4RIHA

Chimeric glycosyltransferase langt2s8ac, carbasugar substrate complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
373
structure length
368
Chain Sequence
b'MKILFVAAGSPATVFALAPLATAARNAGHDVFMGAVEDMVPYIASAGIPAVATTDLPIRHFITMDREGNPVRMPETPEEELDFAGHWFGRMAAGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVPYVRQAWDTGDAWRTDPAASDELRPELRALGLDRLPDPALFVDICPPSLRPADAPPAQMMRWVPANGQRRLEPWMYTKGNRPRILVTSGSRLVFAKKTGFLRGLVADMAALDAEVVIATLDEVAEELGVRAGWVPLDVVVPTCDVVVHHAGGVTALTAMNAGVPQLIVPQGGNFVEAGLRISDFGAAITVDENTPEAVEKACGELIGNPSYAERARELSAEIAALPLPAEVVGALEGLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl transferase homolog,Glycosyl transferase
molecule tags Transferase
source organism Streptomyces cyanogenus
publication title Structural Characterization of O- and C-Glycosylating Variants of the Landomycin Glycosyltransferase LanGT2.
pubmed doi rcsb
total genus 110
structure length 368
sequence length 373
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06722 DUF1205 Protein of unknown function (DUF1205)
A PF06722 DUF1205 Protein of unknown function (DUF1205)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4rihA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4rihA02
1P2BA 2F3SA 4F97A 3ZCSA 2X0EA 1Y6FA 3S27A 1EM6A 1FC0A 4GPBA 2ASVA 5TVGA 3BCUA 2GM9A 2QN3A 4YI5A 4MI3A 4M83A 2IUYA 2IV7A 5IKPA 3UYKA 3OTHA 4N3AA 3NPAA 3OTIA 2BISA 4AY6A 1GZ5A 1L5VA 3ZCUA 5BNWA 3IAAA 4NEQA 2XGMA 4M7PA 5ENZA 3CUWA 1IXYA 1NOIA 3OT5A 1GPBA 2PYIA 2F3UA 4RBNA 1WW3A 4RIHA 3OY7A 2GPBA 3RHZA 1VGVA 1RZUA 3MTDA 4RIGA 3ZCTA 1JIVA 8GPBA 4GZ5A 2F3QA 4GZ3A 9GPBA 4HLNA 1NZDA 1GFZA 2QNBA 2QN2A 4M60A 3VUEA 2IYFA 3CEHA 4EJ2A 1AHPA 4RELA 4MI6A 1YA6A 2AW3A 3ZCQA 3BD8A 1E4OA 4RIFA 1WUYA 3RSCA 3TSAA 3T3DA 2BGTA 3T7DA 3HBNA 2JJMA 4N3CA 2VG8A 2ZB2A 4GZ6A 4PQGA 4RIEA 3MSCA 3Q3IA 1PNVA 2XCUA 4BFCA 4MRAA 1A8IA 2VCHA 1L6IA 3BCSA 1JG6A 1PSWA 2IW1A 2C1XA 3MS7A 3S2UA 2QLMA 3G2IA 2C4MA 3BD6A 4QLBA 1C3JA 1EXVA 4AN4A 4BQIA 1NZFA 1FU7A 1WV0A 2X6RA 3G2KA 2PRIA 5JTTA 1XL0A 4EKEA 3AMVA 4CTMA 1P2DA 2H1HA 1RZVA 1B4DA 3HBMA 1M5RA 1JG7A 4G2TA 3O3CA 3L01A 1XL1A 4CDRA 4LEIA 1PYGA 2BFWA 3QKWA 4FZRA 3WC4A 3TOVA 3MRVA 3T3EA 3UYLA 3BD7A 2ATIA 4KQ2A 4F96A 1K08A 3CEMA 3FROA 3DDSA 5HXAA 1P29A 1JEJA 2G9VA 1FTWA 3OTGA 3TAXA 3DDWA 4W6QA 2QN9A 1FTYA 5C1DA 3IA7A 4YUAA 1P2GA 3T5TA 2AMVA 2QZSA 2QRHA 3L7CA 4KQMA 1K06A 2HY7A 3OKAA 1C8KA 1H5UA 4MHSA 1FTQA 1ABBA 1XOIA 5D00A 3COPA 2XA2A 4BQFA 2PYDA 4BQEA 1P4HA 3G2HA 1QM5A 4XI9A 3S0JA 2QLNA 2GJ4A 3BDAA 1P4GA 3OY2A 3CUVA 3MQFA 2VSNA 1AXRA 1UQUA 2QN7A 1FA9A 1L5WA 1UQTA 4AY5A 3MS4A 2F3PA 1L5SA 3G2JA 3T3HA 2O6LA 3EBOA 3Q3EA 4NC9A 4WHMA 3L79A 3SYMA 4MICA 4LDPA 2JLBA 2ACWA 2PRJA 3MT7A 2SKEA 2SKDA 4YI3A 4RENA 3E3LA 2QN8A 1KTIA 3PE3A 1Z6PA 3EBPA 3PE4A 4EKYA 2VSYA 1RRVA 1P4JA 1JIXA 2G9RA 1FU8A 5LQDA 4N39A 2GEJA 2WTXA 3OKPA 4CTNA 1XKXA 2R4UA 2XGOA 4NESA 3G2NA 4Z5XA 3VDMA 3MRXA 4X7PA 5DU2A 4N9WA 3NP9A 2C1ZA 3HBFA 2GPNA 3NCHA 2IEGA 2XMPA 1XV5A 4EL0A 3CUTA 3MTBA 2QRQA 4HWGA 3BCRA 2XA1A 3T3GA 1O6CA 5I45A 4F9FA 2PQ6A 5DLDA 2IYAA 1GG8A 2AV6A 2Q6VA 2QLLA 2X6QA 3ZCVA 2FFRA 4MI9A 2YJNA 1F0KA 2ECPA 3S29A 3E3OA 3CEJA 2X0DA 1NVKA 3CUYA 1Z62A 3MT8A 3NB0A 3NC4A 3WAGA 2C9ZA 4MHOA 4L22A 2FETA 1WUTA 4X7MA 4X7RA 2R60A 1L7XA 3S28A 1GPAA 3MTAA 1F6DA 2XCIA 3H4TA 1C50A 1J39A 1NLMA 3HBJA 3L7DA 1FS4A 3D0RA 2H1FA 2R68A 1GGNA 4WADA 3QHPA 2GEKA 2F9FA 2P6PA 3MT9A 4AMBA 2GPAA 3Q3HA 1NOJA 2AZDA 1FU4A 3DZCA 2FF5A 3E3NA 3NP7A 4AMGA 3CX4A 3C4VA 5TMDA 2G9QA 1HLFA 3CUUA 3T3IA 6GPBA 1SXPA 1GPYA 3ZCRA 2ACVA 4REMA 3MRTA 4N3BA 5DXFA 2KS6A 2OFFA 3H4IA 1NOKA 3VUFA 1SXQA 5TMEA 3L7AA 3GUHA 3MBOA 4KQ1A 1XC7A 3NAZA 7GPBA 1E1YA 1Z6QA 2VCEA 1JIUA 2QRMA 1WW2A 5GPBA 5JTUA 3MS2A 5IKOA 2GT1A 4WACA 3RT1A 2BGUA 2R4TA 2QN1A 1UZUA 1V4VA 3OKCA 4GYWA 2JZCA 1Y6GA 2R66A 4FKZA 1QKJA 1BX3A 1L5QA 4CTOA 3D0QA 3SYRA 2IEIA 4EL5A 2X0FA 2SKCA 2QRPA 1Y8ZA 3ZCPA 2IV3A 4GYYA 3DD1A 3CV3A 3RSZA 3VDNB 3C48A 1YGPA 3WADA 2XA9A 1Z8DA 3GPBA 2G9UA 1IIRA 1L5RA 3G2LA 4X6LA 5D01A 3L7BA 1WV1A 1LWOA 1C8LA 1PN3A 3BEOA 1LWNA 4XIFA 2QRGA 3D1JA 5TMBA 2XGSA 3C4QA 4RIIA
chains in the Genus database with same CATH superfamily
3TQCA 2C5HA 4AQ7A 1VLZA 4S2EA 1LJUA 5BSMA 4B0OA 1ZH2A 1AIPA 1TTTA 3V55A 4TMXA 2WIGA 4B7AA 1L4MA 1E66A 1PHPA 3DXFA 4IW3B 1BA2A 3K72B 1QYRA 2QAGB 4LWQA 3ZHRA 4NL4H 1P31A 3MZ0A 5A7FA 1Z0IA 4YT5A 3KPUA 5KVAA 2RH5A 4UMDA 1A77A 4QHTA 3TSCA 5KNCH 5IT9A 3CEAA 2VBCA 1H2WA 1M83A 1LDBA 3O93A 3GJ6A 3AHIA 3C24A 4I3FA 3PCTA 3R74A 3ND8A 3B5JA 1U8YA 3UB3A 1QS0B 4R8LA 2B99A 2DP4E 3RJZA 4GPTA 4M1QA 5IKPA 1T1RA 3AUKA 2QQGA 3QYAA 1O6ZA 1L5KA 4EPXA 2RAPA 4I08A 2ZI4A 1J5PA 5BPFA 2CNOA 4DAOA 5K45A 5IJZA 3MD9A 3W9BA 3UHFA 5LP1A 3IPCA 3PGA1 2FSGA 1E2UA 2CCKA 4FN5A 3I6YA 1RE1A 4IL5A 1C9MA 1M0SA 2DBRA 2JCGA 3N6VA 3GGGA 3O9VA 4Q3CA 3TOSA 3DBIA 4ENWA 5EE3A 3ER9A 1Z0DA 4CKWA 4M7PA 4BTVA 2Y1OA 3GG2A 4XFKA 2PLFA 1JFRA 4HH4A 3LHFA 4IOKA 2X2FA 4XPIB 3R9WA 3TZEA 4DDHA 3FVRA 3VYWA 1PUIA 2BFPA 5CA1F 2DJ5A 1Y48E 1CHNA 3QE9Y 1WR8A 2AE2A 5JSKA 2YMMA 2FPXA 4YO7A 3HJRA 2GX6A 1FUYB 2FPIB 4GXQA 4S1WA 3T7TA 1G21B 1RZUA 4B7XA 2JH9A 2HT1A 1JSLA 2GARA 2PEYA 4GYJA 3C0KA 2QW0X 2GEUA 4BNGA 3V80A 4QG3A 4Q1CA 3BMXA 4KTVE 2VRNA 1CUIA 3WHPA 1NLUA 4EJMA 4TV8A 3TZLA 1YS4A 4MVJI 2OZLA 1F7UA 4C1BA 4CU5A 1BDJA 1H3NA 3EW9A 3I30X 4US0R 2HJ9A 4WUVA 2C8VA 3WJ7A 1BX0A 5K6AA 1U90A 3RLIA 3E1SA 4GPD1 1MW8X 3GIWA 3OJCA 1E7QA 4IAOA 3U7QA 5TS3A 1T8UA 2V45A 4EHIA 5LQSA 2FJ0A 3I37X 3T61A 4ZEVA 4FT4A 1WZNA 3JYNA 3ZLUA 3U4QB 4KSBA 5AI9A 1BW9B 4DDUA 3EZGA 3ZVLA 3C7KA 4FDUA 4WKOA 1VMEA 3VO2A 3B52X 1Q12A 1HT3A 3JZAA 4UU0A 2WB2A 3EXHC 4GIBA 2RGDA 2Y2UA 3MQ4A 1ZHFA 1TK3A 2OCYC 2NIPA 4G1FA 1LS1A 2IWRA 4EJSA 5BQ5A 1TYEB 3BWMA 1QVVA 2NNWB 4INZA 1IMJA 4NIMA 1YR9A 5HKLA 5LNK1 3AZOA 1QE3A 4LSWA 4C9BA 4QDKA 2P1DA 4N3CA 4O2BA 3L7LA 3HR4A 7MHTA 5DOVA 1EINA 2QWXA 2VZLA 4MW6A 4IZOA 2BTQA 2GBCA 3T4PA 1FW8A 4Z4HA 1S1MA 4PYOA 1VKJA 1RI1A 3EOZA 3ETCA 3FZEA 3LLCA 3EAQA 4U6QA 1CF9A 4BCCA 4LOAA 1FSSA 1DAHA 4FTWA 3RYIB 4D6XA 5B4UA 2E6KA 1IHDA 4MB6A 3N9IA 4IIDA 2IZ7A 3FKQA 3ZJUA 2JC3A 2IXBA 1TKRA 4B6PA 1TUBB 3L46A 1T43A 1FJGB 4K03A 3GD5A 1UFQA 2XQGA 3SHTA 1UJMA 1DZIA 1S01A 3BE6A 4YAIA 5JZMA 5LP6F 4JELA 4JDPA 5IJ0A 3IRUA 3FCSB 3EEIA 3DLPX 3QVSA 2JGNA 4ZQHA 3W79A 4G26A 4UHCA 3F5MA 5HKKD 3G7SA 2CL7X 1AKEA 3A28A 3GLFE 1KJIA 1VCHA 2D7CA 3H2HA 3FSJX 5BRNA 1FXSA 3LKDA 1BHQ1 3JV7A 1QFSA 3H0CA 1N5OX 4HDKA 4IBOA 1T3GA 1QDEA 4BO2A 3DB1A 3PQEA 1T9GS 1BMFD 1EKXA 1HF3A 4GD3Q 2B0JA 2W70A 4GKJB 1PBNA 1L3IA 4L5YA 5FAKA 4DM7A 4CTMA 1J0AA 3CH4B 3CT4A 3PENA 1QIGA 1RZVA 3ONVA 4YRFA 5D8DA 1QYCA 3OCXA 3WISA 5TPWB 2BGNA 3BN3A 4G1UC 4R5HA 4F38A 1YU9A 2VAWA 2Z1MA 1GJRA 3AESB 4Q5IA 4R3NA 1MZPA 1FQJA 5H9WA 3O3CA 4WD3A 1O94D 3DZJA 3OWHA 2V7QD 4NICA 2YS7A 2MSEB 1M9NA 1E32A 4PNPA 1NTOA 5JQGA 1DSSG 1XAGA 4EOGA 4HX5A 3SAJA 3BGWA 2ZTVA 3BL8A 4O2LA 4PHHA 3VPCA 1AGXA 1OXVA 3DHWC 4CCYB 2A9OA 3KHTA 1QGZA 3ETJA 3K09A 5UKDA 4INPA 3SNKA 3KJXA 1GYRA 4DKJA 1IVSA 1H85A 2C3OA 3DT9A 1PG5A 5ULLA 1BEZA 3A25A 5FP0A 4GX2A 3THRA 3OM0A 2GPWA 2ZRCA 2PV7A 3KDSE 4PWYA 1POWA 3OJWA 3KWFA 3WKAA 1PLJA 3O1LA 1U0SY 1JG3A 2DPLA 2PUEA 2IEYA 1KC1A 3PIDA 4N4AA 4P8RA 2OGSA 5SYNA 3QMVA 4HDOB 2H2AA 3O3NB 1KOLA 4KITB 4I4TB 3QW2A 5AQ1A 3CPEA 1Z3CA 3FBTA 3ISTA 4MVWA 1TMGE 1XHLA 3W6UA 4D98A 2QSUA 4ZFNA 3GLIA 1B74A 5DHSA 4DCCA 2AHOA 4U0JA 1IQPA 2BSAA 4DLAA 1NP7A 2A57A 2HU8A 2ZRHA 2A0FA 3DV2A 4GKVA 1R6AA 4LMAA 1WHTA 2QYTA 1HFEL 3FLAA 3T38A 2EFYA 3HP7A 4IQ8A 5GZ3A 2H52A 3T0FA 5J43A 4Y6OA 3F46A 1L7QA 1E6EA 1KDTA 4F4IA 3KKQA 2I91A 2VEDA 4DGQA 4M0DA 5KYUA 2QG9A 3BJIC 1SVNA 3NRCA 3O8CA 2OR3A 1MRZA 3ICPA 3IOYA 1FFEA 1ZNYA 2R6FA 4D26A 2PSJA 3OWXA 3RYHA 4JP2A 3WSWA 3VU0A 1I5OA 1EVKA 2XKJE 1AMUA 4P32A 4EHHA 1I6KA 1RAAA 3AFMA 4F6RB 4HQNA 5EPEA 4XWAA 5KQLA 1FVOA 2IU3A 1X7DA 3PT5A 3ROKA 4XI9A 4D82A 1E99A 1MC8A 1XN1A 2IKQA 2NT3A 3AIOA 3G2OA 4DPLA 1Y3HA 4AFNA 1O0BA 2A5DA 1F8GA 2FPLA 5IC4A 2LBPA 3OUZA 3QY0A 4ACBA 4R7TA 1C4WA 1ZSYA 3NZEA 4EGAA 4EMTA 4QHSA 3GXBA 2ZBGA 4UQLA 3CZ4A 3FMFA 1EX6A 3I1JA 1G20B 2X15A 2YZMA 1FA9A 3BORA 4J43A 4A16A 3ZHTA 4P4SA 1UFVA 2JKVA 1UQTA 2ZRFA 4EM6A 3FOFC 2HU7A 1VL1A 1C30B 1E5VA 1KO4A 3B6JA 3O1HB 1O6FA 2FW1A 4GOKA 3SBXA 1PWHA 3I72A 3PWTA 3G2JA 1XTZA 1RWBA 1EK1A 3C85A 2UUPA 4CMJA 4KYVA 4HZUA 2R6DA 3EGDB 1WXHA 1SQ6A 4IHKA 4NH4A 1XQWA 2B4KA 1J20A 1JXQA 4NVRA 3ETHA 5C1BA 3MT7A 1GZ3A 1ECLA 3BXEA 3LCUA 4QEDA 4WA7A 4PG8A 4C2TA 3L9XA 1EAYA 1U28A 3ZWYA 3OMXA 1UOEA 4E09A 3F67A 2R3SA 3LG2A 4J6FA 2Z08A 4RMIA 3R6TA 1LCIA 1PJ4A 2F2TA 2YXDA 4FYMA 1YBVA 5JYEA 5H8WA 2AI3A 3CRQA 1YJQA 3IJRA 3FCEA 3N1UA 3ZWDA 4EKYA 2ZSAA 1CUDA 1FFDA 3AL3A 2GR9A 4NYJR 4KIUA 2IIPA 4FM9A 4KMSA 2E7ZA 1PT9A 4Z7OB 3BKXA 4MSUA 3M34A 1SC1A 4TV8F 3P4YA 4YMGA 5KDDA 1AA6A 1JAZA 1CVRA 2FRDA 2EJBA 5HK9A 3P20A 2IY7A 5CDGA 3OKPA 1E3DA 2ZDGA 1CF2O 1R9GA 4HLQB 5AMXA 1U8CB 1JYFA 1JKIA 1F6WA 2RBGA 1CFZA 4YJGA 2OAP1 4X91A 2G28A 3IMFA 2Z2YA 4E3ZA 5B58T 1JG4A 3ILYA 2BPOA 2R8XA 2EGUA 4HNGA 4L4UA 1KJJA 3A3OA 2WZBA 4R2XA 5HJ2A 3FGZA 1I6LA 1RAIA 3LYLA 2IEGA 4DRYA 1MRNA 2MCFA 2LXNA 3IOCA 4DG9A 3A9WA 2RGUA 2XMPA 3EQZA 4B87A 1GRCA 1QZXA 2WR8A 5CH5A 3RABA 3NHWA 3BH7A 3RK1A 4Q21A 1CJKC 1UBTS 2MJLA 4Y9RA 1EP3B 3DCIA 4DV7B 4LK3A 4Q4JB 3WLJA 4URFA 1Y7PA 3VMFA 4DL9A 1G66A 5I5EA 1OFGA 4JCCA 4EIWA 4Z6KA 4J4BA 4MS1B 2E21A 1VL2A 1JH8A 1ZKMA 3DAGA 5CYPA 4GL2A 2I3ZA 5A6SA 2Y71A 4KXWA 3NH9A 2O6HA 4EBFA 4QE3A 2QR5A 2OFPA 1VJ5A 3FUWA 5FLKA 4DR5B 4IVRA 4CM9D 5LBUA 4D02A 3QEOA 3ED5A 2GN8A 4ZGWA 4GT1A 4OL0A 3CH7A 2IRWA 2VP2A 4YGYA 2GUGA 4E4RA 2OV8A 1Q6ZA 4EZIA 3BZWA 3EZ6A 4CLDA 2FETA 2YZ7A 3HXTA 4Q4DA 3MJDA 2J59A 4UFOA 3UNXA 4KLCA 5DHTA 4JEIA 1FUEA 2B6HA 3PDWA 3T7CA 4DA9A 2X9LA 2FXIA 1JE1A 1K8QA 4F85A 3AXTA 2YXNA 2YHBA 4MW2A 1P74A 2O7RA 3AKEA 4BNXA 1FVHA 1G42A 1UAYA 3NHUA 4GP7A 2DQ4A 1D09A 3EOAI 3OSZA 6NULA 4HVLA 1GPAA 2ORED 1K27A 1E4EB 1GRVA 1QGDA 1DIGA 3GVCA 1JNXX 1C50A 3WMRA 1MH1A 2W6OA 1WCXA 2OK7A 3JARB 3WX0A 5IN4A 3KO8A 2CT8A 3NRJA 1GCIA 1GILA 2IC5A 4NYMQ 2ZB7A 2L2QA 3A27A 3OF2A 4W9NC 3RUDA 3SYLA 4L4XA 1RPJA 3W5IA 5E1OA 4YUXA 2IITA 1XJ0A 3WS7A 1ORTA 4HGQA 1SBIA 2H5IA 4WJLA 3AUSA 2XTZA 3OCWA 1OU4A 1TZKA 2FUEA 3P2JA 5F4BA 3ACCA 3RVJA 1Q91A 2VUTA 1TM3E 4RLQA 1AKQA 1CY1A 3BE4A 3V3TA 1Z06A 4FMDF 3WLHA 4BNHA 2EERA 5C4MA 3HCNA 4OP1A 3BGDA 5CVDA 1I4TD 4YCLA 1JLLB 2Z9CA 5EYPA 2AOXA 3DHNA 3QHAA 1OZ0A 3A0RB 4CKXA 4I9NA 1ZOPA 4MEBA 2GSDA 5LLDA 1E3MA 3SKXA 5BXQC 3IKMB 3ZVRA 2Q5IA 3DLCA 3SZRA 3VDXA 5L8VA 2XBLA 4E7PA 1Y8CA 5DXFA 5F7ZA 4LF6B 4XSHA 5K0GA 1A8UA 3WHIA 3TQRA 1P6XA 1YE8A 4MZXA 4Y0AA 5DRYA 4ETNA 3KSDO 3LUJA 1S3FA 1X7YB 1FMTA 1Y6JA 3EH2A 3NIFB 3ONEA 4LZWA 3VI4B 1CDDA 1OLOA 1U7UA 1PR1A 1WCWA 3DQQA 1RHKA 1LF0A 3GFOA 5EHXA 1FJHA 5F2NA 2CFSA 1L4YA 3JRXA 1QTRA 1LFDB 1NSFA 4R2JA 5GPBA 4JBWA 4EYGA 1IIBA 4RZIA 2L19A 3OZAA 1D6JA 3DMYA 4K46A 5IG2A 1PNTA 4OSOA 1L3CA 5A5GA 1YT5A 4KC0A 2BR4A 3TFQA 3A6PC 4TYMA 5C2JB 3NNNA 1NP6A 4X93A 4BEVA 5ALZA 3EPJA 2ZR9A 1XKQA 1Y6GA 1XB2A 2W8ZA 2YBEA 4YV1A 1WX1A 2A3RA 1IATA 4BO3A 3CCCA 3B2QA 1V45E 2C7VA 5IVIA 5KYTA 3AHJA 3OZEA 4JLWA 5ALPA 2ZUFA 3W2TA 1E7MA 3ZZUA 4AJ2A 5JVDF 1U3CA 2H08A 4LYDA 2X7JA 4QASA 1RQ2A 4DIOA 1E77A 2VSFA 1R8YA 3WZ2A 4B5LA 3E5NA 1XDBA 3EWSA 1ZIYA 3UIEA 3E22A 2BCJQ 2ZRGA 4DOMA 5FUXA 1JTEA 2QRUA 4G5GA 2PTHA 2R44A 4Q3EA 3W90A 3ZS8A 1LSJA 3CPJB 1T4GA 2HJRA 3DB2A 4TN5A 2B30A 1UDBA 1EGAA 1XZJA 1ZITA 4FMPA 5KSYA 2XRZA 3OH8A 3QTBA 4WFQA 5CT8A 3HYCA 3ZGLA 3LFUA 3VDNB 4NMXB 3F3SA 4GC5A 1OTYA 3F47A 3HH8A 5EWLA 1VXRA 1SHKA 1A7JA 1Z8DA 1UODA 2CE7A 2YC2C 3GGJA 1Z15A 4C76A 4RMGA 4G1CA 3KJGA 1GCAA 4KFCA 3EZ2A 3FYDA 1ZD4A 3DDUA 5LKAA 2VIIA 1YS9A 5J5VA 4FGLA 1OU0A 3UV6A 3WRVA 5FLXA 4WH0A 1SC4A 4DUGA 3HXMA 4BQNA 2J7KA 3G1TA 5JXHA 2YQ4A 2ZSDA 1ZRSA 1NLZA 4QZVA 2LIPA 4Q16A 4C5AA 1SURA 4HTFA 5JSZB 2H31A 1YI0A 1CERA 2V6JA 3LPCA 5LIPA 4RIIA 3CF4A 4BFXA 3NHZA 4EPVA 4H16A 3M1LA 3TUZC 1XTTA 1QJ4A 4MP6A 4DCNA 1E0KA 1KC3A 1OTXA 2BMDA 2CJYA 4E2WA 5HBGA 3HJTA 5JROA 2XXAB 4QQRA 4MKHA 3WI7A 3HSKA 4F6LA 3AP2A 3I9JA 2HDNB 1LLUA 3WNVA 4F91B 3H2YA 3HVRA 1WMEA 1MB0A 2M6SA 1WVGA 1ZRNA 3CZAA 3OZRA 2GM9A 3VZQA 2HJGA 4YI5A 3DE7X 4NP6A 1UXKA 3U3OA 1G8HA 4OLHA 1IJFA 4OQMA 3KM0A 3EZFA 3UYKA 2C94A 2ZQYA 1N8SA 5LC1A 4BGEA 1AUPA 4M9QA 1PSZA 1OV6A 3QXCA 4CF5A 1TLLA 4GOXA 2IU4A 2VK1A 3DR3A 2JFUA 3FOWA 4OQEA 5LZ7A 2C88A 1YGYA 5AJVB 3KB2A 5E2BA 1RYYA 4QFBA 3U7EB 5CVTA 4P81A 1MO5A 2OCAA 1YZKA 2ZAIA 4J7UA 3GEDA 4B80A 5CLFA 3Q11A 4IHJF 4YLEA 2DPGA 3AM4A 3CTMA 1PK9A 3ZWOA 5E4TA 1T0BA 2GDZA 3RFVA 4GGPA 3UUFA 5HUJA 2H0QA 2GEVA 2QNIA 4ALIA 1WCIA 2FG6C 3B53X 4OREX 1OCEA 3E4DA 4GMXA 2LVBA 1JPNA 2WYWA 4YQEA 4DY6A 1C1DB 3DSRA 3K8ZA 3GJ3A 4AX8A 3AQIA 1FB5A 4RD2A 4H6PA 4N7BA 4RIHA 2CSXA 2AKYA 4M7RA 1JAXA 3NDPA 3KYBA 2XKKA 4MKIA 1OH7A 3DBLA 5HHTA 2FPUA 3E7PA 1A1SA 2H1WA 3FLBA 4OHBA 3E3AA 1WOMA 4FDTA 4IS3A 5AH0A 4CMKA 2J0SA 2WTAA 3ZZMA 1KE2A 3AEYA 3IUMA 4YXFA 1Y8QA 1R8SA 2EFJA 1CXZA 2RGBA 4I50A 4YCJA 1ZVJA 2A0UA 4CQMD 1NVAA 1HNZB 3A3NA 1AZSC 3P1JA 1ZXBA 4RK0A 4E94A 5IT4A 1MJGA 3L6RA 1Z4QA 1JDNA 1B8UA 1GTVA 3PP8A 3WK4A 1ES9A 1XTQA 3OQIB 3N8KA 1P60A 2J3DA 1QG6A 3CCFA 1H2ZA 1PR2A 2C3UA 1R8JA 2ZSBA 2IYFA 2QL6A 2W71A 3ENQA 2A9RA 2ZKIA 4L5CA 4DCVA 3OD1A 1CUBA 1P1CA 4E1VA 2XHEA 4K6OA 5L6LB 1C0LA 3PUHA 5I4BA 1EK2A 1P2TA 3KAJA 2G1PA 3SXUB 1H5NA 4O0LA 1TAGA 2HCRA 3WNBA 3ESQA 4KDEA 2IYRA 1W9HA 2OP1A 5F9HA 2GVDC 4ZI5A 1E4OA 1H0HA 1LZKA 1GSAA 2EZ4A 3DVLA 3U3XA 4ATNA 3QKTA 4DDWA 1QGYA 2PL9A 3E03A 1JKXA 1DRUA 1UFKA 1P3DA 3G5AA 4IJKA 4BOYA 1S1CA 3ZXXA 2YC4C 4WOCA 2OAQ1 5SY4A 4GKAA 4HFJA 4NYJQ 2X13A 4PZPA 4UVDA 3IQHX 4CI0B 4PC6A 3QF7A 1KXJA 3BMNB 2G8LA 3SD7A 4OA5A 5DTJA 2QGNA 1GPJA 4I6JA 2J45A 4YJDA 1OWPA 1QFXA 2C00A 4HS9A 1PNVA 4HUQA 4UAUA 4Z8YA 4FS3A 3ZGYA 2OZKA 4Y6SA 5LUBA 4DSUA 1T1GA 4TKVA 5HZHA 1OR8A 3WB9A 3WA7A 3S5UA 3I5XA 2G04A 2FSUA 3UK2A 2FPKA 3MMPA 1R6BX 5H3LA 1DKNA 1YZYA 3VH1A 3JQ8A 4JGIA 4E11A 4HWRA 2WWTA 1Z63A 2V6FA 3HPQA 1DE0A 2Q3LA 4FVTA 4HDSB 4LQDA 3GGOA 4JENA 1MJNA 2HO5A 5JAMA 4PAWA 1A9ZA 1HT0A 1XQXA 1LF5A 1NJFA 1M6VA 1RJ9A 4RHUA 1CR2A 1XO1A 3H42B 1L7DA 1HNWB 2WUGA 1B0ZA 3B1KA 1QX4A 5CITA 5IZCC 3GAAA 2OM6A 4FSDA 3CLSC 1A88A 1JIIA 1VFNA 3CRMA 1OFUX 3OMWA 2CXNA 1Y4AE 1QH8A 1JVNA 2BDUA 3HV0A 4JUAA 2E18A 1A5AB 1P18A 2VXYA 3AEKA 5IXSA 4C06A 4EVSA 2JAPA 3WJAA 4RYLA 3LECA 2HWXA 4HYQA 1XCBA 4DIKA 4EKEA 1MX1A 2ZYHA 1J8DA 4X84A 2RKWA 4PPGA 4EECA 1HOXA 2QE6A 1TNDA 2YH2A 4FT2A 4K2HA 1XD9A 4Q4LA 2A92A 4RUKA 1RCUA 5CURA 5TXGA 3A6LA 2DT5A 3KP1A 1ZLYA 3OQ1A 3UM9A 1P5JA 1BN7A 1JHPA 5EAIA 2DAPA 4HEJA 3GHHA 3KEMA 1D7AA 2OYRA 4BNMA 4BVFA 1H4TA 3HVJA 4PYLA 4UEKA 4R84A 1U1FA 1W5AA 2I2BA 4CKYA 3IS3A 1ND6A 4QGGA 3S8YA 3JAMA 2A1UB 3GMDA 2QOEA 3UXEA 1BMTA 3LVFO 4U2GA 1HQDA 4ZDWA 5IM4A 1JR3E 1TAHA 2CMFA 3QFSA 1HDOA 3SHVA 2ZIUB 5LP6B 4QUJA 1NVUQ 2IE0A 3VDRA 4L6AA 2A5LA 4GICA 1PT5A 3EDRA 3ZCXA 1I4LD 1TVKA 4K9MA 5LLTA 5DGTA 4KYIB 5E7MA 2ORIA 3C3JA 1NJ8A 1GLGA 4ZK6A 2OBNA 2B4RO 5KPJA 2J5BA 4X00A 1M2OA 1NYTA 1YDFA 3PSHA 4LJ6A 2CFIA 5IYZB 2RI0A 4I5IA 4PNEA 2RJNA 2BFBB 2DUUA 1G98A 3CW2A 4WSOA 4X92A 4BMZA 5JXGA 1W9MA 3DDWA 3ZY4A 5CA1B 2QP9X 2JPDA 1GN9A 2DQYA 3WWCA 1PSDA 1QRAA 2FSIA 4TT3A 3UAZA 3F6BX 3IA7A 3LY9A 4TLLB 4UD6A 5LKRA 1T8RA 2KQUA 2ZSJA 3G59A 3LF2A 4I5DA 5ECDA 5EQFA 1N7IA 3PQ2A 3QUQA 1EDOA 2FR1A 4XOUA 3VC2A 1HI9A 3KR0A 1H6BA 1RWVA 1E4VA 2EEPA 2GJ8A 3TR0A 4EPYA 2BSQA 2NPOA 3MWEA 4MCIA 4RGQA 4V03A 4ZCIA 4A2PA 4IOMA 3DZBA 4M9SA 3HJHA 4FYVA 3DM5A 3B6EA 3K0AA 4Q05A 5REQA 4PRYA 2LP4Y 3F6CA 3H0EA 4LZJA 4X0EA 3Q8WA 3VNBA 1WO8A 1ZJYA 1F1BA 3DDNA 5DIZA 1ZONA 4URUR 5AKHA 1CJTC 3TD6A 4H77A 1DEAA 1VMKA 2JBAA 2P2SA 1JBKA 3EQ8A 1MB3A 3IXLA 4OPMA 1KBOA 4W63A 5ILOA 2RHWA 3TRKA 4OFWA 1KO5A 1SXJE 3OIFA 2O2YA 4NCXA 1QRTA 3PFHA 4XWGA 2J0UA 4UU1A 4M0FA 2QV7A 2BY4A 2HIAA 4DB2A 3G7NA 5HVNA 2D2FA 4LYGA 3E48A 4DSNA 3KZNA 5HCNA 1EUCB 1DQPA 5IDXA 1V1RA 2IOYA 3F7NA 4W1RA 4AY5A 2YY7A 1YC2A 1EH5A 3LUHA 2R1TA 4WINA 2UZ0A 5JDCA 1J33A 4HAIA 4PCLA 3JQGA 3ZXIA 3QZUA 2WF7A 4QNNA 1GN8A 5KJ6A 3LKVA 5ABPA 1GO2A 2Z2IA 3ENNA 3JPWA 1L4GA 4Q4AA 1FDTA 2AQ8A 2V6IA 1E1CB 4WK2B 3PXGA 5GINE 4GX1A 1WDWB 3WWOA 4H4DA 3R9KA 1BEUB 3K9WA 4YQYA 4BKPA 3O8QB 1J2RA 2SKEA 1U8XX 4LZNA 3HCEA 2GERA 1HETA 3J7TA 3EVFA 3TXXA 3C8ZA 3WYBA 2NO6A 2PM8A 1KZ7B 1RRMA 3LGSA 4QIHA 3HKEB 4AKSA 4AKIA 2VPYA 3N76A 1EHYA 3SC2B 1SQSA 4J0DA 4DIBA 4Q24A 2WJ6A 1SD2A 1SBZA 1XALA 2GXUA 4I5EA 2F8TA 4H7EA 1R5NA 1KFCB 1WDTA 4BLRA 3MGCA 2XRYA 1W44A 1Y3CE 3WP0A 4FYWA 5KOIA 5M04A 4TUYA 2P0AA 1WG8A 2KW5A 2ESRA 3NTLA 1E9SA 3WLKX 3EG9A 4AZ0A 3J81A 4CFSA 1L8LA 4LDAA 2A0KA 5FPYA 2V7VA 4D0NA 2J30A 2LNDA 3KHSA 4LJ5A 4P3YA 2WWVD 3TW4A 3NP9A 1XE3A 2IXFA 5B12A 3ZX4A 2W2OA 4KMMA 4FIDA 2P35A 3AW9A 1GGHA 1VB5A 4JKOA 1GRQA 4OVKA 3RAJA 4C07A 4FC6A 3F78A 5ECWA 3VV3A 5JEDA 4Z4FA 3N7TA 4JIGA 4M0MA 4QXQA 5I7VA 1NW7A 2XBMA 1JX6A 1NVXQ 2IQIA 3KB8A 4UUMA 1KZ9A 3GUVA 4UHEA 2JVJA 2ENUA 4AG6A 2FVYA 3TG8A 4N5IX 4C0WA 4QM7A 4E30A 1JI3A 1YQTA 4HWGA 4EUSA 4MVJD 1UDAA 1IU9A 2FLWA 2PKWA 3G5UA 4GQAA 1NYQA 2BDTA 5M7EA 1Z74A 1O6CA 2O2JA 4MKXA 1WB6A 4F9FA 1M8GA 5C1OA 1N2EA 5EZYF 3TOCA 3WL5A 4CG3A 5FUMA 2C9YA 1F17A 4CEJA 1CULC 3DQPA 4Y1FA 1DEKA 2XB9A 3PUYA 1BHJA 3D6AA 3UMFA 3VOBA 4Y67A 2GRJA 4ER3A 1YJCA 4RSHA 5IUNC 3D4BA 1DT3A 3NV9A 3BIOA 4JC5A 4Q1FA 1NDUA 3Q2IA 4MKFA 1NVKA 1KARA 1AURA 3MT8A 2JEOA 4RV5A 1WE2A 2I4TA 4GSYA 1CK4A 1UK6A 5B64A 2X1HA 3RUAA 3N2GA 5FR1A 4OLJA 1VSBA 2G67A 1F2TB 3M9WA 2RHJA 3UVEA 3ESZA 1BCSB 4C3OB 1UIMA 3PX3A 4E5MA 4FHCA 5JYBA 2IZZA 2VJMB 5JJCA 1QQBA 1JFLA 3GY0A 3K92A 1UC9A 2H48A 4TZ6A 4A0QA 2J9YB 1E9VA 2QLFA 3KHUA 2IYSA 4JI6B 3MCWA 3PUVA 1C7ZA 2E3JA 3D0RA 5LZ8A 3WV5A 1MENA 3T94A 3ROEA 1FQKA 2NX2A 4S1NA 1X8LA 2J9XB 3NHRA 2OVBA 3LX6A 4NJMA 1KORA 3E5HA 3KR2A 4GBJA 4U8GA 3ZPXA 4ZDKA 1C8VB 1MB4A 1SBCA 2LCIA 2ZI7A 3Q3HA 2J3QA 5DI9A 5A3VA 2E82A 1SPXA 2EWMA 5GVSA 1QP8A 4YRPA 4RY2A 2QVBA 3NX4A 5AHWA 1PJQA 4QPDA 4YJHB 3F5DA 1M8PA 2ANCA 5J4LA 2PA3A 4QBHA 4YMVA 1FFWA 4OJQA 3ROPA 1QPBA 1VG9B 3CH5A 4LWPA 5JG7A 4MVJM 3N2ZB 3ZHYA 5JY1A 1V2GA 3IP3A 1TT5B 4Q9NA 5LQUA 1C29B 4QQ8A 1W36B 2HFJA 2XCQA 3EVZA 3EFOB 4H35A 1P1RA 2IYVA 4LDJA 3OPMA 1V48A 1TGYA 3QBTA 4KQFA 2WF5A 3I2GA 5I7HA 4BHTA 2FPGA 1W87A 2D0IA 4YO8A 2COUA 5F5XA 1N75A 3HPRA 3W7AA 3I6MA 1T91A 2PSHA 3H4VA 3V7NA 1U3UA 5D3MB 1EXMA 2C29D 3NHJA 5A4KA 5U9CA 5J2UF 2C8LA 2O7VA 2X8JB 3NBZC 2QRKA 5DM1A 5G0WA 3M5WA 3OSUA 1GA6A 1TQ6A 5CK5A 5JMTA 3RAPR 1RWKA 2QRMA 4TOIA 4EY5A 3RUEA 3ZWCA 4FNMA 3QUSA 1YTUA 1FP1D 3GQBA 4CDNA 1J0DA 4IYRA 3K0FB 4EQ6A 1A9QA 1C1XB 4X60A 3W2FA 2C7PA 1RMYA 2BC9A 2QUZA 2BUBA 2VQ3A 2WI8A 2QVYX 3I42A 4OY3A 4PNZA 4YP0A 2OA0A 4F3RA 1ECFA 2I80A 1E1QD 3CLRD 3X2SA 2AG8A 2QN1A 1W35A 2GAOA 4DA7A 5MN6A 4JI8B 1QAMA 1YB5A 4GYWA 4I8IA 4C78A 3P97A 1C1HA 1ZJJA 5EFOA 3O21A 4DEYA 2ZAMA 4IGAA 3K6RA 1BE1A 1VHWA 3W5HA 5IKEA 2CBZA 3D0QA 4Z3OA 3D7KA 1JDZA 4RABA 2FUG1 3NGMA 1LVHA 3NYQA 2GETA 4AUEA 1M73E 1VHJA 1ZBDA 1LPNA 4BC1A 5I9BA 4JP8A 5HDBB 3LI2A 4BVBA 4ON9A 2GK7A 2HADA 2Z83A 3RR2A 3NBAA 1X80B 3U17A 2FN8A 3VH2A 1OWOA 3WOHA 2BYTA 2P3OA 4PIVA 2E4UA 4RU1A 2C7GA 4MCJA 5DHRA 1X7WA 2N1MA 4WFIA 1CYEA 4BDTA 2R8ZA 3DKIA 4QNMA 4IUCS 1MQ8B 2I67A 2I7TA 3MW8A 4CMAA 5H9VA 4GUDA 3UWOA 2IQ5A 4MS3A 3DYVA 3MC1A 5G2OA 2YYYA 5LU8A 1PL7A 2XY4A 1H3EA 5DGIA 2CXUA 3HN7A 3C8HA 1XTKA 1XXLA 3WBFA 4B3FX 3ZDAA 3TCKA 1N8NA 1JIJA 3BXHA 3W34A 2AJ8A 4WERA 3WLQA 3HEBA 3SN6A 4ZV4A 1IB0A 4NG5A 3K5IA 4JLBA 1SD1A 4PG5A 3ZNNA 1IB6A 3D4NA 1NA5A 5ANRB 4DMHA 4YRKA 2ADOA 3THXB 2QTBA 1PFYA 2CB0A 1RKVA 3KFXA 3QXSA 4YXWA 3EPLA 5HCIA 4ETWA 2TMYA 3SOZA 2BTEA 1II8B 3L7KA 4YROA 3N75A 4C3UA 2OCXA 4AJEA 4GHWA 3LOPA 4RLHA 1FC0A 2EQAA 3V32A 1W88A 1JHVA 4KQEA 4ND6A 1HEIA 2ONJA 2C5LA 4NX2A 4EG6A 3JWJA 5GY7A 3DQZA 4DLLA 3A10A 3BXOA 4IGKA 3CW8X 4GPBA 1RWQA 3GROA 3QG5A 3OJXA 1GAJA 4ZT5A 3H9JA 3C5CA 4YRJA 2JK1A 3H9GA 1FS5A 5HDQA 1VHDA 4U5QA 4KFRA 4M1WA 2B5VA 2GK6A 3TCXB 1A72A 1KH2A 2Y3IA 1E1LA 4PX9A 5C4GB 3AY0A 3EA5A 1ODTC 3EDQA 4P4SB 1DIAA 2IY9A 5DEIA 5LR6A 4MQEB 3UICA 1DG1G 2OB2A 1ZR4A 1ZKDA 1ZOLA 1XRRA 2FW9A 3PFIA 1A7UA 2O2SA 1WRBA 2P4HX 1GUYA 3EIUA 1MA3A 2XGMA 4K9RA 4PPYA 4WOBA 1BSVA 3CUWA 1FSGA 4FN4A 1X74A 2E1RA 4OXKA 4CODB 1RJWA 2CDAA 1GPMA 2XUJA 1OYWA 1A4RA 4ZVPA 1T5IA 1NHWA 1ODCA 1P2FA 1O58A 3G1UA 3NALA 4JQOA 4MTCA 4OB7A 4A36A 1Z4PX 3GT7A 3LW7A 2WYHA 2GPBA 5BV8A 1VZ2A 1JJIA 1VGVA 2QRNA 2SNIE 3HXKA 4CI9A 1KQFA 1PAUA 2OCGA 2Q07A 2GNPA 4I9HA 1GNPA 1U9CA 2AYYA 1Z6GA 1B2LA 2BGMA 2QEQA 3KVYA 4J0KA 4JX8A 2N42A 1UBKS 4MI1A 4N40A 3GLGE 2CXTA 3GBVA 3LD9A 4NV0A 4G81A 4WN9B 3FKJA 4HXGA 1IBCA 1CEXA 4IKEA 4QDOA 1SB9A 4U00A 5JXJA 4Y98A 3BMCA 2BZSA 1Z0ZA 3DMDA 4E03A 1DHRA 2QN2A 4ZT3A 2OZVA 1N2IA 4MPRA 1E6WA 1Z6YA 1YR8A 4UNIA 5KBYA 5LOVF 4NYMR 3RPEA 1W2HA 2VPWA 4J7AA 5J2TA 1R6TA 3OFND 4UHFA 4OBXA 1T3ZA 1UAGA 2J31A 2AW3A 4J1TA 3ZCQA 3USCS 4B40A 2Q3JA 5HM6A 3PEEA 2Q62A 2HBYA 3VR4H 2ZDHA 1JV2B 4LMBA 3V6LA 3W8NA 1X1SA 3GRCA 4U1RA 4Q19A 3GP3A 1CY7A 1XSEA 1RYEA 2AI2A 1UBHS 2HPHA 1WUYA 4KE9A 4E2YA 2IHNA 2Q3MA 4P3NA 1TA0A 3MN1A 3U7GA 2BGIA 1HMYA 3EZYA 2CVQA 1DAIA 1QHNA 1E79A 1GUFA 4EHKA 5HPYB 1FZTA 2YWEA 1AS0A 4MR9A 2NUAB 2XB6A 1U7XA 1K75A 2YW9A 3K2IA 2NSDA 2M98A 4HDRA 4KI0A 4PNHA 3ZH2A 5CB0A 1G7SA 3HVUA 3KC2A 2ZB4A 4GZ6A 4JKYA 1XG5A 4JYCA 7MDHA 1SUCA 1Y33E 1L7OA 2WJWA 3DFKA 2GVNA 3HJUA 3NHFA 3O26A 4FDAA 2UZ3A 4BKUA 4D8XA 3B6ZA 4UREA 2EL9A 2G08A 4L5JA 4MPJA 3SQDA 3KJIA 3BTVA 1N0HA 4KMRA 1A50B 1J2TA 1HT2E 2G07A 4WBNF 3U44B 2JLSA 5AKJA 1RRFA 3DEHA 3EBLA 5C35A 4X95A 3OOHA 1BEEA 1ZOSA 2FSHA 1TUEA 1VGQA 1T2DA 1IULA 1I6MA 1FBTA 2A78A 2KSQA 1PV2A 3C7TA 4XKJA 3KL2A 4CRWB 1JYSA 1OV4A 2EKBA 2HJHA 1O97D 4LVOA 1B6TA 3P9IA 1WDMA 2ATCA 3DFIA 2CUNA 2FMHA 3WXBA 5KB3A 2OZLB 3R8FA 2JATA 1XCJA 3O4HA 3X1XA 3TZKA 2EFHB 2WD7A 5KNCA 4EABA 1IN1A 1GPDG 1WV0A 1K8XB 1Y82A 2KMLA 4G4IA 1HDEA 4XVHA 5LWQA 3ZKWB 4AF7A 3G2KA 1VCNA 5LJLA 4ZYUA 3KQOA 1DU4A 4QWWA 4XA8A 5B2ZA 2QJRA 4OGGA 3FUXA 3OT1A 1SZJG 1JQ3A 2D0DA 2RK4A 1Y9ZA 1GG9A 1ZNQO 1F1JA 3B38A 4Q4CA 5ENVA 3I1IA 3G89A 5K2MA 4ZICA 3MMNA 2HTFA 4A8JB 4IQFA 1P2DA 1V8BA 4ABYA 2FPPB 1CNMA 1GKIA 2GEBA 2JH8A 4WIAA 4BO1A 4E07A 2XCTB 2GBFA 3KYIB 3OC6A 2WVHA 1WOYA 1TAQA 2J4FA 1JG7A 2JA1A 2UZ1B 4HDQB 4JFAA 4LOIA 4MWTA 3GA7A 1TO1E 3DFFA 3OLXA 1CZHA 4WESA 1XDSA 2IYYA 4OB6A 5KHLB 2PLWA 3R1IA 5ALQA 2PGAA 5AVZA 1QLWA 4GM4A 1Z6XA 2ID4A 4H1HA 2PJUA 3ZHOA 4PRKA 5CG1A 5EZ5A 3BD7A 2Y68A 4XD7D 4Q9DA 2QX6A 3V4PB 1JEEA 3T4UA 3WMFA 1GGMA 3TRJA 2ZM6B 1K08A 1V3UA 2VDQB 5CD1A 3S8MA 1JEYA 2JLWA 4M9RA 4EPTA 3CRZA 2IWHA 5I8WA 2ABWA 3NMUF 1G7TA 1XU4A 1ZWLA 3IUYA 5EIXA 1MA0A 1XEXA 2IYEA 3ZV3A 3VNVA 2WWRA 1RWXA 2OG2A 5AKKA 2Z4TA 4XSVA 5CUQA 4X1IA 2P0YA 4FFOA 1TYZA 5CYGA 5CW2A 2FMFA 1YIDA 2QN9A 5JS2A 1HTBA 1QO0A 3IKVA 4ZO8A 3W7BA 4F9TA 5K3DA 1C3VA 3OE7D 4G63A 1U4NA 2C59A 2Y2VA 4CKBA 3RADC 1A96A 1YAJA 2P9ZA 2VYVA 1D0IA 5AKLA 5F12A 1N4AA 3T9BA 2GCOA 1HYBA 2QUHA 4YMWA 2QRHA 1G8SA 3L8FA 1TJ4A 4MMZB 2ZAYA 4GUAA 3WYCA 1G21A 4QULA 5THKA 3EA0A 3L06A 4QO8A 1GL9B 1ZK1A 1N7JA 3E82A 4UQPA 1GQSA 1OBCA 3BXXA 3PNQA 1S3SA 1XOIA 2FOLA 1QBKC 4ITUA 4XB2A 5LMNB 4E2ZA 3L6BA 2L0XA 4HN4B 2VF5X 4TMZA 2XV1A 4BQFA 2CLHB 3W8DA 4DVJA 1W49A 2WVAA 2QTLA 4HAWA 3BF7A 2BLLA 2C9BA 4L75A 1RBZA 2J46A 3KQNA 1QM5A 3FSRA 5JW6A 4R2WA 4BC0A 3ETNA 3RFFA 1T0PA 3MCTA 2FPWA 4NLLA 3E9MA 3IE0A 3LQ4A 4WZ6A 4CEHB 3MQFA 3L0OA 4AUKA 1NKVA 2B69A 4WECA 1NUQA 1QYVA 3NBFA 4LJKA 4IV5A 2LKCA 5EE0A 4B9AA 5ELXA 4RFVA 1NM5A 4BMYA 1FIUA 1BQEA 1K1EA 3H18A 4QTTB 5C3UA 2ZVQX 4RAQA 3VA7A 2P1ZA 4O02B 2ZJAA 4OUDB 1SKMA 1SKYB 2JRCA 4RGYA 4BLPA 1NW9B 3OJ0A 2A67A 2GMWA 5IAKA 2BIFA 3RTEA 3O91A 4BB0A 4EHLA 2OENG 2ODNA 5M34A 1JEOA 3VO1A 3PHIA 4WXYB 4CMGA 2X3FA 3E58A 3FH0A 4LZPA 3HBAA 1CQIB 5EIOA 3Q1LA 3UUEA 4O2BB 5CGZA 3T06B 3F7MA 1XWIA 1Z47A 1H22A 2IYLD 5IABA 1GCOA 3JVIA 3A4VA 1Z8FA 3OLCX 2AH5A 1CTQA 4JMPA 1NJ1A 3H2IA 3WGUA 1O96B 2VK4A 1EB9A 2V4UA 3DW1X 2QTVB 3C1AA 2XCSB 3EVBA 2D5BA 2NZJA 2OFWA 3OEYA 1FP7A 2I78A 3IOMA 4NU6A 1G2PA 5BW6B 4EPRA 1XAJA 3KRTA 5L3SB 4LJLA 3EJ6A 4A26A 3AHHA 3OCZA 4TSFA 3SF8A 3LO8A 4Z0PA 2F8SA 3R6DA 2AKAB 1L5GB 3ZZ1A 3DBRA 1GRRA 4L0DA 1H1LA 1EUDA 1TTQB 3DV0B 2V7UA 2D4AA 2G0NA 4K9SA 5AXCA 3N59A 3RTCA 3VTKA 4KXFB 4CM5A 5CCXA 4BTEA 3Q8LA 2OXFA 3C5HA 3CR3C 1QG0A 1LX6A 1XQ6A 2CDRA 3NCHA 1CQJA 4FOLA 4TUYF 4D9BA 1DQSA 4BECA 1YVEI 4DJFC 4Z0HO 4QWMA 2XMQA 4ND8B 5FNVB 4CL8A 2Z30A 5I8ZA 1MX3A 1R50A 4WLOA 1DO8A 2QTHA 4JUBA 1SXJB 3AFIA 1T29A 1G20A 1ZMOA 1ZD2P 3DGFC 4MV9A 3WK5A 2X77A 3N2NA 4PBRA 2NPFA 5A06A 1FRFS 5L95A 5TPWA 1NTRA 4LGCA 3J80A 1OXSC 1RBQA 2HA2A 2W11A 1KI8A 1OJ7A 1ORIA 2MR6A 5G0VA 2XODA 5JT1A 1FTGA 5DGXA 4U7WA 4F4HA 4DRZA 4C4XA 2QKYA 4TXNA 1GT6A 4RFSA 3AV0B 3WJ1A 3G8BA 4LVNA 4TKZA 4R0VA 3ZCVA 1JBEA 3NG1A 4MI9A 5IWAB 4D57A 1UQRA 2PMCA 4AECA 5F2KA 4GWGA 1J9ZA 1AS2A 3M6FA 1AX9A 2ZSUA 1EX9A 1T1EA 2PCJA 3HNRA 3PUJA 4MRRA 3DPIA 5E9QA 5FPPA 3CUYA 1Z62A 2ZYRA 5IVDA 3SLKA 4S1VA 3UEOA 3TXYA 3HNOA 2DY1A 3QJYA 2B35A 2BEUA 3NHBA 4LRYA 1KY5A 5A9SA 1OWNA 2PRYA 5F9MA 3CCBA 1FP4B 4D25A 1G4UR 1X7XB 5K0TA 2HLDD 3B7WA 3RVKA 4OHKA 4C0QC 3SXUA 2CVFA 4AJJA 821PA 1K97A 3JSAA 3IYLW 5HQTA 3WGMA 3RM3A 1T5LA 3OZDA 3TFOA 4R2KA 2J3JA 1IONA 1NQXA 2IJGX 2QRLA 2ZUCA 4I5FA 4O2RA 4TXHA 3L7DA 4CR8A 4KK4A 2H1FA 3S6JA 3VSBA 1Q1NA 2PZEA 4R2MA 1Q77A 3FW1A 3GNTA 4L7VA 2GS9A 2IS6A 4OQZA 3K0BA 1K0UA 2C82A 2X0KA 3WGNA 4J2TA 4TSRA 1H2HA 1AK9A 1WBJB 1NOJA 2PWBA 1JHUA 1L7BA 3LCMA 2C92A 3R40A 4I3GA 4WLNA 4BRSA 4J76A 3IQWA 1GIAA 3NP7A 4Q4HA 3ODPA 2B21A 3G0IA 3CU5A 4MUJA 4QOGA 4QO7A 3KKKA 5AK6A 4AMGA 2WDZA 3HXLA 3D3EA 5DBIA 2XWJI 2RGAA 3HACA 3O38A 1ISHA 3PQ7A 2HC9A 1JZQA 2ZK7A 4RQTA 1KH1A 4RH3A 3UMJA 1BXGB 3AY6A 1ZHOA 1SBTA 1RKXA 1SOMA 4M88A 4C30A 1ODKA 2ZWIA 4TLBA 4RE6A 3G9UA 4HZGA 4EVRA 3BKWA 3JQ8B 1P1FA 1WP9A 2OQRA 3QWBA 2I5PO 3DT8A 2ERYA 1RYMA 1E9AA 3DBOB 2XH8A 2D3WA 3BUSA 4U5XA 4DB4A 2V3CC 1R0LA 3D7MA 2G9NA 2DUWA 2K5UA 2VNJA 1XCOA 5TF4A 2GASA 4HH0A 4A0FA 4DE5A 1DKPA 5FH9A 1D9XA 4B3XA 4BFTA 2PNFA 3A7EA 1MJFA 4W9NA 3UQYS 4QDUA 3W6NA 1EFRA 5K3CA 3LGXA 5HOQA 3QK7A 5DLQC 1P4SA 3D4LA 3CKLA 1WNTA 3MWKA 3H5RA 1OPXA 2I65A 1GFWA 4D0RA 1RW4A 1IY8A 4U0KA 1M34B 4B3RB 3RS2A 1F9AA 4KEAA 2ZULA 1A9SA 3QKRA 5U4XA 2A1TS 2BGUA 1NBAA 4C0HA 4IFBA 3GLQA 5BUQA 4OEHA 1GGJA 1CJBA 3HWSA 4NKRA 3T9DA 1CY4A 2YN0A 3NV7A 3UA3A 1GAXA 3RYCB 2WFMA 4G5HA 3QXHA 3DDOA 4ZZ1A 1VHLA 3PKJA 4P92A 1BYIA 5HFNA 2NZUG 3U3JA 1QIJA 1OLUA 3SYRA 1G7CA 2CHGA 4IZIA 2Y93A 5LB4A 4YH1A 3E9EA 1KERA 5AT1A 3WMWA 1L4EA 1E5DA 4DLXA 3NBUA 1YR3A 4X6YA 1HZZA 1K6JA 3GP5A 4A7PA 5EYPB 1GADO 2ZJ0A 5C51B 1OZHA 1ZN9A 2Y1XA 2XJ9A 1F4PA 4EUKA 1YDEA 5BWLA 3OLWA 1CDOA 3CLUC 2YDYA 1HLPA 3KNZA 3HA7A 2ASEA 4I55F 1GNVA 4BDSA 2HWWA 3ND9A 2BJWA 2HQ1A 2HYIC 2AZXA 2PJZA 3EHEA 2O48X 4IIJF 3DOFA 5J2TF 4Z7NB 2I7VA 1NW4A 4W99A 1KK0A 1X13A 3I04M 5BOSA 3K4PA 2IDZA 4OSPA 1GG5A 3CXRA 2ZVPX 3OX2A 5LA6F 4BE4A 1TA9A 2P2DA 4K9QA 4XGIA 2JEZA 4JB0A 5AVJA 1FLDA 3C5EA 4LJ9A 4XIFA 1E2KA 2J5RA 5KVSA 4R01A 4UJ3A 3AKZA 2HR1A 5F52A 1UPBA 1M54A 1V47A 121PA 2G70A 1BXKA 1YS7A 4MUEA 4Q3KA 4AIRA 4BFUA 1NVFA 5ICCA 4GEGA 3GG9A 1J1IA 4Q1EA 2CVOA 3HTXA 2Q6LA 4ZO9A 2QW8A 1EM6A 1GR0A 1UJ4A 2ZT8A 3PHBE 3VVCA 2O2GA 3CMCO 4TVKA 4WI1A 1LBHA 2AFIA 2V54A 4OQYA 3W5UA 1E2FA 4N9QA 4MUHA 4X85A 1NVBA 3PHJA 4A5OA 4OV6B 1BJTA 3MWGA 1MABB 3QG1A 4P7FA 4WKPA 1G5FA 7ABPA 5FA5A 3A58B 5IAOA 2IV7A 3P2KA 1R15A 4BJ1A 4QYIA 3HLYA 1J7KA 1NMZA 2MSWA 2WMYA 3NPAA 3WWDA 4XPZA 2UVPA 3IDQA 4ER0A 2BI4A 1OFHA 5EY5B 1GQYA 1TIBA 4HN9A 2BR5A 4N5DA 4OJNA 4ZOLB 3RB8A 4BFSA 4DIMA 1WXQA 5DKFA 2HSJA 3LNCA 3PR3A 4BZXA 4AUNA 3AKCA 3BWEA 1D2GA 3LH5A 1OB2A 2ZYDA 1ZCFA 3IAS6 3QLEA 3A11A 4MVJE 1EWVA 1H6AA 1TD1A 1V2HE 5KNBD 5IXJA 3U4DA 3IAAA 1NBWB 2A1TR 4PW0A 4RTLA 1THTA 3TLBA 4JEUA 2ZB3A 1E1CA 4YCMA 2RIRA 3QYPA 2J9ZB 4W5WA 1C41A 2GN0A 4PS1A 1L5HA 2Q7OE 5CA0B 3FB4A 4M8NE 1W85B 1AQIA 1KJ8A 1G6HA 1X77A 4XIGS 2AOTB 3ZIAD 5AVTA 1WW3A 2CNWA 3GVPA 3P9NA 5JV5A 4WMLA 1E18A 1KKUA 4HPXB 1ODJA 3NAGA 4AD8A 1NX9A 5A7GA 4A2WA 5L3QB 5HWSA 3WK7A 2J09A 2AGVA 3KQUA 1W52X 4JDUA 5JZ9A 4O3FA 3ROXA 1MOQA 2X4DA 1RPNA 2BGGA 2HUPA 2GLTA 4OXYA 4WY5A 2FN9A 9GPBA 2MSLA 3RIXA 4NBVA 1V6CA 1X1TA 4MQUA 3WNCA 3K1JA 1KY4A 3FYHA 3DFUA 5IZCA 1M2JA 2QZJA 1KR2A 1SC9A 1B3RA 1T8PA 2K87A 1K8ZB 4P5PA 4Z4CA 3QWIA 1N2CE 3EFHA 3AEQA 1NW5A 3KR1A 3ES9A 1NN1A 5A9TA 1UWLA 4DXHA 5A4DA 5JCZA 2HU2A 2J9FB 4BKMA 1WSAA 4BFLA 4D81A 4HUTA 5CNIA 5DX1A 2P2GA 3CLRC 2DE0X 1OHHD 1TMOA 3E05A 3PQFA 5CJ2A 4YJKA 1R9NA 4Z7JA 1HMPA 1QK4A 2OE2A 1EDDA 1PBTA 3MQ2A 2PLAA 4PSAA 1WKCA 1ISMA 2CWDA 1ADCA 2X9QA 2YS6A 4ZYTA 1T0IA 4PTZA 2WNHA 2FR8C 2VQDA 5E7QA 2R6AA 5H1YA 5LP6C 1Y9EA 3NM4A 3OPYA 1I5EA 4B47A 1ULBA 1EWYA 3UJBA 3AINA 4V3BA 3HE3A 1DBVO 3BFXA 1XEWX 2FWRA 2LRHA 4JODA 4PQGA 4RIEA 4S0XA 1YZNA 1WBBA 1E20A 3PNLA 4MUGA 5GONF 2EKPA 1SZPA 1Z36A 5B3AA 3QPUA 1N0UA 2G6TA 3QUTA 3ZQJA 4CTJA 5CD9A 1FSPA 1NM5C 3AKYA 3DEFA 4G5XA 4N65A 3LV8A 4YECA 1BYUA 3WAJA 2EF0A 3U9TA 1XT6A 4RPJA 1RYHA 1E0DA 2BL4A 2OSBA 2P2CA 1RRPA 1VIMA 3LXUX 5K1ZA 1JG6A 1OZGA 4KN5A 3TYXA 4JVLA 3MS7A 5KDLA 3LBYA 4DYDA 1R0YA 4AS1A 1IMOA 5AM3A 5JZBA 3DAOA 1IC6A 3L0IB 4YQFA 1VMIA 2BGWA 5CCEA 3T1YB 3PICA 4ALJA 1PNOA 4QATA 1TUIA 3A2MA 1NZFA 3AM3A 4RVGA 3BE5A 2QLBA 5JZSA 3DKPA 4H1TA 2FMTA 1V7QA 4DJDC 2PUBA 4KWEA 3PPWA 5J1TB 4KGXA 2VTVA 3P5SA 1UEXC 4P80A 3H75A 5E8JA 4C4AA 1DC5A 2DX7A 2QVLA 3LK6A 2HHLA 1VCIA 4M3NA 4QEZA 2O8BA 4FFWA 1G8JA 2C2MA 5AVYA 4BZQA 4YP9A 5JSZA 3LP5A 2XUOA 3GN2A 4LDRA 1QCYA 1Y8AA 5IS2A 1GTG1 3EXIB 4NBRA 3S4YA 4WL0A 5FOXA 1XNQB 1TI7A 4LQLA 4Z1MA 1TEXA 4JR0A 3UF0A 2WM9B 3M6IA 1ZZGA 3LVBA 3PC7A 1THMA 3TW6A 5IULC 1XL1A 3HGMA 3IAUA 4U7TB 2V7PA 5F3DA 1VCMA 3T12A 5E6RB 2LDXA 4KQ6A 4A6EA 4RE5A 1TECE 1SU4A 3RREA 4D6YA 1H6CA 2Y9MB 4N49A 4RPCA 1GU7A 4TMKA 1LKZA 4LYYA 3FTEA 5ICGA 2HCJB 4L0QA 4WEQA 3JD2A 1NW8A 3CLVA 3BSWA 1WTAA 1TCUA 5E0OA 3HYLA 4HUQB 3UMSA 3M5CA 3PHHA 1VG8A 2VTEA 3DTVB 1WPGA 4WLFA 2XVMA 2DTDA 2HI0A 5M29A 1MG5A 5JDCC 2A58A 2PH5A 3QVGB 1PK8A 4PLZA 2V9ZA 2VP4A 4LRUA 3A1DA 4A0RA 5JMPA 1T6YA 2GF9A 3GJSA 3VKUA 1NRJB 5FTJA 2WYOA 4ZVTA 3LUCA 4LE0A 4GAEA 3SC4A 4LE2A 1M10A 3TGWA 4CV2A 4US1R 3OEEA 2WIBA 2YR0A 2ZTSA 3G8YA 4CLEA 3AGQA 1QFYA 4JLUA 3PE6A 1O03A 2PU5A 3HKBB 1AQ6A 1USVA 2WA1A 3GRZA 2P7IA 1Q92A 3L2OB 2VYCA 2YIJA 4L3VA 3WQQA 5IKMA 4EF4A 1P4AA 2P9HA 3V8VA 2QZSA 2QN6A 4RL6A 1V5IA 4XWYA 3FSEA 4A4DA 3NVDA 3PRKE 5GONB 2GWRA 1NAIA 4URHA 2BT4A 7YASA 4KKVA 2F1IA 4D8WA 5GZ1A 2PH3A 2ZRLA 4YMIA 4MHSA 1ZI8A 1Q21A 5FJJA 3H7AA 4B6RA 1FTQA 1RQXA 3PX7A 5KNDD 2WWHA 3BHNA 3L84A 1I32A 5BORA 2R7NA 1MW9X 1H2YA 1XEFA 3HU5A 3U7JA 1A4UA 2YV4A 3DAPA 3LVRE 4B7CA 2H16A 2AOUB 1X80A 3Q87B 2AMFA 1QE5A 2PMBA 2WG0A 3HZOA 1XYGA 2O5RA 4YAOA 3H9UA 3CNOA 5DN9A 1SG0A 4YLYA 1N5IA 1NJ5A 3DAYA 1PWZA 1ZW1A 1Y4ZA 3CB4A 3FF1A 3GFSA 4GE0A 3VC7A 3CZQA 3L9WA 1ZCZA 2JAOA 3CZCA 5AUNB 2J07A 3C6QA 1A98A 3FR7A 3L6OO 1JSXA 3SFVA 4TWRA 4MLPA 4RA6A 4Z9XA 4BBAA 1IBKB 1UQUA 4JBLA 4NOJA 3N7AA 1H66A 3OQMA 5D5HA 1I7DA 1YE5A 3FTFA 2XTAA 2PIAA 3HKDB 4BNZA 1KGSA 4CFYA 1JDVA 3RU9A 4NC9A 4DANA 4NZOA 1BE8A 5DCWA 3DEAA 5AHOA 3ZDXB 3PFWO 2Z6AA 4LNHA 1K2VN 4RHEA 3HU3A 4B33A 3KQPA 2ACWA 4IXWA 3QKSB 4GPIB 4BNUA 3TOZA 1BZYA 1GEEA 3NOOA 3GVXA 1U3VA 5HG0A 2I2XB 2OCIA 5CEEA 4I8DA 2F1OA 4YRQA 1AVTA 5KQPA 2C9OA 2HMYB 3MJVA 2Y6UA 4RCYA 4PZEA 4DYVA 2FG5A 2JGRA 1DVRA 1SVSA 3I9MA 3T5MA 3QJGA 4ICIA 4NPAA 5C5DA 2P9YA 2VUSA 2Q2QA 3NVAA 3MAGA 1E6UA 1AKRA 5IJXA 1OFVA 5CRIA 4QVIA 4DLUA 4NYIR 4GOLD 5DHQA 3CLSD 3PPVA 5BW4A 1R0RE 2ISSD 2XMZA 2ZR8A 5DLEA 4E5DA 2PUGA 1MUUA 1R9JA 4CIVA 3TDKA 1XKXA 3HDVA 4HGPA 3BYZA 3JQ9A 4DLRA 3TVTA 4D43A 1OX5A 3PDIA 1IHXA 2PZBA 3C1TA 3KKEA 3HBFA 1JNYA 4X54A 4X8HA 1VJDA 4ZI2A 1DTWA 3V8QA 2WLTA 9ABPA 2I8LA 1ADJA 4REQA 3HUFA 1CJUC 4RKQA 3ZWVA 1CDEA 1A97A 2QX8A 3WGVA 1TYBE 1YZQA 2VJBA 1VLVA 1GPLA 1XV5A 2F9LA 3ACBA 4WY2A 3TGLA 2P62A 2WYIA 2IA5A 1T9BA 3HLTA 2C7QA 2ZG6A 2QRQA 3EPKA 4JLVA 3SBDA 1RKQA 2YJ5A 2OOKA 4NOKA 4G23A 1RP1A 1RWPA 2WHXA 4PR3A 5I9NA 1YCFA 1LW7A 5SICE 4YV7A 5IM4F 2RHMA 2PQ6A 4BO5A 4Y1EA 5IK2A 3PYMA 2VN8A 2AV6A 4HWTA 2PT7A 2PWPA 2AW5A 3PC8A 5C8YF 5JRDS 4DS3A 2PLNA 3HHEA 3GNLA 3QWFA 2GKOA 1AGPA 1WZ2A 3FMVA 3HCAA 2I34A 3BWBA 1EE1A 4YJ3F 2ECPA 1WUKS 2OCKA 3DL0A 2Q9BA 4WOKA 3E3OA 1Y6RA 3HVHA 4KBGA 3KWLA 1Z26A 4QGSA 1DXHA 3GT4A 4Q7MB 5D5PA 4MHOA 3UWKA 1KYYA 5KTMA 5J4VA 4RA9A 4NCHA 4JOBA 3G2PA 3SVZA 4EA9A 1USUA 4HAVA 3VOTA 2CW5A 4CLRB 4CHTA 1E94E 4IIJB 2HMSA 3JWGA 3GV0A 3N6RA 3PC6A 4ARUA 1S2LA 3TW8B 1VRWA 3GEGA 3KOXA 3OEHA 3S1AA 4CWAA 3NGXA 1ZW6A 5JR3A 5KYXB 2LR0A 3LA8A 5KI6A 4LF7B 4EYKA 3RS4A 4B8ZA 2QTMA 4HQLA 2DPMA 3Q8XB 4MV7A 5KHAA 3IALA 4O4IF 4OX9B 2H85A 4AXXA 2O8EB 4P3PA 2C4TA 2I2AA 2HFKA 3NANA 4K2AA 3LDGA 2GEKA 3ZNOA 1D2MA 4PBSA 5FWAA 4MTLA 4YFYA 3F4LA 2WDPA 1MEJA 1N7GA 5EPUA 1I2ZA 1HEUA 3RFXA 3T7EA 4MR9B 3PJFA 1DL5A 2XTJA 5T4EA 3ROZA 4YYEA 1XHEA 3LSYA 2OC9A 3N0TA 2N0SA 4O5OA 5BSTA 4E21A 4MUMA 4XFJA 3VR5H 1X86B 4ZI7A 2Q8PA 4D5GA 1TPZA 4I36A 4L07A 1EDZA 5K8UA 1ILWA 3KTAA 3IVXA 4M49A 2O8DA 4HQOA 3MWDA 1GPYA 4QPPA 1VE7A 1ZG3A 3DOHA 2PZJA 3Q7RA 3FFWA 4F5YA 4HFNA 3MIZA 2R2GA 1UT8A 3WFIA 3VNSA 5EJIA 2VWGA 1SBHA 5H3HA 3SE7A 3UGQA 3UJNA 3ESRA 3T5AA 3CNLA 1L1RA 1TQ2A 4Q7JB 3CKKA 3E23A 4L4ZA 3TZHA 4TLCA 1XTJA 1QRDA 1PKXA 1BS2A 4S0ZA 4FHDA 4ENTA 1HDYA 1M0TA 3ELBA 3FOZA 4EFDA 1FFXB 2Z9BA 5KTKA 1BFKA 4G8BA 4RSGA 2Q3DA 4D4HA 2Q9UA 3TNDA 3L0PA 2DJIA 2BKEA 3KJQA 1CS0B 2FF7A 4L08A 1W76A 4NZYA 4HH3C 1Q14A 3C5WP 3HL0A 1EFVB 2QNRA 1BRMA 3R3WA 4EEXA 4L8VA 3NBKA 4K9PA 4KQJA 4TT3D 2IT1A 4HP8A 3ZG6A 2CMGA 4ZQBA 5DE3A 2PKQP 2NWQA 2YV5A 3AKDA 3PGXA 1NF8A 5KX5F 5IKOA 4NNOA 3STYA 3O8QA 3RT1A 2H1SA 5FULA 2AT1A 4OJMX 4YREA 3V42A 2WHRA 1NNI1 1QK3A 3S55A 3KU4A 1THGA 4KX5A 4A0HA 1RZ3A 2JZCA 2IIBA 3VNAA 1VQ1A 4NPHA 3P2EA 2G0TA 2ZWMA 2IP2A 4WESB 2BVNA 4EGJA 5SZHB 4KJZA 1KVTA 3DJFA 3LHIA 3D81A 1XTPA 3UK7A 2AN9A 4MP3A 4BMOB 3SJZA 1KI3A 3PJRA 2DQKA 3E18A 5DNDA 3F90A 5F4ZA 3U0VA 4DLBA 3QV1A 5HJEA 1U6KA 4BP3A 4DV3B 4DR4B 2YQZA 2NO1A 2BM0A 4TKMA 4DMCA 4P0PB 1P7PA 1JB9A 3QU5A 4EDFA 1U4OA 1NT4A 1GZSA 1ZK3A 1O7JA 3V8MA 4F2PA 4FX5A 2VQEB 3K6JA 5CFPA 2Q2VA 3RSZA 1XZBA 3JAWA 5BQFA 2DR0A 4G56A 3IAXA 1PHRA 1Z3IX 2WSLA 4BP1A 4YK7A 4F11A 1E2PA 3MLEA 2I66A 4QUEA 2M6LA 1EBUA 3IQEA 1MZVA 2FPGB 3IUBA 5IVHA 4UCXA 4WXEA 1D1QA 2VWHA 1KK3A 1SHLA 2P30A 2XVAA 5FWYB 2V7WA 5EINA 4CYMA 3GC6A 4UDNA 3A9TA 3HKCA 2BTOA 3R5JA 4WX2B 2VPTA 5ED0A 1T5TA 3W2EA 4N3NA 4JLOA 1GNRA 4ETMA 2JFBA 1PJTA 3IUJA 3O4IA 2GCOB 1W2WB 1SHTX 2QRGA 3LHSA 5CK4A 4EKGA 4LBVA 4Z0TA 4F6CA 4DR7B 2B6NA 2GWHA 1DC3A 1R0KA 4E3WA 3NBYC 4A2QA 4EKDA 3DZIA 4DVGA 3LF1A 5CXQA 3ANYB 3G1WA 4JSRA 4CKCB 1J8YF 3L0BA 1JL3A 4V1CA 1RQ7A 3A9SA 1EYZA 3KQTA 4DDTA 2IYQA 4LNUA 1A4XA 3GFBA 1E5XA 2X0NA 5C7IO 2F48A 3C6BA 3DUWA 2WJAA 4J0QA 4Q9AA 3TGPA 3GFFA 4MO9A 4RSRA 3DP7A 4E31A 4KWHA 2L42A 1L5FA 4F04A 1LI5A 2ZWVA 3WRYA 2QBYA 3HDJA 3KKLA 1HO3A 2ZJ6A 2PD6A 2Z58A 2HCBA 5IMBA 3RC2A 4BBJA 4HK4A 2UXCB 2F1KA 1QF7A 1W5BA 3ZDYB 4OMCA 3OTHA 3HWX1 1BCSA 1VRVA 3L7NA 1EMDA 3OTIA 4LOJA 4ANFA 3NBMA 4ILKA 3T99A 3VRHA 4QXOA 3GWZA 2AKEA 1YL5A 2R11A 4AY6A 1DDOA 1WUJS 2XE7A 3GEBA 1FFBA 2QM8A 2R8OA 3ZDCA 1NC3A 3MTIA 5LLSA 5C8ZA 1FMJA 4XGQA 4OQPA 1JAYA 3KZMA 2HF8A 3KYJB 3RO7A 2GOYA 4BLVA 3OIDA 5L7TA 1TJYA 1J49A 1DMRA 4NJMB 1LB1B 2BTQB 1IK6A 1GQQA 2OECA 3WLEA 1TVEA 4KN6A 4LECA 3DMNA 4N47A 2H92A 1QFZA 3E9RA 3JASA 1LNZA 3NWEA 3WKCA 3JYQA 5CX1A 3DMTA 5BW8A 1IJBA 1QVAA 2NO7A 2EQ5A 4F71A 3C14C 1NBEA 3A0UA 3CSUA 1I14A 3GRUA 1XD2B 3Q8MA 3QE4A 4ZOQI 2Q5HA 4U4AA 1UXGA 3E4CA 5DJ5A 3V7YA 3SJ7A 5I7UA 2MMCA 1XI2A 1B8PA 1SXJC 2DBVO 3BE8A 1PYDA 3I9OA 3LWNA 4DM3A 4IMRA 5EJEA 3OZVA 1FDVA 5TQ2A 3ZHCA 3PNPA 4ODIA 1Q16A 2QMOA 3T5CA 1S7GA 2TMDA 1IUKA 4HC4A 2NU6A 2G1AA 3IUQA 3PD1A 1KQGA 2XUZA 3HP1A 3ZU4A 3K0KA 1ML3A 1RLIA 2HA4A 4DR1B 4PSKA 4OI4A 3I12A 4NV1A 1T5HX 1J24A 2IGTA 5HEKA 4CQLB 1HOTA 2BM8A 4R54A 2RH9B 1FX1A 1L7NA 2G72A 3TNFA 2X8JA 4DG8A 5DM4A 4ZJUA 4JLSA 1KP9A 1QAOA 1PZNA 5DBHX 5EXTA 2P5SA 4AYXA 3K30A 2P2NA 1AQJA 2ZE7A 4BV3A 5FNVA 4MB0A 3GNSA 4BMXA 3C4JA 3AVQA 3ZVKA 1YD7A 3QLVA 3QPWA 2FSPA 2RSLA 3CRNA 1L9KA 3P0IA 4KXXA 4ONEA 2ZIVB 4C5CA 3TSAA 4JHLA 4X7BA 2A33A 3ZWXA 1EDBA 2XVYA 4PTLA 1WUIS 1NPTO 2G06A 3H1TA 5JQGB 1XZDA 3VTZA 4LDQA 3BRCA 3SHOA 3H5IA 5FADA 3P27A 5H68A 2ZUWA 3WV4A 1HYQA 2PVCA 1UADA 2D0PB 4H15A 4HGZA 5AHRA 1DRWA 4PBTA 3GXOA 3ZTWA 5CH3A 1AHNA 3RUFA 1DUSA 1OLSB 2Q0SA 2PFGA 3HMKA 3U60B 2PAAA 4X9XA 4AX4A 2O8FB 4JC0A 2OOSA 5C3MA 1KSFX 1GPWB 1WKVA 5GMOA 4LSMA 3B2EA 4O3MA 1NL3A 3NTRA 5TT0A 2P3QA 2TMKA 1NX6A 3PX2A 1SIOA 1N9KA 3EEYA 2V96A 2XOXA 4IUBS 3TPCA 1VHTA 2PZGA 4NBLA 3RCBA 1LI7A 2BFFB 3QW4B 3BHMA 5F35A 4JT2A 4JUIA 4TPKA 2H2GA 4NH0A 4QRIA 1P1HA 1Z8HA 4MAFA 3GO4A 3ZE8A 2F9MA 3EWIA 1D0VA 1TK9A 2GYWA 2HA6A 1JIQA 1ZY2A 1U0LA 3A36A 1SUFA 3NXKA 1T5OA 1BN6A 3F49S 2VYFA 4ILEA 3S1SA 3NUGA 6YASA 3BMQB 4I1SA 1FXWA 1OMOA 1PGPA 1MXHA 1CUHA 2PYZA 5KOJA 1ZUNB 1MOPA 1GKUB 1WB5A 3JR7A 4B4KA 3T1VA 1OIXA 2B94A 3PGLA 3Q41A 4B48A 2XYHA 3D6HA 4L0MA 2V9CA 2XGJA 5TPZA 3ZIDA 1JI0A 1JHZA 3EGOA 1VP9A 4NCIA 2W4QA 4IDNA 3ZU2A 2JAHA 1SUBA 1JSZA 3DDHA 3M6UA 2WHPA 1XRMA 1W88B 3IPRA 1Z7EA 3CKYA 1CT9A 3QFCA 3BRWD 1REQB 3RQSA 3BXZA 2H57A 1BXGA 1QHIA 1XK6A 4AWAA 2PXAA 1AGYA 5DGDA 1HSZA 3WC4A 4CVNA 1E3QA 4RETA 4Y2XA 3PQ6A 4MMYB 2XAUA 1PDWA 3ELYA 1QYIA 4ZZIA 3GD7A 3QLTA 4FNOA 2J4DA 3WL4A 5LOVA 3A14A 2IZ0A 5K9ZA 3FYUC 3H8JA 4W82A 4JI0B 3PC2A 1AKUA 3A1UA 4B4VA 3BWYA 2AUNA 1JAHA 2VPPA 4B81A 1Y3IA 4F96A 5JDIA 2G8NA 4TLDA 1W34A 4NOLA 3NIBA 1G2QA 4TTTS 1A5ZA 4PO1A 4RKRA 1PS8A 4MUBA 2BHTA 2ZWOA 1G19A 1YOVA 1Z34A 4LRWA 2FZWA 4UUAA 2Q6KA 2FN3A 2RI1A 4KAAA 1KJZA 1QHEA 1X1DA 1SUEA 3O8NA 4DMUB 3K9HA 1VLMA 1FTWA 4GRAA 1MGPA 2IHKA 2PKEA 3O8LA 4I55B 4PZDA 3HU2A 1G8MA 3G6KA 3ZDFA 4J07A 3GZNB 3ZN2A 1K2WA 5DASA 2C2BA 4WNIA 4E08A 4NFYA 2GN4A 2GYYA 2C5AA 3LQQA 5T8KA 3FIUA 4XDGA 3VPGA 3HGQA 5CCBA 3CURA 2NQ2C 4Q18A 3BC1A 3SIRA 2PKXA 1F7VA 2I6UA 3ZKWA 2B37A 2HLNA 3A9VA 3JX9A 3GP8A 1IBMB 4KQMA 3V34A 4PYMA 4F3YA 3FGOA 2HMUA 2ZJ8A 9ATCA 3COSA 3VHXA 2EIHA 1C4OA 3C3MA 5TQJA 2J48A 2ZSKA 3N2IA 2BSXA 2E4WA 3M1YA 1W5TA 1YHNA 3LC0A 4OU5A 5IUKC 4JI1B 2WMOB 4BY9E 5EZQA 1NUUA 2JJYA 1DINA 2AN4A 5I4CA 4YJGB 2FPPA 1RD4A 2Y4OA 721PA 4IWYA 4JKIA 4MLDA 2HO4A 3TSYA 4LXHA 3SICE 1SCAA 1SVUA 4HSGA 4LRQA 4CR7A 1DJQA 1SIWA 4EG0A 1P4HA 4IUYA 5ITSA 1LPMA 3JQFC 1YZVA 4RC9A 1Q57A 3S0JA 5EJ8A 2N1BA 2XB8A 2VS1A 3BMOB 4AMZA 1OC4A 5HRUA 4AXBA 2FWMX 4ITRC 3HB5X 4J4TA 3TNLA 3L6UA 2OHXA 4P3KA 1U6IA 4BIMA 4DRXB 1IBRA 1H69A 2BUAA 1Y9AA 1BD4A 1B43A 2BRUC 2B20A 4GBMA 4KGVA 3VR6H 3IAM1 1N5DA 3Q3VA 4IDOA 1R4NB 3LOQA 1M6HA 3E6AA 3GDFA 4OKIA 1SU7A 3GJYA 3SYMA 3OU2A 2Y92A 3VVMA 1U9IA 2BI8A 2JD1A 4Q3NA 1MDBA 2PRJA 4DN6A 2G1JA 2IPAB 2WIKA 2FWPA 1JHMA 1KEWA 3B8EA 1BU5A 2KM1A 2OBFA 3D3WA 4TLMB 1RM4A 4UC0A 4FGUA 5DNYB 4TMYA 2X86A 4RENA 3BRWA 5CM9C 4CUZA 3RH0A 3RT7A 1K4MA 3I28A 3K5HA 4JR2A 4Q3AA 2G3YA 4EBBA 4AJ9A 2ADFA 3PE3A 2WWWA 2QZPA 4UW9A 2OCDA 5CBPB 5TMPA 3URMA 4J75A 3KKZA 1SA0A 2JFHA 1HE4A 4RV4A 5AIAA 1XN4A 4TV8B 4BB9A 4OM8A 5C52B 1FU8A 4BMPB 3N2EA 2GEJA 4PLCA 2CL0X 3ZOKA 3NWPA 1SD5A 2PUTA 3L6EA 4HNRA 1SBYA 2COKA 3F8TA 1T6ZA 3FJ1A 2C3YA 4Q6BA 5JU6A 2CV2A 4JQYA 4OUKX 5IUJC 2FN7A 4FKMA 5TX7A 2FQWA 1H0RA 1PD1A 4PGAA 1V7PC 1OI3A 1KZ6A 1PQ4A 2Z0MA 3MG9A 4NBTA 1R5BA 1JSCA 4XE5A 3AF6A 2B8NA 1KSGA 3H9QA 1OQAA 4LOLA 5AW5A 2Q4EA 5KCZA 1L0BA 4RNDB 4FFNA 4LGVA 1JMYA 1Z2EA 2QAJA 3OT1B 4OQXA 5FNVF 4F9GA 2R65A 5L4LA 1T2EA 1FX0A 1HDGO 1JU4A 4FNGA 4JY7A 1OH5A 4WQMA 2DETA 2UXBB 1JJFA 2RGEA 4DQVA 3NHPA 4AJKA 2QV0A 3GBPA 3NOQA 1W85A 3VI3B 1U2DA 4GR9A 1EGHA 2DPHA 1D1SA 2F4NA 1DIOB 4AY2A 3HDTA 1YTLA 3QSYA 2Z6UA 3TQIA 1FDUA 3VSAA 2YYAA 1C3OA 1GAEO 2WTUA 1CZUA 3ZDDA 4GU5A 3IT3A 5JPIA 1U4SA 1WEKA 2FJPA 2NSYA 4NQZA 3TL2A 3UMYA 1Q0PA 3TAUA 1XF1A 5CVUA 4Y1GA 3FCOA 2B25A 2QMZA 3O73A 1SCUA 1J07A 1R0WA 4KZKA 4WNAB 2IUUA 3V1LA 5L7WA 4ETIA 4EYEA 4HDNB 4KB5A 5FKJA 4CQNA 1MORA 4HQ0A 4KDFA 2WKPA 2JGLA 3F74A 3GA5A 5K7SA 3AEUA 1DEXA 4PLWA 1SCBA 2O2CA 4L3OA 4Y6LA 1X6VA 2HTEA 4IMIB 1A2BA 1H93A 1C0IA 2C0PA 2I6QA 3BB4A 3I58A 4FEYA 3RSHA 3TWOA 5AM2A 1MC1A 1Z4OA 2X8BA 3KQWA 3SXPA 8ATCA 5AW6A 3OFNA 4IH4A 4O4JA 1EG2A 1U1GA 2BP7A 3OQVA 4L8FA 1N3IA 3TW0A 1GLVA 2WJVA 4BX2A 2PX0A 2A7QA 4W5RA 2DSNA 3QI7A 1WP4A 4DIEA 4YRGA 1NUSA 4HADA 5FA6A 5HRAA 1Y4SA 3RIHA 2W2TA 1VSQA 3L07A 1EZ4A 1L4KA 2IS2A 2J41A 1E1RA 1PL8A 4RZ2A 3D54D 1UBSB 4LY6A 3CIFA 3FMOB 4AF6A 2WSIA 3L6DA 5AK3A 3RRFA 3VSEA 3ISJA 5CDUA 4XCXA 4RK1A 1V9SA 2P67A 2PU7A 1EJ2A 2R8EA 4KI7A 3RANA 4WN3A 4X3OA 1JEQA 5D3QA 3JQBC 3GJXC 3LCRA 5JH7F 2FZ4A 4LA4A 2PX3A 3IX7A 2JAXA 4TVSA 2ACVA 3UGKA 3U56A 3BSFA 5K3OA 1U63A 3NKFA 3X43A 2ODTX 4MWGA 1GFIA 3LAWA 1KDPA 2C20A 2GD6A 3B1WA 3AR7A 2BEVA 2NUPB 4YJ2F 1Z82A 4RWEA 1NPYA 4YFVA 3W1EA 4PS0A 1QHSA 2AX3A 1NJGA 1W30A 3QVMA 3HG7A 4WVFA 1K8RA 1Q95A 3BRQA 3TDMA 2XQIA 3GFTA 3JD3A 2FOIA 1Z6ZA 2R48A 3WL3A 4XYLA 1TAUA 3EIQA 1XTVA 1GL6A 4TLEA 1HA3A 3NASA 3LL7A 2OHIA 4LE1A 1XC7A 5EKUA 4A8PA 1NHGA 1A8SA 3P4XA 5BV1A 3FZYA 3PXUA 1U7TA 2JFQA 1SVKA 2VJCA 4A2CA 3KXPA 4KL8S 1TKBA 1JIUA 5DXAA 3TLJA 3NDRA 3KBBA 4UUBA 3JAKA 4YHBA 4H7IA 4C89A 3GLIB 1K9SA 3FNIA 3A06A 1YRQA 1Z4KA 4TWIA 4HRVA 4YDHB 4P5DA 2IU6A 1XJQA 1Y1PA 4HMPA 4I1RA 2B8WA 3R7SA 3UKJA 4MGKR 3OKCA 1X9IA 3UBMA 3EXEA 1JHDA 1QP7A 3MJTA 4CMCA 5EP4A 4REOA 1LV8A 1TZMA 2KWIA 2CZCA 4OHMA 4OP3A 3EVTA 3UT0A 5KQGA 4XOIA 5FBZA 1AKWA 1DC6A 2W2LA 3FYSA 4JUCA 2IEIA 4GLFA 4J16C 1DAGA 3RYHB 2QRVB 4HT3B 4YCDA