4RIFA

Landomycin glycosyltransferase langt2, carbasugar substrate complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
379
structure length
370
Chain Sequence
b'MKILFVASGSPATVFALAPLATAARNAGHDVFMGAVEDMVPYIASAGIPALSIAPSSIRRYATMDREGEEELDFAGHWFGRMAAGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVPYVRQAWDTGDAWRTDPAASDELRPELRALGLDRLPDPALFVDICPPSLRPATAPPAQMMRWVPANGQRRLEPWMYTKGNRPRILVTSGSRLVFAKKTGFLRGLVADMAALDAEVVIATLDEVAEELRTELPGVRAGWVPLDVVVPTCDVVVHHAGGVTALTAMNAGVPQLIVPQGGNFVEAGLRISDFGAAITVDENTPEAVEKACGELIGNPSYAERARELSAEIAALPLPAEVVGALEGLVENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl transferase homolog
publication title Structural Characterization of O- and C-Glycosylating Variants of the Landomycin Glycosyltransferase LanGT2.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Transferase
total genus 118
structure length 370
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06722 DUF1205 Protein of unknown function (DUF1205)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4rifA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4rifA02
2WTXA 2X0DA 2IUYA 4EKYA 3L01A 3PE4A 2F3UA 3TSAA 3RSZA 3BD7A 4FZRA 3OTHA 1UZUA 3C4VA 1PNVA 4RIHA 1SXPA 2FETA 3OY7A 4GZ6A 2X0EA 3L7DA 2IV3A 4RENA 1L5RA 3ZCVA 3DD1A 1L5QA 4Z5XA 2XA1A 1FC0A 1LWNA 4RIIA 7GPBA 4N3AA 4X7PA 4KQ1A 4REMA 1Y6GA 3GPBA 3OTGA 1NVKA 4N3CA 2C1ZA 1UQTA 2VSYA 3G2KA 4N3BA 4FKZA 4MICA 4M7PA 2VG8A 2IW1A 1L5VA 5DU2A 3MRVA 2FFRA 3ZCSA 3D0RA 1ABBA 1WUTA 5HXAA 1NOKA 3VUFA 4LDPA 1P4GA 3RT1A 4HWGA 2GM9A 2ACWA 3L7BA 5IKOA 2JZCA 8GPBA 3C48A 4PQGA 1Z62A 3RHZA 2GEJA 2QN1A 2F3SA 5ENZA 1JEJA 1NOIA 2GPNA 4MI3A 1JG7A 1L5WA 2ATIA 4AN4A 3MT7A 3OKPA 3HBJA 2AZDA 1P2BA 3EBOA 3MTDA 4WADA 3NCHA 1J39A 3L7AA 4W6QA 1SXQA 3OT5A 3ZCQA 3Q3IA 4LEIA 2GPBA 3CUYA 2R60A 3MTAA 4EKEA 1Z8DA 4BFCA 3Q3HA 2ACVA 2PQ6A 2Q6VA 3CEMA 3BEOA 3OY2A 1XKXA 2PRIA 1L5SA 1FTYA 4RIGA 1GG8A 3CEHA 1L6IA 3O3CA 2QN8A 2G9QA 3NP7A 4YI5A 3WADA 4CTOA 1Y6FA 3HBMA 3CUVA 3MS7A 3T7DA 1XOIA 3QKWA 1C8KA 1EM6A 2BFWA 9GPBA 4AMGA 1XL0A 5JTTA 3T3IA 1PYGA 2X0FA 2VSNA 3HBFA 2SKEA 4MHSA 2HY7A 2BGUA 3MTBA 1YGPA 1AHPA 2QLNA 1P4JA 1WUYA 1FA9A 2AW3A 1M5RA 1C50A 3MSCA 1XL1A 2F9FA 2P6PA 3MS2A 2R4TA 2IYFA 4MRAA 1P2DA 1IIRA 2SKCA 3L79A 3GUHA 1LWOA 4X6LA 3OKCA 4AY6A 5I45A 2QNBA 4M60A 1PN3A 4AY5A 5IKPA 4EL0A 2R66A 3H4IA 3ZCPA 4AMBA 2IEIA 1GPAA 4EL5A 2OFFA 4MHOA 2GPAA 4RIFA 1F0KA 1C8LA 4N9WA 3D1JA 1RZVA 1WW3A 4CDRA 3G2IA 1H5UA 2GEKA 1YA6A 3BDAA 3NPAA 3SYRA 2C4MA 5JTUA 3VDMA 1Z6PA 1WW2A 2QRMA 5GPBA 4XIFA 3DDWA 2X6RA 4F97A 3G2HA 2GJ4A 3G2NA 2GT1A 1JIUA 3MRTA 2YJNA 3MS4A 2VCEA 3S27A 2IV7A 4HLNA 1FU8A 2F3QA 3T3HA 1FU7A 2QN7A 1GFZA 1NOJA 4RELA 4RBNA 3RSCA 3ZCRA 3H4TA 2C1XA 3T3DA 2XGMA 3CX4A 2ECPA 4XI9A 3Q3EA 1AXRA 2AMVA 2R68A 1FTWA 2AV6A 4NESA 2O6LA 2XA9A 3TAXA 4G2TA 1P29A 4YI3A 3MBOA 2QRHA 1XV5A 2XCIA 3WAGA 3MQFA 4CTNA 5BNWA 2KS6A 1O6CA 4MI9A 3UYKA 2QN9A 4X7MA 1NZFA 1VGVA 2JJMA 3T3EA 2IEGA 3HBNA 4QLBA 2BGTA 2QN2A 1HLFA 1FTQA 1Z6QA 1C3JA 1NZDA 3MT8A 3BCUA 5C1DA 3FROA 2PRJA 5D01A 2QLMA 3S0JA 3NAZA 5LQDA 1L7XA 1P2GA 1IXYA 2QRQA 2X6QA 1BX3A 3BD6A 1F6DA 3S29A 1JIVA 1XC7A 3E3OA 4GYYA 4RIEA 1NLMA 3E3NA 5TMEA 4WACA 2G9RA 3DZCA 3BCSA 3IAAA 1A8IA 1P4HA 3SYMA 3COPA 2XA2A 1EXVA 1WV1A 2VCHA 3BCRA 3AMVA 1JIXA 1GPBA 2XCUA 3OTIA 1JG6A 2QZSA 4GPBA 3WC4A 4BQIA 2QLLA 2QN3A 1QM5A 4NEQA 2IYAA 1K08A 4M83A 3UYLA 2G9VA 3T5TA 1KTIA 1B4DA 1QKJA 2SKDA 2XGSA 3MT9A 3CV3A 4F9FA 3T3GA 3S2UA 3ZCUA 2ASVA 5DXFA 2QRPA 5TVGA 3NP9A 1E4OA 3DDSA 4NC9A 5D00A 1GZ5A 5TMBA 2F3PA 2H1FA 4MI6A 3ZCTA 3G2LA 2QRGA 4CTMA 1PSWA 1V4VA 4KQ2A 3VUEA 4YUAA 2XMPA 3QHPA 3CUWA 1GPYA 1GGNA 4WHMA 1FS4A 2G9UA 1RZUA 3BD8A 1Y8ZA 3NC4A 3PE3A 2PYIA 2H1HA 5TMDA 3C4QA 3TOVA 4BQFA 3IA7A 1FU4A 1WV0A 2PYDA 2R4UA 2FF5A 4KQMA 3D0QA 4N39A 3VDNB 4EJ2A 5DLDA 4F96A 3E3LA 3EBPA 3NB0A 3CUTA 3MRXA 1RRVA 4X7RA 4GZ5A 2BISA 1K06A 3G2JA 1E1YA 4GYWA 4GZ3A 2XGOA 3S28A 3CUUA 2C9ZA 4BQEA 6GPBA 3L7CA 3CEJA 1UQUA 3OKAA 4L22A 2JLBA 2ZB2A
chains in the Genus database with same CATH superfamily
2OYCA 3VAZA 1QZTA 3G02A 3QHQA 5AK0A 3WRWA 3NXKA 2EP7A 1B8OA 1FDSA 2GAFA 2VRNA 1YOBA 4GI5A 3BMQA 4L0MA 1T9AA 1NHGA 1DEHA 1J8DA 1GUAA 1Y4UA 2J3EA 2P2GA 2RI1A 2ZTVA 3FPAA 1L7BA 4IIVA 4P53A 4F6CA 3BGVA 1KU6A 1XEFA 3AR7A 2YHIB 4EZIA 1YUNA 2GTIA 3D7RA 5IVIA 2AH5A 3OLXA 5GJBA 4KMOA 2VYND 3DZIA 4DUGD 2FP4A 1NP6A 4UHDA 2RIPA 3QWBA 1BHSA 1D4AA 4HMPA 5DTEA 5GY7A 2YQ5A 2L17A 5LP6B 2ECKA 2JFHA 1E3DA 5CNMA 5JFOA 3UJNA 2ZIGA 2PMEA 4EA8A 3TZLA 2XA1A 1TUBB 1XUOA 1PJRA 3DMGA 3TCXB 1YRQA 1FUUA 2I4MA 3COWA 3FNFA 4X6UA 5G1NA 3W79A 4KKVA 1PS8A 2ZFUA 3ET4A 1AKUA 1E3IA 4FE3A 4Y1RA 3T5PA 1GA6A 1K7SN 1U2PA 2R3SA 2WYVA 3V8MA 9LDTA 3RVJA 3L92A 3FFAA 1RRKA 3D4OA 2GNOA 1N5LA 3R24A 4LHXA 3ETJA 4MAFA 1Z0SA 1LU9A 5DX1A 2BL4A 2OE2A 4JKIA 1NT4A 5AOVA 3AEQB 2JIZD 3HDJA 1THZA 1WMFA 1B15A 1HGXA 3GR6A 3O9ZA 4P3XA 5DU2A 3K6KA 3U13A 4CLRA 1T2VA 1N1GA 1PD0A 1W85B 2HV9A 2H8KA 4JBGA 2CNDA 3ZZTA 3Q6NA 3SFVA 2R6FA 2JDID 4EY4A 3LW7A 4OPMA 1OT5A 3RT1A 3H84A 2C7OA 4KQJA 3CW9A 1LPMA 2ZTSA 3H04A 3UGKA 2ZUFA 1KO1A 1VI6A 4PLGA 2EQ5A 4RF4A 1ZM2A 1W73A 3DBLA 6CHYA 5CCBA 2V1UA 1CUUA 3FRHA 3OCWA 4ZVTA 3WA7A 2VQDA 4KQIA 3ZK9A 4PQGA 4MIOA 3QUQA 2Q1SA 2BMEA 4RA6A 1EUCA 2EAUA 4JVLA 4D9GA 4XIGS 1TDJA 3RVOA 2FRDC 3AIOA 4KGZA 4MI3A 1ECBA 2CJXA 3HU1A 3LHKA 3TTWA 2IF0A 3GVIA 2HK8A 3ID6C 5TS2A 1MJGA 3K9QO 4IJKA 1SIBE 4Q4DA 5SZKB 4A8TA 5L6MB 1RWMA 2LTAA 2CL5A 3RTAA 1RYMA 2Z56A 4C4XA 4HZUB 7MHTA 3HU2A 1GR1A 3F3SA 2H54A 4M1TA 3DV2A 1SA0B 1X3SA 2GVDC 3K8QA 4IQGA 1AZSC 4UUPA 3O31A 1XNRB 10MHA 3PB3A 1NQAO 2V55B 5U4XA 1UFKA 4HWOA 4O2BB 3S2GA 4RXUA 1FNSA 4KH1A 4HDSB 2NTVA 4YJ2B 1X7WA 1NIPA 3GLGB 4LYEA 5HF5A 5ESRA 3VMMA 3TEMA 3G0CA 1DKPA 4MS1A 4HQOA 4E08A 3U3OA 4ZI7F 3PFFA 1ZUNB 2I67A 2PX8A 2Q1WA 3LXRA 3QX8A 3NYRA 2QK4A 4FZ3A 4G1UC 2XT9A 5A4KA 5C35A 4TL8A 2VDRB 4W5TA 4KQWA 1GG8A 3O82A 4GGPA 3VM6A 1MBZA 2JFYA 3EEIA 3F8TA 3GDFA 4KE9A 5EZ5A 3GNTA 5C34B 4B6JA 4MW6A 4L08A 1OU4A 2JCGA 2EIHA 5HIAA 4KN9S 3WFIA 3EMDA 4JT9A 4RM2A 3NP7A 3JARB 3V80A 1NBOA 4BMDA 3QMPA 4BDTA 1B76A 1AUOA 2IP2A 5HK9A 5COBA 4EABA 1IY0A 5K8TA 1PFQA 5JANA 2JFVA 4IDHA 4AKHA 1WW8A 1JLMA 2IWHA 4G1MB 4LDZA 2HHAA 4FMPA 5JU6A 1NL3A 1U0NA 4O4LB 4II2A 1M2VB 5SY4A 3VHRA 1T2FA 1KO8A 4HS4A 4DV6B 2X2OA 2F1HA 1GKYA 5TY0A 3KZ1E 3DVLA 2FN4A 1BZYA 3R8XA 4GLFA 3JS5A 2GN8A 4J03A 1USIA 4DUYB 1J99A 3NTXA 3TZHA 2BM9A 4N5LA 5TQVA 3SHWA 4F38A 3WRXA 3R76A 4EGAA 4F86A 3RAGA 4C0JA 4CN8A 1TTTA 1U3DA 4IHJA 1E1LA 3TOXA 3WY9A 1HNWB 3SD7A 4ASUA 2H06A 1N3BA 3QMMA 3F4LA 5AJUA 4YP7A 4RTRA 4Q1AA 4JLKA 3ZQ6A 4E88A 4G1BA 1N5KA 2NSLA 4EUNA 3ZJVA 4OB7A 2JGDB 4RM3A 4H7IA 3BMXA 4YLGA 4U00A 5A0TA 3R40A 4V0QA 3LV8A 1XXHA 4P98A 5F4BA 3U4CA 3WGNA 1WCIA 1AHHA 1NA5A 2WMYA 4EJSA 1M5UA 4H0FA 2BSXA 2Y77A 3FM9A 4W1SA 1B16A 5ER9A 3ANNA 3B6MA 5A3VA 5DHTA 3VRHA 4LF6B 1XBTA 3ZHYA 2CFCA 2WFLA 4MEJA 4F5WA 4PX9A 1PKEA 5JBQA 4Q4JB 4ND1A 4D7AA 1Y4AE 2EWWA 1H3NA 2X4LA 2Y1KA 1OBFO 2A5FA 2C7BA 2WAYA 2WTBA 3JALB 4A8PA 1O87A 3KYDA 1CE8A 5ANRB 4AZSA 4E7OA 4RD3A 4YT4A 3V8VA 1LTKA 2Y99A 3AX6A 3I9KA 3OM8A 4MVWA 3JSXA 1U9JA 4I4TA 1HE4A 1UDRA 4EL5A 1NXPA 4BFSA 4MHOA 4UVDA 3K2QA 1H1TA 4ARZA 4I19A 3WK8A 4EHHA 5C5DA 4XWGA 2EW2A 1WKBA 3GRZA 2W5UA 3EXEA 4F84A 3L07A 2XDAA 4GVPA 5JS7A 3I9OA 2PUGA 2G5TA 1GCIA 2QD3A 1PFVA 2PMKA 1KEVA 4KB5A 2LXNA 5AW2A 4LHVA 2HJVA 2IP1A 2I2CA 2IHZA 1AF4A 5DF1A 3KCNA 3TD6A 1JE0A 3FR7A 4DBVO 3T9CA 1ADBA 4K9KA 3MUOA 1XQYA 2FUKA 1GLGA 4IZIA 2HM7A 2EKQA 1ECLA 2J9RA 3BE6A 1EBFA 3DHNA 3O7MA 4DYVA 4G9EA 3RYFB 1J8MF 1C0EA 1F8FA 1M66A 2BZ0A 2GH1A 2HU2A 3F71A 3OT1A 3FSGA 5DBGA 4CM4B 4ZGGA 4OSOA 3C6BA 4HLNA 3KXDA 4M7RA 3MMXA 4KLCA 2VA9A 2QN7A 2AK2A 1UPAA 4HRXA 1CZRA 1RD4A 2C99A 1CUWA 2N1BA 2QU7A 3HCNA 3ITEA 4JN6B 2Q4BA 4U7DA 2QMQA 1GTMA 1A9YA 5AJXA 1GZSA 1MW8X 3LBFA 1O08A 3MUEA 4Q18A 2YN2A 4M49A 4W99A 1C0IA 4MS4A 2DR2A 5CB0A 2V7QA 1OCEA 1UIRA 1S6YA 1C30A 4TZ0A 3IBYA 2OEPA 3B89A 1MN6A 1VPTA 2HGSA 5KSZA 1NJ2A 2EFYA 4J0DA 2Q4TA 4O2BF 4URFA 1ZVVA 4P7KA 3QFFA 2VQ6A 4YJ2F 1I36A 1IEWA 2DQ4A 4BS9A 1G2PA 5JD4A 1G3QA 3A7DA 3CLRC 2OZEA 4RPIA 1HYEA 4AD8A 5JI2E 2VDWA 1XV5A 3T3PB 3DEJA 2R2GA 1MT0A 3Q5GA 1RMQA 2OGWA 4MRNA 2GD0A 3SZGA 4PWZA 5L4LA 4PNEA 4CTNA 2B7CA 2HZ7A 2I3GA 2AKYA 4FEGA 4PHTA 2O14A 4KR3A 2PE5A 2CXXA 4R9UC 5AKKA 2BKAA 2ILVA 1NZFA 2WY2D 1ZNXA 1X9HA 3B53X 3M89A 3P32A 1XEWY 1X8JA 1Z5WA 3Q8WA 4FJ1A 5GV7A 4BB0A 4B3MB 1TPZA 1JR6A 2GDZA 1ISMA 2FYTA 4DWWA 4U8GA 5C1BA 5TRTA 1C7JA 4DBLE 1W19A 3I9LA 4PSCA 1TLTA 1TCVA 3ETHA 3VVCA 4Q4AA 5AH0A 2MYUA 3QU9A 2QYOA 2XEDA 4QAJA 3UNXA 3UUGA 1S3FA 1TFRA 1JFFB 2PS1A 3UT0A 5DNYB 1T2EA 5CT4A 4YRQA 1EGAA 5D01A 4PLZA 1IZZA 4TL7A 1JSRA 3IVRA 1OI3A 3VR0A 2CFRA 3TLGB 2G04A 5E6RA 1U31A 1B43A 3S0JA 3NAZA 1L7XA 1EUDB 1QIMA 2G07A 4Q19A 3X1ZA 3MXTA 4PF1A 2QYSA 1DIGA 3KVOA 3ZR4B 4ZTUB 3PENA 3I0MA 1IBLB 3AM1A 5HE8A 1XCBA 3RG2A 4KQCA 1A77A 3QPUA 3EZ9A 1UPXA 4RKEA 4I9UA 1JALA 3F3MA 4MVXA 2H4ZA 3FYDA 1EFRA 2BBOA 1TQHA 4U7FA 1NLMA 3HK2A 4PSVA 5TMEA 1WEHA 2NUAA 4DWJA 3I37X 5IULC 2NUPA 3TOSA 1P4HA 2WUFA 4R3NA 3WBFA 1PK8A 2FE4A 3ORSA 2V7UA 3TQTA 3LHSA 1XZAA 1BD3A 2Q5QA 1UZLA 2VDJA 4PGHA 1NP3A 3TW8B 1U8UA 4JI0B 4M38A 3IDOA 2WM9B 1MAVA 4ZQIA 3OFSA 5F4ZA 3A05A 3BFPA 3LECA 4BBJA 2WJWA 3ABQB 1LVGA 2NZXA 3PL1A 1EG2A 4JVNA 2F3TA 5SY6A 3U3KA 2HMAA 1P75A 2ZJAA 2YRXA 1ESDA 4YDHB 3VAAA 1M2OB 2HLDA 1FRZA 2Y1OA 4Q3NA 3MNFA 5JADA 3I12A 3G9UA 5IAJA 5CDSA 2Y6UA 5CG1A 4QLAA 2RC5A 1KPGA 1UP7A 1X14A 3FGOA 5B1DA 3MJSA 3VNAA 4XRGA 1PFYA 4BNWA 1YZGA 1R4NB 3K1AB 5ECWA 4IVRA 2Y68A 3WC4A 3WOHA 3ZDCA 4CEJB 1T9GR 4GBJA 4LSMA 3ZS8A 1Y5MA 4C05A 4NQRA 4UTOA 3QXCA 3AC0A 3ZGYA 4KXYA 2GHRA 2VDLB 5ISMA 2CMHA 1IM5A 2G9VA 4IMRA 4QEKA 3S2SA 3RODA 2DOKA 2VRCA 1J21A 2X23A 4EI9A 1RSZA 4U7JA 3CR3C 3WKCA 2CDNA 2G8NA 2Z0MA 4TSFA 3EK2A 3GD7A 1IZ9A 2JHAA 4DDMA 1ZUIA 3NBQA 1TZKA 1ZJYA 3ET5A 4PCAA 1N2JA 1YI0A 2JNWA 1P9RA 1R4MB 2PANA 3BJMA 3EOAI 4KQGA 3ZK8A 4WLUA 3CLKA 4A6DA 1AMNA 1LDBA 3ENQA 4OV6B 2PSHA 4G81A 3OCJA 1A8QA 3V8RA 3D3JA 4AY2A 3SXUB 4LI0A 1ZD2P 2A0YA 1I4LD 1EM8B 3VOSA 3CEPB 4C87A 3NU1A 2JI7A 1WU7A 3KAQA 3F96A 4OLFA 3HB0A 4LWPA 2GMWA 1L1FA 1LKZA 2PZFA 5EP2A 2O3RA 5FB3A 1D9XA 5DWDA 1XRNA 1Y1LA 1Y3DE 3I6BA 4LW8A 1L4YA 3SYKA 4DDTA 3X2FA 4M53A 5EWLA 2AUNA 4KXWA 1ADCA 2WPNA 4ISCA 3UAGA 3AVVA 3QBTA 4XVHA 1E3LA 1PJCA 2QTMA 2B78A 3CVXA 4PYIA 1E59A 5J63A 4IYJA 3TLXA 2BMAA 3N2IA 1T1EA 2ETXA 4JU9A 4HAZA 2YS7A 5I7SA 4O2AB 1SG0A 3VJKA 3KZOA 3E48A 2B94A 3QW2A 4P4UA 2JHFA 2P2SA 5BXYA 3SIXA 1XD8A 2IE8A 1AMUA 4MYDA 1FPQA 4LJRA 3LUDA 2ZRCA 3OO1A 3WLHA 4G8JA 1CR4A 1LTQA 2QM8A 4YCBA 5TPZD 4DR2B 4A8HA 2P2CA 3QVUA 1NX9A 3SSNA 4ZAFA 3PI7A 1MC8A 2FF5A 1ADYA 3JCZA 4KQMA 4TT3D 4FYWA 4A2PA 2HSGA 1NKTA 4WASA 1LF0A 1U6IA 1L9XA 5DSTA 4LOKA 3CX8A 1PJAA 4C5AA 1CQIB 2JCSA 1R18A 2WTNA 4F04A 4L4SA 5LNK1 4NV3A 4MVYA 5DM70 2AIRA 4D74A 3TNDA 1YT5A 3C16C 4OH1A 1JTVA 1MX3A 4QPJC 1BEZA 1U5CA 1UXKA 3PCXA 4WBSA 4UAUA 5D1NA 4DEXA 2O59A 3ZU3A 3GIDA 3O94A 4Y67A 4EATA 2ZBGA 1C7RA 1U3CA 2JHCA 3HV2A 2RHCA 4CF7A 3EVBA 3U19A 4OHVA 1HORA 2I1LA 3O75A 4ZN6A 5BV1A 2HXSA 3AF5A 5JYBA 1OMOA 1S5PA 1PEKE 2PKQP 3EZYA 4UW9A 3RU2A 5FI0B 3DTVB 4RPHA 3KJEA 4WN9A 3RAEC 1TL7C 1ZX1A 3L7JA 1ZCJA 4G63A 4JQZA 2X4IA 4WFKA 2H4XA 1N5DA 5G0VA 2CNLA 3AESB 3B5IA 4S1WA 3WGQA 2P5YA 3G5TA 4PYQA 2PIAA 3DKIA 2GN6A 5HF9A 1P2UA 4ZT2A 5NULA 1CYDA 2ZB2A 2Y05A 4DY4A 4HADA 5SZHB 5JG7A 4CM5A 2ZXFA 3GW8A 2KB0A 4BTEA 5KYUA 1YJQA 4ISBA 3ZLTA 4JJAA 5TV2A 4B82A 2H59A 3TSAA 3NAGA 4D43A 1VE9A 3HZOA 3W5DA 1V71A 1A04A 2BELA 2P8JA 4KACA 4KXNA 1BA3A 1I8TA 1IEVA 4YDSA 5DTIA 3LK7A 2YZ7A 1D2HA 4BUJA 1Z8NA 2O3SA 4V1CI 3KK0A 2F8LA 1XKLA 2XCSB 3CNEA 4IJMA 2W6ID 3BHMA 3BIOA 5THXA 2O0JA 2QP9X 1HQDA 4FNOA 5HFJA 5GIPE 5EJ8A 1N0HA 2I76A 4JGBA 5DCWA 3ND6A 5KYVA 2AWOA 3HLYA 1B14A 1FSSA 3IPYA 1O6BA 3CZQA 1DAEA 4TKUB 3DBOB 2RGCA 3FWPA 4Z9AA 5BSMA 1UXJA 3SOZA 1E3SA 4RTOA 3GPBA 3NHKA 1PWYE 4I8DA 4TRMA 4YLYA 3BDIA 3TRDA 4UQPA 2YJZA 3C7DB 5HMMA 3QX7A 1T9BA 1RC1A 2SNIE 2V7WA 3JR7A 4G65A 1IQ0A 3AJAA 4M7OA 3WAJA 2AL7A 3ENVA 1UKZA 3L9WA 2AOTA 3BMOB 3E5NA 3I2FA 4MWGA 4MKIA 4MV4A 4MICA 4XJSA 1DTWA 1E4VA 4EHNA 3URMA 1WMSA 4D9HA 2IZZA 2YV4A 1PJ3A 3K4QA 3DONA 1QIFA 1QRAA 3MRVA 5J59A 4DA9A 4ZRNA 4EPVA 5KYTA 2ZRIA 3NMUF 1YCDA 1LUAA 2LCQA 2PKRA 1HDIA 2CDAA 1QHEA 4C0BA 3MLAA 4XQ0A 1M1YE 1SJ9A 2A88A 2Y1EA 3KUDA 3SMVA 4ND5A 1DG3A 3J7TA 4M0KA 1JLSA 4MDFA 2QMOA 1M6YA 4GP7A 5B1HA 5FBKA 1P6XA 1I2CA 2O8DB 1E79D 4NDNE 1JDTA 1AGPA 4JU8A 1Y8QB 1E61A 4UULA 1Y1SA 4G4IA 4A3SA 4ONEA 3AGQA 3JQ7B 3W5JA 3PUHA 2KI5A 2VXBA 2O57A 4A7PA 1KYIA 1N4DA 1A0OA 4C7MA 4BECA 3CS3A 2XWQA 4QXAA 1JP7A 3CO0S 3Q1LA 2BD0A 3RVBA 3V8QA 1JB9A 3IPRA 4WZAA 5CH8A 1D4FA 2QTFA 3N58A 2FU5C 3IPXA 3MIIA 4HKTA 3TZQA 3A32A 1ORRA 1TJ4A 1DC5A 3N0RA 4FDLA 4MMYB 5B1SA 4DDKA 4E09A 4BPBA 4FOPA 4HH1A 2HHCA 3AW9A 7REQA 3PT5A 3I05A 3N5KA 3T06B 1HOTA 3FNIA 3DPSA 4AAYA 1JXMA 3QQPA 1DTEA 1SUAA 3K9FC 2QN6A 4AWAA 3SEFA 3OT5A 2I4NA 1GR0A 2X8JA 3BMNA 1MPXA 1Q0UA 2GPBA 3FPCA 4AO6A 3ICPA 5LZ2A 5HUHA 4BLVA 3TO5A 5KNDD 1AM4D 1XZCA 3BCHA 4TYYA 3C3JA 3WQHA 1QGAA 1A2BA 4BBPA 4I9FA 2WVHA 3ZXIA 3MLEA 5HIKA 2ZYIA 1ZIDA 4WEQA 1NWCA 3DCNA 1XKXA 1Z4PX 3RYHB 1JTEA 2ZRFA 1UJ4A 1V7ZA 2RONA 5IASA 5JE8A 4F4JA 2WAOA 1A72A 4I5IA 1I80A 2NO5A 4CKXA 1M2GA 1N2BA 4H0CA 2PX2A 1KJWA 3GJ0A 1N6IA 4IIFA 1L6IA 1B41A 4X94A 2MTBA 3HCWA 1NNSA 1KJNA 2NTNA 3CN9A 3QJYA 3R3ZA 3SU8A 1H6DA 1G21B 1R0SA 1T6BY 1JA0A 1IUKA 1W44A 4PFKA 4ALNA 4UJ5A 5EJEA 1W94A 3W77A 2OP1A 3VPAA 2B2NA 1I0ZA 1Q14A 2HUNA 2ZIXA 2E4VA 4NENB 1E5XA 2QTAA 4J0GA 4PGGA 4U2DA 1SWVA 4LRXA 3TZCA 4EHDA 2BUAA 2ZIZA 4JITA 1BXRB 3NHYA 3WLNA 1KH3A 1LDYA 2OHGA 3EIOA 4L6CA 4P54A 5DISB 5AUOB 2A5GA 3JASA 3SNKA 4E2XA 4IG4A 4MV1A 1TIPA 2FR8A 1JDJA 3EGOA 2XB2A 1VXOA 2W6JD 3D6AA 4PW0A 4UDYX 5AKYA 3TQCA 1H0HA 1WY7A 4JUIA 4ZVVA 5JPCA 2CKDA 4L3VA 3SNHA 1GAJA 1AHNA 2BCGY 2AHOA 3F5SA 4MAAA 7MDHA 7ADHA 5LOVA 2ATEA 2O2CA 3JQBA 3KKMA 1N8KA 1Q1EA 3NHJA 4LQ4A 2VTEA 4MH0R 2HIHA 3HXQA 4G97A 4LMAA 5H0IA 1RI3A 2BEUB 4E30A 4FT2A 2DWUA 4QUBA 4B09A 1LPPA 4C78A 3FOAA 6ABPA 1Q22A 4DLXA 4RA9B 4Z4QA 1RU3A 2XNKA 4RK4A 3SR0A 1K6JA 3QKSA 4F4CA 1E9BA 3DUWA 1QYDA 3M5PA 1IN8A 5M3BA 1YC2A 3W06A 1VTKA 3B1VA 1FJGB 4RJLA 1G7RA 1VHDA 4INAA 4CCSA 4X66B 1QGOA 1QV7A 2A9PA 2A1UA 2VHYA 3WGJA 4UAGA 2QRNA 2GAJA 2UUOA 4PN3A 3TI7A 1M83A 1LRLA 2C5SA 1VL5A 3H0EA 2OBMA 1GPKA 2WIAA 1E92A 2P6UA 3OOHA 4WI1A 1SUBA 4X93A 4C30A 4Z7QB 4OXKA 3I8XA 1SK9A 5CA0F 4IIJA 3ANYB 2MCFA 4GYKA 5FPHA 4QRHA 3H5NA 4C2TA 4KQFA 2WD7B 5DBEX 4B80A 2CJYA 2IZ6A 4XX1A 2XMZA 2ADOA 2E4YA 3ACDA 4HD8A 4I50B 3QELA 2A5YB 3NV7A 2BP7A 3SF8A 3F47A 4QWWA 2FR0A 1L5HB 4HXFB 4FR0A 1ZK4A 4FM9A 4PG7A 5KWIA 4TX1A 5B37A 4DLSA 3V4VB 3IB3A 4AYTA 2IKSA 2VJCA 2YNMD 3AY6A 1ZH6A 4BKPA 2IIVA 1ULTA 4UHFA 5E4YA 4KE8A 4NNOA 1K0UA 1U2RA 5FHQA 3D1JA 1CEXA 1P3DA 1P8JA 4OUKX 1Q2XA 5K3FB 3JQEA 4IJ6A 3JWPA 1L1QA 3LXMA 1EAMA 2Y2VA 3IS3A 3QPAA 3F6YA 4GOOD 3BXOA 1LS1A 3IYLW 3TPZA 4DDUA 4OX9B 3O83A 3PXEA 1Z0KA 1ZMOA 1E2UA 4FX5A 4OQXA 1Z6PA 1B1CA 2YIDA 3KTAB 3RF7A 4EPRA 1NBHA 2Q6KA 3VDQA 4EAQA 1B23P 3O1LA 3C3AA 3QKIA 3TF5A 1J23A 1A1VA 1G4AE 3D9QX 3PYMA 1T3HA 2X15A 4I9GA 5DTJA 3ROEA 1PJTA 1GJRA 1GPJA 2CHUA 2PZLA 4B2PA 1E2JA 5AW5A 4EBBA 2QG4A 4BP8A 5JI3E 4QQNA 1Z37A 1U1CA 4ID3A 3U7QA 4A2QA 5GINE 1KQ3A 3ZQ4A 2UYCA 1QQ5A 3VTKA 2W2OA 3ICQB 2F3QA 1ZRMA 3F7TA 3EXHC 4KQEA 2IK8A 1CS0A 1W1UA 1CJCA 1GUFA 1W25A 2X3YA 4QXMA 4XD7D 4LYFA 3L0SA 2Z9CA 4XQEA 1Z0DA 4R7GA 1P72A 1LBIA 4C76A 3H4TA 2G40A 2RH9B 2XLCA 2D5IA 2ZUBA 3F0TA 2FFHA 3PA8A 4HN9A 3CU5A 2ZOSA 3CX4A 1D04A 3WB9A 1KMMA 9MHTA 3DJFA 4YR9A 3DFKA 3RJZA 2O8FB 1ISJA 4CFSA 1U7DA 4MNTA 3OQBA 4LC9A 4URWR 4YAWA 1FP1D 2PZKA 5B6JA 2I9KA 1XMQB 2CVHA 3NIFB 3X3HA 1PG2A 1QVZA 2REOA 1WDTA 5E7MA 4NP6A 4OFBA 5AM5A 3BEDA 4YNBA 1TO1E 4G56A 2RKOA 4MZXA 5CX1A 5FWDA 3WE7A 1R0CA 2R8XA 3MBOA 3P2IA 4ZOLB 1SUDA 3KQPA 3TBKA 2J85A 1GSOA 2FWJA 4CMGA 5IAGA 3E9MA 2F8TA 3A3NA 2YINC 4HEJA 4TYQA 1V7CA 4ZTBA 1RWWA 2Z2JA 5C18A 1TM7E 1WL8A 3N70A 4U6SA 5MFZA 2W6PA 3JPWA 4M1KA 4D5EA 1HRKA 4HEA6 4EVSA 4I2VA 1AKVA 5EP3A 4YRKA 2QN9A 2R9VA 3RNOA 1XU4A 5D7NA 3VU0A 1HL7A 1LFDB 2PA3A 2VTBA 2E4UA 3KQTA 4LZAA 5LCXA 4XYBA 4Z4EA 4R1PA 3IUYA 1CUSA 3LDUA 5JDCA 4JP2A 2PPVA 4AVYA 1VCNA 3C97A 5F5XA 1Q7TA 4FFMA 1TKAA 4MPTA 1NI4A 1VE5A 4CGZA 3RC3A 5P8WA 1M75A 1XO1A 4IBOA 3MHTA 1ZW6A 3MGCA 4R81A 3H75A 1FVHA 1N2XA 2PWZA 1UDAA 4KBGA 4LAFA 3SJUA 4B33A 1XCOA 4BFLA 2YXNA 5EHNA 4JYMA 2PGIA 5LQNA 4F12A 3EF1A 1IRXA 4MCJA 4EB8A 1H23A 3CXRA 4NBRA 3S99A 3GLRA 1KJIA 2EP8A 3FNBA 1IY2A 3QJ5A 3RFFA 3ZD6A 1XC7A 5HQTA 1YAHA 3UV6A 1RTKA 1YK1A 3ML1A 3OFNA 4MI1A 4V1CA 3N2LA 1MX1A 2O2EA 4HQ6A 4ZU6X 1ISGA 1SU8A 2C5AA 1SC9A 3SLGA 4QGSA 3QXHA 2D2XA 2J9XB 5J58A 2QE6A 4MINA 1VCOA 3VR4H 2BUBA 4EG7A 1I7QB 5JPDA 1M6VA 1TEXA 2JRLA 2Q0SA 3EY9A 1OLXA 4FYVA 4QOSA 4WACA 4DKXA 1MQ8B 1PV1A 4D9BA 3C1AA 1US8A 2VTDA 3DNPA 5BMVA 3BGOS 3SYMA 2NU6B 1EJ6A 1NW7A 4MWDA 4QQFA 5GOTA 3HN7A 2ZTUA 4DV4B 3FCUB 5HIIA 3EEFA 4DIUA 3FJOA 5ENVA 3LY5A 1T13A 5AJZA 2WYOA 4ML3A 2FW6A 1V5EA 2DECA 1CJKC 2WJAA 3WK4A 5LKAA 4JUDX 3SX0A 4BVLA 3EBLA 2YJTD 1GLVA 1MEJA 2BGKA 2G63A 4JBWA 4MV9A 1L8LA 3Q1KA 4RV5A 5IC5A 1Z28A 3FCYA 2ZVJA 3GLKA 4K40A 4I50F 2XQIA 3N5CA 4MUNA 1J0XO 2NSDA 1ACJA 3GNLA 5JJ5A 1PR5A 1MF7A 4A0RA 3O8NA 1FK8A 2XYVA 2C0CA 2IEYA 3JZFA 2JFFA 1NZJA 3FLEA 3I5YA 1C7FA 4X3CA 3TINA 2JAHA 5I9LA 2QAGA 4D9MA 5K8UA 5L53A 2ONKA 3PTAA 2IRWA 4PC2A 1HDZA 1DXHA 2OV4A 3L02A 5AKIA 2QSZA 2UXCB 1K08A 4PLTA 3OQIA 1ZJ6A 1DXQA 1O2DA 2WSSD 2AOUB 4GZLA 4MYHA 2JHGA 3ZTTA 3S8YA 3I62A 1RXSA 2NV6A 2ZKIA 4JLUA 2YHSA 4PVCA 4JYAB 4LNUA 4Q24A 4L5BA 1ESZA 1ISFA 1E1QD 2IOYA 4QFMA 3V8NA 2CXSA 3I2GA 1R0YA 4LE2A 3AVUA 1EDOA 1GKLA 2C03A 4XSHA 1NXOA 5H3HA 3ZHOA 3ZCUA 4CQLB 5CEFA 4G5GA 4UXHA 3CC8A 1OA1A 3A1EA 3C6XA 1JWBB 3HDVA 4OHPA 2E37A 2AFHE 4AF6A 1YDFA 3DDSA 1W5FA 2REXB 5B36A 5EMHA 2Z1MA 3DFFA 4O6VA 2DR0A 4H7PA 1YSCA 2PRZA 4OD0A 4ZVOA 5A5GA 1EDDA 3DVSX 4EKGA 1DU4A 1UT6A 2HWKA 1XZPA 2KBEA 3JQFA 2GASA 1QFSA 1T6XA 1VKRA 1ZNWA 2ZJFA 3PUYA 4MVJH 4Q3LA 4MI6A 5IBQA 2YMMA 1N3LA 1E6EA 4HDKB 3SQMA 1PSWA 3WTCA 1IZ0A 3FWKA 4C0AC 3BKWA 3G17A 1CRLA 4LGVA 4X1KA 5ALUA 3KYIB 1H2ZA 2F2TA 2XMPA 1J56A 1ZGHA 3BDVA 3IUSA 4P8RA 1G8GA 3AH8A 2F4NA 4O4HB 1QCYA 4JELA 1U1DA 1DJLA 3F97A 1DNPA 1GNSA 3OZGA 4NCKA 4NMWA 3T15A 4B3TB 2E0IA 4ZOLF 2J6HA 2P4UA 4I0WB 3EJWA 3NC4A 1QSGA 4GH5A 3GAAA 3P2OA 4LJLA 1L4GA 2JJ8A 3EYWA 3IRVA 2I62A 3V8BA 3QEMB 2R6CA 1S8OA 3ST7A 2VP4A 1KNQA 2RCNA 3INYA 5CT9A 3RF6A 4RTQA 1XMIA 4GW3A 2IPXA 3P96A 3VU9B 2M6SA 3V8EA 1JVSA 1R6AA 2RI6A 4CE6A 3IXMA 4AP5A 1NMXA 5TR9A 2J4DA 4OA5A 2IH4A 1QO0D 5DV9A 2ZRNA 1ADJA 4IEEA 1PTJA 1FFCA 4RDHA 2Q7XA 2R1ZA 4B2IA 5K3CA 2VAXA 1JPVA 3EMVA 4RJ2A 1XVAA 1QP0A 4LY0A 4XLLA 1GVHA 2QZ9A 5K7SA 3LQYA 1P1FA 4IEIA 1F38A 1FFXB 1U7TA 2J9GA 1BWPA 2WHQA 4HUJA 4YUWA 4W5QA 1PZEA 4MPDA 5BYBA 1YQWA 3IV7A 5HTOA 2EX1A 4R69A 4BMOB 1KKMA 1PR0A 1O5OA 3LO8A 2O7RA 1PEDA 2XQKA 3IAM6 3WKBA 4EH1A 5BNFA 3VDXA 2GHTA 5BNZA 2BLLA 5BWCA 2XGOA 3AZPA 3MAGA 2P3SA 4BWFB 4WZZA 3DT6A 3T1YB 3LWBA 1U5AA 1E5QA 2VCYA 4I6JA 5TF0A 1I9GA 1NMZA 3B3GA 3FMOB 4YJFA 3RIHA 3EWNA 4DR3B 2WJYA 4NBWA 1JQJC 2NTJA 4G24A 3V4RA 4P58A 5CPFA 2IS2A 1TLFA 2BPOA 2C9BA 4B3IA 2H8GA 3EG9A 4FDUA 1KI4A 3KL2A 3CEJA 1UQUA 2GUGA 3ZW7A 2BMJA 4PN7A 1W0KA 5AVXA 2NZYA 2GYUA 3PC8C 1Z47A 4REQB 3ITKA 2GD2A 3HU5A 4GZMA 5F12A 1CR2A 4ESEA 4CIYA 2IBMA 2FOXA 4DY6A 3PHIA 4CQJA 2YWEA 3EUAA 4OHKA 4V0ME 2VATA 4D4HA 5AW8A 2NAFA 3KSDO 4KTTE 4BLUA 1NE7A 3CNHA 5F1YA 3R4CA 4E5PA 4JJ4A 1C8BA 3GMIA 5AHWA 3C4VA 4HB2A 3CY6A 2A59A 3FB1A 4TWRA 1GA1A 1P0PA 3PUKA 4QOJA 3ADPA 5D51S 5CW1A 1N92A 5A71A 5C8YA 2WPDA 5JNRA 3WJ7A 3A11A 3EASA 3HCBA 1N6PA 2ZUSA 3MJFA 2IYWA 4JUFA 3RFVA 1I2BA 5JDIC 1ZAYA 3TMYA 3A3PA 1WHTA 2J5KA 2NO9A 4QD3A 4S1OA 4Z9XA 4OMFG 1RRGA 4BCBA 1WMAA 3HKDB 3UPDA 3JWGA 3RIEA 1VSVA 4I1IA 3CW2A 3ZY5A 3PFKA 4CKBB 1PGOA 3WMRA 3BFVA 3CUSA 1U0TA 4XVCA 5KU1A 1ITZA 5JISA 1BW9A 1DJOA 1E7YA 4C2BA 1G2IA 5BN5B 4IINA 4UJ3A 3W9UA 4OA8A 5HFAA 1Y81A 1NJ6A 3LOPA 5DVZA 3DBHB 5BSGA 3H5AA 4EYGA 2PS0A 5B2EA 3QHAA 4QUKA 4LSWA 5H70A 1G42A 1DV1A 1Y89A 2CHEA 2EX0A 2X0RA 3A1UA 1VG9B 1OAAA 4X92A 1P0MA 3CJTA 4RD4A 2ZEJA 5HF8A 2RHDA 2FSVA 3THYB 3IBCA 4RU1A 1QQBA 4XWKA 3GLFE 3B1XA 4BMSA 4NOJA 1GFIA 2OHHA 3BFJA 2DQKA 3FCXA 721PA 3U37A 2VKTA 3OMWA 3DXZA 4W9MC 1WCV1 3U61B 5A5DA 2ZLBA 1QHYA 1JILA 1L1EA 3VSEA 1RWBA 3ZHCA 2CL7X 5F2EA 4AIIA 3L43A 1IWBB 1ZI9A 3OIYA 2F48A 1P4GA 4KYIB 1RPJA 4CUKA 2PSDA 4RPKA 4I4NA 3EGDB 1XTVA 2I34A 1Z17A 4X20A 2DY0A 3PNVA 3R0XA 5B3JC 5KNDH 4JXJA 1Y8RA 5H4HA 2CMKA 3LA6A 4TMKA 3T4EA 2OLKA 5LA6A 2ZB3A 1ISIA 4TSRA 5JYDA 3T4UA 1G55A 1LBHA 1YBFA 1PJSA 3I92A 3N53A 3CB2A 4PSDA 3KDSE 3STTA 4AJKA 5L3QA 4MARA 2PAAA 1U0EA 2BFCA 2B1RA 3R3WA 5C3UA 3HU3A 1L5WA 5JY6A 4M87A 1ZOLA 5E2BA 3ZKWA 1HK7A 3U49A 2X0NA 1ONSA 1IHXA 2JANA 1M2EA 1NUHA 5EC8A 2CV2A 2CLSA 3VSDA 1AKEA 3P2JA 1E1MA 3LTNC 3ZV3A 4OJMX 1II8A 1P1KA 2ZT5A 1UBSB 4H6XA 4EPXA 1RAIA 1TYEB 4EI7A 4I55F 5H9WA 3A1DA 3VYVA 4GGOA 3LPNA 4CF5A 1SH7A 2PVCA 3GLHE 5CBKA 3GRUA 2R8OA 5JZ9A 3HKEA 3LH5A 4JI1B 4ZT7A 4EK9A 1XVUA 3TSCA 4E5KA 2AF3C 4KVZA 4OYLA 5AK4A 3TW0A 5EP4A 3VR3A 4TTIA 4AK9A 1V16B 1DJQA 2WF5A 3Q3HA 4CDNA 5CDHA 5CLHA 4MUXA 4LYYA 1IE3A 1YMUA 2Q28A 5KJCA 1KI7A 4D6PA 3GARA 4DUPA 3M5WA 2RGDA 4GRDA 3NFYA 4IXMA 1OSNA 1BCRB 4KV7A 1MC4A 5FPTA 1BXGB 3L84A 1D2EA 4RZSA 1N25A 4CIVA 3LQ4A 1PZHA 2UVPB 5AVSA 4RSHA 2FZKA 4GL2A 4YI5A 1DDIA 1KYZA 3AILA 3NJRA 4QQ8A 5IAEA 3V33A 3BWBA 4ER6A 2ZJ3A 1NBIA 1X94A 1TD1A 2BTQA 2Q1TA 4RK5A 4TUYB 1H8EA 1N5OX 2JFPA 2O2SA 3QKWA 5M2QA 4GRAA 3IV9A 3HY3A 1E7QA 4ZFNA 1EDEA 1S3IA 2WM3A 3E0QA 5ALLA 2W2XA 2BKUA 2CNBA 5KNBD 2ZJ6A 2BZ1A 3OSUA 3RLIA 3ZGNA 5HUJA 1XNQB 3NVMB 2PWAA 3L0YA 4FFPA 1YHZA 3HFGA 1FB5A 4LZNA 4TVSA 3KZVA 2OO7A 4IH1A 4LDJA 4UXIA 4UUAA 4N49A 4D56A 1P3Y1 5DHSA 1NKVA 2V9PA 3TVYA 3WYDA 1H5NA 1YS7A 4BKUA 2XDQA 1Z22A 3FYCA 4LXHA 2ZI7A 4A2CA 2G88A 1LI7A 2FPLA 3DC2A 3KOWA 2CY0A 4GR4A 4JT8A 4BEWA 1PYDA 1Z6ZA 3NOVA 3Q2KA 2GXUA 5DYIA 4FMCB 1OWNA 3SLRA 3ZWKA 4BO8A 5C32A 1WDWB 4D0SA 1QBKC 4TTVA 3FXAA 4TTAA 1UINA 1FJHA 2PL9A 3ECSA 1A50B 4RF3A 4ZCSA 2V3WA 3VU8A 1EUZA 4RD0A 1G8KA 4X97A 4F5DA 1PQPA 1Z9BA 2RARA 3N8KA 4DSNA 1O94A 1L3IA 3MWEA 3KD3A 3SC2A 3X1XA 1CU1A 3AM3A 3OIWA 5I7WA 1HT1E 3MOIA 3PHGA 5E1MA 4ZMBA 3BOSA 4L8GA 2DBQA 1QOQB 1F8GA 4L6AA 1XZQA 5BSUA 4K6CA 3ZWMA 5JAMA 3LCRA 4TYMA 3RK0A 5FL7A 3KQUA 1ULUA 1KAEA 2GAIA 4DLWA 2P27A 5EIBC 3UMFA 4DCGA 3L04A 2PQ2A 5AVRA 1VJCA 1QHHB 2CLEB 2FLWA 3ICVA 3T4XA 4YRIA 2YVAA 2Z2IA 2DC1A 3UK2A 4WRRA 2GK4A 3VBEA 1N9ZA 1G7TA 1AX9A 3Q9UA 2B21A 4RNCA 4CETA 2I2DA 4EF4A 1Y8AA 3KEOA 2BDEA 5LN1A 4HR7A 2QSUA 4CKWA 1XX6A 5ITSA 3DOHA 2N0SA 4DV5B 1EX6A 4CDRA 4RVOA 5AVOA 1RKUA 3TQHA 2PKXA 3W5UA 3O6VA 4RORA 2OQ2A 2YWJA 4LF8B 4BFWA 1A2KC 1KFCB 3AO0B 3FKQA 2C4MA 3BXHA 4G3XA 3UUFA 1RI5A 4UEKA 1SXJA 4Q03A 1HSOA 2H4HA 2V7EA 2IOFK 3VAYA 3R9XA 4P33A 1JLHA 4LI3X 1RPNA 4PYMA 3ZQKA 1XQ9A 3EMBA 1PBTA 2BSQA 4MUMA 3DSRA 4CIAA 3IUBA 1YZYA 3NONA 3BS4A 1GRCA 3RFTA 5JSQA 1G8AA 1FRNA 1L8XA 1YQUA 5J5VA 5FTLA 1TAGA 4EYOA 3HP1A 3ENKA 3MS4A 2AX3A 4BMNA 4J75A 3SS7X 3S27A 1L5OA 2AXPA 3WHKA 4MQLA 3V4SA 5PGMA 3GJXC 3IP3A 3KHUA 3UXHA 4WKPA 5BUZA 3KT8A 3ONNA 1B8PA 2A5DA 2IEBA 2YWDA 3OU7A 4P4TA 5TX7A 1KZHA 1FIUA 3USES 4AECA 1MJHA 2FMFA 5IKXA 2OGTA 3M49A 5AHXA 2J0UB 4P7BA 1YOVA 2ECPA 3WRXC 3N87A 4MA5A 4I3HA 2NO0A 2AG0A 1GNVA 5I7HA 2QR3A 3DZJA 2A78A 1UC5B 2I22A 4TLAA 2BMVA 4Y9SA 1PNQA 2B9VA 1T2AA 4E0BA 4GOXA 4MLPA 4FGSA 3PXUA 4X60A 1KDZA 5IBPA 5H02A 2OD2A 3LPCA 3MAAC 1P80A 4KAXA 3T1HB 4P4SA 3T94A 3ES9A 3IHTA 1EE9A 2HA2A 1D1PA 4LC1A 4LJAA 4N12A 3NNNA 4YPOA 1P91A 1ORVA 5L6LB 5CIYA 2O48X 4EUHA 3NO4A 3GFOA 3M2TA 1QGUA 1YKGA 4O4IB 5IHPA 3WAGA 2CWWA 2RCYA 1YRWA 1WKVA 3KOXA 3RW9A 4EUEA 4W8GA 1U5BA 2P0AA 3AJ8A 4X45A 3TK1A 1G7SA 1X80B 3SZMA 2HNBA 3MBKA 5F2NA 1SCKA 3ZNNA 4N0EA 4C0HA 3E35A 1USVA 4DRXB 4NOLA 1YDMA 5JS8A 4ER0A 4DR5B 1A4UA 1II9A 2NYVA 2MT9A 4F56A 4O8CA 3OO0A 1KYWA 4XJVA 5A1TA 1F6BA 1D7OA 1QG0A 1Z35A 2AC2A 1RPTA 3DXFA 2XVMA 3MPUA 4KN8A 4TUYF 3QX9A 4M36A 1Y7PA 4NMXB 2IYRA 2ZWOA 1NZDA 2XCOA 3DWFA 3C85A 3TZKA 4M1MA 2VXCA 13PKA 3IKTA 1Q3HA 3M6MD 2MWMA 2JLZA 5L3SB 2XZTA 1TYDE 1WXXA 2J9ZB 2QY6A 1MNAA 3N3BC 2GBCA 4HH3C 2NU9B 1CIJA 4QOFA 4A1FA 2IHNA 3QNMA 1RYZA 3BK2A 4UQOA 2QRQA 3OPVA 1X42A 4YRRA 2XWSA 2DKFA 5TB5A 4DQKA 4H3VA 3OWXA 2WJHA 3PNQA 2VT3A 4XQ9A 1NMQA 2C54A 4N47A 3PDJA 4OQLA 4UNNA 4BC0A 2RGGA 3R3JA 3UTDA 1KQPA 3K0EA 4PX3A 4FMCF 1YRYE 3EAQA 4P82A 2CLFB 1UOQA 4Q5IA 1I4EB 3NZEA 3RKUA 4A2WA 1RRMA 4RJTA 1YZTA 1MPTA 4Q3DA 3R1IA 4LZJA 1KR5A 4OFZA 5EZ6B 1AIPA 1HNZB 4RTMA 1L5FA 2ADMA 3PGMA 4NVRA 1DINA 3GHYA 3RDPA 4P2BA 1WZIA 1T2DA 3CMCO 5DHAA 3EN0A 2BEWA 4OU4A 3ABIA 3FDIA 2CC2A 1PNTA 4N03A 1K8XB 3WR5A 2PKYX 3BMCB 1N6HA 1FPMA 2ZPAA 4KV9A 2ET6A 5D85A 1FLDA 4KVAA 1A4IA 1KC1A 4AU1A 1BE1A 4IX1A 1FUEA 1AQ6A 1QCZA 2QYTA 1W6UA 1XHLA 2ZVQX 2PSSA 1ZKDA 2TMYA 4UOZA 5AK3A 2QLLA 3DFIA 1NW9B 2IHTA 3WWDA 4P31A 2RGUA 1GQ2A 4ZEXA 1H8HA 5DW0A 3R3UA 1IOZA 2GUWA 5JZOA 5K8IA 4YCCA 4LWZA 4CN9A 3IP9A 3KALA 3AINA 1C7IA 1NDUA 3F6RA 3K6RA 1V9LA 4KWEA 8MHTA 2CBXA 4MVJI 3I5XA 4DA4A 2ZT7A 3E2MA 2A9KA 3GCZA 3ZZUA 2B25A 2YTZA 4IMJB 4CF3A 2BGJA 3E05A 4JJFA 2VR1A 5LWHA 5DEOA 3PPVA 2J07A 5HW0A 1D07A 2RGYA 2JKZA 1EAYA 4MUAA 3SDZA 5F52A 1JH8A 1U3TA 1PP4A 1K8RA 1U8XX 2F3PA 2AZMA 2QUAA 2WZQA 2E87A 2Y0CA 3PQ2A 4U5XA 4BEBA 1QF9A 2AKEA 4CTMA 1F51E 5BYAA 3HXOA 4JQYA 2NADA 4P3PA 3WGZA 5ALSA 2OZLA 1UJCA 5HIJA 5D84A 4KQ2A 4YUAA 3EEBA 4HBGA 1V3UA 1KE2A 2O6HA 4YCDA 4AWBA 1U2GA 4PG5A 5K0FA 2HLPA 4LXXA 2SCUA 3ZGVA 1KAOA 1EX7A 2HREA 4WHMA 3THXA 5FNVA 1J5XA 4J6FA 2O2IA 1G2OA 1J1UA 1P5RA 2KHZA 2O7SA 3OM0A 4O4IF 1GLNA 5C5EA 1ESEA 4B46A 2HSJA 1B2RA 5I7OA 5JCJD 1BDHA 2C8JA 4YP9A 1FEZA 1CF4A 2ZSHA 2O3UA 4KFTA 3FPSA 2HDWA 3PEUA 1U7UA 1L5LA 5B7PA 4KXUA 3KD2A 1ZD5A 4IY1A 4DE5A 2DH6A 4LY9A 2QL9A 3PFHA 3QM1A 4LDNA 1IRIA 1CUBA 3ZD9A 5A4JA 3CINA 2XMGA 3ASZA 2IPAB 1HY3A 1D0SA 2L82A 2ST1A 2VBFA 2WWIA 4LXGA 3HJCA 1YI1A 3HSYA 3NBZC 3FSRA 2GQ0A 2HBYA 1QCCA 1KTVA 4BNLA 3AVTA 1OAOC 2WYWA 1Y37A 1DAKA 1OYYA 5AR1A 2P9GA 5FO0A 3VKUA 3GC6A 1GRRA 2RE8A 4D8VA 4J6EA 3C7TA 3FTDA 3AKCA 1KVTA 2QUBA 1SC6A 1Z7BA 1OFUX 3NJ8A 5IDXA 3BMQB 1QU3A 3FPBA 2DB3A 3UMVA 5DN9A 4R98A 1HRDA 1T1GA 5KQPA 3WVNA 2HA4A 1KMHA 3K2IA 5EIFA 4URUR 3I9MA 1E1YA 3RRBA 5JAUA 1CSEE 2XLBA 4YRCA 3PKZA 1FFHA 2BHLA 3BSFA 3LDGA 1NNEA 3UN1A 1D0IA 4BQSA 3KJGA 2ADFA 2OQRA 1RADA 3ZDQA 4Q34A 5U1PA 4BQEA 2OCDA 2XR1A 2VPZA 4M9QA 1KAGA 1RBZA 3AK4A 3ROKA 4EQZA 5LYYA 5IJ0A 1GRQA 2X0JA 3QYAA 4Q9LA 3EWSA 3UZUA 4HRAA 1F6WA 1F8UA 4QBFA 4WVFA 2E4AA 3EC7A 1P60A 4Q1DA 1NWHA 5JCOA 2QS9A 1J9EA 3LLUA 2GRJA 2WTXA 3A14A 4GI3A 3RKSA 1XNGA 2YR0A 4Y1RB 3RQIA 1ILEA 1WSDA 3OJWA 4MEAA 4JGIA 1E7MA 3ZH2A 3ZHRA 1T5IA 5CD9A 1JKMA 4NONA 1YBAA 2PZMA 3H2ZA 1CUZA 2P79A 3DQPA 1L5MA 3R20A 3RIGA 5GTDA 3BT7A 2UAGA 1H2YA 4HZGA 5DGHA 2C8LA 4EECA 1ZY2A 3EC2A 3CTPA 2FQWA 1YRAA 4QFBA 4YC7A 4ZCLA 2FETA 4MIYA 4X1IA 4DQ0A 1X9GA 5K0BA 3KHSA 5A02A 2Z2XA 3IMFA 5EPOA 4BVEA 4FUQA 5IDQA 4KLAA 1LNSA 5FL3A 2QTCA 4QIHA 2PH5A 2I1QA 3UPTA 2OCXA 2DP4E 4RIIA 4YUYA 1T8UA 2NVUA 1Y34E 1X8KA 4Y30A 5DN6A 3W6PA 2QEQA 2ZSFA 4TWJA 5AVVA 4LBZA 1W9MA 2IOFA 4QBKA 4BNHA 1NFRA 3CH4B 3F90A 1QG2A 4BZWA 1Z6TA 3G85A 5LD2C 5IDVA 5BP7A 5LUAA 3H87A 3U31A 4I3FA 4YXFA 4OF4A 3RVLA 3MMZA 1QIJA 5JS2A 3T7JA 2G70A 3DBLB 3VU3A 4AUNA 4C22A 4DSUA 5KOJB 3OPNA 1ESCA 3NG1A 2AC4A 4TTRA 2OXIA 2VNIA 2RGWA 1L7EA 3FPEA 4FCCA 2HJWA 1EUCB 1ZHHA 2CZGA 2X8WA 4HFNA 1Q11A 2LBPA 2JRCA 4RW0A 4Y9TA 5EIAA 1U6JA 421PA 2ZI4A 2Z58A 3KJNA 4YREA 5JAQA 3RD5A 3KHKA 3H2SA 4QDUA 2A1TR 2O0KA 3I73A 4YQFA 3T3NA 4NV0A 3QV1A 4RCZA 3FVRA 2HRQA 4X1YA 3BWCA 3SCZA 3SIWA 2QAJA 1R74A 1D5CA 3E0XA 4MEBA 3QXXA 3U4DA 1W87A 4ZCQA 1NXTA 3KB6A 2ZE7A 1XIVA 1RRFA 2WHXA 4JJZA 4E1AA 1CRPA 4YV1A 3EEQA 4HMOA 2RAPA 3K09C 1LEHA 3IAEA 1U04A 5BOVA 2AFIB 2W2TA 3PNLA 1JHZA 2TMDA 3FHCB 4JDUA 3QMWA 1N6OA 2ZWMA 4JOSA 5BO5A 2IDKA 4RACA 3SM9A 4E12A 5JSZB 2D8MA 3QVTA 4LF5B 2RHLA 2GCGA 4MS1B 3W3AD 3ZIAD 2QN1A 1NXQA 2GERA 1RPAA 3DEAA 1DIBA 4KITB 2WKQA 2Q07A 5FOWA 4TMYA 4WQMA 3JAWB 1XDGA 4DM7A 1QHXA 5JBIA 3AWIA 3BJRA 1T4MA 3D0OA 3HUTA 1BN6A 3MT7A 1TF2A 3O8QA 1JFRA 1RLIA 4JUAA 3HBJA 3VO9A 3ND5A 3QLEA 4CV2A 9LDBA 3U39A 5B58C 2XB9A 1JG2A 2I7CA 4KX3A 3MBIA 2IHYA 4OVKA 1E7WA 2VPXA 1V1RA 3IVGA 4GUDA 3DC7A 2IGTA 3BXFA 4R40A 5AJWA 4CUZA 3L4JA 2D1SA 5ITZB 1OI7A 2Y0DA 3CZ4A 4WADA 1CNMA 1R9GA 4WJZA 4UE6A 4FBMA 1X15A 3KQQA 1PUXA 4NHOA 4JLBA 4LJ7A 4FZVA 5E1DA 2XUDA 4BFCA 2GBPA 4GP6A 2QRZA 2JATA 3I4LA 5HQ3A 1VC2A 4AP6A 3V46A 1GT6A 2GCEA 3P9KA 4Q7EA 5KNBH 1MRZA 2RBKA 2Q6VA 3K5WA 3VR4A 5K3SA 4Q1FA 1OASA 3Q7IA 4NRDA 3ZG6A 4BNNA 2AXNA 2Z4RA 1YR3A 3OY2A 1BQ4A 2P3OA 4K26A 4LA4A 2BI7A 5EIWA 5A2GA 3OJFA 4O1MA 1JAZA 1C3VA 4IKOA 4U3JA 5IAKA 3ZWBA 1Q0TA 3CRVA 4BP3A 1J22A 1N2CE 3MT0A 3VTFA 1BQEA 2IXEA 4MS3B 3GDGA 2OORA 3EWIA 4ZO7A 4TTJA 1WTCA 2I3AA 3G7UA 1NYQA 1Z12A 1O95A 2WKSA 4LTDA 3WWYA 4MIKA 3W8RA 5HS6A 4CTOA 3G0IA 3FWHA 4EDFA 3MS7A 1LB1B 2A0WA 4FI3C 2ZBRA 2QJOA 3ELBA 1KI8A 5KJFA 2DLCX 2H2FA 3AEUA 5EP1A 1WCIB 4INOA 4GRIA 4FINA 1F2UB 3CWCA 3FUCA 3GRKA 3PJGA 4JC4A 4ABYA 5JTTA 1E2GA 4J7UA 3A58B 3AFGA 4J9VA 4LDRA 1NXSA 2YH2A 3KTFA 4K9NA 1KXJA 2NXJA 2XVZA 2Y9PB 1RHKA 3QVOA 1IN7A 2CN1A 4GPAA 4HNQA 2JFXA 4TVKA 5GMOA 4ETMA 3AR3A 3PYLA 1COWA 1V7PC 4M22A 2C7GA 4O5AA 4AURA 3GIWA 2W42A 3IHKA 1C14A 4CKCA 4QPPA 4ZYXA 4RY8A 1YGPA 3UMGA 1DFHA 1CE8B 3IHLA 3IHWA 3KYDB 3QE9Y 1F2VA 2PN1A 1AKNA 3D8BA 4K6HA 4OY3A 5GGXA 1J8QA 2HIMA 4I4TB 1U1FA 3FFWA 4EG8A 1F3LA 3X1WA 2WM2A 1LV7A 2EGGA 5IEBA 5D1HA 5DDIP 5TDHA 1RLOA 1SRRA 5CYFA 4EHIA 4KO2S 2HMTA 2IXTA 3EMKA 1MH9A 1NRWA 3UG6A 2VDKB 2Q9UA 3ROGA 3SYTA 4BFTA 2PKWA 3UJ6A 1EP3B 1KJZA 3OF2A 3TN7A 4C9BA 3DCJA 4QM6A 4K9RA 3NGLA 5BRNA 5FX2A 1N9GA 1OWMA 3C7KA 3ZTYA 2Q3LA 4HB3A 3WL4A 3QP9A 2AEMA 3BQMB 1ESMA 2DERA 5JZMA 3WNCA 4R2HA 4MVJA 4R8VA 1Q0LA 3W2TA 1P9OA 1VJ5A 4KUGA 5DLQC 2A0KA 4CKYA 4YRDA 3ORFA 4KFUA 5CDYA 3ROQA 1WXIA 2CYBA 1T1JA 1W5EA 2YIVX 3BRQA 4WUTA 4FC6A 2H2HA 2IHKA 3PVCA 3ZCPA 2JCYA 1U80A 2HF7A 2ZSBA 5ADHA 2NLOA 4EGJA 2OFFA 5CD1A 1QVVA 4LYJA 5C5CA 5KQRA 1QP4A 4RIFA 3DF7A 3COYA 4Q1CA 5F3WB 2I0FA 4IDOA 1DRJA 3CF4A 3FSJX 3H5VA 3DMPA 1ECFA 3R23A 1J2YA 4GICA 4MS4B 5K99A 1PG5A 2L19A 2KM1A 3NPAA 3FCSB 5FNZA 3QE2A 3BVPA 3IVXA 1ODFA 2DFKB 1S0UA 3WB2A 4US2R 3NBYC 2CDBA 4H7HA 4ZZIA 3NBKA 1IN1A 3Q7QA 2CYAA 3TVTA 3ZI7A 3EODA 4GSYA 2Y1XA 2HMUA 3KU4A 1IZ8A 3QTTA 3OZTA 3UJ8A 4OTZA 2IVZA 2VDOB 4EPYA 4YXWD 4KAFA 2FFBA 3EC1A 1DKMA 2VDWB 3IAS1 2X22A 3DT9A 1RS0A 2COUA 4V0SA 3R5TA 3E84A 3D59A 3U9TA 4DMUB 2ZITA 2K7ZA 1VKHA 2JI9A 2IV7A 3A9TA 4ODIA 1N6KA 3JYQA 2FR8C 4RYLA 3STXA 4ENPA 1FU7A 2YASA 4FD3A 4YQEA 1ZESA 2O0LA 3D6NB 1NOJA 3REQA 1ZK1A 2ZT6A 3V1LA 2ZIVB 3GJ8A 5CDFA 5JMOA 2R87A 4RBNA 3W6OA 4PAQA 4FHZA 2I33A 3JQBC 3VR2A 2QVBA 1N2GA 2I6UA 4FE4A 2FGKA 3VX4A 3WP1B 3ZE6A 1AXRA 1NMEA 4FNMA 3QF7A 3JTMA 4BATA 5E6UA 5I9BA 3SJZA 3C43A 1OILA 3EIXA 4MW7A 3GJSA 4Q4AB 3ZDRA 2VDNB 2I6TA 4XR4A 1EWRA 1TU4A 3O91A 4H3HB 3EXFB 1IXSB 1N2IA 3D6MA 1QTQA 5REQA 2XMSA 1MUUA 5JSKA 4EHJA 1ZUWA 1MXHA 1S8NA 2BRUA 3OZFA 5E6RB 3SSMA 3UBMA 1YA8A 3UCFA 3VPHA 3WDKA 2FG7C 4AF7A 4C0SA 4DT1A 1P4RA 4FBGA 1YZKA 5EA2A 4MB0A 4PZZA 4FFBA 4IHJF 2B4KA 1BS9A 4NCNA 1RQPA 4FW8A 1R4ZA 1RT9A 4JMPA 4JP3A 4AO7A 2FZWA 1HKUA 3JVEA 4LRUA 4BFZA 4BQRA 3QWHA 2QDKA 3CKYA 3LHFA 1AS3A 4K9MA 3NR2A 1AS2A 3E7FA 4O33A 5HOQA 2LVBA 1QPBA 2G8LA 4B8WA 4L74A 1Z73A 3CZ9A 4FHGA 4RVSA 4PHFA 4MLDA 1HLFA 1NLFA 1Z2EA 3PQ4A 2WIKA 4KXLA 3RFCA 1P4SA 2XD4A 3LBNA 3WYBA 1ZO8A 2XWBF 4B6SA 1OREA 4EHBA 1RJGA 3H18A 3HJUA 4BO3A 2OFXA 3L0CA 2C98A 4AMYA 2C2HA 2H1CA 3HFRA 4HQNA 1J24A 4L6IA 2CYCA 3DPIA 1SBHA 4MYCA 3WI7A 3VNSA 5HGXA 3A70A 3O8LA 4JB8A 4RY0A 4X8OA 2HK7A 3C2QA 3HE3A 4LXTA 1IZ7A 2R5FA 2DAPA 2HYDA 1MVOA 2VHZA 3LVQE 1XMSA 3E70C 4L73A 4B44A 4YT2A 5B3AA 3A1FA 3KXPA 5LVAA 2VT7A 2LNDA 4I4TF 4MCAA 4H6WA 2IYQA 4I7EA 1TKRA 3SC6A 5KJ6A 2O2ZA 4JXKA 2ZRPA 3L4EA 3VZPA 4AB1A 3JYLA 2OHXA 1LJ8A 4PAOA 4HNTA 3BZWA 3OECA 1RI4A 1Y3CE 3DZCA 1MVLA 1MTOA 3JY6A 3BCSA 1T29A 1UXGA 2RH4A 3NM5A 4K87A 5IN5A 2G4CA 1MABB 2C7VA 5KVQA 3WL8A 4E11A 4G07A 1RWQA 1LBTA 5JNWA 4Y18A 2B83A 3MHPA 4Y7DA 4ATNA 2HW8A 2CFSA 2Y1CA 1JE1A 1PQ4A 1Z7EA 4UTNA 3E8SA 4IV8A 1R64A 3QLJA 3GA7A 4QODA 5AI6A 4U63A 1TUEA 3KCQA 1ZBQA 2G3YA 1QIIA 3AG6A 5BRJA 1N1EA 4WUVA 5JBNA 5JT1A 1OBHA 2SHKA 4UZEA 4RMNA 3AVPA 2PM8A 2ODTX 3G89A 4MWEA 2CDRA 3UAYA 3DM5A 1BU5A 2ZTMA 2GI4A 1Y8CA 2C3OA 2WIJA 1PTKA 1QWOA 1VLVA 4HX9A 5FI5A 3IUMA 1TPYA 1EQ2A 3NATA 4BFUA 4AG5A 1V43A 4GPZA 4WKBA 1G5TA 1E58A 4LISA 3ZNQA 4BQIA 2H7XA 2WC1A 3VHQA 1OH7A 1QIEA 1KFJB 1F8YA 1RRPA 2A92A 1U99A 4Y2VA 2I80A 1INLA 2IYSA 2JASA 2IV2X 5KEIA 1ID8A 2A7QA 3IODA 1EFLA 3CYFA 4WXMA 2H7YA 3LLVA 2NU7B 2FZCA 2Q8NA 3OURA 2P77A 3PNYA 4JEIA 3KYBA 2XGSA 4Q16A 5EWLB 3ZH9B 5JSYA 4OX9Y 3AUXA 3DYBA 4REOA 5KC8A 4F9FA 2B9EA 3T7IA 3CH5A 4AN0A 4KWIA 1M67A 2BVNA 3U4QB 1VKJA 1BIFA 1JZSA 4BO4A 4TSKA 3OLQA 1RZRD 1DADA 1TYAE 2A9OA 3UT6A 3G1WA 3SQXA 3KKKA 3C87A 4WOCA 4GM0A 4OK6A 4F7WA 3UO8B 3B7WA 5LP6A 1E4OA 3H86A 3WL3A 3X0DA 2Z9BA 5J5AA 1DQNA 1ODKA 2NNLD 4QXPA 1L4UA 2IX9A 3JVDA 3TLYA 2P67A 3ANLA 1I94B 4OSEA 3OQMA 2OA0A 3OICA 3OEED 4D45A 4N76A 2C5HA 4B43A 1WLSA 2R48A 2H1FA 1KJQA 2V7PA 2AR9A 4NKRA 2QV0A 3UY4A 1LF5A 2E7ZA 3A1CA 3AR9A 3G8YA 1SVOA 1K66A 3DLCA 4E2YA 4AS1A 4MJXA 2F90A 4AQ7A 4M1YA 3KOOA 4ZCIA 3E9CA 4H1HA 4G85A 1DG9A 3LL7A 3LGXA 1UBGA 2YYSA 3D3QA 4DJ5X 2FWMX 2YW9A 5ARBA 3Q8MA 1QFYA 1RYFA 3JRWA 1FP4A 4MQ5A 3JU3A 1X7HA 3PC2A 1XZHA 2V6JA 2F4VB 4IDCA 1FS4A 2JIMA 2WNHA 3D8TA 1L7VC 5DX8A 4EFKA 4M0EA 1MB4A 1FRVA 2IHUA 3G13A 3OE7A 3PE3A 3ZGLA 3OJCA 1Z33A 4I8XA 4OG2A 4LRYA 1KZ7B 1OTXA 1BMQA 2IC5A 4WXEA 3BM5A 1FNMA 1TC2A 2P6OA 2W7TA 3HJBA 1HEIA 4UMVA 4Y0NA 1W85A 5T4BA 3VYRB 6AT1A 2WT8A 3DTYA 3TOVA 1GSIA 3IA7A 4BGDA 3IDZA 4F85A 4WN9B 1V8FA 3DNFA 1U3WA 3A6HA 4XB1A 1WV0A 2I2FA 1DIHA 1YFJA 2PYDA 3V34A 1B3BA 3QNWA 4RLQA 3VYWA 4C6HA 4OXRA 3PVSA 1SHKA 5BN1A 3FJ1A 4GQBA 4FHCA 1QQ7A 1GGFA 1WTAA 3ABRB 3SDSA 4UVHA 1KRWA 4F4FA 2PGNA 2GJSA 1ZMTA 3OJXA 5AP9A 4CM9A 4K88A 4UUQA 1WSWA 3LC7O 3MJHA 2ATCA 3OWOA 4UU8A 4XUGB 2UZAA 1BJTA 3VH3A 2QAGC 2YRWA 5KYUB 4H60A 3WTBA 1OR8A 5JS6A 2H1OA 4OK5A 4XCVA 4C2UA 1RRVA 3N8GA 4ERNA 1VIMA 5CLFA 3IURA 3LY9A 2BISA 1LTHR 2DLNA 4N5MA 4RVNA 1GAXA 3IOBA 3OPXA 1Q3TA 3G2JA 1Y4DE 2GPTA 2O19A 5BSKA 2IZ0A 1I6LA 1UZAA 2Y0BA 5CFLA 1AN0A 4HZUA 2VIIA 2JBAA 2QLFA 4D8YA 5JV5A 4R3UC 1GSAA 1GM5A 1KEKA 3I09A 1SA0A 3V1KA 3W34A 4OAPA 4OHBA 3OOSA 1PX2A 3A10A 4RHFA 4ZYZA 5F76A 2QT0A 2EEPA 1JHUA 3CVOA 1SKUA 4JLPA 1ZK3A 4O2BA 2PZEA 1T4CA 2XOKD 4ZVKA 4HDSA 4YJ2A 4RJIA 4GOMD 1KY4A 3AFIA 3DMNA 1K3TA 2FFAA 4QBIA 2GYWA 3G49A 3M5CA 1UMBA 3LUAA 3VR6D 4BEJA 1DGQA 2K7FA 1NYTA 3JQFC 1JECA 4XYGA 1F8XA 4D8TA 4NNJA 3EJ6A 1SPXA 4UU1A 3VSCA 4OGKA 2CLCX 4Z4HA 1S9DA 4XASA 3WWEA 3ZBQA 3R9KA 1RC8A 1YH3A 2R6R1 4D2IA 1AHIA 1FP2A 1DTWB 2I5PO 2CNWA 1SXPA 2H1LA 4F3NA 5K8LA 3NUQA 4HP8A 3BFXA 5IANA 4D6YA 1V8PA 4C08A 2G06A 4F9TA 3C5EA 1EJ0A 4NFHA 5J9FA 5CXSA 3KQHA 3BD9A 1QO9A 1V48A 2VPQA 4E03A 1FNCA 1UBLS 1P1CA 1WULS 3A1TA 3S44A 3U17A 1T5DX 3LAWA 1H22A 3GV0A 2BFAA 4O4LA 4RZ2A 5DTMA 1W4ZA 2DFNA 3P20A 3T7KA 2G6TA 3SXJA 1NI3A 4JASB 1JFVA 1XU9A 4V3CA 4M1QA 5JH7B 3MK31 4D25A 3HUDA 5LR6A 2C82A 3D3NA 3SAJA 1CZKA 2AMFA 5IM4A 5JSZA 5H9VA 3HR8A 4J7XA 3USCS 2BAGA 2EDAA 2RBEA 2WP0A 1P2VA 3IEUA 4HWPA 4KL8S 4DJDC 5BURA 1DQZA 3OFVA 1RM5A 1RTTA 2QL6A 1PTJC 3RUCA 4B84A 4ENWA 1VLZA 3Q11A 4KJZA 3VFDA 2FZ5A 2OLJA 3MWLA 3R5SA 3N8DA 1SIUA 2B4QA 3FBTA 3CNBA 1ONOA 2Z6AA 5KJEA 2YXBA 1ZMXA 3B8HA 1RM4A 2BKEA 3INGA 3MCUA 3TIVA 4V2UA 5LQMA 4N40A 4ICIA 1T3ZA 2Q1UA 3F8WA 1U65A 4DYHA 2ZR0A 5C2JB 5H1YA 3GLGE 5L7TA 4II3A 4E2FA 2BT4A 4GECA 1M34E 2X8JB 3K1TA 2GM9A 4R2LA 5AO9A 2AE1A 1H4SA 2GKSA 2JLRA 2PV0A 4P36A 4Q4JA 2DM6A 3A6DA 2JZCA 5BWLA 2A3RA 4BMPB 1ZL0A 4JK3A 3TDNA 1PR6A 3DE2X 1J7KA 1IWOA 4JIMA 2V8BA 3RVSA 3TR6A 2HT1A 2OCIA 1T4GA 4JD5A 3O92A 5KBYA 3REFA 4LYAA 4G5XA 1G6Q1 2IEAA 3C7CB 4C5BA 5KVVA 3DZBA 5I9MA 4XJTA 3C39A 2D3WA 1DVRA 2FUEA 4NU0A 1XRRA 5AUNB 1TK2A 4I9HA 3ZIUA 2GA9A 2DXIA 1D8TA 3SIPA 3STWA 2D13A 3O8CA 4YJDA 1W49A 1MORA 2ZE5A 2HRCA 3UBTA 2J48A 4TTSA 2PBZA 1X1RA 2C20A 2ZIXB 5BOSB 2XWPA 1HZJA 1USKA 1HO3A 2PUJA 2VF2A 1JHOA 1FQKA 5CUQA 4IYRA 1JMVA 4OJTA 5T64A 1J5PA 4PQRA 5I4BA 1VSBA 2M6RA 2H6EA 1JGTA 1NJSA 2IDMA 2I6GA 3KBOA 4N6GA 2BR3A 3DOFA 3HPRA 5WRFA 3RVPA 5EJAA 3NBMA 4F3CA 2YL2A 3ZDBA 5LOVB 2XMDA 5CVEA 3CKLA 2W11A 4EAAA 4CM4A 3CNOA 1OH8A 3BBPA 2YDXA 2RI0A 2VFAA 4WKGA 3U44A 4E5SA 3ON5A 1SU4A 4V3BA 3K0FB 1AXGA 4D9NA 4V02A 2ORED 2VRWA 2EKZA 4CZ2A 2VDUE 5KYNA 1I13A 4IM7A 2VP9A 3QKSB 5EESA 3RREA 3T61A 1YS9A 3TQRA 4JYBA 1Z5VA 5EJ9A 1YIDA 3C1OA 4QFDA 1CR0A 2V9CA 4XWAA 3NT5A 1GAEO 4OI0A 1M1ZA 1XTBA 3LYAA 4P6VF 5EUQB 1GPLA 2HK6A 1TE2A 3TM5A 1WZ2A 5IG2A 2FX2A 1S3SA 5L3RA 3RCBA 4H1VA 1MDFA 1UDXA 2M9MA 4KNVA 1MAWA 1ZICA 1FMJA 2WJPA 1PD1A 2BHNA 2DRIA 4GSKA 3AUAA 4LZOA 4PTYA 3GEBA 1YE3A 3HBFA 4W82A 4H15A 3V32A 4IIJB 3P2KA 3UXEA 2Q2VA 1QNLA 2CBGA 3IUJA 1RYDA 3M7IA 4IOJA 2H52A 1SAYA 4KIWA 3U3JA 3L4SO 4AXXA 1IZYA 4FI3F 2BP7B 2C57A 3N1UA 4EFNA 1W7AA 1SBTA 2QGZA 3OM9A 4M2LA 2WAXA 1ORHA 1PGJA 1A98A 2AGVA 2DT8A 2F9FA 3DVQX 4GDFA 2D2EA 1B42A 4O63O 2YFQA 4RFSB 1E9DA 2IYFA 5KHOC 4W5WA 1JFFA 2FW8A 1JEEA 1XRMA 1MR3F 1TM2A 2WK1A 3EXG2 3JD0A 3LPDA 4TPKA 3ZHQA 4EITA 4Q1BA 1AK9A 2CKMA 1U28A 1XMOB 3MAJA 3ER8A 2O4UX 3K0HA 2Z08A 4YHBA 1JQBA 4M21A 4IDAA 3RBZA 5JH7F 2V7XA 3KJIA 3OKCA 2RGXA 4WY8A 4X6LA 2A14A 5AKLA 1EUDA 3M3HA 4BTVA 5K8VA 5KOHA 4AG3A 3S1SA 3HI6A 5EIBD 5EEGA 5A0FA 4FR5A 4BNXA 1XWIA 3BUSA 2YDYA 4HAYA 4JAVC 1R12A 3MZ0A 5JCZA 1E8DA 1SZCA 5AJHA 4YRNA 3RUEA 2BH2A 5CBPB 2DX7A 3PFWO 3U7QB 1M8PA 1U8EA 2YQ4A 3O4GA 3A2NA 1ULBA 3CIOA 4EZEA 3RARA 5TLSA 5MN6A 2HBZA 2Q4RA 2I29A 2RK6A 1CS0B 2FNAA 1YQGA 2CXTA 1MRSA 1F60A 1F0KA 2HEGA 2V74B 3PC7A 4WFJA 3SC3A 3EOBI 4N9WA 3TQQA 1BROA 1WW3A 3FUUA 3LYLA 3G2IA 3L6BA 4DSOA 2YRFA 3VZRA 3OPMA 5DIZA 1JQ5A 1M5TA 2COKA 1NATA 5CM2Z 1KETA 3ZU4A 4F8EA 1M7BA 3L46A 2ZULA 3VDMA 4IDNA 3W1EA 3PQ8A 3J81A 1W0CA 3D6FA 1QKKA 4OI4A 2FY8A 1UXOA 4EQ6A 5I4KA 3WHIA 1SG6A 4CMIA 4D9CA 4N0PA 5AVKA 4QYSA 4Y98A 3JQAA 2X6RA 5EFOA 3TMAA 4F97A 1J7JA 3G2NA 4TLEA 3SKVA 2Y2UA 2OBNA 4JOQA 4OLAA 2W6CX 5FFNA 4NMLA 4BKRA 4ITVA 5JZBA 3VNRA 3O8DA 3C98A 2D6FA 4QWMA 4YMTA 1EZ4A 1R4NA 3OU2A 3PQEA 5FBRB 3TBFA 4CEJA 521PA 3D43A 2H08A 3AFHA 3NIDB 3TUIC 4F71A 3ORRA 2EIXA 3IA2A 1PWXA 2IXAA 2NTEA 2NZ2A 4YYZA 2VTBB 1K3FA 3GRRA 1JFSA 1FX0B 2HPVA 3L6EA 5CH5A 1YUBA 4AZWA 1X0XA 3DR3A 2XGMA 1EH5A 2II6A 1BE6A 1JEOA 5JRDS 3V4LA 3BZUA 4ASUD 4GLLA 4QKQA 4E5MA 4UBJA 4G4JA 5BQOA 1YMVA 3G0DA 3NFRA 1OTHA 3QENA 4DR7B 4ETNA 1CUIA 1GU1A 1OKKA 4IWXA 3TTVA 3I6YA 1NHWA 3F7MA 3ORHA 4B3CA 1Y33E 2B35A 2OOKA 3BAZA 3HGMA 4C4AA 4CR7A 5C52B 3KUCA 4U39A 1J8VA 1E66A 3GYBA 4S1PA 4S05A 1EEXB 4RLSA 2Q3CA 4FWBA 5LOVF 3C6KA 4AJIA 4B83A 3AERA 1PV4A 3BXZA 1QIGA 1P1RA 1SGWA 1RJDA 3OQHA 1K7FB 1AQLA 2RMKA 3NX4A 4YPFA 3IR6A 2DH5A 2JGRA 4QYTA 4Y6OA 2YY7A 4TLBA 2IYNA 4IUDS 5G4KA 3P0JA 3JWEA 1C4KA 5COAA 4B0OA 5HVNA 3E9EA 3HEAA 2Y1FA 4B73A 1CR1A 4B40A 1D1QA 1NFQA 4ZT6A 3O1HB 4JB0A 4NFLA 1M6VB 2HXGA 3HN6A 3K92A 5HP4A 3SC4A 3HJGA 2PJRA 1TNDA 4Q3AA 2FPRA 4YN3A 1P5HA 1A9XB 5BMVB 2YFYA 1L7RA 2AWNA 1X19A 3CRW1 3OF3A 4HHEA 1Q0HA 3BCUA 4W5HA 3U7JA 3GGDA 2CWDA 1RJFA 3KTOA 2V3CC 4E33A 1ZGGA 4O2AA 2ZJOA 1Z39A 1D3AA 1TK3A 4IIJF 1C9YA 2FXIA 1OUMA 1WDKA 3RVQA 3IEKA 1OLUB 4TWZA 4PCVA 1WR8A 1GT91 2OFWA 4KZKA 1EVIA 2X4GA 1WAMA 4JLSA 2R96A 3WXBA 1K2VN 4V0LA 1SXJC 2B61A 3W78A 4TXMA 4RIEA 2PMDA 3STYA 1C41A 1H94A 1Z88A 2P7IA 3HXKA 3Q10A 4YJHA 1L7AA 2BMDA 3HJRA 2QAGB 5FYQA 1WBDA 3NTVA 5DCLA 4IILA 1CZNA 2Q27A 1X7DA 3AL2A 4K0RA 1A5SB 5ARCA 1CQIA 1SMKA 3FSGD 2GRUA 3UM9A 1N3IA 2VS1A 4C6TB 3BE4A 4D3ZA 1GILA 3COPA 1BOOA 4HZIA 4PPNA 4BVGA 5SZJA 3GEGA 5CGQB 1YZNA 3PL5A 4B3JA 4U6QA 3CR7A 4RQTA 3UWKA 3B52X 3HB9A 4IQ4A 2CUNA 4AL4A 5HNKA 4UAVA 3JZAA 2COEA 4ZO6A 3OZ7A 4GGMX 5DIFA 2UVDA 5FT9A 3U3RA 2V7QD 4QSMA 1JIXA 5AWFC 5KUTA 3VPXA 5T4HA 2ESRA 2PJDA 2DSNA 2FEMA 3CVJA 1ISSA 3I6QA 1GPBA 2P4EA 3H9JA 3U7RA 2P4HX 4YPVA 3PTZA 2C9CA 3PNSA 2QXTA 3DTVA 1BJKA 2PWBA 3Q0IA 4PCLA 1KMNA 2PFSA 1H65A 3ZHVA 5JXJA 4JL8A 4F46A 1MO6A 4FUTA 1B6RA 2HO4A 3D3EA 3ELYA 1BO6A 1ZH4A 3CTMA 5GV8A 4JJ8A 4CIBA 3NIWA 3DMRA 2AT1A 1URPA 3A3KA 3OEYA 1L5ZA 2QN3A 4TS4A 4UHJA 1NAHA 1Q7CA 4C7KA 5K3EA 4KXFB 4OFWA 4CMHA 2V6FA 5E7JA 2WJ3A 3WQRA 4M83A 3O47A 5I9IA 1YBMA 4IVPA 1TJYA 4QO8A 4Z4IA 1YQDA 4GXNA 4PLPA 2SKDA 3D54D 4K2AA 3LBYA 2AXEA 2IYXA 2GF0A 1XA3A 1JLKA 1VJDA 3HQ4O 3EIWA 1NU6A 3WNBA 2F1KA 4RTSA 2V54A 3L4BA 4AJLA 1KK1A 2F1IA 3L1JA 3K3PA 2WZCA 2ASVA 3CRRA 4MYUA 3WGHA 1WPRA 3F6SA 5FWAA 3CBQA 2IUFA 3U62A 3QSYA 2V59A 4R51A 3KEMA 1PVDA 4Y6RA 4G0WA 4NC9A 2PSFA 4FSHA 1QYXA 4Q48A 4DLRA 3OTWA 4O59O 1OPRA 3ZWPA 1CJBA 3PKIA 2VHCA 4DCOA 2RHBA 5D00A 1N8TA 4ZK6A 3N2ZB 3M4ZA 3PU6A 1GZ5A 1DPGA 3I52A 3GU3A 3IAFA 4TLCA 4Y1EA 3LRXA 2OHIA 1KDYA 1GDTA 4LV5B 5MN5A 2XQGA 2H18A 3G2LA 1LNZA 1UANA 1H1LB 3PJEA 2EBUA 3IP1A 3RJ5A 3BQ9A 4V0MA 3TLJA 1ZJ4A 2X8AA 1DELA 3O3MB 2V7BA 1EFRD 5I4IA 2ZQZA 3QHPA 1PDWA 3U3DA 4Z53A 5F1OA 3U5TA 2XUFA 3F9IA 4P2GA 3DAFA 2FR1A 1D4OA 2AMJA 2WE8A 3JZIA 1XEAA 1XDUA 2VL7A 1LPAB 1Q7GA 2FW1A 4A73A 4YX9A 1T36A