2IFQA 1Z7PA 4CY8A 1B48A 1AAZA 1XVWA 2DJ0A 2LQQA 1T4ZA 2DKIA 2KOKA 4O7HA 4PXOA 5LCZA 2GQMA 2L6CA 1OAZA 1S3CA 4Q5RA 3IC4A 3QMXA 4O5UA 3TRPA 4V2LA 2OBKA 4HOJA 3M0FA 3G7IA 4TR1B 3A2XA 1VRSD 3HCZA 2IMEA 2WULA 1ZGNA 2H30A 3HVXA 20GSA 1F3AA 2R5GA 4K8MA 3QAVA 2YZUA 3P2AA 1SK2A 1BG1A 2YN1A 3F6DA 2HSNB 1WRYA 4K1FA 4TVEA 3HVVA 3IPZA 2B1LA 2H76A 4KF9A 3BCKA 4Q5NA 3UARA 2AV4A 5INYA 1Z3EA 3LSZA 2J9HA 3TOTA 1ZMAA 3EURA 4ACSA 4ECCA 4YQVA 5HR2A 1VF2A 2DJ1A 1U87A 3FR3A 3PGTA 3UAPA 2OE0A 4TKYA 1KBNA 1XVQA 3MSZA 2DSAA 2H0GA 4GWRA 1NHYA 2HRKA 4I5QA 3F9UA 4ZB6A 4YQUA 3EWLA 5E59A 5IMAA 1QMVA 2VM1A 4TRXA 3VK9A 1RK4A 4F0BA 1SJZA 2E0QA 2YCDA 2ON7A 4L5OA 2DBCA 1TRSA 2WB9A 1O7UA 2HZFA 1YDKA 1A8LA 2VD0A 4ZB7A 4EO3A 4KSMA 1Y25A 4ZB9A 1HNBA 1TK0B 4WETA 3GH9A 3MWHA 1NW2A 1O8WA 2FY6A 4BL7B 3H79A 3KZQA 5IO2A 4BVYB 1OE8A 1GSYA 2FHEA 3M8NA 3EU4A 2CVKA 1YY7A 2VD1A 4E68A 5KN2A 1SVOA 3TCOA 1AQVA 3HJPA 1GLPA 4FH8A 3ZIJA 5ID2A 4LMWA 4IJIA 3M3MA 3CRTA 2YANA 2EC4A 3H4KA 2X8HA 3UVTA 4MF5A 2HZEB 2X8CA 3IK9A 3DYRA 4FQUA 3IE3A 1XW5A 2V6KA 2P0GA 4KUNA 1GNWA 3GFKA 1N2AA 1GTAA 1EOHA 3MDKA 4YQMA 2MYGA 5KN3A 2G0FA 3FHKA 1O8XA 1OC9B 4GQFA 2GZYA 4E8HA 1SL2B 5GSTA 2XPDA 1SVLA 4ECBA 2J23A 1TK8B 1A24A 1OC3A 1B9XC 1XWKA 1Z7RA 1K3YA 2E2MA 2R0PA 2HT9A 5H5SA 4K0NA 4EVMA 2WJUA 5DVBA 4FYUA 3ZTLA 2GS3A 1XW9A 1AXDA 4PX1A 3IAM2 2RUFA 4AGSA 1T1VA 2YWIA 5CO3A 2VL9A 2BTOT 5B6MA 2PPTA 5BMUA 9GSSA 5JCUA 1T7PB 5IPHA 2WZ9A 1T4YA 22GSA 6GSXA 3CMIA 4TOPA 5CYYA 4X1UA 5GAPD 4USSA 5D96A 3S9FA 3LFLA 4KW6A 5G5FA 5ABRA 1GTUA 4PNGA 2B5XA 4L0WA 3QAWA 3LYPA 2DMLA 4QL7A 3O76A 2B3SA 1EGRA 3TKSC 1GTBA 1A2LA 3WGEA 5AIVA 5J40A 1WWJA 3ERGA 2H19A 4XIHA 1IYHA 2FWHA 3HZ8A 2DJJA 3Q19A 2LS5A 4KX4A 5KEJA 2DMMA 2KUCA 3EE2A 2FWGA 4F2IA 1OKTA 2DKHA 3CSJA 3D6IA 4DSRA 2QA2A 4CY6A 3RDWA 1U3IA 5KOXA 2GT5A 4KB3A 5HR1A 1I9DA 2L5LA 3A2WA 4WXTA 5DJLA 1SD9A 2VCXA 3GX8A 1N25A 1EGOA 4PUAA 2GZPA 2ZNMA 1PL2A 3HHVA 3I43A 4IP6A 3E0UA 3FW2A 2B1KA 4TXOA 3DKSA 4AJ7A 3DD3A 4A5PA 2CZ3A 2C4JA 4FIWA 4ZL7A 4DSQA 4TR0A 1K0AA 4MNNA 2C80A 2PMTA 2RIIA 1GWCA 1FVJA 1G0TA 4ML6A 5JCWA 1XPVA 3N5OA 3LYKA 3M1GA 4W66A 3F63A 4HUAA 1NM3A 2P31A 4HDEA 3KTBA 2G2QA 3H93A 3PR8A 4MZWA 3F8UA 5CRGA 1BAYA 1Z6MA 2L5OA 4G0LA 1EEMA 1JFUA 2FA4A 4QMKA 5IPGA 3GTUA 4PUFC 2QKEA 1HNCA 2H1AA 3TGZA 4JZQA 4MP4A 4PQHA 4F0CA 4GDFA 3TJKA 3HDCA 1K0DA 4V1Ag 4N3ZA 5C04A 2VCZA 3DIEA 1F9MA 1F3BA 1TP9A 4NAXA 16GSA 4ECIA 5IM9A 2C3TA 5A4VA 1K3LA 3F3QA 1PX7A 3ME7A 2H0IA 4MJBA 3KEBA 4MF7A 1BYEA 2ALBA 2RM5A 2LKUA 4HZ4A 5FHIA 3GYKA 2BMXA 3VI7A 3DVXA 2H6ZA 4JR4A 3LQ7A 2I3YA 2A2PA 5DJMA 2CVBA 3IDVA 3US3A 3KIJA 3FZAA 2XBQA 5IMFA 4O92A 2H6YA 1WOUA 1E6BA 3GSSA 2LNSA 4EF0A 2HSYA 4ZB8A 2LSTA 1MD3A 3F4TA 1TK5B 3ME8A 2K18A 4N11A 2L4CA 2YWNA 1WJKA 1K3OA 2CAQA 1OVNA 1WMJA 2R2JA 2A2SA 1I5GA 2DIYA 4HQZA 4G10A 3EMPA 4XCSA 1QGVA 5A1NA 5ECKB 3GNJA 3ZITA 1ERTA 2A4VA 4O5QA 2LRTA 2H72A 2O7KA 2FWEA 1AUCA 2OE3A 4QQ7A 11GSA 4J57E 5CREA 5D93A 2H1BA 5G5EA 2NDOA 1MDIA 4IHUA 4K7OA 1SU9A 2VO4A 2NVLA 1FW1A 4YKGA 5DALB 4EIPA 4AKHA 1PKWA 4AJ8A 1M9AA 2VCTA 2MBTA 5IOWA 1ZCPA 1S3AA 3K8NA 3CBUA 1EEJA 2OA7A 5D9VA 2CX3A 2VCQA 1EP8A 1V2AA 4WBRD 5D9XA 2A2RA 4G19A 4GCIA 4JR6A 1TJDA 2PUKC 1GSEA 3HKRA 5HR3A 4MH2A 2IMDA 4ULXA 2C3QA 2R3XA 3GUSA 3FEUA 4OMVA 4OCFA 2FGXA 1WE0A 1Z9HA 4IBPA 3CRUA 2H1LA 2AHEA 2VAFA 6GSUA 2CA8A 2I4AA 2JADA 2KP1A 5JWRB 1N8JA 3VWVA 12GSA 5FT3A 1FAAA 4WR4A 2RUEA 1BF5A 2X8GA 3LW9A 3Q18A 3FR9A 2HRKB 1TKDB 3DVWA 3CYNA 2ZCTA 1ZYPA 1UN2A 5ECMB 1QK8A 3HJMA 3TKQA 2WS2A 2AJQB 2MMOA 2HE3A 3CWGA 2EIQA 4WKWA 3LWAA 4TN8A 1ML6A 5ECOB 3AY8A 3GMFA 5IIZA 1GUMA 4OO4A 3O6TA 1XW6A 3FK8A 1A23A 5ECHB 1M0UA 4RI7A 4MJEA 3TJBA 2PGTA 4JEDA 3F4SA 1YQ1A 4O32A 2CAIA 2LV3A 2QA1A 3FZ5A 4HQSA 3EC3A 4OFMA 4YKFA 4KCAA 2XC2A 2FNOA 2YNXA 1OKDA 1O81A 3TDGA 3QDNA 10GSA 4NHZA 1X5DA 3E9JB 3KP9A 3P8WA 4RI6A 4AJ6A 1FHEA 1F37A 2B5EA 1TI1A 2FCHA 3JCML 3BJ5A 1EV9A 1M7TA 1DSBA 4IKHA 4K0GA 5IO0A 4BWSA 4MDCA 3ZZXA 1AW9A 3VLNA 2GT6A 3EYTA 2PWJA 1YKAA 4BVXB 2IMKA 5DQSA 4LLRA 2VKZG 2LJAA 4F82A 1T8EB 4MPGA 3UL3A 4G2EA 4TR1A 2O85A 1ZL9A 2YPMA 1X9SB 1X9MB 3TU3B 3DMLA 5ENUA 5CRHA 5J9BA 1VF4A 1B9YC 4N10A 2GSSA 3APQA 2O5VA 2HSNA 2AB6A 2CQ9A 3LJRA 3R3EA 4OWYA 4GSSA 2IWTA 3A3TA 2H1GA 5G1LA 3IRAA 2GSRA 1SENA 1V58A 3RPPA 3IBHA 2C0EA 4EC0A 2B5YA 4ZBBA 4OO5A 3D4TA 3F4RA 1UC7A 2N5BA 2HNLA 4XRAA 5B7CA 2LJRA 2GSQA 1PSQA 1A8YA 4POLA 3HJOA 4HU7A 1PN0A 3IAS2 4FYCA 2F3MA 4EDZA 1K0CA 4ECJA 2YOIA 1TOFA 3EVIA 2C0GA 4MZCA 4OFNA 6GSVA 2I1UA 2EIOA 1AC1A 2V1MA 4MMMA 5A34A 2OT3A 3BD2A 2OACA 1XCCA 4CHSA 1XWAA 3UEMA 1SD8A 1DBYA 1FB6A 5LD0A 4ZILA 3L0HA 4DSSB 3W8JA 1TU7A 3GN3A 2LJKA 2CZ2A 4WR5A 4G9HA 4MK3A 4ICYA 4LL1B 2M72A 4K5RA 4EIQA 2IMFA 3GH6A 4BL7A 1SL1B 4PQ1A 2HRFA 2R37A 5A5HA 4BVYA 5EPFA 3BOAA 3QFBC 3H8QA 3QCPA 4Q5FA 5F06A 3E3EA 4K7IA 4GTUA 4HJMA 4NMUA 1XFLA 2DJ3A 4EDYA 1R7HA 4XTSA 3KJYA 4LMVA 3TJFA 2H73A 2HZEA 1HQOA 1TW9A 3C7MA 1YZXA 1Y1UA 2L4QA 2JL4A 4MA9A 4JE1A 3UJ1A 1DE2A 3NIVA 3UBLA 2DJ2A 2V6OA 6GSYA 2X4AA 5ECQB 1AIUA 4E8EA 3APSA 5HQPA 4Z2RA 1OC9A 1OYJA 2KHPA 3FZ4A 2HSMA 1GH2A 1VF3A 3KM6A 1HD2A 4D73B 2TIRA 4J2FA 5F07A 3FRCA 4K9ZA 1R5PA 2YJHA 4G0IA 2ZUPA 4OD7A 4WF4A 5H5RA 3ISOA 4P3YB 3CTFA 1PX6A 1ERUA 3IR4A 1MEKA 1QQ2A 1O73A 1EWXA 4POBA 1GUHA 1R5AA 3L78A 3F0IA 2D2ZA 2M46A 3U6VA 2VCVA 1E2YA 2JACA 1ZOFA 5DAKB 7GSSA 1M2BA 2C3NA 3HXSA 3ZIVA 4CDOA 4MH3A 4ZXGA 3GV1A 2XPEA 4EUYA 3LORA 2EFDA 3TRQA 2QSIA 1LU4A 3FY7A 2K9FA 1F2EA 4WEYA 5EY6A 3VWUA 5ELAA 1PMTA 1GSQA 4KNDA 2FUG2 4RQRA 3QOUA 2Z9SA 2PBJA 1W4VA 1A2JA 3ED3A 3EPTA 1XOBA 1BEDA 1H4OA 3EU3A 2GVPA 4V2MA 4XS6A 5A4UA 1EOGA 3I69A 4KH7A 4IJ3A 4G0KA 3GURA 3G7YA 1H75A 4X4JA 1FOHA 4HU9A 2X99A 3C8EA 4MABA 1YEXA 4OCEA 3ZMKA 3DEXA 1QFNA 2IIYA 5B8BA 3Q74A 1YF0A 3RPNA 4PQIA 2L6DA 1S3DA 2P5RA 5IMDA 2CX4A 3APOA 5AIXA 1VF1A 5A4WA 4ZL9A 2E7PA 3TKPA 1ZZYA 1R26A 3N9JA 3QD9A 4MLYA 2VL3A 3F3RA 2VLUA 3IC8A 2K8VA 3DWVA 1GNEA 3WT1A 5J3RA 3VFIA 2F8FA 3G9BA 14GSA 3GKMA 2YJ7A 3GA4A 3FR6A 2H71A 3GL5A 3KMNA 1PGTA 2HQTA 1FVKA 1BJXA 1GSSA 1OC8A 3GX0A 4OFTA 1ABAA 2OKAA 2M80A 1ZYQB 2CVDA 2HRAA 5ELGA 2OBIA 4XS4A 1YJ6A 5G2ZA 1UVZA 1U3AA 1BG5A 1SK0A 2RM6A 1UA5A 4MF6A 2H74A 2K8SA 2LNTA 3LG6A 1EP7A 2WGRA 2PVQA 5ECLB 3TJJA 1X9WB 3VWXA 4RUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6Y A;  1GRX A;  3ZFL A;  2IFQ B;  3MAK A;  2JZR A;  2H8L A;  3R2Q A;  4I6X A;  2C0F A;  3QAG A;  5HFI A;  3UBK A;  1DUG A;  3LXT A;  2FWF A;  1PN9 A;  4IS0 A;  3SBC A;  2CV4 A;  2GLR A;  1JZD A;  3KMO A;  5H5Q A;  1PQN A;  3PPU A;  2ON5 A;  3WYW A;  4YAV A;  1AQW A;  4O5R A;  4BWQ A;  5DCG A;  3PIN A;  1PD2 1;  2XHF A;  5CAX A;  3GKK A;  3MNG A;  4GQC A;  3UMA A;  1GSU A;  2FA8 A;  1TRV A;  2ES7 A;  3WT2 A;  2K6V A;  3L9S A;  3RBT A;  1O85 A;  3KD0 A;  1LJR A;  5COH A;  4PUR A;  1M2D A;  5C00 A;  2QGV A;  2LUS A;  3C1S A;  4ZBA A;  2NPB A;  3C71 A;  2P5Q A;  2LRC A;  2LTK A;  3KTL A;  1GSD A;  5E4W A;  3FYG A;  4ILF A;  4IQA A;  5J4U A;  4EKZ A;  2WDU A;  2DLX A;  2YZH A;  1SJI A;  2V41 A;  1J9B A;  3LEF A;  4JBB A;  2VIM A;  4MPF A;  3IV4 A;  3PH9 A;  2R4V A;  4KGI A;  3BCI A;  2GTU A;  5JCG A;  3IXR A;  4IN0 A;  3HVS A;  1X5C A;  1MTC A;  5DAL A;  2B6M A;  5CNW A;  4XRD A;  1XXU A;  2IPA A;  3GKN A;  4HZ2 A;  4HEA 2;  4WF5 A;  2O8V B;  1F6M C;  2LEG A;  4MZB A;  4NHW A;  3RAZ A;  1SKW B;  4KA0 A;  2I9H A;  4GST A;  4ZBD A;  1XZO A;  5AIS A;  3TKS A;  3DGQ A;  2PN8 A;  4AF2 A;  3SWL A;  4TR3 A;  2VCW A;  4GSN A;  2H75 A;  2GZZ A;  1TRU A;  4FO5 A;  1SYR A;  3HA9 A;  1K0M A;  1KNG A;  1LBK A;  5ID2 B;  2LRN A;  4FYB A;  1BQ7 A;  1CQG A;  3D21 A;  2OAD A;  3CTG A;  5IMC A;  5IQY A;  4K7N A;  4HI7 A;  1GLQ A;  3ZVJ A;  4K6X A;  2FD3 A;  1R4W A;  2OJL A;  1B4Q A;  2H66 A;  4I8B A;  1QXH A;  1MDJ A;  2N5F A;  4KDY A;  5G31 A;  2VLT A;  4LL4 B;  4XS1 A;  4IW9 A;  1U6T A;  1TDI A;  5DBQ A;  13GS A;  2B7K A;  2KLX A;  4POK A;  1X5E A;  3TRX A;  4JU5 A;  3M9K A;  5GSS A;  3A5W A;  3L9U A;  4DEJ A;  3J7Y b;  5ECR B;  4EE0 A;  3D22 A;  4BA7 A;  1FB0 A;  3VI5 A;  3VPT A;  1USB A;  2C8U A;  1MD4 A;  3NZN A;  2CT6 A;  4GRF A;  3UIW A;  1WIK A;  5G1K A;  1URM A;  5D9W A;  3P90 A;  1GSF A;  4XHM A;  3D0Z A;  3FKF A;  5EL8 A;  2C1Y A;  3TKR A;  1AQX A;  3KXO A;  1B4P A;  3IK7 A;  3RHC A;  2GDR A;  1BX9 A;  4X0X A;  1Z5Y E;  1V98 A;  4N30 A;  2REM A;  2I81 A;  1GUK A;  1SKS B;  5DQY A;  2VUP A;  2MMN A;  1ILO A;  4NV5 A;  1GTI A;  2H01 A;  4ID0 A;  5KN1 A;  1B8X A;  4YH2 A;  3G7J A;  3WGX A;  2AUV A;  3CSH A;  3KP8 A;  3ZL5 A;  1PL1 A;  3D4M A;  2BJX A;  2C0D A;  2NBS A;  4N0V A;  3FZ9 A;  2UZ8 A;  5CP1 A;  3C73 A;  1JZO A;  3GIX A;  6GSW A;  1X0R A;  3ZFB A;  2HFD A;  1SK1 A;  4BVX A;  3VPQ A;  4GLT A;  1KEB A;  3I6A A;  2IL3 A;  4YAP A;  3IOS A;  1FG4 A;  4TR4 A;  1JZR A;  1TU8 A;  1M9B A;  2DC5 A;  5GZZ B;  4K2D A;  5CRD A;  1NSW A;  4MJC A;  2HSM B;  2YV9 A;  1PA3 A;  2WRT A;  1Q4J A;  2VL2 C;  1GUL A;  1XOA A;  5J9C A;  5ECP B;  4IGJ A;  2IMI A;  6GST A;  1U88 A;  2DIZ A;  5A5K A;  5L71 A;  4RQX A;  3UVH A;  2VOC A;  4ML1 A;  3DXB A;  4X43 A;  4TXO B;  2F9S A;  1ERV A;  3L4N A;  2PER A;  1XBS A;  1SJ6 A;  5HFG A;  1O6J A;  2H1D A;  2KP2 A;  1ST9 A;  2HYX A;  1MDK A;  4NV2 A;  1JLV A;  3GST A;  2YV7 A;  4EL1 A;  3GRX A;  5B6N A;  1J0F A;  6GSS A;  3LXZ A;  4WBJ A;  4KAE A;  1W89 A;  1ERW A;  5GAN D;  1QUW A;  4KCE A;  3RHB A;  4BPY A;  4I97 A;  1K0O A;  5IMZ A;  3ZRD A;  3GTU B;  4DVC A;  3U5R E;  4CW9 A;  4F9Z A;  1G7E A;  3TUE A;  4LA1 A;  4DSS A;  4ZL8 A;  2RLI A;  2WCI A;  3ZYW A;  2WFC A;  3ZVJ D;  2LQO A;  18GS A;  4L5L A;  1XWC A;  3GHA A;  17GS A;  2H6X A;  1IYI A;  1M2A A;  5F8B A;  1G6W A;  3O3T A;  5AN1 A;  1TTZ A;  1G7O A;  2TRC P;  5D73 A;  2V32 A;  4IQ1 A;  1FO5 A;  2MMZ A;  5J5N A;  4L8E A;  3KCM A;  1WP0 A;  1RW1 A;  4IP1 A;  1ACV A;  2N5A A;  4PGT A;  3W6G A;  1V40 A;  4TW5 A;  5FWG A;  4TXV A;  2HSH A;  4ZIJ A;  1XWB A;  3EIN A;  3W8S A;  19GS A;  2V2G A;  2F51 A;  1OE7 A;  2DJK A;  4Q5Q A;  3C1R A;  5B8A A;  4EXJ A;  5JWQ B;  3ERF A;  3UOM A;  2L59 A;  1EZK A;  5EVO A;  2TRX A;  5AGY A;  1TI3 A;  3HZ4 A;  1YEP A;  1XIY A;  3J7Y k;  4D73 A;  1XWG A;  3OR5 A;  1JHB A;  3TKS E;  1T3B A;  4XS4 B;  3D5J A;  2E2G A;  4ISD A;  1K0B A;  5DDL A;  2B7J A;  5IMV A;  2GQK A;  1A0F A;  2QC7 A;  3V1W A;  4IVF A;  1VGL A;  3HYP A;  3TJG A;  3NOF A;  2MBS A;  4MJA A;  2O89 A;  1YF1 A;  1DE1 A;  3LGC A;  3KGK A;  1YKC A;  3TOU A;  5ECI B;  4HJ2 A;  3QR6 A;  5D9T A;  2PU9 C;  3H1N A;  5DAK A;  4Z7X A;  5CRW A;  2JZT A;  5JWO B;  3Q6O A;  1Z6N A;  5DCH A;  1EV4 A;  1RQM A;  1SL0 B;  4N0Z A;  3HY2 A;  5G30 A;  2H70 A;  2GGT A;  1HNA A;  3EMX A;  1A2M A;  5D8I A;  4KDU A;  1C72 A;  1V57 A;  1T00 A;  3IA1 A;  2EIR A;  3P7X A;  5KN0 A;  3QPM A;  1GL8 A;  2GQL A;  3IHQ A;  3VUR A;  1THO A;  2YP6 A;  4KSO A;  1Q98 A;  1KTE A;  3KH7 A;  2OE1 A;  1K0N A;  3M9J A;  4I2T A;  3GKX A;  4KDX A;  5HFK A;  2X64 A;  2H0H A;  2L57 A;  1HYU A;  5LNK e;  4HS1 A;  2VLV A;  4PNF A;  1J08 A;  1SYX A;  2IN3 A;  3BBY A;  4IEL A;  2HLS A;  5F05 A;  3TB2 A;  3L9V A;  2MMA A;  4V2N A;  2JSZ A;  5F0G A;  5IOX A;  1WPI A;  2GST A;  3GL3 A;  2HXK A;  1GP1 A;  3DRN A;  4QL9 A;  1TXX A;  2HI7 A;  3WGD A;  4GXZ A;  2NTO A;  5J41 A;  4J56 E;  1NHO A;  4POM A;  1JLW A;  2JZS A;  2R6K A;  1A0R P;  1ZYE A;  2YWM A;  1PKZ A;  3ERW A;  1THX A;  4GF0 A;  1PRX A;  3KH9 A;  4NXI A;  3ZML A;  2AYT A;  4I2U A;  1TRW A;  4L0U A;  5HR0 A;  1V9W A;  3WD6 A;  2VM2 A;  1JZW A;  2MZC A;  8GSS A;  2JU5 A;  2XBI A;  4F03 A;  2O87 A;  3A2V A;  1ON4 A;  4V1A p;  3F6F A;  3CSI A;  1CQH A;  4NWY A;  2JSY A;  4NPB A;  2F8A A;  4MCU A;  3QFA C;  5ECS A;  4PTS A;  4KE3 A;  2HRN A;  5ECN B;  1FOV A;  3HD5 A;  3ZLP A;  2PVO C;  3I9V 2;  2IJY A;  2VL2 A;  4H86 A;  1Y6E A;  2YWO A;  3VWW A;  1SKR B;  2FLS A;  2AAW A;  1M99 A;  3ZRE A;  3CXG A;  4JRR A;  2IFQ A;  1Z7P A;  1B48 A;  1AAZ A;  1XVW A;  2DJ0 A;  2LQQ A;  1T4Z A;  2KOK A;  4O7H A;  4PXO A;  5LCZ A;  2GQM A;  2L6C A;  1OAZ A;  1S3C A;  4Q5R A;  3IC4 A;  3QMX A;  3TRP A;  4V2L A;  2OBK A;  4HOJ A;  3M0F A;  3G7I A;  4TR1 B;  3A2X A;  1VRS D;  3HCZ A;  2IME A;  2WUL A;  1ZGN A;  2H30 A;  3HVX A;  20GS A;  1F3A A;  4K8M A;  2R5G A;  3QAV A;  2YZU A;  3P2A A;  1SK2 A;  2YN1 A;  3F6D A;  2HSN B;  1WRY A;  4K1F A;  4TVE A;  3HVV A;  3IPZ A;  2B1L A;  2H76 A;  4KF9 A;  3BCK A;  4Q5N A;  3UAR A;  2AV4 A;  5INY A;  1Z3E A;  3LSZ A;  2J9H A;  3TOT A;  1ZMA A;  3EUR A;  4ACS A;  4ECC A;  4YQV A;  5HR2 A;  1VF2 A;  2DJ1 A;  1U87 A;  3FR3 A;  3PGT A;  3UAP A;  2OE0 A;  4TKY A;  1KBN A;  1XVQ A;  3MSZ A;  2DSA A;  2H0G A;  4GWR A;  1NHY A;  2HRK A;  4I5Q A;  3F9U A;  4ZB6 A;  4YQU A;  3EWL A;  5E59 A;  5IMA A;  1QMV A;  2VM1 A;  4TRX A;  3VK9 A;  1RK4 A;  4F0B A;  1SJZ A;  2E0Q A;  2YCD A;  2ON7 A;  4L5O A;  2DBC A;  1TRS A;  2WB9 A;  1O7U A;  2HZF A;  1YDK A;  1A8L A;  2VD0 A;  4EO3 A;  4KSM A;  1Y25 A;  4ZB9 A;  1HNB A;  1TK0 B;  4WET A;  3GH9 A;  3MWH A;  1NW2 A;  1O8W A;  2FY6 A;  4BL7 B;  3H79 A;  3KZQ A;  5IO2 A;  4BVY B;  1OE8 A;  1GSY A;  2FHE A;  3M8N A;  3EU4 A;  2CVK A;  1YY7 A;  2VD1 A;  5KN2 A;  3TCO A;  1AQV A;  3HJP A;  1GLP A;  4FH8 A;  3ZIJ A;  5ID2 A;  4LMW A;  4IJI A;  3M3M A;  3CRT A;  2YAN A;  2EC4 A;  3H4K A;  2X8H A;  3UVT A;  4MF5 A;  2HZE B;  2X8C A;  3IK9 A;  3DYR A;  4FQU A;  3IE3 A;  1XW5 A;  2V6K A;  2P0G A;  4KUN A;  1GNW A;  3GFK A;  1N2A A;  1GTA A;  1EOH A;  3MDK A;  4YQM A;  2MYG A;  5KN3 A;  2G0F A;  3FHK A;  1O8X A;  1OC9 B;  4GQF A;  2GZY A;  4E8H A;  1SL2 B;  5GST A;  2XPD A;  4ECB A;  2J23 A;  1TK8 B;  1A24 A;  1OC3 A;  1B9X C;  1XWK A;  1Z7R A;  1K3Y A;  2E2M A;  2HT9 A;  5H5S A;  4K0N A;  4EVM A;  2WJU A;  5DVB A;  4FYU A;  3ZTL A;  2GS3 A;  1XW9 A;  1AXD A;  4PX1 A;  3IAM 2;  2RUF A;  4AGS A;  1T1V A;  2YWI A;  5CO3 A;  2VL9 A;  2BTO T;  5B6M A;  2PPT A;  5BMU A;  9GSS A;  5JCU A;  1T7P B;  5IPH A;  2WZ9 A;  1T4Y A;  22GS A;  6GSX A;  3CMI A;  4TOP A;  5CYY A;  4X1U A;  5GAP D;  4USS A;  5D96 A;  3S9F A;  3LFL A;  4KW6 A;  5G5F A;  5ABR A;  1GTU A;  4PNG A;  2B5X A;  4L0W A;  3QAW A;  3LYP A;  2DML A;  4QL7 A;  3O76 A;  2B3S A;  1EGR A;  3TKS C;  1GTB A;  1A2L A;  3WGE A;  5AIV A;  1WWJ A;  3ERG A;  2H19 A;  4XIH A;  1IYH A;  2FWH A;  3HZ8 A;  2DJJ A;  3Q19 A;  2LS5 A;  4KX4 A;  5KEJ A;  2DMM A;  2KUC A;  3EE2 A;  2FWG A;  4F2I A;  1OKT A;  3CSJ A;  3D6I A;  4DSR A;  3RDW A;  1U3I A;  2GT5 A;  4KB3 A;  5HR1 A;  1I9D A;  2L5L A;  3A2W A;  4WXT A;  5DJL A;  1SD9 A;  2VCX A;  3GX8 A;  1EGO A;  4PUA A;  2GZP A;  2ZNM A;  1PL2 A;  3HHV A;  3I43 A;  4IP6 A;  3E0U A;  3FW2 A;  2B1K A;  4TXO A;  3DKS A;  4AJ7 A;  3DD3 A;  2CZ3 A;  2C4J A;  4FIW A;  4ZL7 A;  4DSQ A;  4TR0 A;  1K0A A;  2C80 A;  2PMT A;  2RII A;  1GWC A;  1FVJ A;  1G0T A;  4ML6 A;  5JCW A;  1XPV A;  3N5O A;  3LYK A;  3M1G A;  3F63 A;  4HUA A;  1NM3 A;  2P31 A;  4HDE A;  3KTB A;  2G2Q A;  3H93 A;  3PR8 A;  4MZW A;  3F8U A;  5CRG A;  1BAY A;  1Z6M A;  2L5O A;  4G0L A;  1EEM A;  1JFU A;  2FA4 A;  5IPG A;  3GTU A;  4PUF C;  2QKE A;  1HNC A;  2H1A A;  3TGZ A;  4JZQ A;  4MP4 A;  4PQH A;  4F0C A;  3TJK A;  3HDC A;  1K0D A;  4V1A g;  5C04 A;  2VCZ A;  3DIE A;  1F9M A;  1F3B A;  1TP9 A;  4NAX A;  16GS A;  4ECI A;  5IM9 A;  2C3T A;  5A4V A;  1K3L A;  3F3Q A;  1PX7 A;  3ME7 A;  2H0I A;  4MJB A;  3KEB A;  4MF7 A;  1BYE A;  2ALB A;  2RM5 A;  2LKU A;  4HZ4 A;  5FHI A;  3GYK A;  2BMX A;  3VI7 A;  3DVX A;  2H6Z A;  4JR4 A;  3LQ7 A;  2I3Y A;  5DJM A;  2CVB A;  3IDV A;  3US3 A;  3KIJ A;  3FZA A;  2XBQ A;  5IMF A;  4O92 A;  2H6Y A;  1WOU A;  1E6B A;  3GSS A;  2LNS A;  4EF0 A;  2HSY A;  4ZB8 A;  2LST A;  1MD3 A;  3F4T A;  1TK5 B;  3ME8 A;  2K18 A;  4N11 A;  2L4C A;  2YWN A;  1WJK A;  1K3O A;  2CAQ A;  1OVN A;  1WMJ A;  2R2J A;  2A2S A;  1I5G A;  2DIY A;  4HQZ A;  4G10 A;  3EMP A;  4XCS A;  1QGV A;  3GNJ A;  5ECK B;  3ZIT A;  1ERT A;  2A4V A;  2LRT A;  2H72 A;  2O7K A;  2FWE A;  1AUC A;  2OE3 A;  4QQ7 A;  11GS A;  4J57 E;  5CRE A;  5D93 A;  2H1B A;  5G5E A;  2NDO A;  1MDI A;  4IHU A;  4K7O A;  1SU9 A;  2VO4 A;  2NVL A;  1FW1 A;  5DAL B;  1PKW A;  4AJ8 A;  1M9A A;  2VCT A;  2MBT A;  5IOW A;  1ZCP A;  1S3A A;  3K8N A;  3CBU A;  1EEJ A;  2OA7 A;  5D9V A;  2CX3 A;  2VCQ A;  1EP8 A;  1V2A A;  4WBR D;  5D9X A;  2A2R A;  4G19 A;  4GCI A;  4JR6 A;  1TJD A;  2PUK C;  1GSE A;  3HKR A;  5HR3 A;  4MH2 A;  2IMD A;  4ULX A;  2C3Q A;  2R3X A;  3GUS A;  3FEU A;  4OMV A;  4OCF A;  2FGX A;  1WE0 A;  1Z9H A;  4IBP A;  3CRU A;  2AHE A;  2VAF A;  6GSU A;  2CA8 A;  2I4A A;  2JAD A;  2KP1 A;  5JWR B;  1N8J A;  3VWV A;  12GS A;  5FT3 A;  1FAA A;  4WR4 A;  2RUE A;  2X8G A;  3Q18 A;  3FR9 A;  2HRK B;  1TKD B;  3DVW A;  3CYN A;  2ZCT A;  1UN2 A;  5ECM B;  1QK8 A;  3HJM A;  3TKQ A;  2WS2 A;  2AJQ B;  2MMO A;  2HE3 A;  2EIQ A;  4WKW A;  3LWA A;  4TN8 A;  1ML6 A;  5ECO B;  3AY8 A;  3GMF A;  5IIZ A;  1GUM A;  4OO4 A;  3O6T A;  1XW6 A;  3FK8 A;  1A23 A;  5ECH B;  1M0U A;  4RI7 A;  4MJE A;  3TJB A;  2PGT A;  4JED A;  3F4S A;  1YQ1 A;  4O32 A;  2CAI A;  2LV3 A;  3FZ5 A;  4HQS A;  3EC3 A;  4OFM A;  4KCA A;  2XC2 A;  2FNO A;  2YNX A;  1OKD A;  1O81 A;  3TDG A;  3QDN A;  10GS A;  4NHZ A;  1X5D A;  3E9J B;  3KP9 A;  3P8W A;  4RI6 A;  4AJ6 A;  1FHE A;  1F37 A;  2B5E A;  1TI1 A;  2FCH A;  3JCM L;  3BJ5 A;  1EV9 A;  1M7T A;  1DSB A;  4IKH A;  4K0G A;  5IO0 A;  4BWS A;  4MDC A;  3ZZX A;  1AW9 A;  3VLN A;  2GT6 A;  3EYT A;  2PWJ A;  1YKA A;  4BVX B;  2IMK A;  5DQS A;  4LLR A;  2LJA A;  4F82 A;  1T8E B;  4MPG A;  3UL3 A;  4G2E A;  4TR1 A;  2O85 A;  1ZL9 A;  2YPM A;  1X9S B;  1X9M B;  3DML A;  5ENU A;  5CRH A;  5J9B A;  1VF4 A;  1B9Y C;  4N10 A;  2GSS A;  3APQ A;  2AB6 A;  2CQ9 A;  3LJR A;  3R3E A;  4OWY A;  4GSS A;  2IWT A;  3A3T A;  2H1G A;  5G1L A;  3IRA A;  2GSR A;  1SEN A;  1V58 A;  3RPP A;  3IBH A;  2C0E A;  4EC0 A;  2B5Y A;  4ZBB A;  4OO5 A;  3D4T A;  3F4R A;  1UC7 A;  2N5B A;  2HNL A;  4XRA A;  5B7C A;  2LJR A;  2GSQ A;  1PSQ A;  1A8Y A;  4POL A;  3HJO A;  4HU7 A;  3IAS 2;  4FYC A;  2F3M A;  4EDZ A;  1K0C A;  4ECJ A;  2YOI A;  1TOF A;  3EVI A;  2C0G A;  4MZC A;  4OFN A;  6GSV A;  2I1U A;  2EIO A;  1AC1 A;  2V1M A;  4MMM A;  3BD2 A;  2OAC A;  1XCC A;  4CHS A;  1XWA A;  3UEM A;  1SD8 A;  1DBY A;  1FB6 A;  5LD0 A;  4ZIL A;  3L0H A;  4DSS B;  3W8J A;  1TU7 A;  3GN3 A;  2LJK A;  2CZ2 A;  4WR5 A;  4G9H A;  4MK3 A;  4LL1 B;  2M72 A;  2IMF A;  3GH6 A;  4BL7 A;  1SL1 B;  4PQ1 A;  2HRF A;  2R37 A;  4BVY A;  5EPF A;  3BOA A;  3QFB C;  3H8Q A;  3QCP A;  4Q5F A;  5F06 A;  3E3E A;  4K7I A;  4GTU A;  4HJM A;  4NMU A;  1XFL A;  2DJ3 A;  4EDY A;  1R7H A;  4XTS A;  3KJY A;  4LMV A;  3TJF A;  2H73 A;  2HZE A;  1HQO A;  1TW9 A;  3C7M A;  1YZX A;  2L4Q A;  2JL4 A;  4MA9 A;  4JE1 A;  3UJ1 A;  1DE2 A;  3NIV A;  3UBL A;  2DJ2 A;  2V6O A;  6GSY A;  5ECQ B;  1AIU A;  4E8E A;  3APS A;  5HQP A;  1OC9 A;  1OYJ A;  2KHP A;  3FZ4 A;  2HSM A;  1GH2 A;  1VF3 A;  3KM6 A;  1HD2 A;  4D73 B;  2TIR A;  4J2F A;  5F07 A;  3FRC A;  4K9Z A;  1R5P A;  2YJH A;  4G0I A;  2ZUP A;  4OD7 A;  4WF4 A;  5H5R A;  3ISO A;  4P3Y B;  3CTF A;  1PX6 A;  1ERU A;  3IR4 A;  1MEK A;  1QQ2 A;  1O73 A;  1EWX A;  4POB A;  1GUH A;  1R5A A;  3L78 A;  3F0I A;  2D2Z A;  2M46 A;  3U6V A;  2VCV A;  1E2Y A;  2JAC A;  1ZOF A;  5DAK B;  7GSS A;  1M2B A;  2C3N A;  3HXS A;  3ZIV A;  4CDO A;  4MH3 A;  4ZXG A;  3GV1 A;  2XPE A;  4EUY A;  3LOR A;  3TRQ A;  2QSI A;  1LU4 A;  3FY7 A;  2K9F A;  1F2E A;  4WEY A;  5EY6 A;  3VWU A;  5ELA A;  1PMT A;  1GSQ A;  4KND A;  2FUG 2;  4RQR A;  3QOU A;  2Z9S A;  2PBJ A;  1W4V A;  1A2J A;  3ED3 A;  1XOB A;  1BED A;  1H4O A;  3EU3 A;  2GVP A;  4V2M A;  4XS6 A;  5A4U A;  1EOG A;  3I69 A;  4KH7 A;  4IJ3 A;  4G0K A;  3GUR A;  3G7Y A;  1H75 A;  4HU9 A;  2X99 A;  3C8E A;  4MAB A;  1YEX A;  4OCE A;  3ZMK A;  3DEX A;  1QFN A;  2IIY A;  5B8B A;  3Q74 A;  1YF0 A;  3RPN A;  4PQI A;  2L6D A;  1S3D A;  2P5R A;  5IMD A;  2CX4 A;  3APO A;  5AIX A;  1VF1 A;  5A4W A;  4ZL9 A;  2E7P A;  3TKP A;  1ZZY A;  1R26 A;  3N9J A;  3QD9 A;  4MLY A;  2VL3 A;  3F3R A;  2VLU A;  3IC8 A;  2K8V A;  3DWV A;  1GNE A;  3WT1 A;  5J3R A;  3VFI A;  2F8F A;  3G9B A;  14GS A;  3GKM A;  2YJ7 A;  3GA4 A;  3FR6 A;  2H71 A;  3GL5 A;  3KMN A;  1PGT A;  2HQT A;  1FVK A;  1BJX A;  1GSS A;  1OC8 A;  3GX0 A;  4OFT A;  1ABA A;  2OKA A;  2M80 A;  1ZYQ B;  2CVD A;  2HRA A;  5ELG A;  2OBI A;  4XS4 A;  1YJ6 A;  5G2Z A;  1UVZ A;  1U3A A;  1BG5 A;  1SK0 A;  2RM6 A;  1UA5 A;  4MF6 A;  2H74 A;  2K8S A;  2LNT A;  3LG6 A;  1EP7 A;  2WGR A;  2PVQ A;  5ECL B;  3TJJ A;  1X9W B;  3VWX A;  4RUV A; 
#chains in the Genus database with same CATH topology
 1G6Y A;  1GRX A;  3ZFL A;  2IFQ B;  3MAK A;  2JZR A;  2H8L A;  3R2Q A;  4I6X A;  2C0F A;  3QAG A;  5HFI A;  3UBK A;  2WW2 A;  2UV8 G;  1DUG A;  3LXT A;  2FWF A;  1PN9 A;  4IS0 A;  3SBC A;  2CV4 A;  2GLR A;  1JZD A;  3KMO A;  5H5Q A;  1PQN A;  3PPU A;  2ON5 A;  3WYW A;  4YAV A;  1AQW A;  1S3R A;  4O5R A;  4BWQ A;  5DCG A;  2WVX A;  3PIN A;  1PD2 1;  2XHF A;  3A5I A;  5CAX A;  3GKK A;  3MNG A;  4GQC A;  3UMA A;  1XG8 A;  1GSU A;  2FA8 A;  1TRV A;  2ES7 A;  3WT2 A;  2K6V A;  3L9S A;  3RBT A;  1O85 A;  3KD0 A;  1LJR A;  4Z2U A;  5COH A;  4PUR A;  1M2D A;  4K2X A;  5C00 A;  3FMW A;  2QGV A;  2LUS A;  3C1S A;  4ZBA A;  2NPB A;  3C71 A;  2P5Q A;  2LRC A;  2LTK A;  3KTL A;  1GSD A;  5E4W A;  3FYG A;  4ILF A;  4IQA A;  2EFH A;  5J4U A;  4EKZ A;  2WDU A;  2DLX A;  2YZH A;  1SJI A;  2V41 A;  1J9B A;  3LEF A;  4JBB A;  2VIM A;  4MPF A;  3IV4 A;  3PH9 A;  2R4V A;  4KGI A;  3BCI A;  2GTU A;  5JCG A;  3IXR A;  5J4Y A;  4IN0 A;  3HVS A;  1X5C A;  1MTC A;  5DAL A;  2B6M A;  5CNW A;  4XRD A;  1XXU A;  2IPA A;  3GKN A;  4HZ2 A;  4HEA 2;  4WF5 A;  2O8V B;  1F6M C;  2LEG A;  4MZB A;  4NHW A;  3RAZ A;  1SKW B;  4KA0 A;  2I9H A;  4GST A;  4ZBD A;  1XZO A;  5AIS A;  3TKS A;  3DGQ A;  2PN8 A;  4AF2 A;  3SWL A;  4TR3 A;  2VCW A;  4GSN A;  2H75 A;  2GZZ A;  2EFE A;  1TRU A;  4FO5 A;  1SYR A;  3HA9 A;  1K0M A;  1KNG A;  1LBK A;  5ID2 B;  2LRN A;  4FYB A;  1BQ7 A;  1CQG A;  3D21 A;  2OAD A;  3CTG A;  5IMC A;  5IQY A;  4K7N A;  4HI7 A;  1GLQ A;  2WZS A;  3ZVJ A;  5J4V A;  4K6X A;  2FD3 A;  1R4W A;  2OJL A;  1B4Q A;  2H66 A;  4I8B A;  1QXH A;  1MDJ A;  2N5F A;  4KDY A;  5G31 A;  2VLT A;  5A34 B;  4LL4 B;  4XS1 A;  4IW9 A;  1U6T A;  1TDI A;  5DBQ A;  13GS A;  2B7K A;  2KLX A;  4POK A;  1X5E A;  3TRX A;  4JU5 A;  3M9K A;  5GSS A;  2WW0 A;  3A5W A;  3L9U A;  4DEJ A;  3J7Y b;  5ECR B;  4EE0 A;  3D22 A;  4BA7 A;  1FB0 A;  3MYD A;  3VI5 A;  3VPT A;  4BIK A;  1USB A;  2C8U A;  1MD4 A;  3NZN A;  2CT6 A;  4GRF A;  3UIW A;  3RGB C;  1WIK A;  5G1K A;  1URM A;  2WW1 A;  5D9W A;  3P90 A;  5A5H B;  1GSF A;  4XHM A;  3D0Z A;  3FKF A;  5EL8 A;  2C1Y A;  3TKR A;  1AQX A;  3KXO A;  1ZYN A;  1B4P A;  3IK7 A;  3RHC A;  4AKX B;  2GDR A;  1BX9 A;  4X0X A;  1Z5Y E;  5BMU B;  1V98 A;  4N30 A;  1SVM A;  2REM A;  2I81 A;  1GUK A;  1SKS B;  5DQY A;  2VUP A;  2MMN A;  1ILO A;  4NV5 A;  1GTI A;  2H01 A;  4ID0 A;  5KN1 A;  1B8X A;  4YH2 A;  3G7J A;  3WGX A;  2AUV A;  4AI6 A;  3CSH A;  3KP8 A;  3ZL5 A;  1PL1 A;  3D4M A;  2O3E A;  2BJX A;  2C0D A;  2NBS A;  4N0V A;  3FZ9 A;  2UZ8 A;  5CP1 A;  3C73 A;  1JZO A;  3GIX A;  6GSW A;  1X0R A;  3ZFB A;  2HFD A;  1SK1 A;  4BVX A;  3VPQ A;  4GLT A;  1KEB A;  3I6A A;  2IL3 A;  4YAP A;  3IOS A;  1FG4 A;  4TR4 A;  1JZR A;  1TU8 A;  1M9B A;  2DC5 A;  5GZZ B;  4K2D A;  5CRD A;  1NSW A;  4MJC A;  2HSM B;  2YV9 A;  1PA3 A;  2WRT A;  1Q4J A;  2VL2 C;  1GUL A;  1XOA A;  5J9C A;  5ECP B;  4IGJ A;  2IMI A;  6GST A;  1U88 A;  2DIZ A;  5A5K A;  5L71 A;  4RQX A;  3UVH A;  2VOC A;  4ML1 A;  3DXB A;  4X43 A;  4TXO B;  2F9S A;  1ERV A;  3L4N A;  2PER A;  1XBS A;  1SJ6 A;  5HFG A;  4Z2T A;  1O6J A;  5KOW A;  2H1D A;  2KP2 A;  1ST9 A;  2HYX A;  1MDK A;  4NV2 A;  1JLV A;  3GST A;  2YV7 A;  4EL1 A;  2A4H A;  3GRX A;  5B6N A;  1J0F A;  6GSS A;  3LXZ A;  4WBJ A;  4KAE A;  1W89 A;  1ERW A;  5GAN D;  1QUW A;  4KCE A;  3RHB A;  4BPY A;  4I97 A;  1K0O A;  5IMZ A;  3ZRD A;  3GTU B;  4DVC A;  3U5R E;  2R0C A;  4CW9 A;  5BRT A;  4F9Z A;  1G7E A;  3TUE A;  4LA1 A;  4DSS A;  4ZL8 A;  2RLI A;  2WCI A;  3ZYW A;  2WFC A;  3ZVJ D;  2LQO A;  18GS A;  4L5L A;  1XWC A;  3GHA A;  17GS A;  2H6X A;  1IYI A;  1M2A A;  5F8B A;  1G6W A;  3O3T A;  5AN1 A;  1TTZ A;  1G7O A;  2TRC P;  5D73 A;  2V32 A;  2R0G A;  4IQ1 A;  1FO5 A;  2MMZ A;  5J5N A;  4L8E A;  3KCM A;  1WP0 A;  1RW1 A;  4IP1 A;  1ACV A;  2N5A A;  4PGT A;  3W6G A;  1V40 A;  4TW5 A;  5FWG A;  4TXV A;  2HSH A;  4ZIJ A;  1XWB A;  3EIN A;  3W8S A;  19GS A;  2V2G A;  1S4B P;  2F51 A;  1OE7 A;  2DJK A;  4Q5Q A;  3C1R A;  5B8A A;  4EXJ A;  5JWQ B;  3ERF A;  3UOM A;  2L59 A;  1EZK A;  5EVO A;  2TRX A;  5AGY A;  1TI3 A;  3HZ4 A;  1YEP A;  1XIY A;  3J7Y k;  4D73 A;  1XWG A;  3OR5 A;  1JHB A;  3TKS E;  1T3B A;  4XS4 B;  5A1N B;  3D5J A;  2E2G A;  4ISD A;  1K0B A;  5DDL A;  2B7J A;  5IMV A;  3HMJ G;  2GQK A;  1A0F A;  2QC7 A;  3V1W A;  4IVF A;  1VGL A;  3HYP A;  3TJG A;  1TXU A;  3NOF A;  2MBS A;  1I1I P;  4MJA A;  2O89 A;  1YF1 A;  1DE1 A;  3LGC A;  3KGK A;  1YKC A;  3TOU A;  5ECI B;  3MIX A;  4HJ2 A;  3QR6 A;  5D9T A;  2PU9 C;  3H1N A;  5DAK A;  4Z7X A;  5CRW A;  2JZT A;  5JWO B;  3Q6O A;  2WVX B;  1Z6N A;  5DCH A;  1EV4 A;  1RQM A;  1SL0 B;  4N0Z A;  3HY2 A;  5G30 A;  2H70 A;  2GGT A;  1HNA A;  3EMX A;  1A2M A;  5D8I A;  4KDU A;  1C72 A;  1V57 A;  1T00 A;  3IA1 A;  2EIR A;  3P7X A;  5KN0 A;  3QPM A;  1GL8 A;  2GQL A;  3IHQ A;  3VUR A;  1THO A;  2YP6 A;  4KSO A;  1Q98 A;  1KTE A;  5J47 A;  3KH7 A;  4G01 A;  2OE1 A;  1K0N A;  3M9J A;  4I2T A;  3GKX A;  4KDX A;  2O36 A;  5HFK A;  2X64 A;  2H0H A;  2L57 A;  1HYU A;  5LNK e;  3IHG A;  4HS1 A;  2VLV A;  2X49 A;  4PNF A;  1J08 A;  1SYX A;  2IN3 A;  3BBY A;  4IEL A;  2HLS A;  5F05 A;  3TB2 A;  3L9V A;  2MMA A;  4V2N A;  2JSZ A;  5F0G A;  5IOX A;  1WPI A;  2GST A;  3GL3 A;  2HXK A;  1GP1 A;  3DRN A;  4QL9 A;  1TXX A;  2HI7 A;  4K5S A;  3WGD A;  4GXZ A;  2NTO A;  5J41 A;  4J56 E;  1NHO A;  4POM A;  1JLW A;  2JZS A;  2R6K A;  1A0R P;  1ZYE A;  2YWM A;  1PKZ A;  3ERW A;  1THX A;  4GF0 A;  1PRX A;  3KH9 A;  4NXI A;  4AKG A;  3ZML A;  2AYT A;  4I2U A;  1TRW A;  4L0U A;  5HR0 A;  1V9W A;  1YVL A;  3WD6 A;  2VM2 A;  1JZW A;  2MZC A;  4AKI A;  8GSS A;  2JU5 A;  2XBI A;  4F03 A;  2O87 A;  3A2V A;  1ON4 A;  4V1A p;  3F6F A;  3CSI A;  1CQH A;  4NWY A;  2JSY A;  4NPB A;  2F8A A;  4MCU A;  3QFA C;  5ECS A;  4PTS A;  4KE3 A;  2HRN A;  5ECN B;  1FOV A;  3HD5 A;  3ZLP A;  2PVO C;  2WVY A;  3I9V 2;  2IJY A;  2VL2 A;  4H86 A;  1Y6E A;  2EFC A;  2YWO A;  3VWW A;  1SKR B;  2FLS A;  2AAW A;  1M99 A;  3ZRE A;  3CXG A;  4JRR A;  2IFQ A;  1Z7P A;  4CY8 A;  1B48 A;  1AAZ A;  1XVW A;  2DJ0 A;  2LQQ A;  1T4Z A;  1YEW C;  2DKI A;  2KOK A;  4O7H A;  4PXO A;  5LCZ A;  2GQM A;  2L6C A;  1OAZ A;  1S3C A;  4Q5R A;  3IC4 A;  3QMX A;  4O5U A;  3TRP A;  4V2L A;  2OBK A;  4HOJ A;  3M0F A;  3G7I A;  4TR1 B;  3A2X A;  1VRS D;  3HCZ A;  2IME A;  2WUL A;  1ZGN A;  2H30 A;  3HVX A;  20GS A;  1F3A A;  2R5G A;  4K8M A;  3QAV A;  2YZU A;  3P2A A;  1SK2 A;  1BG1 A;  2YN1 A;  3F6D A;  4PI2 C;  2HSN B;  1WRY A;  3RFR C;  4K1F A;  4TVE A;  3HVV A;  3IPZ A;  2B1L A;  2H76 A;  4KF9 A;  3BCK A;  4Q5N A;  3UAR A;  2AV4 A;  5INY A;  1Z3E A;  3LSZ A;  2J9H A;  3TOT A;  1ZMA A;  3EUR A;  4ACS A;  4ECC A;  4YQV A;  5HR2 A;  1VF2 A;  2DJ1 A;  1U87 A;  3FR3 A;  3PGT A;  3UAP A;  2OE0 A;  4TKY A;  1KBN A;  1XVQ A;  3MSZ A;  2DSA A;  2H0G A;  4GWR A;  1NHY A;  2HRK A;  4I5Q A;  3F9U A;  4ZB6 A;  4YQU A;  3EWL A;  5E59 A;  5IMA A;  1QMV A;  2VM1 A;  4TRX A;  3VK9 A;  1RK4 A;  4F0B A;  1SJZ A;  2E0Q A;  2YCD A;  2ON7 A;  4L5O A;  2DBC A;  1TRS A;  2WB9 A;  1O7U A;  2HZF A;  1YDK A;  1A8L A;  2VD0 A;  4ZB7 A;  4EO3 A;  4KSM A;  1Y25 A;  4ZB9 A;  1HNB A;  1TK0 B;  4WET A;  3GH9 A;  3MWH A;  1NW2 A;  1O8W A;  2FY6 A;  4BL7 B;  3H79 A;  3KZQ A;  5IO2 A;  4BVY B;  1OE8 A;  1GSY A;  2FHE A;  3M8N A;  3EU4 A;  2CVK A;  1YY7 A;  2VD1 A;  4E68 A;  5KN2 A;  1SVO A;  3TCO A;  1AQV A;  3HJP A;  1GLP A;  4FH8 A;  3ZIJ A;  5ID2 A;  4LMW A;  4IJI A;  3M3M A;  3CRT A;  2YAN A;  2EC4 A;  3H4K A;  2X8H A;  3UVT A;  4MF5 A;  2HZE B;  2X8C A;  3IK9 A;  3DYR A;  4FQU A;  3IE3 A;  1XW5 A;  2V6K A;  2P0G A;  4KUN A;  1GNW A;  3GFK A;  1N2A A;  1GTA A;  1EOH A;  3MDK A;  4YQM A;  2MYG A;  5KN3 A;  2G0F A;  3FHK A;  1O8X A;  1OC9 B;  4GQF A;  2GZY A;  4E8H A;  1SL2 B;  5GST A;  2XPD A;  1SVL A;  4ECB A;  2J23 A;  1TK8 B;  1A24 A;  1OC3 A;  1B9X C;  1XWK A;  1Z7R A;  1K3Y A;  2E2M A;  2R0P A;  2HT9 A;  5H5S A;  4K0N A;  4EVM A;  2WJU A;  5DVB A;  4FYU A;  3ZTL A;  2GS3 A;  1XW9 A;  1AXD A;  4PX1 A;  3IAM 2;  2RUF A;  4AGS A;  1T1V A;  2YWI A;  5CO3 A;  2VL9 A;  2BTO T;  5B6M A;  2PPT A;  5BMU A;  9GSS A;  5JCU A;  1T7P B;  5IPH A;  2WZ9 A;  1T4Y A;  22GS A;  6GSX A;  3CMI A;  4TOP A;  5CYY A;  4X1U A;  5GAP D;  4USS A;  5D96 A;  3S9F A;  3LFL A;  4KW6 A;  5G5F A;  5ABR A;  1GTU A;  4PNG A;  2B5X A;  4L0W A;  3QAW A;  3LYP A;  2DML A;  4QL7 A;  3O76 A;  2B3S A;  1EGR A;  3TKS C;  1GTB A;  1A2L A;  3WGE A;  5AIV A;  5J40 A;  1WWJ A;  3ERG A;  2H19 A;  4XIH A;  1IYH A;  2FWH A;  3HZ8 A;  2DJJ A;  3Q19 A;  2LS5 A;  4KX4 A;  5KEJ A;  2DMM A;  2KUC A;  3EE2 A;  2FWG A;  4F2I A;  1OKT A;  2DKH A;  3CSJ A;  3D6I A;  4DSR A;  2QA2 A;  4CY6 A;  3RDW A;  1U3I A;  5KOX A;  2GT5 A;  4KB3 A;  5HR1 A;  1I9D A;  2L5L A;  3A2W A;  4WXT A;  5DJL A;  1SD9 A;  2VCX A;  3GX8 A;  1N25 A;  1EGO A;  4PUA A;  2GZP A;  2ZNM A;  1PL2 A;  3HHV A;  3I43 A;  4IP6 A;  3E0U A;  3FW2 A;  2B1K A;  4TXO A;  3DKS A;  4AJ7 A;  3DD3 A;  4A5P A;  2CZ3 A;  2C4J A;  4FIW A;  4ZL7 A;  4DSQ A;  4TR0 A;  1K0A A;  4MNN A;  2C80 A;  2PMT A;  2RII A;  1GWC A;  1FVJ A;  1G0T A;  4ML6 A;  5JCW A;  1XPV A;  3N5O A;  3LYK A;  3M1G A;  4W66 A;  3F63 A;  4HUA A;  1NM3 A;  2P31 A;  4HDE A;  3KTB A;  2G2Q A;  3H93 A;  3PR8 A;  4MZW A;  3F8U A;  5CRG A;  1BAY A;  1Z6M A;  2L5O A;  4G0L A;  4PI0 C;  1EEM A;  1JFU A;  2FA4 A;  4QMK A;  5IPG A;  3GTU A;  4PUF C;  2QKE A;  1HNC A;  2H1A A;  3TGZ A;  4JZQ A;  4MP4 A;  4PQH A;  4F0C A;  4GDF A;  3TJK A;  3HDC A;  1K0D A;  4V1A g;  4N3Z A;  5C04 A;  2VCZ A;  3DIE A;  1F9M A;  1F3B A;  1TP9 A;  4NAX A;  16GS A;  4ECI A;  5IM9 A;  2C3T A;  5A4V A;  1K3L A;  3F3Q A;  1PX7 A;  3ME7 A;  2H0I A;  4MJB A;  3KEB A;  4MF7 A;  1BYE A;  2ALB A;  2RM5 A;  2LKU A;  4HZ4 A;  5FHI A;  3GYK A;  2BMX A;  3VI7 A;  3DVX A;  2H6Z A;  4JR4 A;  3LQ7 A;  2I3Y A;  2A2P A;  5DJM A;  2CVB A;  3IDV A;  3US3 A;  3KIJ A;  3FZA A;  2XBQ A;  5IMF A;  4O92 A;  2H6Y A;  1WOU A;  1E6B A;  3GSS A;  2LNS A;  4EF0 A;  2HSY A;  4ZB8 A;  2LST A;  1MD3 A;  3F4T A;  1TK5 B;  3ME8 A;  2K18 A;  4N11 A;  2L4C A;  2WVZ A;  2YWN A;  1WJK A;  1K3O A;  2CAQ A;  1OVN A;  1WMJ A;  2R2J A;  2A2S A;  1I5G A;  2DIY A;  4HQZ A;  4G10 A;  3EMP A;  4XCS A;  1QGV A;  5A1N A;  5ECK B;  3GNJ A;  3ZIT A;  1ERT A;  2A4V A;  4O5Q A;  2LRT A;  2H72 A;  4PHZ C;  2O7K A;  2FWE A;  1AUC A;  2OE3 A;  4QQ7 A;  11GS A;  4J57 E;  5CRE A;  5D93 A;  2H1B A;  5G5E A;  2NDO A;  1MDI A;  4IHU A;  4K7O A;  1SU9 A;  2VO4 A;  2NVL A;  3CQF A;  1FW1 A;  4YKG A;  5DAL B;  4EIP A;  4AKH A;  1PKW A;  3CHX C;  4AJ8 A;  1M9A A;  2VCT A;  2MBT A;  5IOW A;  1ZCP A;  1S3A A;  3K8N A;  3CBU A;  1EEJ A;  2OA7 A;  5D9V A;  2CX3 A;  2VCQ A;  1EP8 A;  1V2A A;  4WBR D;  5D9X A;  2A2R A;  4G19 A;  4GCI A;  4JR6 A;  1TJD A;  2PUK C;  1GSE A;  3HKR A;  5HR3 A;  4MH2 A;  2IMD A;  4ULX A;  2C3Q A;  2R3X A;  3GUS A;  3FEU A;  4OMV A;  4OCF A;  2FGX A;  1WE0 A;  1Z9H A;  4IBP A;  3CRU A;  2H1L A;  2AHE A;  2VAF A;  6GSU A;  2CA8 A;  2I4A A;  2JAD A;  2KP1 A;  5JWR B;  1N8J A;  3VWV A;  12GS A;  5FT3 A;  1FAA A;  4WR4 A;  2RUE A;  1BF5 A;  2X8G A;  3LW9 A;  3Q18 A;  3FR9 A;  2HRK B;  1TKD B;  3DVW A;  3CYN A;  2ZCT A;  1ZYP A;  1UN2 A;  5ECM B;  1QK8 A;  3HJM A;  3TKQ A;  2WS2 A;  2AJQ B;  2MMO A;  2HE3 A;  3CWG A;  2EIQ A;  4WKW A;  3LWA A;  4TN8 A;  1ML6 A;  5ECO B;  3AY8 A;  3GMF A;  5IIZ A;  1GUM A;  4OO4 A;  3O6T A;  1XW6 A;  3FK8 A;  1A23 A;  5ECH B;  1M0U A;  4RI7 A;  4MJE A;  3TJB A;  2PGT A;  4JED A;  3F4S A;  1YQ1 A;  2WW3 A;  4O32 A;  2CAI A;  2LV3 A;  2QA1 A;  3FZ5 A;  4HQS A;  3EC3 A;  4FXY P;  4OFM A;  4YKF A;  4KCA A;  2XC2 A;  3HVN A;  2FNO A;  1M3I A;  2YNX A;  1OKD A;  1O81 A;  3TDG A;  3QDN A;  10GS A;  4NHZ A;  1X5D A;  3E9J B;  3KP9 A;  3P8W A;  4RI6 A;  4AJ6 A;  1FHE A;  1F37 A;  2B5E A;  1TI1 A;  2FCH A;  3JCM L;  3BJ5 A;  1EV9 A;  1M7T A;  1DSB A;  4IKH A;  4K0G A;  5IO0 A;  4BWS A;  4MDC A;  3ZZX A;  1AW9 A;  3VLN A;  2GT6 A;  3EYT A;  2PWJ A;  1YKA A;  4BVX B;  2IMK A;  5DQS A;  4LLR A;  2VKZ G;  2LJA A;  4F82 A;  1T8E B;  4MPG A;  3UL3 A;  4G2E A;  4TR1 A;  2O85 A;  1ZL9 A;  2YPM A;  1X9S B;  1X9M B;  3TU3 B;  3DML A;  5ENU A;  5CRH A;  5J9B A;  1VF4 A;  1B9Y C;  4N10 A;  2GSS A;  3APQ A;  2O5V A;  2HSN A;  2AB6 A;  2CQ9 A;  3LJR A;  3R3E A;  4OWY A;  4GSS A;  2IWT A;  3A3T A;  2H1G A;  5G1L A;  3IRA A;  2GSR A;  1SEN A;  1V58 A;  3RPP A;  3IBH A;  2C0E A;  4EC0 A;  2B5Y A;  4ZBB A;  4OO5 A;  3D4T A;  3F4R A;  1UC7 A;  2N5B A;  2HNL A;  4XRA A;  5B7C A;  2LJR A;  2GSQ A;  1PSQ A;  1A8Y A;  4POL A;  3HJO A;  4HU7 A;  1PN0 A;  3IAS 2;  4FYC A;  2F3M A;  4EDZ A;  1K0C A;  4ECJ A;  2YOI A;  1TOF A;  3EVI A;  2C0G A;  4MZC A;  4OFN A;  6GSV A;  2I1U A;  2EIO A;  1AC1 A;  2V1M A;  4MMM A;  5A34 A;  2OT3 A;  3BD2 A;  2OAC A;  1XCC A;  4CHS A;  1XWA A;  3UEM A;  1SD8 A;  1DBY A;  1FB6 A;  5LD0 A;  4ZIL A;  3L0H A;  4DSS B;  3W8J A;  1TU7 A;  3GN3 A;  2LJK A;  2CZ2 A;  4WR5 A;  4G9H A;  4MK3 A;  4ICY A;  4LL1 B;  2M72 A;  4K5R A;  4EIQ A;  2IMF A;  3GH6 A;  4BL7 A;  1SL1 B;  4PQ1 A;  2HRF A;  2R37 A;  5A5H A;  4BVY A;  5EPF A;  3BOA A;  3QFB C;  3H8Q A;  3QCP A;  4Q5F A;  5F06 A;  3E3E A;  1M3J A;  4K7I A;  4GTU A;  4HJM A;  4NMU A;  1XFL A;  2DJ3 A;  4EDY A;  1R7H A;  4XTS A;  3KJY A;  4LMV A;  3TJF A;  2H73 A;  2HZE A;  1HQO A;  1TW9 A;  3C7M A;  1YZX A;  1Y1U A;  2L4Q A;  2JL4 A;  4MA9 A;  4JE1 A;  3UJ1 A;  1DE2 A;  3NIV A;  3UBL A;  2DJ2 A;  2V6O A;  6GSY A;  2X4A A;  5ECQ B;  1AIU A;  4E8E A;  3APS A;  5HQP A;  4Z2R A;  1OC9 A;  1OYJ A;  2KHP A;  3FZ4 A;  2HSM A;  1GH2 A;  1VF3 A;  3KM6 A;  1HD2 A;  4D73 B;  2TIR A;  4J2F A;  5F07 A;  3FRC A;  4K9Z A;  1R5P A;  2YJH A;  4G0I A;  2ZUP A;  4OD7 A;  4WF4 A;  5H5R A;  3ISO A;  4P3Y B;  3CTF A;  1PX6 A;  1ERU A;  3IR4 A;  1MEK A;  1QQ2 A;  1O73 A;  1EWX A;  4POB A;  1GUH A;  1R5A A;  3L78 A;  3F0I A;  2D2Z A;  2M46 A;  1PFO A;  3U6V A;  2VCV A;  1E2Y A;  2JAC A;  1ZOF A;  5DAK B;  7GSS A;  1M2B A;  2C3N A;  3HXS A;  3ZIV A;  4CDO A;  4MH3 A;  4ZXG A;  3GV1 A;  2XPE A;  4EUY A;  3LOR A;  2EFD A;  3TRQ A;  2QSI A;  1LU4 A;  3FY7 A;  2K9F A;  1F2E A;  4WEY A;  5EY6 A;  3VWU A;  5ELA A;  4HSC X;  1PMT A;  1GSQ A;  4KND A;  2FUG 2;  4RQR A;  3QOU A;  2Z9S A;  2PBJ A;  1W4V A;  1A2J A;  3ED3 A;  3EPT A;  1XOB A;  1BED A;  1H4O A;  3EU3 A;  2GVP A;  4V2M A;  4XS6 A;  5A4U A;  1EOG A;  3I69 A;  4KH7 A;  4IJ3 A;  4G0K A;  3GUR A;  3G7Y A;  1H75 A;  4X4J A;  1FOH A;  4HU9 A;  2X99 A;  3C8E A;  4MAB A;  1YEX A;  4OCE A;  3ZMK A;  3DEX A;  1QFN A;  2IIY A;  5B8B A;  3Q74 A;  1YF0 A;  3RPN A;  4PQI A;  2L6D A;  1S3D A;  2P5R A;  5IMD A;  2CX4 A;  3APO A;  5AIX A;  1VF1 A;  5A4W A;  4ZL9 A;  2E7P A;  3TKP A;  1ZZY A;  1R26 A;  3N9J A;  3QD9 A;  4MLY A;  2VL3 A;  3F3R A;  2VLU A;  3IC8 A;  2K8V A;  3DWV A;  1GNE A;  3WT1 A;  5J3R A;  3VFI A;  2F8F A;  3G9B A;  14GS A;  3GKM A;  2YJ7 A;  3GA4 A;  3FR6 A;  2H71 A;  3GL5 A;  3KMN A;  1PGT A;  2HQT A;  1FVK A;  1BJX A;  1GSS A;  1OC8 A;  3GX0 A;  4OFT A;  1ABA A;  2OKA A;  2M80 A;  1ZYQ B;  2CVD A;  2HRA A;  5ELG A;  2OBI A;  4XS4 A;  1YJ6 A;  5G2Z A;  1UVZ A;  1U3A A;  1BG5 A;  1SK0 A;  2RM6 A;  1UA5 A;  4MF6 A;  2H74 A;  2K8S A;  2LNT A;  3LG6 A;  1EP7 A;  2WGR A;  2PVQ A;  5ECL B;  3TJJ A;  1X9W B;  3VWX A;  4RUV A; 
#chains in the Genus database with same CATH homology
 1G6Y A;  1GRX A;  3ZFL A;  2IFQ B;  3MAK A;  2JZR A;  2H8L A;  3R2Q A;  4I6X A;  2C0F A;  3QAG A;  5HFI A;  3UBK A;  2UV8 G;  1DUG A;  3LXT A;  2FWF A;  1PN9 A;  4IS0 A;  3SBC A;  2CV4 A;  2GLR A;  1JZD A;  3KMO A;  5H5Q A;  1PQN A;  3PPU A;  2ON5 A;  3WYW A;  4YAV A;  1AQW A;  4O5R A;  4BWQ A;  5DCG A;  3PIN A;  1PD2 1;  2XHF A;  3A5I A;  5CAX A;  3GKK A;  3MNG A;  4GQC A;  3UMA A;  1GSU A;  2FA8 A;  1TRV A;  2ES7 A;  3WT2 A;  2K6V A;  3L9S A;  3RBT A;  1O85 A;  3KD0 A;  1LJR A;  4Z2U A;  5COH A;  4PUR A;  1M2D A;  4K2X A;  5C00 A;  3FMW A;  2QGV A;  2LUS A;  3C1S A;  4ZBA A;  2NPB A;  3C71 A;  2P5Q A;  2LRC A;  2LTK A;  3KTL A;  1GSD A;  5E4W A;  3FYG A;  4ILF A;  4IQA A;  2EFH A;  5J4U A;  4EKZ A;  2WDU A;  2DLX A;  2YZH A;  1SJI A;  2V41 A;  1J9B A;  3LEF A;  4JBB A;  2VIM A;  4MPF A;  3IV4 A;  3PH9 A;  2R4V A;  4KGI A;  3BCI A;  2GTU A;  5JCG A;  3IXR A;  5J4Y A;  4IN0 A;  3HVS A;  1X5C A;  1MTC A;  5DAL A;  2B6M A;  5CNW A;  4XRD A;  1XXU A;  2IPA A;  3GKN A;  4HZ2 A;  4HEA 2;  4WF5 A;  2O8V B;  1F6M C;  2LEG A;  4MZB A;  4NHW A;  3RAZ A;  1SKW B;  4KA0 A;  2I9H A;  4GST A;  4ZBD A;  1XZO A;  5AIS A;  3TKS A;  3DGQ A;  2PN8 A;  4AF2 A;  3SWL A;  4TR3 A;  2VCW A;  4GSN A;  2H75 A;  2GZZ A;  2EFE A;  1TRU A;  4FO5 A;  1SYR A;  3HA9 A;  1K0M A;  1KNG A;  1LBK A;  5ID2 B;  2LRN A;  4FYB A;  1BQ7 A;  1CQG A;  3D21 A;  2OAD A;  3CTG A;  5IMC A;  5IQY A;  4K7N A;  4HI7 A;  1GLQ A;  3ZVJ A;  5J4V A;  4K6X A;  2FD3 A;  1R4W A;  2OJL A;  1B4Q A;  2H66 A;  4I8B A;  1QXH A;  1MDJ A;  2N5F A;  4KDY A;  5G31 A;  2VLT A;  5A34 B;  4LL4 B;  4XS1 A;  4IW9 A;  1U6T A;  1TDI A;  5DBQ A;  13GS A;  2B7K A;  2KLX A;  4POK A;  1X5E A;  3TRX A;  4JU5 A;  3M9K A;  5GSS A;  3A5W A;  3L9U A;  4DEJ A;  3J7Y b;  5ECR B;  4EE0 A;  3D22 A;  4BA7 A;  1FB0 A;  3MYD A;  3VI5 A;  3VPT A;  1USB A;  2C8U A;  1MD4 A;  3NZN A;  2CT6 A;  4GRF A;  3UIW A;  1WIK A;  5G1K A;  1URM A;  5D9W A;  3P90 A;  5A5H B;  1GSF A;  4XHM A;  3D0Z A;  3FKF A;  5EL8 A;  2C1Y A;  3TKR A;  1AQX A;  3KXO A;  1ZYN A;  1B4P A;  3IK7 A;  3RHC A;  4AKX B;  2GDR A;  1BX9 A;  4X0X A;  1Z5Y E;  5BMU B;  1V98 A;  4N30 A;  1SVM A;  2REM A;  2I81 A;  1GUK A;  1SKS B;  5DQY A;  2VUP A;  2MMN A;  1ILO A;  4NV5 A;  1GTI A;  2H01 A;  4ID0 A;  5KN1 A;  1B8X A;  4YH2 A;  3G7J A;  3WGX A;  2AUV A;  4AI6 A;  3CSH A;  3KP8 A;  3ZL5 A;  1PL1 A;  3D4M A;  2BJX A;  2C0D A;  2NBS A;  4N0V A;  3FZ9 A;  2UZ8 A;  5CP1 A;  3C73 A;  1JZO A;  3GIX A;  6GSW A;  1X0R A;  3ZFB A;  2HFD A;  1SK1 A;  4BVX A;  3VPQ A;  4GLT A;  1KEB A;  3I6A A;  2IL3 A;  4YAP A;  3IOS A;  1FG4 A;  4TR4 A;  1JZR A;  1TU8 A;  1M9B A;  2DC5 A;  5GZZ B;  4K2D A;  5CRD A;  1NSW A;  4MJC A;  2HSM B;  2YV9 A;  1PA3 A;  2WRT A;  1Q4J A;  2VL2 C;  1GUL A;  1XOA A;  5J9C A;  5ECP B;  4IGJ A;  2IMI A;  6GST A;  1U88 A;  2DIZ A;  5A5K A;  5L71 A;  4RQX A;  3UVH A;  2VOC A;  4ML1 A;  3DXB A;  4X43 A;  4TXO B;  2F9S A;  1ERV A;  3L4N A;  2PER A;  1XBS A;  1SJ6 A;  5HFG A;  4Z2T A;  1O6J A;  5KOW A;  2H1D A;  2KP2 A;  1ST9 A;  2HYX A;  1MDK A;  4NV2 A;  1JLV A;  3GST A;  2YV7 A;  4EL1 A;  2A4H A;  3GRX A;  5B6N A;  1J0F A;  6GSS A;  3LXZ A;  4WBJ A;  4KAE A;  1W89 A;  1ERW A;  5GAN D;  1QUW A;  4KCE A;  3RHB A;  4BPY A;  4I97 A;  1K0O A;  5IMZ A;  3ZRD A;  3GTU B;  4DVC A;  3U5R E;  2R0C A;  4CW9 A;  5BRT A;  4F9Z A;  1G7E A;  3TUE A;  4LA1 A;  4DSS A;  4ZL8 A;  2RLI A;  2WCI A;  3ZYW A;  2WFC A;  3ZVJ D;  2LQO A;  18GS A;  4L5L A;  1XWC A;  3GHA A;  17GS A;  2H6X A;  1IYI A;  1M2A A;  5F8B A;  1G6W A;  3O3T A;  5AN1 A;  1TTZ A;  1G7O A;  2TRC P;  5D73 A;  2V32 A;  2R0G A;  4IQ1 A;  1FO5 A;  2MMZ A;  5J5N A;  4L8E A;  3KCM A;  1WP0 A;  1RW1 A;  4IP1 A;  1ACV A;  2N5A A;  4PGT A;  3W6G A;  1V40 A;  4TW5 A;  5FWG A;  4TXV A;  2HSH A;  4ZIJ A;  1XWB A;  3EIN A;  3W8S A;  19GS A;  2V2G A;  2F51 A;  1OE7 A;  2DJK A;  4Q5Q A;  3C1R A;  5B8A A;  4EXJ A;  5JWQ B;  3ERF A;  3UOM A;  2L59 A;  1EZK A;  5EVO A;  2TRX A;  5AGY A;  1TI3 A;  3HZ4 A;  1YEP A;  1XIY A;  3J7Y k;  4D73 A;  1XWG A;  3OR5 A;  1JHB A;  3TKS E;  1T3B A;  4XS4 B;  5A1N B;  3D5J A;  2E2G A;  4ISD A;  1K0B A;  5DDL A;  2B7J A;  5IMV A;  3HMJ G;  2GQK A;  1A0F A;  2QC7 A;  3V1W A;  4IVF A;  1VGL A;  3HYP A;  3TJG A;  1TXU A;  3NOF A;  2MBS A;  4MJA A;  2O89 A;  1YF1 A;  1DE1 A;  3LGC A;  3KGK A;  1YKC A;  3TOU A;  5ECI B;  3MIX A;  4HJ2 A;  3QR6 A;  5D9T A;  2PU9 C;  3H1N A;  5DAK A;  4Z7X A;  5CRW A;  2JZT A;  5JWO B;  3Q6O A;  1Z6N A;  5DCH A;  1EV4 A;  1RQM A;  1SL0 B;  4N0Z A;  3HY2 A;  5G30 A;  2H70 A;  2GGT A;  1HNA A;  3EMX A;  1A2M A;  5D8I A;  4KDU A;  1C72 A;  1V57 A;  1T00 A;  3IA1 A;  2EIR A;  3P7X A;  5KN0 A;  3QPM A;  1GL8 A;  2GQL A;  3IHQ A;  3VUR A;  1THO A;  2YP6 A;  4KSO A;  1Q98 A;  1KTE A;  5J47 A;  3KH7 A;  4G01 A;  2OE1 A;  1K0N A;  3M9J A;  4I2T A;  3GKX A;  4KDX A;  5HFK A;  2X64 A;  2H0H A;  2L57 A;  1HYU A;  5LNK e;  3IHG A;  4HS1 A;  2VLV A;  2X49 A;  4PNF A;  1J08 A;  1SYX A;  2IN3 A;  3BBY A;  4IEL A;  2HLS A;  5F05 A;  3TB2 A;  3L9V A;  2MMA A;  4V2N A;  2JSZ A;  5F0G A;  5IOX A;  1WPI A;  2GST A;  3GL3 A;  2HXK A;  1GP1 A;  3DRN A;  4QL9 A;  1TXX A;  2HI7 A;  4K5S A;  3WGD A;  4GXZ A;  2NTO A;  5J41 A;  4J56 E;  1NHO A;  4POM A;  1JLW A;  2JZS A;  2R6K A;  1A0R P;  1ZYE A;  2YWM A;  1PKZ A;  3ERW A;  1THX A;  4GF0 A;  1PRX A;  3KH9 A;  4NXI A;  4AKG A;  3ZML A;  2AYT A;  4I2U A;  1TRW A;  4L0U A;  5HR0 A;  1V9W A;  1YVL A;  3WD6 A;  2VM2 A;  1JZW A;  2MZC A;  4AKI A;  8GSS A;  2JU5 A;  2XBI A;  4F03 A;  2O87 A;  3A2V A;  1ON4 A;  4V1A p;  3F6F A;  3CSI A;  1CQH A;  4NWY A;  2JSY A;  4NPB A;  2F8A A;  4MCU A;  3QFA C;  5ECS A;  4PTS A;  4KE3 A;  2HRN A;  5ECN B;  1FOV A;  3HD5 A;  3ZLP A;  2PVO C;  3I9V 2;  2IJY A;  2VL2 A;  4H86 A;  1Y6E A;  2EFC A;  2YWO A;  3VWW A;  1SKR B;  2FLS A;  2AAW A;  1M99 A;  3ZRE A;  3CXG A;  4JRR A;  2IFQ A;  1Z7P A;  4CY8 A;  1B48 A;  1AAZ A;  1XVW A;  2DJ0 A;  2LQQ A;  1T4Z A;  2DKI A;  2KOK A;  4O7H A;  4PXO A;  5LCZ A;  2GQM A;  2L6C A;  1OAZ A;  1S3C A;  4Q5R A;  3IC4 A;  3QMX A;  4O5U A;  3TRP A;  4V2L A;  2OBK A;  4HOJ A;  3M0F A;  3G7I A;  4TR1 B;  3A2X A;  1VRS D;  3HCZ A;  2IME A;  2WUL A;  1ZGN A;  2H30 A;  3HVX A;  20GS A;  1F3A A;  2R5G A;  4K8M A;  3QAV A;  2YZU A;  3P2A A;  1SK2 A;  1BG1 A;  2YN1 A;  3F6D A;  2HSN B;  1WRY A;  4K1F A;  4TVE A;  3HVV A;  3IPZ A;  2B1L A;  2H76 A;  4KF9 A;  3BCK A;  4Q5N A;  3UAR A;  2AV4 A;  5INY A;  1Z3E A;  3LSZ A;  2J9H A;  3TOT A;  1ZMA A;  3EUR A;  4ACS A;  4ECC A;  4YQV A;  5HR2 A;  1VF2 A;  2DJ1 A;  1U87 A;  3FR3 A;  3PGT A;  3UAP A;  2OE0 A;  4TKY A;  1KBN A;  1XVQ A;  3MSZ A;  2DSA A;  2H0G A;  4GWR A;  1NHY A;  2HRK A;  4I5Q A;  3F9U A;  4ZB6 A;  4YQU A;  3EWL A;  5E59 A;  5IMA A;  1QMV A;  2VM1 A;  4TRX A;  3VK9 A;  1RK4 A;  4F0B A;  1SJZ A;  2E0Q A;  2YCD A;  2ON7 A;  4L5O A;  2DBC A;  1TRS A;  2WB9 A;  1O7U A;  2HZF A;  1YDK A;  1A8L A;  2VD0 A;  4ZB7 A;  4EO3 A;  4KSM A;  1Y25 A;  4ZB9 A;  1HNB A;  1TK0 B;  4WET A;  3GH9 A;  3MWH A;  1NW2 A;  1O8W A;  2FY6 A;  4BL7 B;  3H79 A;  3KZQ A;  5IO2 A;  4BVY B;  1OE8 A;  1GSY A;  2FHE A;  3M8N A;  3EU4 A;  2CVK A;  1YY7 A;  2VD1 A;  4E68 A;  5KN2 A;  1SVO A;  3TCO A;  1AQV A;  3HJP A;  1GLP A;  4FH8 A;  3ZIJ A;  5ID2 A;  4LMW A;  4IJI A;  3M3M A;  3CRT A;  2YAN A;  2EC4 A;  3H4K A;  2X8H A;  3UVT A;  4MF5 A;  2HZE B;  2X8C A;  3IK9 A;  3DYR A;  4FQU A;  3IE3 A;  1XW5 A;  2V6K A;  2P0G A;  4KUN A;  1GNW A;  3GFK A;  1N2A A;  1GTA A;  1EOH A;  3MDK A;  4YQM A;  2MYG A;  5KN3 A;  2G0F A;  3FHK A;  1O8X A;  1OC9 B;  4GQF A;  2GZY A;  4E8H A;  1SL2 B;  5GST A;  2XPD A;  1SVL A;  4ECB A;  2J23 A;  1TK8 B;  1A24 A;  1OC3 A;  1B9X C;  1XWK A;  1Z7R A;  1K3Y A;  2E2M A;  2R0P A;  2HT9 A;  5H5S A;  4K0N A;  4EVM A;  2WJU A;  5DVB A;  4FYU A;  3ZTL A;  2GS3 A;  1XW9 A;  1AXD A;  4PX1 A;  3IAM 2;  2RUF A;  4AGS A;  1T1V A;  2YWI A;  5CO3 A;  2VL9 A;  2BTO T;  5B6M A;  2PPT A;  5BMU A;  9GSS A;  5JCU A;  1T7P B;  5IPH A;  2WZ9 A;  1T4Y A;  22GS A;  6GSX A;  3CMI A;  4TOP A;  5CYY A;  4X1U A;  5GAP D;  4USS A;  5D96 A;  3S9F A;  3LFL A;  4KW6 A;  5G5F A;  5ABR A;  1GTU A;  4PNG A;  2B5X A;  4L0W A;  3QAW A;  3LYP A;  2DML A;  4QL7 A;  3O76 A;  2B3S A;  1EGR A;  3TKS C;  1GTB A;  1A2L A;  3WGE A;  5AIV A;  5J40 A;  1WWJ A;  3ERG A;  2H19 A;  4XIH A;  1IYH A;  2FWH A;  3HZ8 A;  2DJJ A;  3Q19 A;  2LS5 A;  4KX4 A;  5KEJ A;  2DMM A;  2KUC A;  3EE2 A;  2FWG A;  4F2I A;  1OKT A;  2DKH A;  3CSJ A;  3D6I A;  4DSR A;  2QA2 A;  4CY6 A;  3RDW A;  1U3I A;  5KOX A;  2GT5 A;  4KB3 A;  5HR1 A;  1I9D A;  2L5L A;  3A2W A;  4WXT A;  5DJL A;  1SD9 A;  2VCX A;  3GX8 A;  1N25 A;  1EGO A;  4PUA A;  2GZP A;  2ZNM A;  1PL2 A;  3HHV A;  3I43 A;  4IP6 A;  3E0U A;  3FW2 A;  2B1K A;  4TXO A;  3DKS A;  4AJ7 A;  3DD3 A;  4A5P A;  2CZ3 A;  2C4J A;  4FIW A;  4ZL7 A;  4DSQ A;  4TR0 A;  1K0A A;  4MNN A;  2C80 A;  2PMT A;  2RII A;  1GWC A;  1FVJ A;  1G0T A;  4ML6 A;  5JCW A;  1XPV A;  3N5O A;  3LYK A;  3M1G A;  4W66 A;  3F63 A;  4HUA A;  1NM3 A;  2P31 A;  4HDE A;  3KTB A;  2G2Q A;  3H93 A;  3PR8 A;  4MZW A;  3F8U A;  5CRG A;  1BAY A;  1Z6M A;  2L5O A;  4G0L A;  1EEM A;  1JFU A;  2FA4 A;  4QMK A;  5IPG A;  3GTU A;  4PUF C;  2QKE A;  1HNC A;  2H1A A;  3TGZ A;  4JZQ A;  4MP4 A;  4PQH A;  4F0C A;  4GDF A;  3TJK A;  3HDC A;  1K0D A;  4V1A g;  4N3Z A;  5C04 A;  2VCZ A;  3DIE A;  1F9M A;  1F3B A;  1TP9 A;  4NAX A;  16GS A;  4ECI A;  5IM9 A;  2C3T A;  5A4V A;  1K3L A;  3F3Q A;  1PX7 A;  3ME7 A;  2H0I A;  4MJB A;  3KEB A;  4MF7 A;  1BYE A;  2ALB A;  2RM5 A;  2LKU A;  4HZ4 A;  5FHI A;  3GYK A;  2BMX A;  3VI7 A;  3DVX A;  2H6Z A;  4JR4 A;  3LQ7 A;  2I3Y A;  2A2P A;  5DJM A;  2CVB A;  3IDV A;  3US3 A;  3KIJ A;  3FZA A;  2XBQ A;  5IMF A;  4O92 A;  2H6Y A;  1WOU A;  1E6B A;  3GSS A;  2LNS A;  4EF0 A;  2HSY A;  4ZB8 A;  2LST A;  1MD3 A;  3F4T A;  1TK5 B;  3ME8 A;  2K18 A;  4N11 A;  2L4C A;  2YWN A;  1WJK A;  1K3O A;  2CAQ A;  1OVN A;  1WMJ A;  2R2J A;  2A2S A;  1I5G A;  2DIY A;  4HQZ A;  4G10 A;  3EMP A;  4XCS A;  1QGV A;  5A1N A;  5ECK B;  3GNJ A;  3ZIT A;  1ERT A;  2A4V A;  4O5Q A;  2LRT A;  2H72 A;  2O7K A;  2FWE A;  1AUC A;  2OE3 A;  4QQ7 A;  11GS A;  4J57 E;  5CRE A;  5D93 A;  2H1B A;  5G5E A;  2NDO A;  1MDI A;  4IHU A;  4K7O A;  1SU9 A;  2VO4 A;  2NVL A;  1FW1 A;  4YKG A;  5DAL B;  4EIP A;  4AKH A;  1PKW A;  4AJ8 A;  1M9A A;  2VCT A;  2MBT A;  5IOW A;  1ZCP A;  1S3A A;  3K8N A;  3CBU A;  1EEJ A;  2OA7 A;  5D9V A;  2CX3 A;  2VCQ A;  1EP8 A;  1V2A A;  4WBR D;  5D9X A;  2A2R A;  4G19 A;  4GCI A;  4JR6 A;  1TJD A;  2PUK C;  1GSE A;  3HKR A;  5HR3 A;  4MH2 A;  2IMD A;  4ULX A;  2C3Q A;  2R3X A;  3GUS A;  3FEU A;  4OMV A;  4OCF A;  2FGX A;  1WE0 A;  1Z9H A;  4IBP A;  3CRU A;  2H1L A;  2AHE A;  2VAF A;  6GSU A;  2CA8 A;  2I4A A;  2JAD A;  2KP1 A;  5JWR B;  1N8J A;  3VWV A;  12GS A;  5FT3 A;  1FAA A;  4WR4 A;  2RUE A;  1BF5 A;  2X8G A;  3LW9 A;  3Q18 A;  3FR9 A;  2HRK B;  1TKD B;  3DVW A;  3CYN A;  2ZCT A;  1ZYP A;  1UN2 A;  5ECM B;  1QK8 A;  3HJM A;  3TKQ A;  2WS2 A;  2AJQ B;  2MMO A;  2HE3 A;  3CWG A;  2EIQ A;  4WKW A;  3LWA A;  4TN8 A;  1ML6 A;  5ECO B;  3AY8 A;  3GMF A;  5IIZ A;  1GUM A;  4OO4 A;  3O6T A;  1XW6 A;  3FK8 A;  1A23 A;  5ECH B;  1M0U A;  4RI7 A;  4MJE A;  3TJB A;  2PGT A;  4JED A;  3F4S A;  1YQ1 A;  4O32 A;  2CAI A;  2LV3 A;  2QA1 A;  3FZ5 A;  4HQS A;  3EC3 A;  4OFM A;  4YKF A;  4KCA A;  2XC2 A;  2FNO A;  2YNX A;  1OKD A;  1O81 A;  3TDG A;  3QDN A;  10GS A;  4NHZ A;  1X5D A;  3E9J B;  3KP9 A;  3P8W A;  4RI6 A;  4AJ6 A;  1FHE A;  1F37 A;  2B5E A;  1TI1 A;  2FCH A;  3JCM L;  3BJ5 A;  1EV9 A;  1M7T A;  1DSB A;  4IKH A;  4K0G A;  5IO0 A;  4BWS A;  4MDC A;  3ZZX A;  1AW9 A;  3VLN A;  2GT6 A;  3EYT A;  2PWJ A;  1YKA A;  4BVX B;  2IMK A;  5DQS A;  4LLR A;  2VKZ G;  2LJA A;  4F82 A;  1T8E B;  4MPG A;  3UL3 A;  4G2E A;  4TR1 A;  2O85 A;  1ZL9 A;  2YPM A;  1X9S B;  1X9M B;  3TU3 B;  3DML A;  5ENU A;  5CRH A;  5J9B A;  1VF4 A;  1B9Y C;  4N10 A;  2GSS A;  3APQ A;  2O5V A;  2HSN A;  2AB6 A;  2CQ9 A;  3LJR A;  3R3E A;  4OWY A;  4GSS A;  2IWT A;  3A3T A;  2H1G A;  5G1L A;  3IRA A;  2GSR A;  1SEN A;  1V58 A;  3RPP A;  3IBH A;  2C0E A;  4EC0 A;  2B5Y A;  4ZBB A;  4OO5 A;  3D4T A;  3F4R A;  1UC7 A;  2N5B A;  2HNL A;  4XRA A;  5B7C A;  2LJR A;  2GSQ A;  1PSQ A;  1A8Y A;  4POL A;  3HJO A;  4HU7 A;  1PN0 A;  3IAS 2;  4FYC A;  2F3M A;  4EDZ A;  1K0C A;  4ECJ A;  2YOI A;  1TOF A;  3EVI A;  2C0G A;  4MZC A;  4OFN A;  6GSV A;  2I1U A;  2EIO A;  1AC1 A;  2V1M A;  4MMM A;  5A34 A;  2OT3 A;  3BD2 A;  2OAC A;  1XCC A;  4CHS A;  1XWA A;  3UEM A;  1SD8 A;  1DBY A;  1FB6 A;  5LD0 A;  4ZIL A;  3L0H A;  4DSS B;  3W8J A;  1TU7 A;  3GN3 A;  2LJK A;  2CZ2 A;  4WR5 A;  4G9H A;  4MK3 A;  4ICY A;  4LL1 B;  2M72 A;  4K5R A;  4EIQ A;  2IMF A;  3GH6 A;  4BL7 A;  1SL1 B;  4PQ1 A;  2HRF A;  2R37 A;  5A5H A;  4BVY A;  5EPF A;  3BOA A;  3QFB C;  3H8Q A;  3QCP A;  4Q5F A;  5F06 A;  3E3E A;  4K7I A;  4GTU A;  4HJM A;  4NMU A;  1XFL A;  2DJ3 A;  4EDY A;  1R7H A;  4XTS A;  3KJY A;  4LMV A;  3TJF A;  2H73 A;  2HZE A;  1HQO A;  1TW9 A;  3C7M A;  1YZX A;  1Y1U A;  2L4Q A;  2JL4 A;  4MA9 A;  4JE1 A;  3UJ1 A;  1DE2 A;  3NIV A;  3UBL A;  2DJ2 A;  2V6O A;  6GSY A;  2X4A A;  5ECQ B;  1AIU A;  4E8E A;  3APS A;  5HQP A;  4Z2R A;  1OC9 A;  1OYJ A;  2KHP A;  3FZ4 A;  2HSM A;  1GH2 A;  1VF3 A;  3KM6 A;  1HD2 A;  4D73 B;  2TIR A;  4J2F A;  5F07 A;  3FRC A;  4K9Z A;  1R5P A;  2YJH A;  4G0I A;  2ZUP A;  4OD7 A;  4WF4 A;  5H5R A;  3ISO A;  4P3Y B;  3CTF A;  1PX6 A;  1ERU A;  3IR4 A;  1MEK A;  1QQ2 A;  1O73 A;  1EWX A;  4POB A;  1GUH A;  1R5A A;  3L78 A;  3F0I A;  2D2Z A;  2M46 A;  3U6V A;  2VCV A;  1E2Y A;  2JAC A;  1ZOF A;  5DAK B;  7GSS A;  1M2B A;  2C3N A;  3HXS A;  3ZIV A;  4CDO A;  4MH3 A;  4ZXG A;  3GV1 A;  2XPE A;  4EUY A;  3LOR A;  2EFD A;  3TRQ A;  2QSI A;  1LU4 A;  3FY7 A;  2K9F A;  1F2E A;  4WEY A;  5EY6 A;  3VWU A;  5ELA A;  1PMT A;  1GSQ A;  4KND A;  2FUG 2;  4RQR A;  3QOU A;  2Z9S A;  2PBJ A;  1W4V A;  1A2J A;  3ED3 A;  3EPT A;  1XOB A;  1BED A;  1H4O A;  3EU3 A;  2GVP A;  4V2M A;  4XS6 A;  5A4U A;  1EOG A;  3I69 A;  4KH7 A;  4IJ3 A;  4G0K A;  3GUR A;  3G7Y A;  1H75 A;  4X4J A;  1FOH A;  4HU9 A;  2X99 A;  3C8E A;  4MAB A;  1YEX A;  4OCE A;  3ZMK A;  3DEX A;  1QFN A;  2IIY A;  5B8B A;  3Q74 A;  1YF0 A;  3RPN A;  4PQI A;  2L6D A;  1S3D A;  2P5R A;  5IMD A;  2CX4 A;  3APO A;  5AIX A;  1VF1 A;  5A4W A;  4ZL9 A;  2E7P A;  3TKP A;  1ZZY A;  1R26 A;  3N9J A;  3QD9 A;  4MLY A;  2VL3 A;  3F3R A;  2VLU A;  3IC8 A;  2K8V A;  3DWV A;  1GNE A;  3WT1 A;  5J3R A;  3VFI A;  2F8F A;  3G9B A;  14GS A;  3GKM A;  2YJ7 A;  3GA4 A;  3FR6 A;  2H71 A;  3GL5 A;  3KMN A;  1PGT A;  2HQT A;  1FVK A;  1BJX A;  1GSS A;  1OC8 A;  3GX0 A;  4OFT A;  1ABA A;  2OKA A;  2M80 A;  1ZYQ B;  2CVD A;  2HRA A;  5ELG A;  2OBI A;  4XS4 A;  1YJ6 A;  5G2Z A;  1UVZ A;  1U3A A;  1BG5 A;  1SK0 A;  2RM6 A;  1UA5 A;  4MF6 A;  2H74 A;  2K8S A;  2LNT A;  3LG6 A;  1EP7 A;  2WGR A;  2PVQ A;  5ECL B;  3TJJ A;  1X9W B;  3VWX A;  4RUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...