4RIFA

Landomycin glycosyltransferase langt2, carbasugar substrate complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
379
structure length
370
Chain Sequence
MKILFVASGSPATVFALAPLATAARNAGHDVFMGAVEDMVPYIASAGIPALSIAPSSIRRYATMDREGEEELDFAGHWFGRMAAGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVPYVRQAWDTGDAWRTDPAASDELRPELRALGLDRLPDPALFVDICPPSLRPATAPPAQMMRWVPANGQRRLEPWMYTKGNRPRILVTSGSRLVFAKKTGFLRGLVADMAALDAEVVIATLDEVAEELRTELPGVRAGWVPLDVVVPTCDVVVHHAGGVTALTAMNAGVPQLIVPQGGNFVEAGLRISDFGAAITVDENTPEAVEKACGELIGNPSYAERARELSAEIAALPLPAEVVGALEGLVENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl transferase homolog
publication title Structural Characterization of O- and C-Glycosylating Variants of the Landomycin Glycosyltransferase LanGT2.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Transferase
total genus 118
structure length 370
sequence length 379
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06722 DUF1205 Protein of unknown function (DUF1205)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4rifA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4rifA02
3TOVA 1FS4A 2WTXA 5JTUA 3NPAA 3L7AA 2YJNA 4W6QA 3WADA 4RELA 1RZUA 1EM6A 3T3EA 1PSWA 1GFZA 3H4IA 1K06A 1BX3A 3MTBA 4EKEA 2SKCA 4X7RA 3QKWA 2R4TA 1GGNA 5HXAA 1L5QA 3DZCA 1KTIA 1NLMA 4CDRA 2H1FA 1Z6PA 3SYMA 3VUFA 3OTIA 4MI9A 3OY7A 1JIUA 2VSNA 5ENZA 3CV3A 2BGTA 1L5WA 1H5UA 2AZDA 2BGUA 3MQFA 4CTMA 1GZ5A 1L5VA 1K08A 3C4QA 3DD1A 3EBOA 4YI5A 4AMBA 3RSCA 4GZ3A 1SXPA 4G2TA 4EKYA 2XCUA 3VUEA 2IV7A 5D00A 4MI6A 4WHMA 4LDPA 2FF5A 3C4VA 3E3OA 3C48A 3L7CA 1NZDA 1NOJA 3BCUA 3NC4A 2F3SA 3OKAA 1A8IA 5TMBA 4MRAA 3MT9A 3T3HA 2AV6A 1XKXA 3T3IA 4X7MA 3UYLA 4M60A 1C8LA 3QHPA 4KQ1A 3PE4A 2PRIA 3Q3IA 3G2NA 3BD7A 3SYRA 2X0EA 3ZCPA 2QN2A 3MRXA 4X7PA 5BNWA 1P4GA 2AMVA 1P4HA 4XIFA 3TAXA 2PQ6A 3GUHA 2FETA 4F97A 3Q3HA 3MS2A 1JG6A 2QRPA 2QRMA 2X6RA 3BD8A 3BEOA 3L79A 2ACWA 1UZUA 3S27A 1C3JA 4RIFA 4NC9A 5DU2A 3MS7A 1IIRA 3S29A 3ZCVA 3D0RA 1HLFA 3DDSA 2GPBA 5TVGA 3OTHA 1FU8A 2X0DA 3IAAA 3GPBA 5I45A 4WADA 6GPBA 1WV1A 1JIVA 4F9FA 5C1DA 2R60A 1Z6QA 3MTDA 4N3AA 2IEGA 2C1XA 4RIEA 3OKCA 2PRJA 3L7DA 1NZFA 3MT7A 4GYYA 9GPBA 3MS4A 4M83A 5D01A 2ASVA 3TSAA 3S0JA 3Q3EA 2GPAA 2PYDA 8GPBA 3MTAA 2JJMA 4HWGA 1L7XA 2R4UA 4EL5A 2QLMA 3BD6A 3DDWA 4AN4A 1FC0A 3FROA 1F0KA 2XA1A 4YI3A 3NP9A 1RZVA 3BCRA 5DLDA 2PYIA 3HBJA 1FU4A 3MT8A 1C50A 1WUYA 2C9ZA 3WAGA 1XL0A 1GPYA 4N9WA 5GPBA 2HY7A 3T7DA 1B4DA 1XOIA 3ZCSA 3NAZA 4RBNA 1PNVA 2GJ4A 1WW3A 1AXRA 1P2GA 2VCEA 4LEIA 1JG7A 4X6LA 1PYGA 3PE3A 3D0QA 1Y8ZA 3WC4A 4GYWA 2X6QA 3L7BA 2QN9A 4N3CA 1F6DA 4EJ2A 3MRVA 3EBPA 2QRQA 2G9RA 4MI3A 2R68A 2QLLA 4RENA 2G9QA 1NOKA 1FTYA 3E3LA 2IEIA 1LWNA 2IW1A 1FTQA 4MICA 2XGSA 2C4MA 1LWOA 3CEMA 3ZCRA 2GT1A 1XV5A 1YA6A 1XC7A 4FZRA 4AMGA 2XA9A 1UQTA 2SKEA 3L01A 4RIGA 2QRGA 3G2KA 3CUTA 4CTNA 1Y6GA 4MHOA 1P2DA 1L5SA 1L6IA 2GEKA 1ABBA 4NEQA 1E1YA 3CUUA 3S28A 3ZCTA 4BQIA 3D1JA 3NP7A 3T3GA 2XMPA 3HBMA 4M7PA 2QRHA 2QZSA 1FTWA 2QN1A 2OFFA 2ATIA 4BQFA 2F3PA 3G2JA 1XL1A 1GG8A 3UYKA 2BFWA 1Z8DA 2IYFA 2JZCA 2P6PA 4GZ5A 1C8KA 1NVKA 3HBFA 3G2LA 4RIIA 4Z5XA 4YUAA 3NB0A 1P29A 2BISA 3CEHA 3HBNA 3E3NA 1NOIA 5JTTA 4HLNA 4BQEA 2F3QA 2XGOA 3S2UA 3CEJA 1EXVA 1QKJA 4GZ6A 2QNBA 5DXFA 3MRTA 3OKPA 4RIHA 1JEJA 4WACA 2XCIA 2XGMA 3MSCA 2QN3A 1GPBA 2ECPA 2R66A 3G2IA 3AMVA 2GPNA 1Y6FA 1Z62A 1M5RA 3T5TA 1PN3A 1E4OA 1UQUA 2ZB2A 2IUYA 1V4VA 4MHSA 2QLNA 1JIXA 3ZCQA 3RT1A 4AY5A 4PQGA 2F3UA 3RSZA 1J39A 3OY2A 2QN7A 2GM9A 4N39A 2FFRA 1O6CA 5IKPA 2H1HA 1WV0A 2XA2A 2Q6VA 4CTOA 4N3BA 1P4JA 3CUWA 1L5RA 1WUTA 3ZCUA 3BCSA 3MBOA 2F9FA 4REMA 2C1ZA 2VSYA 3RHZA 1IXYA 1VGVA 5IKOA 2QN8A 3OT5A 4EL0A 3G2HA 2VCHA 3OTGA 1YGPA 4GPBA 3VDMA 4F96A 3NCHA 4NESA 3CX4A 4BFCA 4AY6A 5TMDA 2O6LA 1GPAA 2GEJA 3CUYA 2IV3A 3IA7A 3BDAA 2AW3A 3H4TA 4KQ2A 1AHPA 4L22A 5LQDA 2KS6A 1FA9A 1QM5A 2JLBA 5TMEA 4KQMA 2G9UA 2ACVA 4FKZA 3T3DA 4XI9A 3VDNB 3CUVA 2IYAA 7GPBA 1FU7A 1RRVA 1WW2A 3O3CA 2VG8A 2G9VA 1SXQA 3COPA 2SKDA 1P2BA 2X0FA 4QLBA
chains in the Genus database with same CATH superfamily
4MEAA 1ZH8A 1H1LA 5EHIA 2WJHA 5JTUA 1XCLA 4Q3OA 4AECA 1E32A 1IUOA 2CMFA 1GAEO 4RVCA 2QD1A 1X1CA 2W6JA 2OM2A 2XAUA 2CK3D 5LLSA 5CA0B 3I9FA 5L3VA 1CUXA 3H6KA 1J06A 1MH9A 4DRXA 1V9LA 3SQWA 5KNLA 4U2FA 4GKJB 1Z5PA 2IXGA 5ECYA 3B8HA 2KI5A 2CXSA 4ZJZA 2D1RA 5D2CA 4MP8A 4G1VA 2DPMA 4RHYA 1CW2B 2OD7A 3N8KA 2ZS7A 3AM3A 1SG9A 5CVVA 1VIMA 4KWCA 4CKWB 4E3ZA 4Y3UA 1TOAA 1ZOOA 3AI3A 3TJZA 2QU7A 4MRRA 4XB6B 3KFVA 2PCLA 3B1ZA 3QXCA 2JFPA 1IVNA 2BLNA 3Q3CA 3AKDA 1P1RA 1E59A 5AUPB 2ZGVA 4ZICA 4BBJA 1DU4A 2LE0A 5HKAA 4G1MB 1Z4KA 4MI9A 3KJXA 2Z1DA 2O2XA 4BLOA 4GYJA 3ZHSA 1A5ZA 3LXMA 1ANKA 1CUZA 1T0IA 2EEZA 4V0SA 1C7QA 1TA9A 3LHIA 1UKYA 5F3DA 5BYKA 1SUEA 1LBIA 2CD7A 1EBUA 3KKMA 4DCNA 2RHOA 3BF8A 4DYHA 1FLVA 2ZR0A 5LA6B 5TEWA 1KI6A 1Z74A 2I1WA 2ZJYA 3KL2A 1SXHA 1BFUA 1I01A 1YIDA 2HJWA 4PLWA 4X1KA 4ZAYA 4RKRA 3V00A 1DI0A 1I1HA 2F48A 3MQFA 1JR2A 1GZ5A 3UPUA 1WMBA 2CSXA 3SG0A 5LL6P 1ZNXA 3IELA 3MEQA 4CKYA 1TQ2A 3LAWA 1GQRA 3G0IA 1EFLA 2PZBA 3CZMA 2EYQA 2RG1A 1KZYC 3U3JA 5F98A 3RIHA 1E1CA 4G1FA 2Q3BA 1B8VA 1D7AA 1LK5A 4WXRA 3SJCA 1TMOA 1RKVA 1EFVA 1OFUA 1USGA 5ALGA 4C20A 4LY9A 3PTAA 3OZSA 4N12A 1I8TA 1ZISA 5BWBA 1UMDA 1VHTA 1LDNA 3H1AA 1IPFA 4F91B 1I2MA 4D43A 1RR6A 1KJNA 4KLCA 4YJ3F 3ZV3A 5BNFA 4M60A 4RAQA 5FR1A 2YDXA 1UWCA 2P3OA 2UZ1A 1L5HB 2VWPA 4JZYA 5AOCA 3U80A 4A8TA 4RADA 1LDMA 3H3XA 3VR2A 4ESEA 1XCOA 3BD7A 4HNUA 2X0EA 2AMFA 5IK2D 1IQPA 3B9PA 1IY9A 1JF8A 2V55B 2WAYA 3ORRA 4QUIA 3UAGA 3UJBA 4DT1B 3JARA 3KZ1E 1SD5A 4CTJA 1R8SA 1K7EB 3E9EA 1ILEA 4AD8A 1AKYA 1UH5A 2FETA 1SCKA 3KKQA 3H1TA 1NDQA 3C74A 3JQ7B 4TQUS 4JQCA 3A06A 4R1UA 2CXHA 1ZZGA 4DDHA 2P35A 4CHGA 3DZJA 4F8YA 2D4AA 2YBEA 3C24A 3IMGA 4QO7A 1EFKA 1HE2A 2R8EA 4E1AA 1X9HA 4ZDIA 1IQ0A 5CB6A 3I30X 4EG1A 4KOAA 1OA1A 2C9OA 3BEOA 3ONNA 1PW7A 1QRRA 2V5UA 2ACWA 5J4HA 4A5OA 3E5NA 1WKCA 1U63A 5JSZB 5IFKA 3PDHA 5JXJA 1RJGA 4FQ5A 2ZPAA 3HB0A 5F78A 1TEXA 5IVIA 1A04A 3WNQA 1N0VC 1E79D 2B1QA 4TT3A 3ZBQA 4CQMB 5I48A 1I4WA 4KSBA 2B4YA 3PI6A 3S29A 1M74A 1KPHA 4KNWA 3L05A 1KZ1A 5AJWA 5DK4A 4AIIA 3U16A 4FT4A 2Q6LA 2V7PA 5DLPA 3AKZA 2HF2A 3B3FA 1F1JA 4DUPA 2R6DA 2X0DA 4DY6A 2V4ZA 2QTRA 4E4TA 4ETIA 2ONZA 1OIXA 1H2HA 3L46A 4WADA 1CJKC 1YZHA 1IQRA 1K0FA 2JFZA 5HF8A 4AJKA 4AJ2A 5KTPA 3U17A 3CNOA 4EO7A 1QFMA 1QO9A 4HAUA 4LZPA 4HDQB 4PGAA 1TYCA 4AC9A 5AW2A 4TLEA 1GKKA 3STWA 3GCDA 2P27A 1FLNA 1KFCB 3LPDA 4ZCPA 4CQNA 2VNAA 3GB9A 4O4LB 5DLEA 2BMVA 1K1EA 4YDHB 3ZE7A 4DJDC 4FFWA 4RNCA 1U7XA 4ZI2A 3OUUA 4HN4B 1EGAA 3F78A 2F43B 1HE8B 2X4IA 3GA0A 4Q37A 4DMMA 1JMYA 3A31A 1M3SA 4H0CA 2GFQA 4HNHA 4UFOA 1NNEA 4EY7A 2GRJA 1RKBA 2XDAA 1PUIA 4RPLA 4QOEA 1WCIB 4HNAA 1Z5NA 4H1HA 2GLTA 3M1AA 1NVVQ 3Q3EA 4OX9Y 4JVOA 1XXLA 4EG6A 4N01A 5M3BA 2WF8A 4UE2A 5REQB 1NKSA 3F1LA 2DR0A 4PAQA 4EJ6A 4GQIA 5CURA 3VAAA 3YASA 3F7MA 1L7XA 3P2IA 5A9TA 5TNXA 3H97A 4M9QA 4EL5A 4XDHA 5AP9A 4LF9B 1ABEA 3ZE8A 3RI3A 4E0BA 3AL0C 4AJEA 3UC5A 1UKBA 3TLMA 5EJMA 3SJUA 4LGVA 4EI8A 3B5IA 3G85A 3WMGA 2IZ6A 5JMWA 3NANA 1RZVA 2WTNA 4NS4A 4IS3A 4RKEA 3ETDA 4F71A 1E96A 2ID9A 4HD8A 4S3MA 1CK4A 1OU4A 2G7ZA 4LQCA 3HU1A 3WGZA 3H8JA 4YT5A 1JG1A 2IIVA 3AR4A 4MVCA 1OX4B 4QJ5A 5EJ7A 4JXZA 3T15A 4A2QA 4R7TA 1TVEA 1W46A 4KFUA 2Z6AA 4WRRA 3PD0A 4FNOA 2JIZA 2WUWE 1DBVO 5EZQA 4Z0NA 2C77A 5ES4B 2FHPA 4C30A 2BFFA 8MHTA 1Y4UA 2H4YA 1KOFA 2EBHX 3WWZA 1H3EA 4OOEA 1SA0B 3LGXA 4PHFA 1XRJA 1FP4A 2O2JA 2B7BA 3IRUA 3M82A 5AOBA 3A9VA 5KWJA 2G4CA 1DOHA 1VL6A 2X8WA 1NXPA 4C7MA 3K0AA 5BMVB 4KODA 1ESCA 1WCXA 2PSFA 1PNVA 4P6VF 4FHDA 4XLZA 1GPLA 2CJFA 4YAJA 3BWBA 1S2DA 4TV9F 1YTLA 3MCTA 4I55F 3RABA 1NVBA 1CZUA 2PL1A 2FEXA 2VJAA 3V1NA 3WNCA 4ENRA 3AVYA 1W0CA 3V32A 1QOQB 4DS3A 4C2TA 1AE1A 4AYXA 3FNBA 1M8KA 5IZCA 1Y3BE 3VH3A 2PKYX 2E49A 3RSSA 5LYJB 3DJFA 2BSXA 2RHTA 3D6TB 1N5DA 3TKLA 1KI7A 4RL6A 4M22A 3NGMA 3CPHA 3S2YA 2HWYA 4LXGA 1U7OA 1V1MA 2DUMA 3PCRB 3ABIA 1KXJA 4OU4A 2AD1A 1Y5LA 1RQXA 1JKJB 2GN4A 1FZQA 5AKZA 1VHDA 3EGXA 5JYEA 4LWQA 1R18A 3HCEA 1W85A 1XJ0A 3PFBA 5AVOA 2IZOA 3TH5A 1YMQA 2AZTA 2QRJA 4P92A 1DPFA 4RENA 4XH9B 4Y7DA 1E5LA 4RD4A 2CHFA 3AHJA 3U4AA 5LMNB 1XXHB 3UH0A 1J33A 1FF9A 2Q49A 4RGBA 4BVKA 1YGYA 4IJ5A 1OWMA 2ZANA 5AJZA 1KY4A 2MSLA 3DOJA 3RUAA 1YDMA 3MLEA 4LZNA 1EH5A 2DG2A 3A1DA 3RVMA 4FYPA 3K05A 1Z7WA 1DC6A 3KHKA 1UK8A 4NYJR 3CINA 1M2VA 3GG9A 2QRGA 3BXFA 2A57A 2CXRA 2FFHA 1GWNA 4G5RA 4I50B 1FXWF 3DUFA 5DGTA 3TB6A 4CTNA 4WJLA 1GCIA 4FILA 4D6PA 1RPAA 1L4MA 1PQPA 1E69A 2PO7A 3IDQA 2BYTA 3FB1A 1X1QA 3SX2A 3RTEA 3D81A 1ZHHA 4YP7A 4J1QA 2ZETA 4DLUA 4HB2A 4P3OA 4QBGB 5KX5F 1VBFA 4C06A 4LCEA 4AY3A 3D1JA 1PGJA 4OQ4A 1CJMA 1DJLA 3OPYB 2VRWA 1UBEA 3FKSA 3LP6A 1K97A 2HO5A 1F06A 2E4WA 5FUYA 2BUAA 5BSHA 5JAZA 1Z36A 3ZHOA 2G17A 4JUFA 3I3OA 2E4AA 4U9HS 5KMGB 3EGDB 5SYNA 3NWBA 4YAUA 1ZAYA 1EVLA 2PSSA 3SOPA 2P5YA 2BSAA 4TTPA 3ZHYA 3C8MA 1V7QA 3IHKA 1Q3HA 4KXQA 2QJWA 3G2JA 4PPNA 4YAFA 3BJZA 3ADCA 1D07A 4URVR 2FW8A 4TLLB 5C4GB 5JASA 1ZH4A 5KU7A 2JLYA 3K70C 2WU0A 2FLVA 4K0RA 2YZMA 4OIMA 3KRTA 2ZYRA 4MKGA 4Q82A 2Q62A 4AWAA 1I3KA 5F9FA 4AKHA 4W8GA 3R9XA 3HUEA 4PYRA 3HXTA 1V3UA 4YMUA 1NQXA 2DBVO 3HNOA 4MK4A 3NHZA 4IIXA 2AEFA 4CCYB 1ZJZA 1ZUD1 1OVMA 4O4JA 1PR1A 4EECA 4EQ6A 5I3CA 1R00A 3TTUA 1OXTA 3DEYX 3W4JA 3JAKB 4FZJA 4X84A 4B8YA 4KDEA 3RS8A 2POQX 3D4BA 4IEEA 3H1BA 1T5DX 3FPGA 3OD5A 3TLCA 2AEJA 4K03A 1Y8RB 1JJIA 4YAOA 2GJKA 3CH7A 4NMWA 1IZZA 3M6LA 5DRYA 4W5TA 3P4XA 3KB2A 2GZ2A 5FWDA 4AWXA 4REQB 2XTJA 3IV6A 4HC4A 2YDYA 4TMVA 4C4XA 2W4MA 3ODPA 2B4RO 4GMFA 3WL7A 3IIEA 3KVVA 3ML1A 3HYLA 3R7AA 3VR3A 2NXWA 3D4LA 1KBZA 4O2AB 5C37A 2OFWA 4LDNA 4GHWA 1AF7A 1JEEA 1QFJA 5EIFA 1JBKA 4EKDA 1JI0A 2RIPA 1C1DA 4HWPA 5FBRB 1N0IA 2JAPA 2KSQA 2QSJA 3MA0A 1HOTA 3NG1A 4XB2A 1W5AA 5DI3B 4EB8A 3N7AA 4BMDA 4WLVA 4QTXA 3JASA 2A30A 3E0QA 3O1HB 5EUBA 1ZM4A 2XCQA 3Q8MA 4AJ1A 1Z6GA 3FPBA 3Q41A 2QKYA 2W2VA 3CW2A 4IDAA 4PGHA 4U9IS 2F1OA 3MJFA 4MHTA 1PN3A 5MGNA 3AFMA 4TXMA 3DOCA 5DHUA 1R37A 3TBKA 2C83A 2IUYA 3KPWA 4GG1A 4R6WA 2R6CA 5LQNA 2AI3A 2NO0A 3SZRA 5JNRA 3FDZB 4YP5A 1CS4C 2VRCD 3ZU5A 3BERA 5KS2A 1AC5A 2XUQA 4FYMA 1U2SA 4M87A 2PUCA 5T57A 1T0HB 1XA4A 1SC4A 2ORWA 1T9HA 3OE5A 5KKNB 2PGAA 3AHGA 2Y76A 4MUNA 5AKJA 2H1LA 4UJ5A 4L72A 1QOZA 2FX2A 3V34A 1V39A 2B7CA 3PPVA 1GAWA 1T8WA 3U61B 5KPDA 2GM9A 3ENWA 1ZO8A 2DH6A 2H2DA 4A82A 2X22A 4AF7A 4QT0A 1ZCAA 4WDQA 3A3NA 3PLAE 2QRNA 3QQ5A 4LPSA 5HQJA 1AN9A 2WABA 4FHCA 3LZCA 3GVHA 3CCBA 4NMHA 3OPVA 5LSAA 2VF4X 1LS1A 4XYGA 5C1PA 1SUBA 1P5HA 4XUDA 1X1RA 2BSQA 4P4SA 1IOLA 1M2EA 3Q6NA 4FS3A 1ESZA 1SIBE 3DNMA 3VNRA 2CKDA 5BXYA 2FDCA 4G4IA 4UDOA 3NEJA 1XDZA 3QBTA 4EP1A 1Q14A 3T1TA 4DMCA 1KDPA 2IXEA 4ARBA 1BDJA 4DJFC 2WM2A 4TGLA 3STXA 3FLEA 3VBEA 4GLJA 5GADl 3CX4A 1PX2A 3O9ZA 2FJUA 2ZPTX 2BMEA 2QPTA 1GYPA 4JR2A 3COJA 2CNOA 4DNFA 1V8BA 3EY4A 2QPAA 2CV2A 3LUBA 1Z2DA 2FOXA 2FQYA 1E89A 2R2AA 4BO7A 1RPZA 1RDFA 2J9ZB 2JD1A 2UVQA 1P7WA 4GYKA 1OX6A 1C30A 5D86A 3OOWA 1FSSA 1J9GA 3IDZA 2ZXFA 1MCZA 3U37A 4DABA 2QOEA 1JIJA 3O38A 4XJXA 2OAGA 5G0WA 2BCEA 1MPXA 1Y1LA 5LP6C 1FX0A 3OIFA 3O4RA 3DEJA 5E7QA 3VO8A 3KJEA 1MA0A 1EXVA 3UGTA 2DR3A 2G06A 2ZJAA 3DMNA 2YZ2A 4PO3X 5A5EA 1OYYA 1FDOA 1K4KA 1SOAA 1TUGA 1XD2B 2BI7A 1CF9A 2DAPA 2NQ2C 3QKSA 4OQDA 1ZR2A 4OEHA 1BOFA 1ZQ1A 2LDXA 3I9NA 3K1YA 1V5WA 2RGNC 4LGMA 4XDYA 1ZINA 5J5CA 2B1IA 5CM8B 1LRKA 2SKDA 2GCIA 3KJGA 1AGYA 4TL6A 2GN6A 3DKKA 3K4QA 2VXBA 4BAUA 4D45A 1G7RA 5LMCA 3IKTA 2RHDA 4L0QA 1UBFA 1CR0A 4XJSA 3JQ6A 4CZ2A 1PUJA 3LL7A 2D74A 2YWJA 5AK3A 1CHDA 1TECE 2Q28A 1L7DA 1WM1A 3LVQE 3RS9A 3L18A 3Q0IA 4DIDA 3D4NA 3R41A 1LDBA 2P9FA 2BJVA 1JR3E 1SO8A 1R0CA 1F2UA 4CKEB 4D3ZA 1NHGA 1YR3A 2BELA 5KYWA 1G6KA 2CF6A 1CB7A 3ZC3A 4Q6WA 4OQZA 2NIPA 1Q12A 1QKIA 2HBZA 1S96A 1G17A 2VPZA 4JEMA 2VUIB 4L4YA 5B3JA 5IMBA 3TOCA 3ICQB 1KE2A 1QS0A 3JZMA 3L7MA 5E1MA 5ILGA 5K3AA 3RBAA 4F8JA 2WWYA 3DNFA 3MERA 1XRMA 3K20A 3ABRB 5BOVA 5KTRA 4MR8A 1XRLA 4F9EA 1KZ9A 2XBUA 2YWCA 1YIOA 2GLUA 2HA0A 3B1YA 1K5HA 2QGZA 4LZAA 1KTIA 1FJHA 1ZNYA 1AK1A 3OZWA 4GEKA 1MIHA 4KAFA 3ZH9B 1W49A 1Z18A 2C2ZA 5BVHB 3ZJVA 1D9ZA 2JRCA 1HT2E 2BM1A 2O23A 3RSFA 4OREX 4YCDA 4U7PB 1GFIA 1XHEA 2EZTA 3PNKA 4P5EA 4V0ME 2H65A 2VO1A 4FU0A 5BWNA 1YMVA 1Z22A 2H31A 1SKUA 2HJGA 2VHVA 1DEHA 3G5TA 1VB5A 2WAXA 1ZCBA 3FCAA 1BXKA 4PLGA 3IULA 5HEKA 4E5PA 5DMHA 4F11A 1GNPA 4PFJA 4AMVA 2E89A 2XTMA 1M1UA 4P3PA 4N5MA 3DVQX 1JEYA 1RD4A 3CB4A 1YULA 5DTJA 3G2PA 3ER9A 4QEZA 4BX9A 5E3JA 4AMBA 2Z56A 1DRJA 1HEIA 3STVA 3H2KA 4PSCA 1U4OA 1BH2A 4GFDA 1YRQA 4GOXA 4RWZA 4PANA 1QDEA 4KV9A 2DKOA 4NR0A 4G67A 1UJCA 3VUEA 4F6LA 4B5KA 3BGOS 2ZAYA 1W1WA 3F1KA 3OESA 4MI6A 5BN5A 2H1IA 1P2UA 3O47A 2IEDA 4CL0A 4NOLA 3AR2A 3P8ZA 5EJEA 2HI0A 2GN1A 3G1UA 4IV8A 2PBFA 3L7CA 1UF9A 1OI2A 4IILA 4O08A 4Z4CA 3FOEC 1TNDA 1CC1S 4RAOA 3RAFC 4I5DA 4RFSB 2R1VB 2ZIXB 3W5UA 1RYYA 3FMOB 5DCWA 3DEIA 2A5YB 3SAJA 3SZMA 1LVHA 4CIYA 2WKRA 2RHHA 1C8LA 2G6BA 4KQ1A 3GEGA 2PRIA 1AK9A 4N03A 4BFTA 1CNEA 3VSEA 2AG0A 1ITZA 2O4CA 3KZKA 2GZMA 4HLUA 3TFWA 5KIAA 5BNWA 3U9SA 2VF5X 1HMYA 3IAS6 2AMVA 1IE3A 3M2PA 3LUCA 4ZANA 5J3JA 3PDCA 1KYXA 4D9EA 5GGXA 4EY4A 5LQKA 1OYVA 3PNLA 3TZHA 1X2EA 1ISIA 4UMDA 4DMGA 1FMFA 5H5JA 2Y9PB 4J94A 2GVNA 5BUSA 1TUBA 1GZVA 1SG0A 1UIRA 5K3EA 3B6MA 3JQQA 4G37A 2W42A 2YMMA 3OURA 3FJ1A 4RXTA 1M2NA 5A0VA 1AGNA 4ZCQA 4I8XA 1F2TA 4L5JA 4DDVA 4B4UA 2ZRCA 4RH1A 1W5EA 5EYPB 2XB4A 1DMRA 4DR5B 2H18A 4OATA 4ZJPA 4RSRA 1UAAA 4UU8A 1CR6A 2Y2UA 2C8VA 2QMUA 3TRFA 4YCSA 3TLXA 2I29A 1UZUA 3B7PA 5F9HA 4Z7NB 3NT4A 2V3CC 5TC4A 1THGA 2C97A 2EBWA 2HCBA 4KUEA 1LPPA 4WLFA 1J2EA 3RRBA 3V8MA 3DOUA 2EJWA 1Y5IA 4UEQA 1BXRA 1SIOA 4IWYA 3NMUF 3GXBA 1Z6ZA 1IOWA 4XD7D 5K0CA 3INGA 3ADDA 3D2BA 1P2TA 1ZI6A 4LKRA 4OUKX 2HT6A 1YQEA 4H6PA 5JRJA 2BGNA 3O95A 4MTLA 3AVTA 2YW2A 1J42A 4AL4A 2EW2A 2FLKA 2ZIZA 3VZBA 3C3KA 1GIAA 3GJ3A 4NCXA 2BGKA 5IF9A 3K31A 3WYFA 2IRWA 2XNDA 4QJ3A 2Y77A 1ZXBA 5H8WA 1JHXA 2FWPA 3D9QX 4QELA 3EOBI 4Y2PA 5I7EA 4OI0A 3GOQA 1DINA 4WOBA 3SS8A 5SY9A 5EP2A 1FBTA 1MP0A 1T25A 1DPGA 2FPPA 2VBIA 3MTDA 4NJOA 5FRDA 3LGAA 1M2KA 3WISA 4EA6A 3QENA 5EUMA 1BCRB 3RVOA 1XAJA 4P38A 4RIEA 2RKWA 1R6TA 3ZWKA 5C32A 3ZDBA 2H7XA 1J23A 4K87A 1CD5A 1GO2A 1ZG3A 3QUAA 2K2WA 2H1VA 3HC7A 4WN3A 3Q12A 4GX5A 3VA7A 3V4ZA 4EAAA 4WLNA 2C2OA 1JA1A 1MO4A 3P2JA 4MQFB 1OI7A 4GI5A 4G5QA 2A86A 2QP3A 2RAPA 1F60A 1CJVC 2R87A 5E6RA 3TSAA 1WVGA 3E70C 1W36D 3BVPA 4NLLA 4BVBA 5AVQA 1TEVA 3MAJA 3QV1A 5LU9A 1BX0A 4Y0NA 3CKLA 1CE8B 2NNLD 2CLKB 3FB4A 4HADA 4TUYB 8GPBA 5KC8A 3DJYA 4XM2A 1YDGA 1ZIPA 3QI7A 3O2QB 3R8CA 4IJUA 4HNVA 3QFCA 2VR1A 1V5FA 3NM6B 3I61A 1K3FA 3KLPX 3HYRA 4J90A 4CWAA 3WOHA 3A8TA 1EB9A 2GUGA 5CD1A 1B6RA 2JAXA 1M76A 2H9YA 4XOIA 1T26A 2O3JA 1MC5A 3B1VA 3D8RA 1YUBA 3THXA 1QDUA 2AI2A 4F3TA 1N8SA 3I9LA 3ND9A 2EEPA 3DYIA 5ALJA 3WLNA 4CM3A 1SK9A 1WNFA 1U8FO 2F00A 2DE0X 3I8OA 1A9QA 3EE6A 4M8LA 4W9NA 1NM5C 2IOFK 1FU4A 1KQGA 2ASEA 3MT8A 3W7AA 2GJAA 2VQSA 5JH7B 2J6IA 3H9EO 2O4UX 2WMOB 1Q7RA 4H7JA 1C9NA 2NSJA 2PPVA 4J0DA 4KN8A 5CW2A 2WLTA 4A73A 4D3SA 7REQA 2HJVA 1ISSA 3OEHD 4M99A 2PZEA 1EK1A 2FA9A 2QVGA 1KMMA 4PYJA 2X3UA 5H7XA 1DLIA 2FSIA 2GWHA 5ALZA 1QP4A 3P19A 4RBNA 1JP7A 3G6WA 4D8TA 1I3MA 3HCWA 4WN9A 4ZREA 3K0BA 1WW3A 2ZJBA 1NV8A 3ZHZA 4S1VA 4O4JF 4Q9AA 1T2CA 3IOMA 2VP2A 3IDOA 3PCTA 3PXBA 4MMZB 2AOTB 5DNDA 5DYTA 5JECA 5JBQA 4BYMA 1MO2A 2WYOA 3UMFA 1VHQA 3FNIA 3RH0A 3VZCA 4LXHA 2ZYHA 2I0FA 3ABOB 3BWVA 2I71A 3MCUA 2NV6A 1X7GA 1EP2B 1CRLA 1HBJA 2O2DA 3OHPA 3Q8XB 4I5GA 5CH5A 2X6QA 3L7BA 2R79A 2XJ4A 5FPHA 3L6EA 1ZGGA 2C4WA 3BQNB 2PWAA 1E9BA 2L18A 2P9CA 3FCUB 1I0IA 3FWHA 4DIBA 3NNDA 5CA1A 3QOXA 2FB9A 3C3MA 1T4CB 2CLCX 3K8ZA 2J46A 4MO2A 4WW0A 1RE1A 5FCDA 4MV5A 1OBFO 1QVRA 4PG8A 3MSXA 3O4VA 3QFFA 4Z2AA 5DBHX 1LCIA 5JCPA 5HBGA 2PLNA 3PEFA 4OHZA 1H2FA 4IDGA 4A36A 3HS3A 3PVZA 5EXSA 4QKQA 3I05A 1W1UA 4NATA 2WZBA 4HQRA 5C8ZA 1QAOA 4M0CA 3V6LA 2QMYA 3OHSX 2UZ0A 4KXMA 4J6EA 2I62A 5DCLA 3H04A 4IBOA 1II0A 1QZUA 1XV5A 1YVUA 2Y8EA 3NVAA 4MV0A 3PA8A 5DM4A 1E6LA 2ADMA 3CRRA 1F14A 3ES9A 3QJGA 2QLBA 2QUBA 4OJTA 5E6SB 1YZ3A 2COUA 3SLKA 3WAKA 1CYDA 1PWXA 4FP9A 5ED0A 3TZ6A 2GI4A 5JOQA 5I01A 2Y1LA 1DB3A 1C8VB 1SBHA 4Y2TA 4DV0B 1FFWA 1AHIA 3UTCA 5CFZA 1A1SA 1T9AA 1D6NA 1R12A 1X1TA 4CT0A 4KCGA 3FHTA 2AFIA 1QHEA 2B4AA 1JT2A 1U5BA 1WLYA 4L8VA 5FWNA 3KUKA 3UXHA 4QQKA 5IBQA 1EDOA 2AFRA 4DV1B 2NYRA 4QFDA 1LEHA 2DTXA 5BN4B 3PQ6A 3CWCA 3USZA 2JIBA 4GWKA 2ACKA 4O2BB 4R0VA 1R8YA 3OLCX 3VPAA 3PQ2A 3OICA 1U9JA 4KLRA 1L7EA 3A9UA 3NTUA 3G5LA 3JQ8B 4WZAB 2IU0A 3ZE2B 4CIAA 1MX9A 4FN4A 3ZD6A 5KNDD 5AICA 2W2MA 3RK4A 1O95A 4J16C 2GZHA 3CG0A 4ALMA 2A1UA 1UBTS 4K88A 1WUIS 3CNHA 1A69A 2BVNA 4RTLA 3S2EA 2PX0A 3BIWA 2VC2B 4CKCB 4LSZA 3WV5A 2HLDD 3I58A 1KZ7B 3W3AD 5AD1A 2F3RA 2VF2A 3DGEC 2PNFA 2VZ9A 3PJDA 1Y9ZA 3TVTA 2P8JA 4CR7A 1GVHA 4IFTA 4DLZA 2GFIA 3ESBA 1D09A 4XPIB 2ZVPX 5IJWA 3KTDA 2YHIA 3WIEA 5MN6A 3DDUA 5CNMA 3RODA 2EL9A 5F35A 4DCJA 4EG5A 2I4OA 1FNNA 1FDTA 3OE7D 3LA8A 3AJAA 2HN9A 4ZGWA 5EJIA 4O1IA 1EFCA 4Z54A 3WB9A 4HDOB 1N1MA 1OIVA 4M8NE 3WBJA 5I7UA 2B2NA 2WWHA 3BWXA 4ZO9A 3LCRA 3W9UA 4DL9A 4MGKR 3LVBA 5IDYA 1IAVA 5EQFA 1Z12A 1MPTA 3IPRA 1KI9A 3ED5A 2FMHA 5I7AA 3M9LA 5IAEA 1EUCB 2VNKA 4LV8B 1G0NA 3TF5A 2PUGA 4LGCA 3OOJA 1HNNA 3C5WP 5JFOA 5AI4A 3PXUA 2H59A 2MJLA 2ZI7A 3BA1A 3OQBA 4KO3S 2XLCA 1AF4A 5CLLA 5ALYA 3HP1A 3A4IA 2RMKA 1TMKA 1Z6AA 4H7DA 3GXOA 4A0RA 3G79A 3BJIC 4QUGA 3I6ZA 1A9TA 4K8OA 1QG4A 3G49A 3OLVA 4EGJA 2OO3A 3L0OA 1ZN8A 5FQOA 2I9PA 1PLKA 3QBEA 1ZD8A 4RYLA 4EFMA 1U2DA 4Q4HB 4Q5IA 3PC2A 2P4SA 1VJRA 3OIYA 3A1TA 5E6UA 4C1BA 3FF4A 3CC8A 2IPOA 3OX3A 5P21A 4J3NA 1TM1E 3RHFA 3V4OA 3WG9A 5B57C 1Y9DA 5H4GA 3TECE 1Y37A 2QN3A 5JG7A 2OO5A 5BW5A 3QG1A 1LPMA 5FUWA 4TZ6A 4YFYA 5IJ0B 3LBHA 4CM6A 3KZMA 3LX5A 1VECA 3RUDA 2FZGA 3UMVA 4CETA 3PPIA 1XZMA 3DCIA 4LYFA 4PHTA 1UQUA 3VC2A 1M2GA 1WLSA 1P0FA 3FLMA 1XQ6A 1T9GS 1U8ZA 3DBVO 3S5JA 5JIBA 4V02A 1Z4OA 2WG2A 4DIKA 3FSGA 1YO6A 1G3RA 2I8LA 1ZD1A 1N1DA 2ID8A 2WHRA 3GT4A 5EP3A 3ETNA 4CMHA 2P79A 2UZIR 4HEA6 4J0QA 1KNQA 2G5GX 3T9EA 2UXDB 1WKVA 4DV3B 3IAM6 2XQFA 4CEHB 4D74A 1EKXA 3ROKA 3FVQA 3SXUB 4AG3A 3KJHA 4YRRA 1FBNA 3M33A 1UFVA 3FCXA 2XT6A 1U8CB 1B3RA 2KYRA 3PNOA 1VKRA 2I1LA 2AFHA 2YJ6A 1MJFA 1MZPA 2BJWA 3JTEA 4ZVOA 2M6RA 3RV3A 2FN7A 2IUTA 3VU3A 4PO1A 3NAGA 3EFEA 4YUYA 1J70A 4KR2A 1GTL1 4XIYA 2DP4E 3QXGA 2GAIA 5K6RA 2RHRA 3G5MA 4U3JB 3EZYA 4HGPA 2F8LA 4LRYA 4ESVA 3L4KA 3DM9B 3GLFB 2OSVA 5KCZA 3HA7A 4DV4B 1AV6A 1SBZA 3K1ZA 2WDPA 3T12A 3ILYA 1W34A 3LO5A 2GK4A 2RH4A 3OLWA 5EJ2A 5MDHA 3MRSA 4IJWA 4NU0A 1LDYA 1G4AE 2ISSD 1Q6ZA 2C29D 5L3ZA 2XMBA 2JL1A 3RTBA 4WKGA 5HIIA 2XTZA 1RQ7A 1RE0A 4WLOA 4ZZ3A 3LBAA 4H4EA 2PJDA 1TUIA 4J0FA 3EYWA 2NU8A 3RYHA 3DBHB 1W30A 1G8JA 5FB3A 4KR3A 3LF2A 2KMLA 1YFKA 1AS0A 1V1RA 4HTFB 1NGSA 4BNWA 3U5TA 4GOMD 5ESDA 5BQOA 3GARA 1CJSA 4DDKA 3CBQA 4NFSA 5JCOC 1NN3A 3BE4A 2BW0A 1KORA 3EGWA 4A0FA 2O59A 1VJDA 2XUZA 2V97A 2WM9B 3SKYA 1J9ZA 3T4XA 1S9DA 3T7CA 2W8BB 4KQKA 4G0UA 3HR4A 1F3LA 1NBMA 4YT2A 2D1FA 3R9KA 2VQ3A 3D8BA 3IHWA 3F6SA 4WNAB 3FYUA 1L7AA 1ATIA 1QR2A 3U9LA 4B79A 3KYIB 1GRCA 3FRIA 4QGGA 5J2TB 2DHCA 4DXAA 1H85A 1LSOA 4RD6A 2QE6A 1RT9A 4MQUA 4DARA 4GPTA 2Z2KA 2AN5A 3CZ4A 1F6WA 1N78A 4FKZA 2TYSB 1W4LA 3QLVC 4YMVA 1QNFA 7GPBA 3KHTA 2X0JA 2YVLA 5JD6A 2NSDA 1E1QD 2IDKA 5K9ZA 1CQJA 1RXVA 4Z53A 1V3TA 4FS8A 4BLSA 3C2QA 1YS1X 2J9RA 2WYVA 3K9GA 4NONA 3TMKA 4BLVA 2UUOA 5DM70 1U7ZA 2FPMA 2FMFA 1U9IA 3N2GA 3EWSA 4GM1A 4M9ZA 4DMFA 4EW6A 3PEYA 1W2GA 4JVSB 1UPUA 1VE6A 3C1UA 1A9OA 4XR9A 4EZEA 1KAOA 2EAUA 3UN1A 3VO2A 4I5IA 2KBEA 3JWEA 4MV9A 4RELA 4BPRA 4MJ3A 2QRZA 2XIJA 3GZ4A 4HJXA 2VI5A 3DTNA 4QEKA 3T3EA 5A62A 3INYA 3ROTA 1HQYE 3H4IA 4QOJA 4RKYA 1SQGA 2WWWA 1ZSYA 4OXXA 4E51A 1ZM3A 3LH5A 1CVIA 1W0JD 1OFVA 1TTQB 2X42A 5BSWA 1RRKA 5CX4A 5GZ1A 2OKGA 2VAPA 1SOVA 3WGUA 3MMPA 1AKTA 2PRSA 5JRDS 3WL5A 3MD0A 1EVEA 5K20A 2Q07A 4OP1A 4MAMA 4WE3A 1ZEMA 1HTTA 1G5IA 3OJEA 4UMFA 3P5SA 1UQRA 3R7BA 1E1RD 3FNQA 3WIUA 4ZCRA 4H3KB 3VI3B 3BIJA 2WTEA 3ADOA 2IYSA 3R5SA 4PIMA 5B7PA 3OQNA 4PYIA 1CUIA 5ALXA 4Q7QA 3K30A 3WP1B 4OB6A 1E3LA 2YFYA 2LIPA 4DCCA 1RZ3A 1GCGA 1T0UA 1XCGB 4I08A 1BVYF 5TF4A 4H59A 3D8SA 4BGVA 2FMIA 2R6GA 1W73A 2G67A 1GQFA 1CZOA 2VSNA 3KBBA 3LW7A 3MJEA 3OG9A 4LZLA 4CF3A 3ZX4A 4P3NA 5TPWB 4PCUA 4PSDA 3Q10A 5BYAA 2VP5A 1TI7A 2IZ1A 1GT91 2H2HA 3IB6A 4RVUA 3VHXA 2M98A 4B4DA 1E5DA 4P7KA 3V1MA 4EKYA 2RGRA 1KARA 3GPIA 1IHUA 3WVNA 3EW9A 5BV8A 3ANNA 3D31A 5CX1A 1ZK0A 2VJOA 2Q8QA 5ALPA 1R0YA 3AHEA 3GUUA 5FTKA 5EXTA 4YMWA 2GYUA 4RTSA 4MWGA 1O9GA 3SLRA 4Q15A 5E9QA 2KJQA 2NSHA 4JGIA 2WWGA 3L9WA 1JBEA 2ABWA 5ETJA 4KPEC 1XD8A 3NALA 3VSCA 3MT9A 3FPKA 4XFKA 4ED9A 5LNK1 1NT4A 1QQ5A 4KMSA 1VG1A 3RADC 3QOYA 4RABA 3BL6A 3HO8A 5C8YA 1F5SA 2QAGB 3Q3IA 5I9LA 1Z7YA 3DBRB 3Q7QA 1RKUA 1XKQA 2LR0A 4G5YA 4MYHA 5BN1A 4TZ0A 1W36C 4GOND 3WOVA 5TE9A 3AR3A 1CZHA 4FEYA 1GKYA 3NC1C 5JAIA 3GUHA 3PIRA 1DKUA 2ZVDA 5G1PA 1L4LA 1I24A 2AOUB 2E37A 3E1KA 4EHKA 5B1YA 4XX0B 1U94A 1A8HA 1RYDA 4O1MA 1P33A 3ORSA 2O8EB 1UJ5A 5ESXA 1UPTA 4BNGA 5SZHB 4QFMA 1LZLA 2WYWA 2C9CA 1GG2A 1UEIA 3A7DA 1SCIA 3QTBA 3R40A 4RK0A 4TQAA 4CW7A 3DS8A 2PAFA 2WJGA 3KWMA 5JAUA 5GP1A 2BEVB 3ASUA 1D0VA 3BOSA 3D8NA 1XRRA 1OH6A 1R9NA 2ZE5A 3H1EA 1NUHA 4G5OA 2BFOA 1V6AA 2F1KA 4QG7A 2C2GA 3H11A 1OT3A 4Y1GA 1XPOA 4P9NA 1DCKA 3UXMA 5FPPA 2O2EA 2QDKA 1NVMB 4N6NA 4PXAA 4JB3A 2BEUB 3FUUA 4HN9A 1BU8A 3V5NA 4YC7A 3ZCVA 1U28C 2HO4A 2XRZA 1XZPA 4A3SA 3OPNA 3VJLA 3WRYA 1CX9B 2IODA 2R6R1 4A9AA 3ZHRA 4A16A 1UBCA 5CA1F 1YCDA 4OXQA 1O7JA 2VEOA 1Z7GA 2F3TA 4WKBA 5ILQA 3TBFA 3CKYA 2CMHA 3L0PA 1JAZA 2IY9A 2KLBA 3N8DA 4J8PA 5CB4B 1P3DA 2W43A 3MELA 3OWOA 3U26A 2YXBA 3KTAB 2HHHB 4G3XA 4RHXA 4BU0A 1WF6A 4EG8A 5JMTA 4R05A 2BP7B 1D04A 4A1OA 3IGFA 4C7XA 4LY0A 4PNEA 3FYSA 4BP3A 3VU9B 2DMRA 4CJXA 3MWKA 1PK8A 2AEMA 2EDAA 4FLFA 2BN4A 2GYWA 2ONYA 2HT1A 4R5HA 1VCHA 2QTLA 2ZI3A 3LUPA 2DYKA 3ELWA 4ACAA 4G9EA 2A5JA 3ANYB 3F3MA 3I64A 4IUCS 2DHRA 1CEQA 5CA0A 2C5LA 3WYBA 2ZAGA 3FMPB 1TF7A 2NP7A 4B83A 3EX7C 4IFBA 1G38A 4NQZA 1X0VA 2LKDA 2P91A 3LFUA 2GN0A 5CHYA 5GJCA 4B17A 4POAA 4Y67A 3HJBA 5CITA 1KEEB 1ECLA 1FDIA 4CKWA 2AF3C 1OF1A 2H4FA 2WOOA 4L5YA 4PLPA 4M89A 1YF3A 2JFWA 2YIMA 3MMNA 2YHUA 3FPAA 1YZUA 4OB8A 1O8BA 3FROA 3HJUA 5KAMA 1JG4A 4X00A 2GPYA 3EGOA 3SDBA 3ZE6A 1PTKA 2FW9A 2JI6A 3DVRX 3TGWA 3UJ7A 2GUWA 3VDRA 3PNMA 3W2EA 3W2TA 1EUQA 3NP9A 4TTVA 2XUOA 2NZUG 1PL0A 2SBTA 2F9LA 4M8SA 2Y92A 4KACA 1H9BA 3HVRA 1RQ2A 4UM9D 1OY1A 5IMSA 3RBXA 2DFDA 3WMFA 1JAIA 5CAEB 2ZVQX 3P1JA 1VI5A 2HHAA 4LJ4A 1HDXA 2BTOA 1BA3A 1GILA 1WX1A 4U7DA 1Y4AE 4X1IA 5CG1A 1MN6A 1KWKA 3RS2A 5LA6A 4B34A 4DLAA 2OECA 3LCUA 4W5QA 1GAXA 1NJGA 2G80A 2X0RA 1P74A 3IUMA 1CFJA 2Z1NA 3RRZA 2GNPA 3WYCA 2DQKA 5HKKD 3EJ6A 3U7GA 2GOYA 4HWRA 3TIFA 1T8UA 2OV8A 1XRNA 1OKKD 3I0NA 3KR1A 4U2EA 4ZRNA 5CT6A 4UBIA 5LBIA 5EY5B 2P9GA 4LDQA 2VUSA 1U3DA 2P6UA 2Q5OA 4LXUA 1F8YA 4OQPA 2C4VA 5J43A 4TVBA 4JCCA 4QGHA 2ORED 4O8ZA 2BAGA 3L6CA 1GZ6A 2RI0A 3VSDA 1XD9A 2WINI 2VDQB 4YEDA 4FVTA 1QAMA 4N47A 3NJ4A 1VJCA 2FHSA 1FQWA 4L27A 3TFQA 4UUOA 3RFUA 3PJEA 4KYIB 2GHIA 5E3HA 4R40A 5IAJA 1JQJC 3DAGA 3RFXA 5HJ5A 1YNSA 1JG7A 1RM0A 3IRVA 3OM0A 3OOYA 5DLYA 5IN5A 1PSZA 4ZVTA 1QCYA 4UXIA 2IBSA 4MUIA 4B0PA 1JKIA 1G8KA 3OSUA 4QVIA 1VLZA 4YQFA 4MOWA 4FWTA 1L5HA 3WC4A 1R8QA 2NSLA 2BCJQ 1CY6A 2FY8A 3HUUA 2H3HA 4FOTA 5EHNA 5KNBA 3FJYA 4E5YA 4DQUA 5HR5A 2ZBEA 1Y8CA 1FUUA 2ZWPA 4C2UA 5EINA 4CCSA 1XZDA 2IPNA 4DT1A 4CLOB 3EIFA 2FDRA 1DSSG 5G3YA 1JIKA 1GPDG 2QRQA 1Z33A 4B73A 7MDHA 1W2HA 3WB1A 4DLXA 2HU2A 2V03A 3OT1A 1VG8A 3JQ7A 1E2GA 5AW7A 4I3FA 4JX9A 3U1VA 3UA3A 3R7LA 4OHOA 2R6ZA 1BEEA 3QE0A 4O4HB 1XZJA 3F49S 3DLCA 1B2RA 2X3FA 1FP7A 2Z98A 2FPOA 1WY5A 5A5FA 4U6QA 4YMLA 2N1MA 3I8SA 1QX4A 3U7QA 1JQ3A 3ESXA 4Z6KA 2Q50A 3JQGB 5DASA 1E77A 4D9HA 4E11A 1B41A 2X0KA 2FN9A 2PKXA 2R6JA 2Q2VA 5EUQB 9ATCA 4IYRA 5JSZA 1NW4A 1IY0A 2II6A 1HL3A 1Y34E 1GU7A 4HXEB 4TKZA 3WFIA 4DE5A 4DKJA 4MO9A 1X70A 2FZKA 4CQMA 1Y7PA 1FJGB 3B5EA 1GZ3A 2DUWA 4GI1A 5TJ9A 2ES4A 5B4VA 1TIPA 5EKTA 3U49A 3IBTA 1EINA 1Z4LA 3ABZA 4NZZA 3NGXA 2WP0A 2Q1TA 3PRHA 4PLYA 3WGVA 4OK6A 4KPGA 1ZXXA 1MA3A 3SC3A 4AS3A 7MHTA 1ZJ6A 4GF5A 3IAXA 2QL7A 4D3YA 1NMQA 4MKFA 4QREA 4MS3B 1PEDA 5K0ZA 1J90A 3GNSA 1JFSA 3UAOA 1IHOA 2XNCA 2EW8A 3PC4A 4RZ3A 3PDJA 5F21A 5B30A 1LBTA 5AHOA 3BK7A 4S35A 4QBIA 2JH3A 2XODA 5CDTA 8ADHA 4HB3A 1NVEA 4ANFA 2ZJ5A 4H6WA 1TK2A 1ZNWA 3E35A 4I19A 4O4LA 2XOXA 2IWHA 1IWPB 4KBYA 2C5FA 3RRMA 1P0IA 2F43A 3BA6A 3GROA 2J4DA 2OD9A 3EK2A 3Q85A 3P9SA 2XUFA 3FWPA 3GGOA 2AUTA 1WCIA 1BS1A 4KMMA 5G0UA 2PBLA 2I7CA 1V37A 4COOA 1A2OA 1J8FA 1QNLA 3H13A 3LIIA 4P7GA 5A4IS 5REQA 2WMDA 3KOUA 1OB2A 1R64A 1YBFA 1PR3A 3UJPA 2AFHE 4N1AA 1T9ZA 1NR7A 2H0QA 1NURA 3V2UA 1LTKA 1ODLA 6ADHA 1P4RA 1ESDA 4K0KB 3QVVA 5AHRA 1RWMA 3FRJA 4JITA 3SLGA 4ARZB 4OAPA 3QW2A 4MCJA 5AKYA 4WNCA 2FEPA 1M1YB 1XMIA 2RHWA 3GQVA 3UICA 2JGJA 2KQUA 1JXMA 1X3LA 3TN7A 3VPBA 4P2GA 5A7GA 4CUZA 1OX4A 1JAHA 3KQLA 2CBGA 3M5PA 3N86A 4MGYR 2IHZA 3MGCA 4QFBA 1G6OA 4KFSA 4DGSA 1JMKC 1SQ0A 3HCDA 4YROA 1OXBB 4AICA 4DWJA 4EF5A 3N75A 2Y1DA 5ICFA 1M2JA 1YHZA 4DMUB 5K8CA 1AKUA 2I6UA 1J8DA 1XTBA 2ZIGA 3MTGA 1UT5A 2EFCB 3KT0A 1UDBA 1SFRA 3AR7A 1SA0A 2OBXA 2WNSA 2WUGA 1Z34A 3OX4A 1FK8A 3GGPA 1Q3KA 5H82A 3T7TA 4CM7A 3WMEA 3R7WB 3H5NA 5TQ2B 1DX6A 1NKVA 1QORA 4XSGA 4OP2A 4NZ9A 4DMRA 1SCJA 2BJHA 5BPHA 1HT0A 2VTEA 1DKRA 4YPFA 3V8NA 4BUCA 1T3LA 5BMVA 1LF0A 2H3EA 2PTHA 3LP5A 3EPLA 2Z6VA 1NBME 1K5DA 4D8UA 1AY0A 3INTA 4RZQA 4BNTA 1EGVB 4YRIA 1HFWA 4HUQB 3SX4A 1OZFA 3RVRA 1W4ZA 5EE0A 4CU5A 4DYDA 3DCYA 2VYNA 4E12A 5TIIA 4AY5A 1XSEA 2GM5A 1YJBA 2HD4A 2BZGA 3UMGA 1NTOA 3WKCA 1G1MA 2OBYA 4MUYA 2PANA 4JDUA 1HRKA 4LQ4A 2ZRHA 2IYWA 5GAJA 4FFBB 4C5CA 2GZSA 4RV9A 4XCVA 4F60A 3RANA 3CF2A 1JKJA 2QE7A 2ZPUA 4A92A 4Q34A 3KSBC 4OUDB 4PZUA 3EQ6A 2DQYA 3AVOA 3AG6A 1U3GA 1WV0A 3EXIB 3QVLA 2JFHA 2Q6VA 1U7DA 4HGNA 4LF7B 3UK0A 5DK6A 5ELXA 4LHSA 4MGIR 2P4EA 1WXQA 1LVUA 2QT0A 2COEA 4FMDF 3RGWS 1L5RA 1U2TA 1A50B 1JFRA 5IABA 3TRDA 1N0HA 1XXHA 1SXGA 3CRNA 2ERXA 2W2XA 3KSRA 1XF1A 1PG2A 4JNKA 3ZQ4A 4JZKA 1UC8A 2MSNA 3SHTA 1X1DA 3UJAA 3CZPA 3LD9A 4FOPA 2R8YA 1GTG1 3OT5A 1G5RA 4MCHA 2GEVA 4K6FA 2CZGA 1CUUA 2Y1OA 3C3CA 5HS4A 4MLZA 1SHJA 4OH7A 2A59A 1GPMA 4GP7A 4RPKA 4ZPJA 2Y6UA 1R0XA 1IB0A 2C9BA 4JJKA 1KXZA 1BVRA 1VHJA 2OC9A 4N5IX 3PHCA 2X3YA 2E4ZA 4LV5B 1KY2A 1MB2A 5FORA 4IVPA 3LVRE 2NZ2A 2RDMA 5CFNA 3S1SA 1MORA 1TVMA 2NM0A 3EDQA 3E5HA 1RQLA 2HYDA 3IA7A 4QA9A 4RA6B 3GD7A 5JRZA 4JBXA 5HF5A 3OPYA 4C4SA 4BNJA 1DL5A 2WWTA 4HB0A 3COYA 4QXMA 3TPCA 2FW6A 2JGNA 1V25A 2X58A 3B38A 2CUNA 1JLRA 3EGDA 5C8YF 3C14C 4ZVLA 4EY3A 5KMGA 3I34X 1UDWA 5ICMA 3P9PA 5SYAA 1H42A 2N0SA 3I1JA 3U3DA 1B6SA 3KM0A 3P9NA 4LJ5A 3VC3A 5JWOA 1ORWA 2NADA 5M29A 3UPTA 1AZLA 1Z0DA 3E2IA 3G6KA 4CEJB 1YXMA 3OC0A 4K6MA 1M0SA 4LHXA 2O1SA 5CXSA 3ZGLA 1ZMXA 3QXXA 2ZT7A 2P0EA 1FU7A 2ZS8A 2NZVG 4ER3A 5GM1A 3H1PA 2XKJE 5CT8A 2AMJA 3L92A 1J2YA 3Q11A 1MUUA 4M1QA 1XTRA 4RDCA 5A6SB 1L5LA 1SXQA 3ZLVA 2X0FA 1VPWA 2GEUA 5CLHA 3F71A 2VDOB 4BMVA 3ETLA 3U0VA 3NPAA 3IT0A 5BW6B 1S9HA 1WKBA 1J21A 3AEQB 4KK4A 2OV1A 4HWTA 3SXJA 2ODTX 4FCVA 2JLRA 3DF7A 3GYBA 2OBBA 1GXSA 2A14A 4WXYB 4CCYA 1FDUA 5DYNA 5BP7A 2V0GA 3VX3A 2UYOA 2M6LA 1KRXA 1DQSA 2CK3A 2CNWD 1QK4A 1Z47A 3EMDA 3JAKA 1S3IA 4GAEA 1IBSA 2VHZA 5EE3A 2VDVE 1TMYA 3RARA 4LF4B 1SU4A 2W6MA 3EFBA 3UJ9A 3CY6A 3WZLA 5EP1A 1Y8RA 5A3RA 3RAGA 4E5UA 2ZJOA 2WV7A 4GO1A 3SNKA 1T3ZA 1ZM9A 3PEWA 2HWXA 2PZFA 4ZTUB 1ZGBA 4REQA 4UNQA 1L5QA 3DE4X 1G2OA 3JPWA 4PQEA 5FH9A 5IBCA 1DIOB 3WXMA 1T8PA 2ZUTA 1BE0A 4LG1A 1I9GA 4M46A 3PPYA 5ICCA 1VRVA 1U0OC 1Z6PA 2WB4A 4GSKA 2P3SA 4NK4A 3IPLA 1KQNA 3WK6A 3HJRA 4CR8A 4G65A 5F7ZA 1EQAA 1FOEB 1P3JA 2X9QA 4ECEA 2AKEA 4EKIA 4ZI7B 1FPMA 2LW7A 2VDWB 3UUFA 1QJCA 1Z06A 1GCAA 4QECA 5DI3A 1UMBB 5C3UA 3ZDRA 1EQ2A 4UM9B 5DSXA 5I8WA 2I34A 3D1VA 3E81A 3M9XA 3WLTA 3OE4A 1PZXA 1EJBA 1MKYA 2WI8A 5DDIP 2OENG 3QJ5A 3Q0TA 4BNFA 2HRQA 1GG9A 1G8HA 3C3BA 3FCEA 2GCEA 3PQDA 3LYUA 3EGCA 3OT4A 5CA0F 5GQSA 1ABBA 4K3UA 3A11A 3FDZA 3H1GA 2RC5A 2QTMA 2AWOA 1WB9A 2ZRFA 3GPDG 3C3XA 2HA4A 1I0ZA 3LRTA 3KKPA 1Z3IX 3L0SA 1U7PA 1D6JA 4ETNA 2JGLA 3WYGA 1BDHA 4QUJA 3C4VA 5EPUA 1Q7GA 2ZU6A 4G9BA 1UBUS 3FOBA 3TD6A 1NZDA 1F1BA 3WL8A 3WXBA 3LQ2A 4F46A 4HGOA 1HM5A 1D8AA 1QP8A 2QI9C 4A26A 2PWPA 4GI2A 5DWQA 5HM6A 1JHQA 3LT2A 3VU0A 1NUUA 1NWCA 1YL7A 4MPJA 2Q5EA 5IBPA 5KTNA 2C5BA 1XLTC 3I12A 3JSXA 3K6KA 1V8FA 2JGEA 4X91A 1CYEA 1YL6A 1ZCZA 4WDRA 4R84A 1ETUA 1YAHA 3ZH2A 4Z1MD 4PX9A 2QN2A 5K01A 5SZKB 4QHTA 3MOSA 4ZAFA 3TAXA 3VPSA 5LD2B 5LA6F 5HKOA 2XWJI 4LXIA 1DDGA 1NVDA 1LC3A 4JMLA 3QEBZ 2RK6A 4UQLA 3F5QA 3PWTA 2AX4A 3KOOA 4CLHA 3EASA 5CD9A 5JFTA 4H77A 3CRQA 1DIGA 2H8KA 3HU2A 4GPD1 3N2ZB 4GXRA 1EZ1A 3FGZA 3PPXA 4JC8A 4RACA 5FAXA 4EA8A 1IATA 3CZQA 2C57A 1AXEA 4YAGA 4IV5A 3EZ2A 4IJMA 1GCOA 1NVFA 1RCTE 4H15A 2BT4A 3AUTA 1SOWA 4WK6A 5JMPA 2F1IA 1K68A 3IVMA 2G9NA 4Q1AA 2YRWA 3H9QA 3UWKA 4FMBB 2PMEA 4B31A 4EGQA 4JXXA 1RAFA 4MVJI 2GKOA 5E95A 4M1MA 4D41A 3P9KA 3OP1A 4Q19A 5E3IA 2H85A 4ZYXA 4RE6A 4MQ6A 5GV8A 3GNLA 4QNMA 4TSKA 3OZXA 4PNPA 3M2TA 2E18A 2BGLA 1KDOA 3H5VA 5EJGA 1UPAA 3GLHB 4AUEA 1EG2A 3B8EA 5I9MA 5D51S 5KTYA 2XVMA 3K09C 5ISMA 4TTQA 1J1UA 3EFHA 1V48A 2ZJ3A 4HWKA 5AKGA 4A23A 4D8XA 4I1PA 4W5OA 4S04A 2GVDC 1KETA 1L4UA 3IIMA 1QH0A 5TGTA 4MUFA 6AT1A 3LWZA 5F7XA 3T7IA 4I46A 1G59A 1RIFA 3LOUA 2ZYDA 1XD2A 2YCLA 1HORA 3ORHA 4Q03A 3KKNA 1K0UA 1S8FA 3EN0A 3LFHA 1MNQA 3PGJA 4BUJA 2WYIA 1IUPA 2VUUA 5FF9A 1ZU4A 2RIRA 2V0NA 3HXOA 4ITVA 1W5FA 1BJTA 2IYUA 1PVOA 1AB6A 2A3NA 1VJTA 2D1TA 2B61A 3FUXA 1ZD9A 3JTMA 4FYXA 4RHTA 3ZJYA 3CX8A 1GPWB 3IB3A 3EEOA 3NUGA 2NNWB 3B89A 1UFOA 5DXJA 2H4XA 5CCXA 3RUIA 1D3AA 2YZGA 4DTCA 3ZDFA 3NR2A 5HFJA 3VPXA 2FRDC 2KWIA 4FUTA 2ECOA 4IO0A 5TY0A 4CKEA 3N70A 3IAFA 2XVXA 3MF4A 1EVZA 4OLFA 2IY7A 3HVJA 1XIVA 3W77A 3OBIA 3RW9A 1LPAB 1TL7C 2CVHA 3THSA 1DIBA 3CZAA 4YGXB 2MR6A 1PEYA 4R41A 4OK3A 2ILTA 2ZE8A 1KOJA 1QH9A 4EW1A 2QLMA 4FBLA 1CDEA 2F8MA 3H0EA 1BE8A 3QUBA 1C7ZA 3MMSA 4NNOA 4RUKA 3EUAA 1RHRA 1DBPA 3UCFA 3ZW9A 4B3JA 1XEWY 5D3QA 1PV4A 4LI3X 5CVDA 4GL2A 2FN8A 2Q8PA 1OLUB 3KKOA 1EM8B 1E2KA 4KE9A 4KXUA 4XPZA 4YI3A 5FR2A 2BFNA 2NYVA 1EB8A 5JSKA 2OXEA 4M1ZA 2HIAA 3MINB 1DE0A 1C1YA 4TL7A 5ITVA 4U1RA 4B6QA 2X2PA 2Q41A 3QPWA 4QHSA 5CDYA 3DFMA 1C50A 4JYMA 1WUYA 3PF9A 1RRFA 1SB9A 2HHCA 2YIJA 5HX7A 2E1RA 1S01A 5JO0A 1QIMA 2OTCA 1T2NA 4O4LF 3TW4A 4HK4A 1G21B 2FV8A 1JHAA 1XA3A 1T5LA 2XDYA 2WV9A 4RHFA 1M8FA 5JJIA 3O73A 4N9WA 5J4YA 1P31A 1Y3HA 2P69A 3GEPA 3V1YA 1ZMOA 1JV2B 3R9WA 1N5LA 3EUEA 1T1SA 4EJSB 4EDFA 5CIQA 4YRTA 5PGMA 3T0IA 5BY2A 4XZ3A 1F9AA 1FLAA 3GLKA 3JPYA 3PKJA 5JNLA 2PJZA 1EK0A 1RAGA 3DHEA 3ZXYA 1MVOA 3IT2A 4NU8X 1NUTA 3ZVKA 2OWEA 3EULA 3PFNA 2ZT6A 2Y05A 5K99A 5K3OA 5LJLA 3AQ4A 4J2TA 2X8AA 3TW6A 1JLHA 1XTJA 1ZVKA 1Z9BA 4NZYA 3UAZA 1N5KA 1WMEA 4RFSA 2QV7A 2R1VA 3Q3GE 2P9HA 1R5BA 4OKNA 4C01A 1PDVA 3MJDA 3PUXA 3T5DA 5F7OA 3ZVNA 1U02A 1PFVA 4NBSA 1FUEA 2QRLA 3MCVA 5K8TA 3CQ9A 4EYKA 2SHKA 4FTWA 1UIMA 5DRTA 1CU1A 1F7VA 4AQDA 3VKHA 5DXAA 5LXTB 5KWVA 2I2DA 2P68A 4YRNA 1SVLA 1W7AA 2IYRA 2IE0A 3P32A 1TAHA 1Y1RA 5J4LA 1J8YF 3BKXA 1RBMA 1SVNA 4XSHA 5FLEX 1Y1SA 4M1SA 5BT9A 4NHEA 1NOKA 3T3PB 4DEYA 5EHGA 4D3XA 5JCZA 1XZFA 1LNZA 1L8AA 2BZ0A 5KKCA 3B12A 3CR8A 4XLLA 5BNTA 1QRTA 4QLAA 1GITA 3L0YA 4MICA 3GAFA 4J0EA 3GG2A 5D7NA 2XE7A 5EYPA 3CW8X 1JAXA 4BO9A 1AB5A 5CM2Z 2XUAA 1ZBQA 4XRGA 4UUPA 5BMVF 4FMCB 3PUZA 3X1DA 3PHLA 3IQWA 3L5OA 5E4YA 2ZTSA 1T6YA 4L28A 4UATA 1WULS 1MAWA 2GETA 2GRAA 2X77A 1NBIA 1Z7EA 2ZE7A 1SURA 2I87A 2ILVA 3C7TA 3LX6A 5HCUA 1TKAA 3FE2A 4ZC1A 4COKA 1V7PC 3C70A 5GZ3A 4RULA 2QZZA 2P2ZA 3N1UA 4NJEB 3V3TA 3EFOB 3NBQA 4TXJA 4H3SA 2RK4A 1VGRA 5JU6A 4US0R 3I9JA 2C99A 3BXXA 1E3WB 5AHKA 3SJ7A 1L8XA 3LT4A 1T9GR 3NONA 1SXJB 1AVTA 5JSYA 2QB5A 1Y3IA 3CNLA 1JVNA 3PQ8A 4QUAA 4G5SA 3H5IA 1N2EA 3G8DA 5G53C 1Y9AA 1ARZA 5KNBH 1Y8QB 3KYJB 5ES3A 4D9MA 5IUJC 5A71A 1CUFA 4O8CA 3I6MA 1JDBC 3BWMA 5ALLA 5IEBA 3COSA 1CSEE 4PCAA 4ZVPA 5TDHA 2DHDA 4BMNA 1OPXA 1UXGA 2PZAA 3CLKA 3EARA 1BZYA 3EGVA 3ET5A 5L45A 5M7EA 1XZGA 4JSTA 3BIFA 2ZJ1A 3RJ5A 3OQOA 4MDFA 1VSVA 1QF7A 1C9DB 3BCHA 5AI0A 4P1ZA 1QRSA 3A28A 1BCRA 1FVHA 3RRJA 3VISA 3L4EA 1JYFA 3VPHA 3IXLA 2N9UA 2PJUA 5L3QB 2HGSA 3M0EA 2XKKA 3AHDA 1CY4A 2ADOA 2VIIA 3GP3A 3NBZC 2IYFA 4S1TA 4TTRA 1OH7A 4MQFA 1XUOA 4GZ5A 5AOAA 4E3WA 1LQTA 3ESYA 1MRZA 3K5IA 3NYRA 1EJ2A 2Y3IA 2IYLD 3PKIA 4JN6B 1CBUA 4YRAA 4MV8A 4PNHA 1G8SA 1N5IA 1NXQA 2NU7B 5DTEA 3V33A 4EMSA 5T8KC 1CE8A 4M0FA 3E84A 1G0OA 4TUYA 1KAEA 1A4IA 4PPQA 2A78A 2XZPA 5BWMA 3K9FC 3N59A 4JR0A 1YKSA 3GY0A 3MGBA 4V2IA 5HNKA 2CC2A 1X80B 3LY8A 5FOUA 3NBAA 1WY7A 3FBWA 5TQVA 1QCCA 2DM6A 4Y9SA 1AUVA 1IL0A 1DAPA 2QUZA 2AKAB 3TZKA 2JZOA 4EYGA 5ESWA 2ZB4A 4B47A 5EGSA 2XCRB 1AS3A 2FZEA 2A0UA 2ZYUX 2BBTA 3UWPA 1G5HA 1RLIA 4G86A 5JH7A 2CXOA 4PYOA 1W5SA 2H5LA 3DEFA 5AUQA 5L53A 3W5SA 1IJEA 1XZLA 3D0OA 3OKPA 2JI4A 4FDTA 4IL5A 4OM8A 1GZHB 4HXGA 4B3BA 4EGAA 1DC7A 3QEKA 4QUBA 3KR9A 3G9QA 1BHQ1 3J80A 2OHJA 4L0DA 4RF3A 1ZGCA 2VT7A 3HJGA 2YYZA 1NVGA 4L95C 4UAGA 1NU8A 5JS6A 4RTOA 3NU1A 3PYMA 4IVRA 3EXEB 4G0MA 1Q57A 4LHYA 5EESA 4GDMA 3C3AA 3R20A 3WNVA 3IMCA 1AKRA 2J7PD 2N75A 1IQUA 1PG0A 2VBFA 4W8OA 5DULA 5DWVA 5LZ7A 1KI8A 7ABPA 1W25A 4FEAA 4OA5A 3LMKA 5AKXA 3SIXA 4HUTA 5B1EA 4C29A 2D13A 1ZK2A 3K6JA 1E2BA 2AOTA 2Y1EA 4YB8A 2C84A 4FDLA 3NOVA 5SZJA 3KSAC 4QL3A 3HFJA 1O0SA 3LQQA 1NSYA 2VRCA 3IOBA 2YH2A 1SOMA 3HA3A 4NYMQ 5LC1A 3AP2A 1R4MA 4YCMA 2FGJA 2VJDA 3W90A 4FGZA 3ZDAA 2WJAA 1B6GA 3CZ5A 3ILXA 3Q7PA 3HVHA 4PQGA 1XTVA 2XSZD 2IA5A 1QP0A 2F3UA 3RU7A 1C3OB 1TC2A 3DXFA 2V7BA 3MLBA 5SV2A 5EHZA 2ZJ8A 3AVUA 4LF5B 1T4CA 4LGYA 4UNNA 3ZR4B 4NZPA 4E13A 1TCCA 4CMGA 4HGZA 2BHTA 2HEIA 3FSRA 2QR5A 3GFQA 4AN0A 3PIIA 2XA2A 4O6VA 3F4KA 4JIMA 1A2KC 5HKLA 1V2HE 3LIPA 2JVJA 5CW1A 3RQIA 3R6GA 3ZCUA 1E2HA 2XEDA 3CH4B 3FHCB 4I0WB 4X6XA 1OFTA 3X2FA 2EFJA 3E0XA 1FMLA 2YQ4A 4ZZ1A 4OYYA 3JCZA 2W4QA 1Z2EA 4G25A 1JDJA 2VSYA 3TSYA 1TK9A 4KTTE 3ODGA 1R9GA 3K0KA 4J6FA 1VGVA 1QF9A 1YRLA 2QN8A 4HB4A 4KXYA 3SDSA 2WPDD 3D43A 3ZK8A 2ZWIA 1II8B 5IS2A 2GNOA 3NYWA 4R2MA 5E6SA 2VWHA 3M6IA 2PKCA 1XK7A 2E87A 1NQOA 2JLCA 3DVLA 3VDMA 3VSAA 2DHQA 1EXNA 4ZOBA 4J3JA 1QGZA 3QX8A 2ICAA 4ZQGA 5E38A 4CMIB 3NIWA 4YRCA 3IX7A 4BMYA 3EIUA 2CFCA 4MZXA 1A8PA 2GEJA 1J00A 2QVLA 1U1GA 3ZIDA 2EARA 4ZRDA 4AW9A 3HHPA 2J5XA 5E7MA 4UHDA 1KHHA 1W8IA 2PV0A 4MRVA 3HI6A 4AP6A 1AGPA 721PA 4UCWA 2J5RA 4QDKA 5BN4A 3F6RA 3A14A 3U5ZB 4PS0A 3QM1A 4O2LA 4PSKA 3BHJA 2HH9A 4NV0A 3SEAA 3A70A 3WK8A 3B3JA 2RJOA 3X1YA 5A04A 2B35A 2HK7A 2QJOA 3JQ8A 2O1XA 3E9RA 4WZAA 4BLUA 3CEPB 3BG5A 2OORC 2WHEA 3PSHA 3PQ3A 4FR5A 5TMEA 3NHMA 2G9UA 8AT1A 1E2PA 3QWHA 1U5AA 5JBIA 1RXCA 4GPZA 1ZIYA 2RFLA 1PR2A 1D2HA 2GNAA 4GXNA 5EE5B 3T3DA 4HCJA 1BRMA 3FI0A 3MJTA 4CKCA 4X1OA 4EG3A 5IJZA 3AINA 1GEEA 1O54A 4WTOA 5K3DA 2ZT5A 1USKA 5E2BA 4L0MA 5CDHA 4EUKA 2OZPA 2FVYA 1RXUA 1VPVA 2WJPA 5EZYB 5BN3B 1U7UA 1YKFA 1WZUA 3GEHA 4XPIA 5I4IA 3UQYS 3TOVA 5IAGA 2Y4OA 3QFSA 4JT2A 3UCXA 2HLPA 4P4LA 3B7GA 4JOBA 4Z4GA 2VDMB 4I1IA 5LU8A 1NBEA 5KYUB 2W7TA 3RG8A 2HA7A 4W5NA 5H3HA 2AN9A 4C76A 3WWDA 4R98A 1YACA 1BVHA 5G02A 4L85A 1K89A 4J75A 4OJNA 3PJFA 1G5PA 1SEVA 4I1UA 4MVJD 4KOEC 4AWBA 1O57A 1K75A 1EUCA 2R751 4BE9A 4L08A 1NW6A 1LRLA 3V7FA 2G76A 2H08A 3WKAA 5I8PA 3MW8A 4V3CA 5AI8A 3HXQA 5EQTA 4KE8A 2G4VA 5A3VA 2HV9A 1V45E 3ZZMA 4JP1A 1UCFA 1XROA 4IXTA 1GTZA 4FE4A 1S8OA 3FF1A 3GJYA 4G4JA 2JIDA 4FSDA 1XZKA 2EGUA 1A9PA 4Q4HA 1E9AA 4EUFA 4INAA 2CLEB 3PEVA 4CT5A 4IZ6A 5AHXA 5HP4A 4MKHA 1V1JA 1UADA 4EAQA 2Q2OA 4QGAA 1EXMA 2C2MA 2OD2A 1TD1A 4QFCA 4UTXA 3GX1A 5I9BA 3SBDA 1ZL2A 3QW4B 3T4PA 3KOZA 4IOJA 3UXEA 5FDFA 4R2JA 2DWUA 4MQLA 3TUIC 1EWQA 1NYTA 5JC1A 5ENZA 2EJCA 4UCXA 4BTVA 2NPIA 4UTPA 3FVRA 4CTMA 4CG1A 1ISMA 3JQFC 1Z0KA 2B5OA 2NOAA 3NBFA 3N58A 1JR6A 4PYLA 3ND5A 5IJAA 1TQ4A 1HY3A 1H94A 1LUAA 1I2CA 1U9YA 4G2TA 4JI3B 3EWIA 1YFLA 5JY1A 2GZRA 1E98A 2H48A 3Q5EA 3QVSA 5D1HA 1FFDA 3ZDCA 4ID9A 5ULLA 4U7TB 5ALQA 1OILA 3R23A 1DX4A 2IVZA 3BWEA 4MDHA 4NCAA 2XNSA 1P9OA 3NXKA 3SMQA 3R74A 3UF0A 5F64A 4F2PA 3OC6A 3QLVA 4CEHA 3FPEA 1JB1A 3DV2A 1G6HA 4HZIA 4JL8A 1W48A 1N2CE 2IOFA 3PQ4A 3SXUA 3WFJA 3IR5A 4E5NA 4AJNA 4HXYA 3V42A 1MVLA 1IAQA 3AI1A 1SC6A 3LKZA 5EAIA 4B48A 2PL5A 4MLPA 1XAHA 2F2TA 2AV6A 4OI2A 3T3HA 5H02A 1WHSA 5C31A 1AQUA 5D6NA 4H60A 3QHPA 4UM8B 5HJ2A 3C43A 1BS2A 3FKQA 4M9SA 4C4TA 1DUVG 4PR0A 3UMMA 5K0BA 5ENDA 3ZCPA 1JSZA 4WKCA 5AW9A 1OI4A 1KGSA 3MMXA 2NPFA 3H87A 4U3JA 4X7PA 4CYMA 4ZI3A 4XIFA 1ZJ5A 1KI1A 4I4IA 4LSMA 4R5MA 3RYFB 1PJSA 3ZY3A 4CUJA 4DA9A 1PNRA 1L7NA 3TNFA 1ADBA 4HGRA 2NTJA 4NDZA 3RT9A 4ZYVA 3DQZA 4FCCA 3O75A 1P9RA 4GBJA 4U7HA 3EAFA 1P77A 4ZAVA 3A58B 1Q7CA 3OFNA 4P81A 1ORIA 3IESA 3VNBA 1SVOA 1X19A 1IWOA 3U3KA 3S68A 2O52A 3SBEA 3UB3A 2WJ3A 1TC1A 1XZAA 3UV3A 1EK5A 1J1IA 3V9AA 5DX1A 5C5IA 1W9HA 1IYZA 1RI1A 1U81A 4HTFA 1TA4A 3A6LA 1MQAA 3A1VA 3PG5A 1FQJA 2JKYA 1B00A 1GV0A 1MR3F 2NYAA 4K3VA 2FPGB 2H1WA 4RIFA 4C88A 4ZYLA 4KO2S 3T4EA 2W8BA 4NHOA 2IHKA 4U2GA 3UKDA 4DV5B 4IIHA 5L7TA 4BQOA 1QO0D 4UASA 4LDJA 3CJTA 3KPYA 4N5HX 4WNAA 2QUKA 4X8HA 5UKDA 1K4MA 1C9KA 3SIPA 3D0RA 5C5DA 5J2TA 2C31A 3DDSA 5DIZA 4GVPA 2HQRA 5DHQA 5CYFA 4BFUA 4R54A 3T95A 1JTFA 1CUDA 1MX3A 3PQFA 1G7SA 4ER5A 3V8VA 5K0TA 1N32B 5A3SA 4ZQHA 1ECFA 5BQXA 1O6ZA 1PJAA 2J59A 2ZYVX 3NH6A 3R3JA 4D97A 5JISA 1Z68A 3HKDB 5KYKA 4RTRA 4ZYWA 3HLKA 3R6TA 3Q4GA 4DLWA 4N18A 1RC0A 1MGOA 3ZUGA 1RAEA 4LC0A 4RMHA 1Z6QA 3L7IA 4LRWA 1TAUA 1N2OA 4JP8A 1S2LA 2CHGA 1YDWA 3QMMA 4W5HA 3QOFA 4II7A 1D2NA 3EXG2 5FA8A 3HBLA 3U7EB 4W7IA 3RJTA 5ALSA 4OGFA 4UNIA 4AKGA 3STUA 4L78A 2UYHA 1YOVB 4LFAB 1IBCA 1NP7A 3UAVA 3C5EA 1Q74A 4M83A 4I3HA 2QX7A 2I4IA 3KAPA 4Y2YA 2K7ZA 1YCFA 5DCUA 2FEMA 2D1QA 4B74A 5F77A 1E2IA 3IO3A 4IGEA 4URXR 5JAPA 3MTAA 4HWGA 4GKVA 4TMTA 5SZIA 4B8ZA 3PR1A 1YR2A 1QF6A 2RSLA 4UE6A 2UDPA 1SBNE 4BEWA 3DEHA 4FM9A 3OHMA 4OQEA 2Z4TA 1UWKA 3C98A 5DBOA 3L1VA 1S89A 2AQ8A 1ZC3A 2DFTA 3PI7A 3K72B 4OA8A 1JFVA 2GPJA 3PNQA 1EDDA 2BI4A 1ZXLA 1AKEA 1P7YA 2CJXA 2IF0A 2M32A 3OIUA 2E82A 3PFWO 4II3A 2OESA 2A35A 4UDNA 1PTJC 2A4MA 4KXXA 4I6EA 3DZFA 3QU9A 5AM1A 4Y2JA 4F8EA 4Y6PA 2Q4DA 1W47A 2QNIA 4OL0A 3IVGA 4NPCA 3SFTA 1TM2A 4BEVA 2C3OA 3DL0A 3WTBA 2YJZA 3C16C 3UW1A 3VYSB 1Q92A 3BL8A 5TPWA 2EL7A 4PLFA 5FLXA 4RVGA 5D8DA 3FETA 2NZ8A 3T9DA 1EWRA 3GT3A 4G5FA 2QQEA 2GD6A 1ZL0A 2NPOA 2R86A 1U28A 3BE6A 5G40A 5BNZA 2CVPA 3OEHA 1VJ0A 2C5AA 4JYBA 1J0BA 4JJ4A 4NG5A 5EWLA 1XYYA 4CF5A 1R8XA 4EPRA 2XGJA 1GTSA 4RQUA 3GDHA 5CU7A 5E9AA 4P83A 3LKVA 4B4WA 5B3KA 3HCPA 4TUYF 4D5EA 5CFLA 2D4HA 2LV8A 2CL6X 2BL4A 2WF9A 3WYAA 4CFZA 5ARDA 1YJ5A 1P2GA 2CZQA 2ZRQA 3OCZA 1U6KA 2QTGA 3L84A 3VX4A 2YWGA 3QYAA 1I2DA 2H57A 4LEIA 3RLFA 2XRYA 1Z7BA 4X8LA 3WJ7A 4BKMA 1D9XA 1ECPA 3D0QA 4JC0A 2Z3ZA 5IASA 2A84A 2X4GA 2QQ0A 1ZZEA 1OMOA 3ID6C 2A2ZA 3WZ2A 2WLSA 1ZOLA 1U3WA 2QAGA 4CMEC 2ZJ4A 4ZT3A 1PG5A 2LWIA 3OTQA 4L50A 3F4LA 3DBRA 4N3CA 4XR4A 2JAOA 3JQBA 1L4GA 2OB1A 2G5TA 3K5WA 1UMDB 3AHFA 3AETB 5FOQA 2PX8A 2WG1A 4J7CA 3GP5A 2BE9A 4P33A 4RLSA 4XWAA 2ZUUA 5I9NA 2AOUA 5H3CA 1SUDA 4RKFA 4WK0B 1DBIA 4XX0A 5FKJA 4KL8S 4BWYA 2O8EA 4PVDA 4NKRA 4ENQA 1ZUWA 1DXHA 2FSPA 1OX5A 2V7TA 2IXAA 5YASA 1KJWA 1B0AA 3AIOA 3U4QB 2WBLC 3ESRA 3MJSA 1ZU5A 4ARSA 5K0FA 4ZVKA 2QPLA 3K4HA 5DPMA 2JGFA 3CEMA 4CUKA 5C0OE 4A8HA 1FW8A 3EG9B 4P8RA 1N6RA 2BEVA 3L49A 2A5FA 2WZQA 4NMLA 4NY1A 5LOVB 1H0RA 1YQQA 1UC9A 2AJ8A 4RIGA 1PFGA 4HG2A 3AEKB 3JVDA 5E1DA 3EXG1 1DV2A 4GQBA 2LNDA 4QLOA 1KJJA 4WECA 1H65A 3BFKA 3NEYA 1UP7A 4LBWA 2W83A 3O8DA 2BEUA 4KNVA 4PAWA 2O0LA 5ALTA 3S5UA 4WV3A 3UOWA 1SG6A 2DQSA 1RJ9B 3QIVA 3QPBA 4WY5A 4D4KA 3GELA 4GX0A 4DQLA 2HXSA 3M3PA 2QV0A 4CDGA 2HZ7A 3G13A 2KX7A 1EFTA 4YAWA 3VR1A 3I3SR 1A2QA 1TYEB 4OSEA 4YCAA 1BE6A 2GTHA 4BCDA 4EVRA 2R8ZA 3UT6A 3DDCA 2QY6A 1KZ6A 1UC4B 4WEOA 2EERA 5CB4A 1S5PA 2CJPA 1VLLA 1N5JA 2ZJ2A 2C9MA 2QRHA 1TCAA 2O8VA 3KB6A 3KTAA 1KTVA 3ICCA 3HY6A 1YVRA 5HZKA 3DDOA 1P4AA 3LTEA 1H66A 5BV1A 4CIWA 4TOIA 2HCFA 3C4JA 4IDEA 2BP7A 4JLSA 5HW0A 3O0DA 5JATA 3MQ4A 4LHWA 3KPUA 1ZVVA 3VU9A 4JELA 5EIAA 2I9KA 3I83A 2O3SA 4R7GA 3B78A 5JV5A 3FFXA 3B1JA 1GG8A 3DTTA 4PSVA 4XB1A 1QFYA 2DXIA 4WERA 1T8SA 3GHHA 1QRAA 1ILWA 5DBGA 5LQRA 1N92A 3TLAA 2E9SA 3JQ9C 1J5XA 2Y99A 1OXVA 2I1QA 4HPXB 3WJ2A 2HLDA 2TMYA 3W3AA 3ZKAA 3GLIB 1D5WA 2A5GA 4ND2A 3WWEA 3I2JA 4U2CA 4C0JA 4XIJA 3WGMA 4CV1A 3RNOA 4YACA 4G8JA 3IP3A 5AM0A 2CE2X 4AG6A 2G82A 2XW6A 3ELYA 3LBYA 3QPVA 3R5HA 1HYHA 1RACA 1THTA 1HL7A 3GJRA 4L0CA 4WCFB 5DNUA 1KEEA 4LZOA 3NB0A 1YZGA 2YS7A 2YXDA 1FTNA 3ANMA 3DYBA 3OU2A 3MHPA 3W4IA 4MW7A 2XDQB 1VLMA 1V4BA 4LCJA 4LKOA 4FYHA 4HVAA 121PA 5AW3A 1Z5UA 1K7FB 2AJCA 3KQSA 4IJKA 4L07A 4TN1A 1BKYA 3HFSA 1ZVJA 5HCIA 1KH1A 1FFCA 1V8ZA 3SJBA 1EG7A 1HKHA 4F84A 3I4CA 2MSKA 2ZSUA 4HOYA 3S2ZA 1PR5A 4JYPA 3UB4A 2XGOA 3ZZTA 3FY4A 4JA0A 3DV0B 3FHLA 3A1CA 4C0QC 3UUEA 1HPLA 1L3BA 5CAEA 5D87A 5JJLA 1AS2A 4D92A 3HRKA 3M8KA 4GBGA 2X9VA 3V1TC 3SU8A 3OCXA 1TTTA 5JNVA 4TKUB 2C7GA 5ITWA 3OQIB 3TUJC 4Z4EA 3DULA 3VZRA 1LTQA 2GMWA 3BAZA 3ZGNA 3ZQ6A 2ZYSA 1JQAA 3IEUA 4ZO7A 1G2QA 4U8GA 4OYHA 4D8YA 3MILA 2BPOA 1H8HA 2R66A 5AT1A 1BC5A 1SBYA 4ZVUA 2EX0A 4KO8A 4MV6A 2JFUA 3EEQA 3L77A 3QE3A 4YO8A 1E9EA 5IVPA 4YAIA 4TS3A 1BKDR 1L7MA 3IVAA 2JB9A 2ZJ0A 1VSQA 3B2QA 4HDAA 4K7JA 4YT8A 4R71A 3ZOZA 3ZPXA 3L4SO 4KH1A 3SXPA 2FSVC 1EXWA 2RGEA 1QANA 4MRNA 1NP6A 3PEEA 1SJ9A 4IQGA 3RT1A 4DMLA