4RIRA

Structural analysis of the unmutated ancestor of the hiv-1 envelope v2 region antibody ch58 isolated from an rv144 hiv-1 vaccine efficacy trial vaccinee and associated with decreased transmission risk
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
226
structure length
219
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLGGRYYYDSSGYYYFDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the unmutated ancestor of the HIV-1 envelope V2 region antibody CH58 isolated from an RV144 vaccine efficacy trial vaccinee.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CH58-UA Fab heavy chain
total genus 35
structure length 219
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirA01
3JV0A 5EIVA 2X4PB 3C60A 1FZJA 4YR6B 2R1YA 5ALCH 3IVKA 4RNRB 1JHTB 4KAQH 3U7AA 2H2PC 1J86A 3O11B 2IFFL 3U4EA 4PP1C 1R24B 1CDIA 1HINH 1SMAA 4JM4L 4LAQL 1P4BH 3NOIA 4QRSA 4KPHH 5L88L 1I9JL 4R7DA 3C6SB 4GQ9L 3N9GH 4UILH 3JTSA 4HIEA 3KPMA 4GKNA 5DJ2A 3V79C 4JREC 3WFCL 1HK6A 4ZFGL 4CRPA 1BZ9B 5BQ7B 2R29H 2ORBH 2H41A 2PO6A 4LLUA 5EOCJ 1EK3A 3K2UH 4NOBA 3WNKA 5CIPB 4OD1L 5CWSA 1EO8L 5GXBB 3ZYOA 3S96B 2EYRB 4MAYA 3V9FA 2ARJB 3BZEB 2P24A 4EOWL 3WDIA 1FL3A 4HW6A 5BZDB 3RI5K 1KG0B 3FO0L 1MI5D 4LSRH 1QR1B 5TE7H 4K23L 4MLSA 5I18H 4LHUA 5D7LE 1OAUL 4A6YH 1FIGL 4KY1L 4EI6A 1MPAH 3QI9A 1UA6L 3U9PL 3ZHLA 4LVHC 1CF8H 5I8OH 5L6YH 3MACH 1NCUA 4U6YB 1GIGH 4L4TB 3OGCA 4PJDA 3T3ME 3HCVA 1U6AH 3F8UB 2J8OA 1DVFB 4D3CL 2R4SL 5E8NA 5DS8A 4N68A 4O2FB 4B50A 1I8MB 1G7LB 1LE5B 5D2LE 2XYCA 4PJCE 3NCYP 5HHOB 4OI7A 4GXUN 3MUJA 5C0JB 4MJ2A 3SKUD 3U1SL 2W9LA 2YN5A 5BS0D 5IESH 3MRGA 3V6OA 2DDQH 3PWUA 4LVNC 4A6YB 12E8L 1N5AA 1RHHB 1CXKA 4NQVA 3DMMC 1R3LB 1CICC 3QCTL 1A6UL 3UP1A 3BDYL 1V3MA 3EYUL 5AZEL 1U93B 3LSOB 1EX0A 3SE8H 2ZOKB 1JF6A 2YPLB 4U1HA 3IDXH 5KS9E 1RPQA 4YDIL 4E41B 5LQBH 4CAGA 3Q6GL 1FYTA 5SV3A 4YGVB 1J9CT 4RBPK 2QKIA 3VGHA 3MA7A 1R5VA 4WW2A 4NO5B 2EDBA 4HIIA 5B8CB 2W65B 4H0GA 4P2YA 1MY7A 4U33A 4DVRL 3UTSA 1F97A 3QQ4B 5EBMA 3IFPB 2FR4A 2X70B 3QWOA 5DC4B 2FL5A 5E08H 4RAUB 1XF2B 1RZ7H 1FO0A 1T1ZA 5EB9A 2E5EA 2BHUA 2YKLL 2APXA 4GQPH 3OKNB 3NGBC 4M6NH 4QXWA 5KANG 1YQ2A 5JXAH 2YPLD 3FONB 4NNYA 2D03L 3KXFA 4L3EA 4HGMA 4YZFE 3RKDC 4DTGH 2FIRT 3E2HC 2RAMA 4X5XA 5EZOL 5E1AB 2HTKD 4IRZH 1T0MA 3WIHA 1JFQL 1MCQA 3K1KC 4X4YA 4Y1AB 1XR8A 5J7CC 1KJMA 3RDTB 2WINA 3S9DB 4OLEA 3GI8H 5JHLH 4JQVC 4PY7A 4L8DB 1PEZA 4QEGA 2NW3B 4DUVA 2AXHA 4N9GB 1WWWX 5DMJB 4I0PB 1KB5H 4MQSB 3VD5A 2R2EA 4NM8L 2EEBA 4M48H 2Z0BA 3MRHA 1NGPH 4M7ZB 1OWWA 3LVEA 1NAMB 4OF6A 1NCAL 1D5ZB 2HMID 5INCA 2CLVA 4JY5L 3HZYB 1IQWL 1YDPB 4MB5A 1DQLL 2GK2A 4FHBD 4ONGL 3ESUF 2NPLX 1WWAX 2BCKA 2XWBA 3TYGL 1CDYA 2I25N 1OB1A 3P77B 2HG5B 4JDZA 2I9LB 2ICWI 3CVHA 4P3DA 1NFIB 1DUZB 3WBDA 3WN5A 4MQTB 1VKXB 1XF5A 5JOFB 4R96A 3VFUA 4S1QL 1ZGLM 1HHGB 5IHZB 4X83A 4JFQA 3IAPA 4LSPL 4OZIA 1JNHA 1KTKE 4TSAH 1K5NB 1YPZE 3L1OL 3UXFA 1IGMH 3GRWL 1L7IH 2HTLD 4ZXBB 4NDMB 5FA3A 3UTQB 4LAJH 3D1MC 1YEEL 2VUYA 3MV8B 4R97B 1EBPA 2J7LA 2XRAL 4Y5XB 2P8MB 3DSNA 3FOMA 5K9KA 5K59F 4ZTPL 4U7SA 4K7PL 4NFCA 4WHDA 2VUOA 3DGGB 5TGBB 3MRCA 5EUOF 3RFZC 3QCVH 1A0QH 4HF5L 4RCAA 4OFVA 3MFFA 4LHUG 3C8KA 4OF7A 1TVBB 5D1XC 1QSFE 2EDWA 3AS2A 3D6GA 3KJ6H 3OKMA 3L5WA 3V5KB 4NBXB 4H88H 1NBZA 3TBVB 3HPJB 1ZK9A 2UZIH 5BW7C 3NN8B 4HPYH 5IQ9A 1CYGA 3FFCE 4JO4L 1FGNL 1NC4B 2UZXB 5TDPA 4DUWA 1ODAA 3V0AC 5I1LA 5JUEH 4NQCD 3VD7A 4CMMB 4YBLC 1OCWL 2MMXA 3FO9A 5H8DA 4YHKL 5KSBA 1AR2A 3RVXC 4OM1H 4H25B 4L3CB 4KC3B 3EKCA 3GKWL 2SEBB 3DTXB 1OGTA 4OGAC 1TETL 3HLAA 1IGCH 3ZHKA 3I3BA 1OSZB 4FA8A 2LTQB 4R90L 2C7UB 2RCSL 4NJ9L 5KSBF 3D3VD 3TYGH 2MPAH 1AO7A 3ZKQD 3RUGE 3HNSL 4F7CA 3DMMB 3EOBB 1UC6A 3UTPE 2WMPA 3SKOB 3MR9A 5GRVL 3MOAH 4Z9KB 3RGVA 2HFEA 1C7TA 4EDXB 2ADJB 5E2WH 3CXDL 3MV7B 4NQDB 4AK1A 4Z78A 4H1LH 1S5HB 2X1WL 4F7MA 1OLZA 2RFXA 2X4OA 4M03A 4P2OB 5IVZB 3WFDH 3S88L 3DVNB 4WU5B 2XWJA 2PUQT 3V52H 3QA3B 5IHLB 5IEKB 3VXMD 3D25A 4UV4H 1KIPA 2X42A 3RZCC 1ZHKB 1LEKA 4JRYB 2JK5B 3B3IA 1BGXH 2X4QB 3TA3B 4RIRB 1YEFH 4APQC 4U1IB 3QIWD 5D93C 5LKNA 3S35H 2B1AL 3LPFA 1FZKA 5DRZB 4J1UB 1UM4H 3ILPB 4G6FB 4LCCC 2ZSVA 4OCNC 2W92A 3VXRB 4Y8AA 3CFIC 3MLVH 5FYKL 1F4WH 4RGOH 3N85L 3ES6B 4KGLA 4C56A 3TZVC 3SDXB 1J8HB 4P2QE 3DI3B 3NFSH 1MJ7L 1N59A 2JIXA 4MCYA 3VRIA 4IDJH 4JFOB 4D9LL 2DQTL 5C07E 4RMSA 3PWLB 3ZTJG 4LSTH 4FNLH 5E4EC 4YFEA 4R0LC 2QADC 4WHTA 2NY2C 1A7PL 4J3XA 1FBIL 2DOCA 3CK0L 3HHRB 3KLAA 4YNYA 5C0FA 5I76A 3P30H 5EORH 3L7EA 4X99B 3EGSB 2VN7A 1PLGL 1TNNA 3FMGL 5EOCH 3VXTB 2Y7QA 1T22B 3ALWA 4U6TA 2FHFA 3ZE1E 4HK3J 3VXMB 4BYHA 5DHVA 2OJZL 5ALBL 3QG7L 3K1DA 1UH4A 3R1GL 3IF1B 1U41A 4JZJB 4JGMA 4NKMA 4ZYKA 3DETD 2YD7A 5D8JL 1GRWA 2H8PB 1MAML 5ALCL 2K7PA 5IF0A 2EDNA 3LB6D 2OLDA 1UM6H 2EIZA 4JRYE 3VWKD 5HYJD 3NZHL 4KPHL 5L88H 5KOMC 5CJXA 4LCCA 3RIFF 4NUJA 5EU6A 3LN4A 5A2KH 3P4MA 1PYWA 3O0RH 1N4XH 3SDCD 4HS8L 1F8TH 3G6JB 4Y4HC 1DLHA 5CEZD 3NFNB 4BZ1H 5HYQA 4J4PD 4CDHA 1OGAB 4PY8J 4UOW0 3GSQA 3AXLA 4NQCB 2VXUL 1DE4B 2FLBT 1EA9C 5I16A 5HVWA 3H3KA 4D3CH 1NUFA 5C0BB 5J11C 5SWSA 2VAAA 3MLWH 3PXHA 3MOQA 3B43A 1PY4A 2G75B 4HLJA 1H3UA 3LH2L 4Z7WB 4QRRD 2DJUA 3CZFB 4KRLB 1RK1B 5IJVB 1PVHA 5BVPL 3S4SG 2J88L 3A67H 4K23H 5I18L 5F9AC 4GMSH 4IOSD 3NBNA 1TCRB 5DA4A 3D39A 3KHOA 1RK0A 2Q87A 2BY3A 3WIIL 4KTDH 4YGVA 4Y4HA 3PF2A 3BEVA 3SDDD 4ZDHB 1PZ5B 2GTZB 3UTTB 4QY8A 5ID0B 1RZJL 2HJLA 1WBZA 1LILA 3U30B 1Y18A 1TNMA 4GS7B 3AGVA 2VLME 1YEJL 5DUBA 4ODVH 1KIRB 1HKLH 5DD1H 4NZJA 3ROLB 2H2PD 1KN4H 5C0CD 5C0CB 2PYEB 2DM3A 4NWUH 1H3PH 5SX4I 5L6YL 2X05A 5DTFB 2NX5E 2JLLA 4FFVD 2AJYH 1JPFA 5F71A 1RZFH 5IB2A 5F1NA 3EOAA 2AERT 4N90E 5IMMA 1IMHC 2HWZL 2IADA 2KUTA 5EC2B 5TE6L 1Z0NA 2VRAA 3O0RL 1JNNL 5BS0E 2MTPA 1QRND 4YHIA 4H20L 4RFNC 1TJGH 3O3DB 5F96L 2OMNA 4LLVA 3DUSB 1MQ8A 5CSGA 5EBWB 1HSAA 5F70A 4AM0A 4N9GA 3MOBL 3H7LA 4U0QB 3TLRA 2GEEA 3OBAA 1EXUB 3T4YB 2DBLL 2VLLA 3DX6B 3MYZA 3QO0B 3MRDB 2G9HB 4M6MH 5HHPB 3P9MB 2JB6B 2GITB 1VENA 4JFED 1FL6A 4KWUA 5J1AB 2Z35A 5D7LD 2RBLA 1KIQB 4TUKL 4PG2A 1OGAD 3FQRB 4R26H 1RFDH 3SDDA 2FWOA 32C2B 1L0YA 1I75A 3GSNL 3MRPB 3VG9B 5EBLA 1BBJA 4YHLL 1DBJH 1FZOA 4FTVD 4PTTA 5CIPH 1GPOH 1KBGL 2FD6H 2PW2A 4JG1H 3LY6A 3FRPA 3QEHA 2YD8A 1GGCL 2JCCF 4DGYL 3VGAC 5TE6H 1BFOB 3G9VA 4BUHA 5LWYL 4QRRA 2YRPA 3FL7A 4XMPL 4JY6A 3I6KA 4Q6IA 4GOSA 1T4KA 3C5SB 2FX9L 2NY7H 3HCVB 3HG1E 4ZXBA 4TPRL 2R1WA 1JYVA 1HKLL 4FMFA 1Q72L 1HSBA 4FZEL 1K3ZA 5EUKB 5MP6L 4XPHH 3T3PE 4FP8L 5FHBH 4LLMA 2P45B 2IQAA 5CP7A 4ZMAT 1M05B 4LCYB 1FRGH 1YMHB 1FV1B 4DKFL 5IBUG 3O6FA 2OR9L 1ETZB 2CH8A 3QR2A 1KYOK 3ZKNC 3QIBA 3HG1A 2EXYD 4ZS6D 5HI5C 3WXVL 35C8L 3DRTB 4GRWB 4P9HC 3PHQB 3IDMB 5IQ7L 4M3KB 3B9EA 1AO7E 1UB6B 3GSUB 4JY5H 1GZPA 3AREA 3STZA 5C70A 4YBQD 2W07A 3O2WL 1NMAH 4ELMB 5HHOD 1X7QB 4XP4L 2CKNA 2QADD 4FQJH 4JPVH 4GRWF 3WIFA 4W4NA 1U8HB 4RAHA 4KK8C 1YJDL 2EECA 4QHMB 5GGSY 5T3ZL 3OAZH 4HBCL 4HBQA 5KS9B 2D7QA 3QPXH 3RX8A 1Q9LB 4KKLC 1G9MH 4DEPB 4NM4L 4AZ8A 3ARGA 4KROB 2V5TA 3IT8D 1XF3A 3S96A 5D1QB 2XA8L 4I3GA 4IOFD 3MGTB 2ITCB 4KKBC 1IAMA 4LSSH 4HJJH 5DFVC 4WO4D 1UWXK 4R90H 3JV5A 5J13C 1UZ6E 2OSLA 5HGBB 2W0PA 1KJ2A 1S9WA 5FOBA 1BX2B 1XGPA 2UYLA 2BSSA 1CDUA 1FC1A 1DP0A 3KWWB 2APVA 3ISWA 4JDVA 3EYSL 1A3QA 4OZFA 3JVGC 3SDAA 3STLA 4OAWA 4G42A 1KJVA 4MCZB 1E6JH 4Z7VA 3NA4A 4QXUH 4K8RD 4X6EA 4YHKH 1WJ3A 1TETH 3MZGB 3UDWA 4Z7QF 3UPRA 1RZKC 4I3SL 3S34H 5DK3A 1QPPA 1U3ZA 4JPIB 1I1RA 3OXRA 4M43L 5J06A 3ARFA 3LN5B 4LCUA 2VQTA 1Y6NR 3MUY1 5HVGB 5ANMB 4ZS7H 3W5MA 2NW2B 2HT2C 1EZVY 1R3LA 3QB7C 4L8SB 3AMKA 1A1NB 1B4JH 3T65B 3H3PL 1AH1A 2EYSA 2Y6SD 1U92B 1KLUA 1R5IB 3S6CA 1UGNA 2VL5A 1F45A 5CJXC 4PGJA 3LS5L 3S7GA 1DANU 3HA0A 2WIIB 5DRXB 1SJHB 3QEGL 2PO6D 4ZOBA 2HFFB 4AY0A 1IAKA 1BGXL 4JFOA 4L3EE 4P5KA 1CGXA 3ZDYF 1ZA6A 4YC2C 1NGXA 3CUPB 3HNVH 3BN9C 3VW3L 3KPSA 4LP5A 5F1IA 2LU7A 5E5MA 2X70A 3QWOB 4TVPE 3KNBA 1VGEH 5B3NA 1MCPH 1Z0MA 4OB5L 3X11A 2OS7A 1FO0B 3RPKA 4K7FB 5J6HB 2R0WH 1W0VA 3GJFB 5D9SB 3D39E 5D4QA 5MEOB 1R3IH 1XR9B 5K9KB 3CDCA 3H42H 4DFIA 4RSVA 4P2OC 3ZE2F 2VYRE 5E94B 4PJEE 5T1LA 4ODBD 4PJGB 3S5LA 1JYNA 1CGVA 2VDKH 4U7KA 1QSED 4OKDA 1MRCL 4R4BB 4XTRD 2GTWA 5AEAA 1MWAL 4MXQC 3VWJA 3ZE0F 2ICEB 3IFNL 4U6VL 3MMEA 3JV6B 3OQ3B 3V5KA 4Y1AA 1T83C 1GGTA 1A6WL 4JN1H 1FFPB 2WWMC 3RGVC 4HGWB 4R8WH 5EIIA 2PF6A 1BM3L 3MRBA 1AR1C 1NFDB 2ZZUT 3MLXH 1D6EA 4HIEB 3ABZA 4JHAH 5HGHA 3I2CH 3LPGA 5ACZA 1Z5LB 1U8KA 1XGUA 1I3VA 5IFHL 4H25A 1WFNA 5FO9B 2FEDC 4X80L 1RZ8B 3UJJL 3AXLB 3SN6N 5HHXH 5DUML 4XGZB 2C7UA 1IC1A 1UG9A 1NDMA 1DEDA 2I24N 5DVOA 2P24B 4RMVA 4HKZA 3FB7B 5JXEA 3C08L 4XCFH 3DMMA 4UQ2B 4JQXC 1IE5A 3CXHJ 1TMCB 4HWBH 3EO1A 1EMTH 2UUDK 4IOIA 3QH3A 5ICZB 5AZ2L 4PR5A 5CGYC 4WI5A 1WCQA 4X5WB 1UM6L 3D9AH 4JFXB 3X13A 4P57B 3QISA 3QFJD 2BY1A 4OFKA 4CVWA 1A7NH 5BV7B 3K8LA 1F6AA 3DIFA 1RZJC 5IG7B 1CR9H 1JWMB 1LEKB 1ZHKA 4BJLA 3MRNA 4APQD 4LCWD 4HXBH 1AXIB 5IBUB 3DXAB 4QRPB 4HH8A 1CLZH 1QLFB 1MFNA 3QO1B 4WGVB 3TA3D 3T1WA 1I7ZA 2UWEE 4F7PB 3NIFF 2VXQL 4PIRF 2OJEB 5H37G 2VDLL 2WSKA 2FJGB 3WFEH 1MQKL 4Y5XC 4E9LA 2NCMA 3MQIA 1MRDH 1F90H 1I8IB 3BWUC 2B1HL 2J8UF 3C60B 2UVFA 2WBJD 2AJ3A 3HC4L 1NAKH 1JHLH 1IGFL 5I2IB 1U2CA 5F1NB 2CJUL 1NDGB 1ADQH 3GO1H 4ZFGH 2DLHA 3WXWL 3NPSC 3FN0H 4A2LA 4KFZC 4IBLT 3FQTA 4R3SA 3V5HA 1AGDA 2UWEB 4D9QE 3OB8A 1ZSDA 2NXYC 3ZTJH 4YAQA 1U58A 3NPSB 4UQ3A 6FABH 1QKZH 1CBVL 4ENED 3DXAE 4M6OH 5EBMB 3O3DA 2LAGB 4KK5D 4XNXL 5F44A 1IGTB 4J3WA 1T20A 3BH9A 1KB5B 4OCYL 4O4YL 5C6TL 3FT2B 1GOGA 3TT1L 3GMPB 1MPAL 4R97C 5FB8A 2C1OB 3N50A 3QFDA 1CXIA 2EZ0D 1JGVH 5IOPA 1GIGL 1K9TA 2XI9A 2E9IA 1KEGL 3S4SB 5GZOC 2FBJH 3O2DH 2XZQH 3ZL4H 1A9BB 1MRDL 3GBNH 3IDIA 3IFOB 2R1XB 1GC1L 5CILH 3BPNB 1R3HA 2UY6A 3VH8A 1LEIA 2ZPKL 2Y9RT 5I8KH 2IPUK 1BEYH 3DVNA 3MXWL 1CFVH 1FN4B 3I3DA 4O5LH 2OI9C 4U6XA 3RDTA 4M93B 5T1MA 4UU9B 2FH8A 3WNLA 12E8H 1TTUA 5BOZG 4PRPB 1YEGH 1QBLH 3AB0B 2VLJE 4M4RA 4MDJA 3TCLB 1ZHNB 4U05A 4KKAD 1R0AH 3OJDB 4EZMA 4H1LG 4JFPB 4X7DC 1OTSC 3BT2L 5IW6B 4JO3L 4O2CB 5CEXB 1XGRA 1ZS8A 3ZT5A 3GHEL 3CU1A 3KJ4C 1MIML 5GHWL 1IEBA 4X6CF 5F9JB 3RY6C 4I4WB 3ULSB 3I02B 1DQDL 3V5DA 4QTHB 3O4LD 4ZFFB 3C5ZA 1FIGH 4KY1H 5I1IL 2BOCA 3OHXB 1I7TA 3R8BB 1VKXA 1AY1L 2APWA 1LVEA 2XQBH 2WUCH 3FN0L 4HKXA 3MOBH 4PGZA 1QYGH 3KAAA 4LDLB 4YHOH 5JDJA 1BD2A 3G5ZA 2NY0B 3F12B 2PXYD 2X2YA 4PGCA 1BIIA 3D39B 3IKCA 4Y4KD 1WIUA 4RISL 5IB5A 2YUXA 2VH5L 4Y8DC 1JK8A 1JGDA 4MX7B 4CJ1A 5I73C 1SVZA 3FQWB 3V6OC 5JQHC 1R0AL 3B9VA 2Z8RA 5CLWA 5CMAB 3EYUH 5LBSH 4AENB 5F6HI 5GGSB 2NY3D 5FHBL 4L3EB 1YY9D 5ITBL 3N0PB 1TJHH 4X5XB 1FHGA 4N0CC 4YXLL 3MODH 2XZQL 3ZL4L 3OKKA 4JZNA 2JB5H 3KPSE 1LE9A 3OPZH 1WIPA 3W2DL 3MNVB 1OW0A 3HRZA 3JUYA 1EEYB 4NM8H 1XIWD 5I1CH 1A3RH 1UKTA 4WW2C 4FQQA 4U1NA 1QACA 4YDVA 1NGYB 3L7FA 5T5NF 4UUJA 5D72H 3UYRL 5IMLA 4LOUC 4JDVB 4NZDA 5DHXB 1CDBA 3MLRH 5ANME 2HVJB 3MRHB 3SDAB 3RVWC 5I0ZA 1TPXC 1UZ6F 1MAJA 4LHUD 3U36B 1A1OB 4MHHI 3GHEH 1YEKH 2HFTA 3H9HA 4QHKI 4Z76A 3BKJL 5C0BA 2DYPD 4G5ZH 5SWSD 1KT2B 4MA8L 4K7PH 5DJZA 3U6RB 2BNRD 3WS6A 4DKDC 1RI8A 3CFCL 5LBSL 1QFWH 1T5WB 3DX8A 4PJDF 2XKNB 1G1YA 2D31A 4PG9A 4WWKA 3GK8H 1JJUA 3DETC 5D1XB 4KZDL 1JGEB 1S5HA 4JPVL 4G6ML 2VITB 5IGXH 2ZJSL 4EBQL 2UZIL 4X98B 3P11H 3DXAD 4NN6C 3ILQD 3QSKB 1N7ML 2C1PB 3ARDA 1PG7L 2AJVH 5HPMA 5LAXB 4WUUB 4LP4A 3ZT6A 1J0YA 1ERNA 2F15A 4LCWE 4ZO8A 1U8MB 2D9CA 2ZCKL 1WITA 3RWGB 2MJWA 2ZUSA 3CFEB 4N5ED 3QUXC 3PP3K 3MLZL 3FTGB 4X7EC 5JLZB 3OKOB 2V7NB 3CCHB 3GIVB 1SYVB 3VXRA 4NO3A 3TBTA 2ZUXA 3C5ZC 5IBTH 4MJ6B 1FYHB 4MZ2A 4BH7A 3O41B 1OCWH 3QEQB 1ZOXA 5F1SA 5INDB 1OM3H 4C59B 2NY1C 4H5SB 2D9QB 3LEXB 5FGBA 3KPRE 2IQ9L 1EDQA 1UWXH 1AGCA 4ZD3L 1QFOA 3JV6A 4AQOA 3QDJA 5ID1A 1CXLA 3GSUA 4JFZH 4X6FB 3G6DH 1E4JA 3EO0B 5CBEA 1VSCA 5EIIB 4X80H 1BVZA 4H1LA 4GRWH 2WAHA 2JF1A 1WT5A 2NTSP 5T1KA 3C6LD 4OIAA 4ERSL 1DBKH 2J8UE 2XFXB 3BZEA 3D0VA 4FRWA 1AGFB 3QYCA 1MFBL 4R7NB 3FB5B 2G9HA 3MLXL 2XWTB 4KRPD 3CX2A 3QEGH 3W11D 2MPAL 4KGJA 4AH2A 4IRJB 3MLVL 1QSEB 5F7EL 5FYKH 8FABB 4WTXA 4NRZA 1BVKA 1C08A 4XWOC 5JW3H 1YEHL 2JCCA 1CFBA 3D3VB 4PLJD 4U6VH 1I9IL 1OAXL 1RURL 5L2KD 4K3JH 1U9KA 4G9FE 2HAZA 4C57C 1J0HA 4NP4H 4JN1L 2GW5A 5DS8B 1UA6H 3U9PH 1FFOA 3G6JF 1KPRB 4PR5B 5F21B 4KK5C 1MUJB 1FYTE 4XBPB 1NC4D 1E28B 4L8CA 3ILQC 1MF2L 5AZ2H 3C87A 4G6JL 1XF4B 1YEFL 5A16B 2YWZA 5I1HH 5HHXL 4L3AA 1V7NL 6CGTA 1YEIL 1P69B 5ESAB 4BZ2H 4LLMB 4UIKL 3OAUL 2CO7B 4EDWH 5JDSA 4F7PA 5EOQL 2GYSA 2HRPH 1DUZA 1CLZL 2NNAB 3IFLH 2IAMD 4Y4KC 4PLOB 1CD1A 4S11A 3TO4D 2QKIB 3O8XA 2NYYD 5BO1L 2FJFB 4ODSH 3UTSE 3WHE1 1T0NA 3C6LA 3WSQL 1WEJL 4AYFA 2NX5B 3BPOB 4M7ZC 4P4KA 4YPJA 1X4ZA 3SE3A 4GUPB 4KRPB 3D9AL 3E2HB 4NP4L 1QLRB 4NCC1 5MHSD 1IAKB 1X7QA 4AT6B 4Y5YB 3RL1A 2FX8H 2PXYA 3NA9H 3O6KH 4ZUSB 1Z2KA 5KVEL 1KN2L 1RV6X 3INUH 4MDIA 3ARGC 2FYYA 3OKDB 1AQDA 1NPUA 3IS0X 4N90D 1HOCA 1CVRA 3QUYA 2YKLH 4D0BA 3MBED 2W0KA 4Q9QH 2F5AL 3TIEB 1JYWA 2UY7A 3PNWB 2OTWB 3VDCA 3N1GC 1AI1L 1W0WB 1VGKB 3QG7H 4KI1A 1W8NA 3FN3A 4RNRA 1JHLL 7FABH 3VI3E 3HI1B 4K7PX 3IJHB 5DHVH 5J4MA 3DO7A 2F54B 1CN4A 4IRSD 3VFOA 2H3NA 1LO5B 2V7HB 1NGWB 5JW4R 4L4VE 4MVBD 5CZKA 2GT9A 4WFFD 5CHNB 5KW9H 1CG9B 1RUQH 3D69A 1MCBA 4NUGH 3TWCH 3VMNA 4OAWB 1UB5B 1CE1H 4PJFE 1MFAH 2J1KA 4ZUUB 4AM0B 3EHBC 2L4OA 1CL7L 2YD1A 4W81A 1BJ1H 3ORJA 2QQLL 3QXDA 3U9UB 1HH6A 2GSGB 1A7BA 1TQBC 1YNKH 1EXUA 3T4YA 2YPVL 2XWBB 3B4NA 2Z91A 4UB0L 3BQUB 1BD2E 5EOQH 3TZVD 2R69H 4FQ1H 4W6YB 4OCXH 4XAWH 2FGWH 4ZXBC 3IDJB 1IM3B 1DDHB 3G5YA 4PB0L 3SQOL 4R96B 4EDXA 3EYOB 1O7SA 1CLOH 3NCEB 3QI9B 2M2DA 1A1MB 2YXFA 2MHAA 1A8JH 1JNHB 5IFJA 4KUCD 5C6WH 4WU5A 1MIMH 2VL5B 3V4VH 2VB5A 3REWB 4L8BA 2Q8AL 1SJHA 5C08B 2YRZA 2ZUVA 3A6BL 1RU9H 2XXMB 2IFGA 2ADFH 4JHWL 5FA3B 4HHAA 2GK0B 4HKXB 4GO6B 1C16B 4OCYH 1T7ZA 3QIUA 3VXME 4ODWA 4XHQA 2E7HA 2YOCA 2P8MA 3FOMB 5DEGA 4YHML 3NCFB 1MFEL 5E5MB 1H0DB 5ESVB 2XY1A 4F9PA 3LMJL 2BXYA 1BPVA 2ZSVB 3DGGA 5TGBA 4HXAL 4P5MB 1QLFA 1I1AB 5JOEA 5CILL 5GS0D 3ULVC 4ZG1A 5E2UL 1U3HB 3UZVB 1G0XA 1I4FA 1PQZA 1JPGA 2APFA 1KCUL 5DQJB 3U0PB 4XVTL 5FDYA 4WWKD 1XGTA 4HK0A 3OZ9L 4P2QB 2PR4H 2R0ZH 3GSNH 4F8TA 3SDXE 4OF0A 5DD0L 5KAQF 1L7IL 3FKUS 3ARFC 1S5IL 1U6AL 1N8ZA 5ERWA 3QG6B 2WBJA 3VXRE 3UDWC 1I1YB 2VDPH 3MJ9A 4M4PA 2R23A 3VXSE 3CVIH 4RAUA 3WIHL 3GIZL 1OP5K 1KCKA 4FQLL 4DJMA 4JLRB 1S7UB 3QPQD 4L9LC 1ZSDB 2KZWA 1RFDL 2YSSA 2X1QA 2DKUA 4JPWL 3RL2A 4UTAH 4PP2A 1RZ8A 1QP1A 5I71C 4Y88A 3I6GA 1T1WB 2JELL 5I1GL 5E1AA 4XGZA 3MJ6A 2NY0D 5D1QA 1DQJB 3UMTA 4BH8A 4N8VA 4ONFH 3WDHA 3C2AH 2C1OA 4HKZB 2I60L 5DFVD 1LK2B 2V17H 1VEOA 4Y0GA 4YXLH 2AEPH 2OR9H 4MQXD 5IW3A 4IRSC 2CDFA 2I07B 4M61B 1U8PA 4FQXC 5JIKA 3MV7E 4NQDE 5B38G 4QHUA 4Y5VA 2FX9H 2NY7L 3DUUB 5JUEL 1QFWL 4BM7A 1GGUA 1B0WA 3DYPA 4MJ4A 4X9GA 4YFLF 4RIRA 5F97E 2P46B 4EIGB 3CLEH 3GMMB 3CX5K 4ZO6A 4UMGA 4ODXA 3ZMRA 5EFIB 1NAMA 3C5SA 3NCJL 1EEQA 1A64A 4QXGL 3QIWA 4XMPH 5BOPA 3MODL 5DK2B 4IM8A 4NYLB 4ETQB 2IANA 5DFTA 5F1OB 4YEFA 4JPIA 4PJFF 5F8RC 2AABL 1DQQB 1OTSD 2PYFA 3HRPA 1KF9B 5I17B 2VL4A 4MAYD 4O2CA 3FFCB 3QIBC 1RULH 3IDYB 4LGRB 4RQQB 4U3CA 4L8SA 3SEPA 4OD3H 4U6HA 4J6RL 3HR5B 3VFUB 5J8OA 2NR6D 1IEBB 3ULUL 5LCVH 4JFQB 1SJEB 2X4RB 3P4OA 4G6MH 4TTDC 1EFXD 3ULSA 3VXQB 4ELKA 3PHQA 1QSFB 5EZLA 3NFSL 7CGTA 3SOBH 1I7TB 1T1XA 3HMWL 3ARSA 2NYYC 1PFCA 1TZHA 4QF1B 4QGYA 4BQ6A 2MCPL 2VLRB 4XMLH 2ITDA 3LKRB 3WLWD 3BKJH 2CIIB 3BPCB 5F7NC 4YEEA 4XBEL 2AXGA 1JRHL 1Y18B 2Y7QB 2YD2A 4NO2A 3RWIB 3SDCB 3PGFH 3MV8E 1CFNB 4WVRA 1MJJB 5IP4A 3X11B 1NMCC 3CFKA 1X6LA 1FDLH 2AJUH 4Y19E 4JFDB 1OAKH 1KJ3L 3RKPA 4KXZH 4EBQH 3QFDB 4PJHB 5I30H 2OSLB 5IB4B 2IGFH 1BX2A 3KYMB 1XGPB 5D96C 3BZDA 5I1AB 5SV4A 1F3RB 1NGQH 1RUAL 3GHBL 4BK5A 1DN0A 2LE9A 3ETBF 4NBYB 1H5BA 4Z0BL 1XCTB 3HMXA 1NCWL 1NANH 1DLHB 3S35X 5EZIH 4BQ8A 2G2RB 1N3NB 3V0WL 1CCZA 2NR6C 1NFDA 2F8XC 3DARA 1VADA 1ITBB 4GAGL 1ZWIA 3VWKC 1G7IA 5T5FH 4LCUB 4EVNA 2DS4A 2GI7A 2VSCA 5FYKE 3R1GH 3RVWD 4KJYA 1XF4A 3QDAA 3C9NB 2JB6A 4PJ5A 1PGRB 3TT3H 1KUMA 3MO1A 3LS5H 3RWCB 2GSIA 1FG2B 2HLFD 1MHPL 2A6DA 5E95B 5IV2B 1URLA 1SY6A 3OKEA 1UEMA 3AS3A 1W72A 3GBMH 1BQHB 4Y1AE 1S9YB 3MV11 4OLYH 4YX2L 1YN6A 2B39A 5IVZA 5ITFB 1TJIH 1U8QB 2HLFC 5D2NB 5D1XA 1HQ4B 4FFZH 4HUNB 4X5WA 1RZIA 2VZ3A 1N6UA 5E8EA 5DLMH 1P1ZA 1NGXB 2H9GA 5DGRA 2DMBA 1KN2H 1WISA 4F37F 5DUBB 3PGDA 3CSYA 4TUJB 4LEOB 2CD0A 5BJTA 3VW3H 2PYEA 4YZFF 5C0DA 1BFSA 2BVYA 5C09D 4GKOA 3IDGB 1BF2A 4NQUA 1AI1H 3PIQB 2G60H 3VXUB 4C56B 5E94A 1S78C 1YEIH 2Y07L 5EO9A 5D7IE 4R4FH 5HGAB 1MOEA 1LGVA 3GMQB 5E70A 4XNZC 4JO2L 5SWZA 2LQRA 3GDBA 4IJ3C 3K8MA 4MJ6A 9CGTA 5EC2A 3A6OA 4XPFL 4Q9QL 1OQOA 4E41E 4P46B 4LARL 1AKJA 2YPLE 3JXAA 2HFGL 3I50L 3MV9D 2J3SA 3KLAB 5C0FB 4F7TA 2BNQA 2Y1VA 4ELMA 3DX7B 1L9NA 2ZWLT 1P4BL 3DVGA 3MCLH 3TVMC 2A6IB 4PJAE 4L1DA 5I8EA 5K93A 1CG9A 2EXWC 1MCPL 1BJ1J 3KPQB 2HJFA 2VZVA 1BM3H 1T1YA 4FG6C 2YXMA 3K8KA 4OLUL 2C3XA 2OQJA 3GRWA 1IBGL 4NWTL 2OM5A 3I2CL 1BWWA 5E8OB 1OP5H 2KDGA 3BH9B 4AIZB 2RQ8A 4ZSOA 2EH8H 3PV6A 3VXNA 5T1KB 3SQOH 2Q86A 3C6LC 1NJ9A 4MNGB 4GW1B 3GMPA 4L4TE 2YRLA 3IU3B 2M1KA 3OF6D 4WNQA 4MQ7A 3MRPA 4N0YL 1A14L 5FCUH 5E2JA 4AH2B 3DX8B 3IFNH 4HG4K 2B1HH 2DD8H 2EIZB 2PW2B 1OF2A 2BZDA 5CEYA 3L3OA 4DAGL 1A6UH 4K2UL 2ICCA 1FJ1A 1F00I 1A6WH 4OV6F 4OZGF 2YPKB 5E2TL 3JBG7 3X13B 1CGTA 3AAZB 2HT3D 3TVMD 3UYOD 5JHDE 2VAJA 5GIRA 4PRID 2CSPA 3REWA 5KW9L 2ICWJ 1A6AB 2X89A 3BIBX 4NQCA 3IAQA 2G5BB 1NH6A 3U7WH 5EUKA 4M8QB 1JMZA 4OZHA 2DLGA 2H1PH 2VAAB 4LNRA 5DHYB 5JIHA 3SGJA 2V2WA 5D5MB 4B0MM 5E2UH 4OCRL 4HQQL 4OZFH 3DSFH 3I6LE 4OLVH 3X12B 1AD0B 2VXVL 4PJCA 2FJGA 5F9DC 4MQXC 5KVDL 4CN1A 5DA0B 1ZLWK 5E08L 3X14A 3TNNB 2E9BA 4P99A 4DCQA 5B39A 1ZT1B 4Z7WF 2BOCB 1JPGB 4O2EB 1J1PL 1IGYA 2WIIA 3KPLB 4N8CH 4V1DE 5MERB 2W0FA 4K3GA 3E3QE 1ORQA 1S7RA 2IPTH 1A7NL 4RRPA 1VFOA 2DQEH 4LF3A 4Y16A 4F9LA 4KVNH 4J3SA 4OZ4A 3TESA 3CVIL 3VI4F 4EKXA 1DUYB 4K94H 2ILLA 5JIPA 1DQML 1X5AA 1CT8B 1VEPA 1R5WB 2EDOA 5E2TH 3SO3B 2HJLB 1RJZB 4QLRA 1QEWA 3DBXB 4FZEH 1F5WA 1I1YA 5CBEB 4PS4L 4GBXA 2ATKB 4RFNB 1T20B 2KQMA 3RL1B 4Z8FL 1KB5A 1JZ3A 4YDJB 1PDKA 2ITCA 4TVPD 4TNWK 5ESQB 2Z4QA 5BS0A 2YD4A 4WWKC 3BP7B 4GS7C 4HWZA 3U2SA 3WKNA 1Q0YL 5L7XL 4OLVL 4QCIA 4H26B 1NAKL 4MJIE 4OLZL 4I13B 1ZKAA 2A6KA 4RMUA 4RDQG 4HJJL 4PJ7A 1LE9B 5KVFH 3MNVA 3CH8A 3HPLA 1U8JA 1ZEAH 3CSBA 1P84J 5T3XD 2FEEL 4NIKB 1FLTX 4JRXD 2CGRH 3AS0A 1KPUA 3EYQD 1UKSA 4FXKA 5JXAL 1J05B 1CZ8L 4MNQB 4PRHB 4B7IA 1Q94A 3QUXD 5EZOH 1BQHG 1YQVH 1BD2D 1WQVT 4QXUL 3RZWA 5HHPA 1MFDL 4GH7B 2W1NA 1IM9A 4ENEC 5DK2A 4NYLA 4ETQA 4X4ZA 4OUUB 3T0VA 1U2HA 2EC8A 4WFGE 1PSKL 4W6WB 3VCLB 3MLYL 3ROOB 5I1KH 5DK0B 1J87A 2GFBA 2F53A 3QXUA 5E1HB 1MFCH 2DWEB 3WHXB 1P7QB 2GCYA 3H3PH 1JL8A 1JGEA 4DZ8B 2ZUQC 1GL4B 2V5MA 4M48L 3BOVA 5TDNA 4K94L 4TTDD 2CKBH 4NHUB 5ACMA 3FRUB 4X0KA 1A0QL 4HF5H 3F12A 4PGCB 3CUPA 1IL1B 3P4NA 5GRUH 3VG9C 1IQWH 4JFEB 4HFWA 4DW2L 1KXTB 4YHZL 3UTOA 2OR7A 2WLZA 4MA3B 3RWDB 2QL1A 1B6DA 2MOVA 4YQXH 4IRJD 3VU2A 1G7PB 5CGTA 3GSRA 1MI5A 1INEH 4TVSa 5EU6D 1AHWA 1P7KB 1CK0H 3O45B 1E6OH 2ZSWB 4M3JA 2CLZB 4TYUA 1LO0H 5IK3B 4K9EH 2VZOA 3D2UA 3OGOE 2UV3A 3IDMA 3RJQB 3ARPA 5HDLA 1OP3H 2H6PB 5GZNC 2HH0H 2AK1H 3B8SA 1FNGA 3KLSA 4KKCD 1GZPB 2DL2A 4LSVL 4NNPL 1MJ8H 5KJRH 4MD0B 1BZ7A 3J7HA 1EV2E 5ERWB 1WZKA 3ARXA 3C8DA 2VQ1B 5IJKA 5DQDL 1Q72H 2P4AB 4TQEL 3KLDA 4DN3L 2FEDD 1G9NH 1FZMB 3LZFL 5D6CB 3UEZA 4Q6YA 2QSVA 3QXDB 3ULUH 3H9HB 4UINH 4JLRA 4XCNB 5DT1H 4KQ3H 5ITBH 1MCHA 5DYOA 2C4XA 3E1F1 3BQUA 3U6RA 3CFDA 1BQLL 2IAMC 3O4OB 4K3EH 2XTJC 2JIXD 3S4SA 8FABA 1KNOB 2CDEB 1NC2A 4PJFA 4PY8I 5D1ZA 1FYTD 3O2VL 4POZD 5F1KC 1IGJB 1RJLA 3QJHA 5DMYA 8CGTA 2NXYB 4UOW1 3LRHA 5DD6A 1NGQL 1RUAH 1YYLH 1YN7A 1BFVH 1Y6MR 4I48B 4PRIE 4WI6A 2QBWA 4HHAB 1CICB 1OAQH 4E42A 2ZJSH 4GLRH 5FEBA 5HDBE 3LKPB 3UTPD 3LRSA 3KXFD 1O5DT 3A0OA 1LD9B 5IHUH 1JGLL 1DBAL 1JN6B 2P8PB 2NW2A 1H0DA 3ULVF 4YLQT 3BE1L 3UX9B 3W82A 4LEOA 5DRNA 4MA8H 1MHPH 3CFCH 1DLFH 3E6HA 4KQ3L 2F8VA 1QTYT 1DQQA 2AJ3B 2FCBA 1FNSL 2XN9B 4HMDA 3MTRA 1BVLA 3RVUC 4BSVA 2WK2A 2X1XR 3MJ9H 3M8OL 5T3XE 4X7TB 1MEXH 3WKML 2GAZA 2JTDA 5BVJA 5SWZB 4U3HA 3CSPA 3MCKA 3BIAX 3FB6A 3NGBB 3LB6C 3FHAA 5TDOA 4HG4J 5GGQH 5HHMB 1JZ7A 2A38A 1OAZH 2VLRD 2CDGB 3O11A 3U4EB 4DN3H 5IM7A 4YXKH 1DQTA 1NGZA 2QQKL 2R15A 5L0QB 1ZT4A 2CLRA 4MD4A 5E4IA 3OXSB 1W0VB 3GJFA 1CICD 2ZNWA 3WD5L 2VXQH 4L3ED 1WAAE 2NY3B 3OKDA 1C1EH 4MNGE 1F8TL 2R4RL 2DLFH 3KS0J 2BY2A 1G1CA 3MNWB 1T66D 3I6GB 3KPOB 1IFHH 2R9HD 1QSEA 4PJBF 1YC8A 5HYJA 3BH8B 2EYRA 1AHWC 3OKKB 1MAMH 4XNUH 1A7OL 4P9MH 3QDGE 3EJYD 4PJAB 2WWMD 5EORL 4I77L 1R6VA 4GT7A 4LKCB 2R2HB 1YY8B 3B9KD 4BFBD 2AEWA 1MREL 1NGWA 3BDXA 1CFQA 5BRZB 3BRDA 2HVJA 3O6LL 2Y25A 4Z7VF 5ALBH 5HHQA 2D0GA 4PRNA 4G6FD 5J56B 4NKQB 4GG6B 4K3DL 3CC5B 4GAYB 5A3IC 5I74C 2O5YH 2VZTA 3D0LB 2BNUA 5F7DB 2W9DH 1FVCA 4C56E 3P0VH 3VXUE 4Z76B 5MEND 2NZ9D 4AG4L 4B7LA 4J3VA 3WL9B 4D0CB 5C0RL 4ZPVA 1U8OB 4GG6F 5E00A 1EEUA 3OHXA 4RQQA 3QXWA 1CGSH 1YEJH 4WHCA 2HVKB 1MWAH 3G08A 4JM2F 4N0YH 4XRCA 2CRIA 2PTTA 4S1DD 2F53D 1EFXA 4PP1D 1N26A 1SEQH 5EZLB 3WS3B 1XMWA 5DQ9A 3O6MH 3QCUL 5GGTL 2AJYL 4W6XB 3O3EB 4EI5B 3SKMA 4ODSL 5IB3A 5KG9A 3SE3C 2BMKA 3LKRA 5JTWA 2AQ1A 3QIUB 3QP3A 1B0GA 2X7LA 1P1ZB 1ND0B 1KB5L 1IAOA 1CE1L 1JZ8A 2CKBB 3QZWG 3T0EB 3RWIA 3F58H 1RZJH 2FYYB 3MLTB 4AL8L 4EJ1C 1AQDB 5EU6E 1ZANL 1JZ4A 4Q9RL 1VACB 3FT3A 1J0KA 5L7XH 1XF2A 1IEAB 1SYVA 1MIEL 1RIUH 4QT5A 2BVPA 1T3FA 1U3HD 1BBDL 1DFBH 2IALA 3IDGA 4XPGL 1U3HA 1KULA 1KLGA 4WEBH 5FGRA 1LK3H 2JJWA 5IB1A 3U46B 2A6KB 4MLIA 5L2KE 4DGVL 4H5SA 1WWBX 5I1AA 5ILTL 1FNEA 1FZJB 1OTUC 3GSXB 5DUPH 1DQMH 3D85D 1HIMH 1FVDA 4RISH 1C5DB 3FB8A 4JY4B 4Y4FD 4G8FB 3ZDXF 4F7TB 3SE4A 1XEDA 1WZ1L 4OKVB 3T1FA 1RD6A 2P8LB 1U95A 3GNML 5TQ2L 3S36X 1VADB 1BWMA 2GKIA 1MCWW 3EFDH 4PJHE 4J12A 5I8EB 1KLFA 4NKDB 4S0SD 3T2NH 4JG0L 3FOLB 4JFDE 4L4JA 2IG2H 1T1YB 1AGFA 2CGRL 5K59E 4Y2DC 1TJHL 4HZAA 5C8JB 5FM4A 4KJYB 4PGBA 3ZZ1A 3WCYA 5GPRA 1S8DA 1G0DA 3QIBD 3NMEA 1B2WL 1UM5H 4UDUB 2DQEL 4NC1E 2VJXA 2NY6D 3BQUD 1T7XA 5K9QG 3GKZA 2O93L 4OD2B 4RMQA 2GFBB 3CVHH 4K94C 4OFYA 1NFIA 4PRAA 4XVTH 2X4SA 5H35A 1G6VK 2ICWB 3QFJB 2DQHH 5CSZA 3RTQC 3RWHA 3TH4T 4MJIA 4MSWA 5JO5B 1UFUA 2NXZC 3QUMB 5FUCE 2L7JA 3H9ZA 3PHOB 4O51B 5TDNB 1RZIB 2AQ2A 1CGWA 1HIML 4S2SA 1F3JA 1WAAA 3TIDB 5J6GB 1CI5A 1FCGA 5E4EB 2KH2B 3CJJA 5BXFB 4GMTL 4HFWB 2WUBH 3QNYB 4OI8A 3CSYB 4NHCL 3VGGA 5HYSA 5FDWB 4P59L 4G8EA 4HIXL 3HFMH 1I9RH 2BJML 4NQEE 3TF7C 3G6AB 1A2YA 4QHLB 4IEFB 3T8XA 3U4BH 1AIFA 2NMSA 3TO4A 4I4WA 4K55A 1J1XH 2H32A 3C5ZD 3V5DB 4HUUA 1F3DH 3OAYH 3CPLA 4D0DA 1AP2A 4WEBL 2EDLA 1HHJA 1II4E 4U6HB 3GMQA 3RVXD 3WXVH 3VFPA 3LSOA 3RVTD 4EQ3A 5D7LA 5J12C 4B53A 3KPTA 4PREA 1ZVYA 2XIDA 1MLCA 1H8SA 3G5ZB 1JHTA 3O3AB 4MXVF 3BP6A 3O2WH 4I5BB 1Z6JT 1U42A 1E4KA 2IQ9H 4EUPB 3UBXB 5IQ9B 1JK8B 3KS0H 5MI0B 3RKDD 4WW2B 4R7DB 3LD8B 1BREA 1DUYA 3IETB 2W65A 1Z9MA 1RZ7L 4NPYB 3Q3GB 5EUOB 1S7XB 4U1MB 2BSED 2VQ1A 1K6QH 1UXSA 2X4UA 5L8LB 2C5DC 5I74B 2ZOLB 3L3JA 1MNUL 3TVMB 1FP5A 1GAFL 3HS0B 2FZ3B 1JZ6A 3D18B 4POYA 1ORSA 5EU7C 1D5MB 2XA8H 5D70H 5E8OA 4NZRL 1BOGA 3HZKA 4KKNA 5JQ6L 1T7YA 2BNQE 5FUCC 5JOPE 5FYKD 4BH8B 2A9NL 3N1FC 3GMRB 4JFDA 3V8OA 4CVXB 3BN9D 4KH2A 3KXFB 1I7UB 3CVHL 1F4XH 5F7LB 2I07A 4M61A 4M1DL 2DBJA 5KN5B 4OBSA 3TO4C 1LO5A 3QXAB 3W5NA 4UUJB 4YWGL 1DN0B 2K3TA 4U1KB 1EFQA 4JR9H 5EOTB 4JKWA 5DD6B 1IQDB 2Z93B 4PJDB 4NM4H 4AEHH 3G5XB 4CADA 2HT4D 1HWHB 3H7BA 1OL0A 3MLSL 2CIKB 1G9NL 2HT2D 25C8L 3RHWK 1LWRA 1HH6B 2GSGA 1CGYA 4LSSL 2IC2A 3ARBD 4C58B 1YEEH 2OK0L 4FFWC 2J8UA 3MV9B 3ULVL 5EA0H 2AK4B 5F7EH 1V3LA 4LNVA 1V7NH 3DHJA 1RJYA 3SDXF 5KSVA 4ZTPH 4MA1B 4JANA 4P2RE 2W9EH 3VWJD 3E6FA 1EGJH 3AU1A 2JJUA 5E24E 3KLHD 3JWDH 4XP5L 3C6LB 4R4NC 1RUPH 5I75C 3QAZC 4C56D 1PY9A 4HJGB 4KJPC 5HPMB 4QF1A 1HHGA 4P2RB 5CZVL 4KJWC 4OZFG 4JKPL 5FAAA 3QPQC 1ZHLA 1FAKT 2YWYA 4DGIL 5ECJE 1IAIH 1NSNH 5HI3C 5BV7H 3TA3C 4JFEA 4KROC 3EDDA 4OF3A 1KEMH 5I1HL 4ZAKC 4MS8D 1JRHI 2IBZX 4L8SC 2FL5B 3X3GL 5GZND 5I30L 1CE6B 2VDOH 5ISZB 3QEQD 3GSNA 1X9QA 3OAUH 3PDDA 4ZUTB 4P5MA 2CQVA 1C5BL 4KKLD 2A0LC 3RJDA 4CMHC 3NCCB 1ZGLB 1DLFL 1IM9D 3H42L 4X6DB 3KLHC 4ALAH 2ED8A 5GGTA 1MH5A 4I77H 1UJTA 3V6FB 2VLKD 2H3NB 2V7HA 4XVSL 3BKYL 3WNOA 1K3IA 2I27N 2BHZA 1XCQA 5K33A 5FO8A 2MCPH 1KB9K 1E4KC 4KZEH 1NBZB 4FXLA 1OPGL 3OV6A 4XNYH 1FNHA 5HVFB 2BNQB 1X3DA 2R2HA 3EO0A 3PL6B 4PV9A 2X9WA 5T3ZE 2NW3A 1E27A 3MUGA 2X4TA 4KAQL 3GMLA 3PWPD 4JQVA 3AM8A 5F7WC 3P4MB 4HUWB 1F6LL 2ED7A 4Z7NE 4UTBL 1D5ZA 4LAQH 4XNMB 1HXYA 2P5WA 2NY4C 4WWID 3SGDH 4OQ1A 1DE4A 1X44A 3G5YB 5C09A 1WTLA 2BNUB 1OSZA 1C1EL 3HUJB 2DLEA 4M1CC 5DYOB 1A1MA 5E7FA 5GRWA 3WL9A 5D6DA 1KG0A 1HHKB 3TJEH 1P6FA 1SEQL 2HLAB 4PRHD 4PB0H 3IDXL 1OY3B 1HDMA 3RGVB 1VCAA 4LHUB 1J88A 4HPOL 4NKIH 4EOWH 2MSPA 1Q9WA 3TGXA 4PJIF 3QJHB 2YPKA 4ODWB 1CLYH 4IDJL 4FTVB 3OGCB 3LQAL 3O9WC 5AUMB 1FFQA 4C54A 1YNTB 1N5YL 4K3DH 1KIPB 4WW1A 5TE4L 4MAUL 4Y5VC 2Q7NA 3MRMB 4MXWH 1FG9C 5EG6C 2FX7H 1DL7H 4LLWA 4YBHA 3MRGB 1D5BA 2HKHL 1CS6A 4JN2B 5J9PB 4TVPH 2ICES 2P5EE 1CU4H 5HGAA 3REVA 3QZWB 1AGEB 3QFJE 5TE7L 2IMMA 3GMOA 3HB3D 3HE7A 2R1YB 1ZT1A 3UTZA 1FYTB 4HC1H 1KLGB 3TBVA 3H0TA 3L9RB 3ARUA 4P2CG 1JZ2A 1Q9OB 2AV1A 4ZFOL 4L9DA 1QBBA 2K7QA 4EXKA 2UZYB 1R5VB 4OQTL 4LF3B 4Y4KB 1KBGH 2FD6L 4JG1L 4G9FB 1W0YT 1TTGA 2A6IA 4ZQKA 1MCOH 4JPKL 3IXTA 2QQQA 5HVHC 5F3HB 2HJFB 2Y72A 3FB8B 3QQ4A 1WBXB 3TH2T 1WTGT 2XKSA 2AQ3A 4LLVB 3Q0HA 1QSEE 2AJXH 2WBKA 4FQLH 5D6CA 1T1WA 3G5VB 4XPBL 4CN6A 4X99A 1I85C 2D4FA 3V0VB 3QNXB 3F7YB 3O4LB 2QV2A 4LLYA 2J4WL 4GG8B 3I9GH 1T22A 4ZS6C 5DWUH 1WBYB 3ZKND 5HGDA 4OIIH 4OCMC 1OARH 3KPRA 4CW1B 1J12A 1V3KA 1MHEA 3C2AL 3SDDB 2R39A 3EJJX 3IRPX 3O2DL 4XHJC 2FATL 5CHNA 1ED3A 5SWSE 3Q1SL 2ZPKH 4OFIA 1SJXA 4HS8H 4PTTB 1I8LC 5KSAB 2ENSA 3S37L 2P43B 1UADC 3KPNA 4N1HB 5CUSH 3QEQE 3ARFD 4OLUH 4NUJB 5EU6B 4QRRB 3E3QC 3EDFA 3TIDA 1F02I 3T0EE 4OCSH 5DHYA 3NFNA 4IMLA 1VEMA 1NLBL 5I17A 3B5TA 5T1KD 3MO1B 4RBPH 4LPWA 5IROC 2EKSA 4P2QD 3GUTA 1KN4L 4PJXF 2J4WH 1M05A 5GRJL 4O2EA 2G75A 1MCNA 1XF5B 4ZNCD 1JPTH 4BSWB 2LTQC 1I1AD 5GSRA 5C71A 1IGML 1NCBL 4GXVL 1RUQL 3RVVC 1H3VA 2WQ8A 1PEWA 3LKSB 3VWKB 5LGHL 4YFDB 4WHTB 3CIQA 2Y23A 1KCRH 5L2KA 3DBXA 4X9FA 3UJTL 2DM2A 1CFNA 3BSZL 3KJ4B 1YC7A 5D7KD 1TDQA 4NQSB 2OBGA 5KSAD 4MNHB 3BKMH 4MGXA 2BVUA 4OLZH 1BFTA 4LSUL 3VXUD 4M1GH 5CD5D 4J3TA 2Y6SC 5BRZE 3VXUA 2LV4A 3IYLW 4FFYH 2VERN 1J1XL 4N5UA 3ZHDA 1IZKA 1N0XH 4LQFH 2NY5H 4KK6D 5DI8B 3LKOB 4HS6B 4DN4L 4ELMF 3C8KB 5CD3A 4KTYA 4P46A 3QDGB 2DWDB 2OTPA 3BHBA 4GRLD 4UDTB 4MA7H 2WW8A 4TSAL 5HGBA 2VLKA 4Z77A 2A9NH 3B83A 3NN8A 3QXAA 1ZEAL 1E4XI 3KWWA 3HNTL 4UT7H 3LS4L 4ZO9A 1RZKH 1PX3A 1UWEL 1VB9A 1FVDB 5A3ID 4ZOCA 1T0PB 4H88L 4RZCB 1GOHA 1MJUH 1IGCL 4Q0XL 1V05A 3O3BB 3CC5A 4GAYA 4G9FD 1HSAB 1CZ8H 3TN0D 2AI0H 1U95B 1MFCL 5TPWH 5DJAA 1ZHBB 2XQYK 5ICYA 2FIKB 5C9JB 4GW1A 2DQGH 1Y6KR 3RRQA 1HNFA 4KMQA 1VFBA 5JQ6H 5J3HC 2YMXL 3UO1L 1QSZA 1QBAA 1YECH 1QR1A 2RCSH 4NJ9H 1PZUB 5I1KL 2APTA 5IROA 1JWSA 5CFHA 1HQRB 2KQNA 4JKPH 4U6YA 4NHUA 4JO4H 5CD5C 3D87B 3H9SD 5BV7L 3EFFB 4HUMB 5DD3L 3ARBC 1KTDA 3PGDB 5HHMD 1MHCB 4N0FB 4KK6C 3DWTA 3X3GH 3DURB 3VJ6A 4KU1A 4M8QA 4JDTL 1MFDH 4F3FA 3VRLF 5E56A 1IAOB 2CKBA 1FORL 1Q9KB 4NSKA 4YHNA 4R2GD 1RHHA 3PGCB 3ESVF 3M07A 2XN9D 2W9EL 4PRIB 5SWQA 2YZ1A 3B6SB 3RGVD 5MHSE 1AIFB 2G60L 3TO4B 2IAMB 3EOTL 3O4OC 5DZOA 4X7SL 3L5WB 3S37X 2VLJB 3F5WA 3MRJA 4PRPE 4U1GC 3V2AR 2EIEA 2MWCA 3V6FA 3RVVD 4QYOB 1UEYA 1G7MB 3WEXB 3QHTC 2EDYA 3DVGB 5JXED 5AYUH 3KPMB 3FB6B 3GSWB 3P9LB 4KHTH 2WP3T 4ODHL 4LSVH 4NNPH 4K8RC 3VXOB 4NQTA 4F2MB 1M6OA 5DZNA 2ESVA 5BQ7A 4G7YL 5GJTL 1FFPA 5DJ6B 2MQ0A 2P8LA 1A6TA 4NN7C 3CFKB 4PJGF 3UBXI 3VFRA 3Q3GA 4MAYB 5F7KC 4F9LC 1VPOH 3QDJD 4BZYA 3EW3B 1U8KB 1FL3B 5BZDA 1GGBL 2Y06H 3EO9L 2XPGB 3D18A 4PG2C 5SX4H 4AEEA 4ZTOL 4KV5E 4POZC 1D9KC 3HUJA 3V8CA 5ADPH 1I9IH 1OAXH 2FWOB 1RJLB 1NFDF 4PJHF 1AD9A 1D9KA 5DURB 5C0IA 3RBSA 2HLAA 4GW4B 4DQOL 2BVTA 1KGCD 5I9QB 5HHVH 2E9JA 4LPVA 1INDH 1QVOA 2UUDH 4XHJD 5EU5B 2CMRL 4P9HH 1KPUB 3PHOA 4KK8D 1ZWIB 4XNYL 5GRYA 2R2EB 2OTUB 4QOKA 4WY7L 5F88B 1NBVL 4NWTH 4FTVA 2NLJB 1D7FA 5DO2C 2FX7L 4LNRB 1S9XB 3DIFB 1I1FB 4CMHB 3MRKB 2XG4A 2AGJH 5BMFH 5JNYA 4DKEL 2ERJB 2CIKA 3V7MA 4S1DC 4HUXB 3LV3A 3QNZA 3LAFA 4D8PB 5E6YA 4JFEE 4NO0B 2R0WL 3HAEB 3RWJA 1C5CH 5DK0A 5B39B 2YUZA 4QRPE 3Q5YA 5A2FA 2DI7A 5D1QD 3X3FL 1HEZB 1G7JA 2DRUA 4WFGD 4I0PD 5A1AA 3PQYE 3ZYIA 1OP3K 4W70A 4O02H 1X5HA 1R3KA 2DM7A 3BGFC 4NN5B 4GQ9H 3U0TB 1NDGA 3H0TB 3OSKA 5E03A 3SKMB 1T2XA 2ENYA 1JWUA 1C12B 4YDKH 4BKLB 3AS1A 4MXQD 4X6BB 4JQIL 1KJ2L 2BC4B 5IEHB 1YYML 4I2XB 4K71B 4OF8A 2ZSWA 3ALXA 1FL5B 4LRIA 5IVXB 3KVQA 4M6ML 1CXHA 1A7QL 4Y89A 2A9ML 5FB8B 1FLRH 3MLPA 2FATH 5FUZH 2I5YL 1I7UA 2DQCH 1DQDH 5HD8C 2V9QA 2O5ZH 5DJ8B 4LSRL 1A7OH 7FABL 1H3PL 3I6LD 4M02A 5JA8B 3GZKA 3PABA 2FSEB 1W72L 4LVEA 3P0GB 4PJ7F 1RZFL 5I1LB 1DL7L 3O6ML 3QCUH 1J05A 5GGTH 1LEIB 3CNKA 2YD9A 4JRXB 1FN4A 1MREH 2HKHH 4JKKA 5FKPB 4MCZA 4KMTH 2DBLH 1NLBH 3IDUA 5D1QC 3WLWC 5FM5M 5KOVC 4PJGE 4ODVL 5HDQL 1QSVA 3NFPA 3WLBA 4B5EA 1KIUA 3OJDA 5F7HA 5CGYD 2Y07H 4NWUL 5CUSL 3VFGL 3FJTA 4P49A 1KNOA 2CDEA 4JANB 4FMKA 1INQB 2ADJA 2IH3B 5JW5B 4EI6B 5JORA 2RB8A 1ZLVH 1NDMB 1HN1A 3OX8B 2PTTB 5KSUB 1Q1JH 3QRFM 4UIMB 1EFXB 4PB9L 3OPZL 4OD2A 4X0KB 3C5ZB 1KCVL 3B2UC 3QA3A 3NCBB 5IEKA 4DGYH 4JHWH 1HDMB 4HJGA 2BRRH 2ICWA 3QFJA 4Y5YC 5CSZB 5E8DL 4CDGC 4EI5A 1DBBH 5LWYH 2Z31A 3MCLL 4OZGB 5L8KB 1UJ3C 3VFNB 1JVKA 4P5KB 2EDKA 2PKDA 5C0JA 1BFOA 5ID0A 5AG9A 4HEPG 1U3JA 1QQDB 2M8XA 3I6KB 4Q6IB 3P9WB 2W9DL 3N1MC 3PWUB 5IB5B 4A6YA 3AY4A 3X12A 1I7RA 1IEAA 4HXAH 4ZFZA 2CLZA 5DMIH 2P7TB 5K9OB 3LPWA 3X14B 5JHDB 4PV8B 5EIQA 3GFUA 2F8OA 4E41A 1Z3GH 3HN3A 1M71A 1S7WA 4BSVB 3HC4H 5HI4C 1HHHB 3HKFA 3LKQA 1RMFH 4LPXA 2XV6B 4YHLH 5IB1B 1FGVH 5BCAA 4MCYB 1XGYL 3GK8L 2BVEA 1EAPB 5HYEA 2QHLA 1A4KA 5AWNH 4XCCH 5F7UA 3QHFH 3W39B 2BSRB 4XXCA 2APBA 1C5DA 4APQA 2ZUUA 3LMJH 4HS3A 1XIWA 4FQQB 1QEWB 1MJ8L 5ICXB 4HGWA 2BVOB 4M6OL 3MNZA 5IIEA 3EGSA 3SKNA 5HGHB 1AC6A 3RWEA 3OR6A 2VLLB 3DX6A 1LO3L 1NMCB 3MRDA 4I8DA 1JI2A 3EOBA 3O3BA 2JELH 4FFWD 5I1GH 4LGSB 3TJHD 1NL0H 1NAML 5C3LD 1H3GA 1CD0A 3VFSA 2OL3H 2VNCA 3SPVA 2VXSH 1QRNA 3BP4B 4TNWF 3WJLC 2AW2A 4P4KC 2AEPL 3GBNL 5C0BD 1GC1H 3HPLB 1TVHA 2BY0A 3T0BA 5EBLB 4DN4H 2BFVL 4XC3H 4XP1L 4ELME 4WRLA 4QTIH 3IDIB 3ZKSD 4XC1L 3GRWH 4PJ5E 3QEHB 3UBXG 5D7IB 4ZFOB 1X5FA 3DGCR 3PWVA 5KVGL 1CFQB 1I8KB 1BP3B 3OKYA 1QA9B 3BUTA 1TZGH 3X17A 2RJMA 5BW7A 4P46D 5EZJB 2NY2D 3GMNB 2XT1B 4CVUA 2P5WE 1JGLH 3ARFB 3LN5A 2RR3A 4TOYL 1Q0YH 2IMNA 4TSBH 4D0CA 4FQXA 4JFFB 2F53B 1T03H 1YMHA 3W11C 4AIXA 4FS0A 5JLZA 3PWNB 2GAZB 1RK1A 5IJVA 3KJ6L 1AY1H 4J7RA 1XFPA 3HG1B 4YHYB 3K4ZA 4OZIB 1KLUB 1R5IA 3DRTA 1EAJA 4IOFC 2YC1A 4OT1H 5FXCH 4HKJA 1IL1A 2ZCHL 2CK2A 5D1ZD 4TSCH 1UB6A 3BP6B 3MJ8B 1SHMA 1MRFH 3TV3H 3A6CH 3MUZ1 3KG5A 1G7MA 4Y4KA 5KG9B 3IKKA 3RWDA 3UTTA 4JDTH 3GM0A 3WUZA 3S34L 4GKZA 3MLSH 1DSFH 4GAJH 4TULL 3GKWH 1RUML 3BFOA 3W9DB 1FFNA 2Y06L 3EO9H 3SY0A 3JSSA 3FCTA 3HNSH 3WO4B 3V0VA 1KENL 3MLYH 3O4LA 2NQCA 2IBGA 3MRLA 5I1DA 5J3HD 5EPMB 4MA1C 5IB2B 2IANE 4UNTA 4OB5H 2K1MA 5C7XH 2O26U 3CU7A 5KN5A 5FV1L 3QCVL 3CXDH 4X7SH 5EC1B 2PCPB 4I3RH 3D3VA 5JPNA 5AYUL 5GRUL 4CMMA 5CZXD 3BGMB 1EEYA 5C6PB 4N0UB 2BVQA 5DMGD 2X9XA 3STLB 4Y2DA 4IS6B 3I3EA 5HYQB 4L3CA 4YDVB 1A47A 2EDJA 3S3JA 3HG1D 3IB4A 5FV2A 1KPVA 4PD4J 1INEL 5MEPB 1ZHNA 3BGAA 4F57L 4J3OC 4UT6H 3EUUA 2R2BB 2PTUA 2GQHA 4R8WL 1E6OL 4ZO7A 1F58L 4XNMA 4PGBB 3AFLA 5C0CE 4RGOL 2E8ZA 5JZ7C 2D3VA 4M5YL 2VLRE 2XKUA 5TJWK 4U1GB 5HD8D 3HC3L 2D7NA 4R6UA 2J6EH 3FQNB 1JTPA 2P5ED 4XX1E 1U3HC 3EO1B 5FA4A 4G7YH 5GJTH 1G7JB 4XPTL 4FFZL 1CD1B 4HK3N 1HYSC 1XH3A 2R8SH 3CD4A 3V52L 3MBXL 1N64L 4OGYL 4KJQD 4XWGH 4JKMA 1JN6A 2P8PA 3IKCB 5IWLC 3VFWA 3NTCH 4IRSA 5FK9A 3SJVA 3WJLA 1PKOA 4LQ1A 5DRNB 4MX7A 4OGAD 1QSFD 5DJDA 1KV3A 3DURA 3VJ6B 4ZUTA 4K07A 5CJQL 2XA3A 4QT5B 2B5IC 1H9VA 4ZUSA 1AC0A 2IQAB 5CP7B 4LLWB 4WHYH 2X6MA 5C0BE 4LCYA 3V95A 3NIGE 2VLMD 3TFKC 1J8HA 2OJEA 4G8GB 1GCFA 2EH7L 1MCLA 3ZKXC 1OPGH 4NQCE 5IVXA 2AKRB 3RNKB 1OGAE 1OD9A 2NXZB 3GJEA 3BAEL 2ZUWA 3TBTB 3BMWA 2Q20A 4JAMB 4L29B 4F8QA 4CGTA 1YEHH 3JTTA 3RZCA 2NY1B 4F15B 1T7VA 1UACL 5FUOL 1B88A 1CD9B 1ZAGA 4AMKL 2F54A 4LARH 1ZLWH 2R0KH 4M5ZL 5EBWA 4G7VH 1QFWM 1NGZB 3SO3C 1H15A 1NQBA 3NABH 1ZT4B 3AUVA 4MD4B 4LU5L 2D7TL 1AGDB 4ZQKB 2VXUH 4K2UH 4YH6A 1JCKA 1WZ1H 4DOHB 3L3JB 2E27L 1MIEH 1IGTA 3MLUH 3ARGB 5J1AA 5DJCB 4Z6AT 1KIQA 4WI8A 3HC3H 4PJIE 5ICYB 3P0YH 5CJQH 3OR7A 4M6NL 2ZUTA 1XF1A 1SYSB 1U0QA 1FH5H 3CSGA 3EJYC 4G43B 4O02L 2H1PL 4F9PC 5IOPB 1IC7H 4XVSH 2M26A 3LH2H 4E5XA 2LVCA 4XPTH 1UJ3A 3SCMB 3EYOA 4RMWA 3PXJA 3IFLL 3T77A 3I85A 2R8SL 5T1DL 4NZTL 1PYWB 1X4YA 4Z7UB 5C07B 4HZLB 3MV01 1KJVB 4K9EC 5FUOH 5IG7A 1KTDB 4AMKH 1IRAY 3EFDL 4LASH 3U79A 3V7AG 5FDWA 5C0AA 2P48B 4XP9H 3KPNB 3UPRB 2QADB 1MCOL 3BESR 4JPKH 3MROB 2A6JA 3RP1A 1N4XL 3G6AA 4LCIL 3CMGA 5I0DA 5TE4H 1JGUL 2NY4B 1EJOH 5GHWH 1S7VB 1T80A 5BZWA 3THMH 1IFHL 5GZOD 5A16A 4OCRH 1NLDL 3P2TA 2GJZB 1N2RB 2Q76B 1EO8H 1D3CA 2IAMA 4LPYA 2HWZH 4HIHB 3NCMA 2OR8A 4PUBH 3O3AA 4JEGB 4JZJC 2H26B 5GQBA 4HCRA 4Y4HB 4QYOA 4WGWB 2Y5TA 3O8XB 4M6AA 1I9JH 3HI6L 4BSJA 3O9WB 1BD2B 1SBSL 3GSWA 3P9LA 3MACL 3T0WA 3O9WD 1R3KB 1FGVL 3QBTB 4MXWL 5D7SL 3TBSA 3WN5C 4F7EB 1QO3A 5JW4Q 2WBJB 3C60D 2WUCL 4GW5B 1ZA3A 1HE7A 2R23B 4OIIL 4X7CC 1BOGB 3MC0A 1RSFA 1S7UA 3QI9D 5DD5H 3ZTNL 1XR9A 3UPAA 4EN3C 4LLDA 1YEKL 5IESL 1EZVX 3MXVH 4L4VB 2V6HA 1J0IA 5I1IH 2BFVH 1MY5A 3TIEA 5I1CL 1DQJA 2F54E 2EE9A 1AJ7L 2OTWA 1NKRA 5MENA 4G6KL 5JIIA 5I66A 1OARL 4PJEA 4JFHE 4ODUA 4YXHH 1D9KB 4ETYA 2JJTA 4JY4A 4JO1L 4CKVX 4NT6B 1UCBL 1WUNT 3DROA 1JTTA 4U1NB 1FPTL 2LU3A 3SOBL 4FQHB 5IWLA 3BKCL 1D6EB 3Q1SH 5E2VH 3GB7A 3JWOC 4HC1A 4MZ3A 4TPRH 1C7SA 3U1SH 5HYSG 2EYTA 2IF7A 4G9DB 3GMMA 5D7SH 3V4UL 1BLNB 4V2BA 4KV5F 1RMFL 4KDWA 3F7QA 1ZLVK 4OCXL 5DWUL 1P5UA 5AZEH 3WLBB 4GSDH 4UT9H 2OK0H 5F9JA 1NL0L 2Z91B 4BELD 1U36A 5DD5L 4PTUB 1M7IA 1UVQB 3ZTNH 1QNZL 4FFYL 1VFBB 3VFMB 1UYWL 4PUBL 4UI2A 3W2DH 3FRPG 2HT4C 2YBRB 1FZOB 3AVEA 4LQFL 3RTQD 5GS1A 5ICZA 3WO3B 4WHYG 1JWSB 1AJ7H 1X5KA 4QRQB 4QXTA 3BSZH 3FAWA 5FO7A 5B21A 1EJ6A 1H8OA 1SBSH 1YPZB 5D72L 3RAJL 5T3XH 4IRJC 3SO5A 4KMLB 5KVGH 3TPKA 4OT1L 1MFEH 4WUUA 4KJQC 1OP9A 2GJ6E 2YN3A 3D48R 1JWUB 4ZOAA 1A2YB 4QHLA 4KJPD 2VKXA 5HYFA 4Q0XH 2NY5L 2H32B 4LIQE 3N06B 3H2WA 3L3IB 4XVJH 4FQIH 2E6JA 4G5ZL 4Z95H 3L3HA 3MX0A 4MXVE 4PRPD 1FV1A 1HHJB 5HI3D 4ZFZB 5T5NG 1CL7I 3RWFB 1E4WL 5IQ7H 4M1GL 3JWDL 4NO3B 2GTWB 3PNWA 1DSFL 4PFEA 1ZTXH 2DQIH 4U1JA 3MRLB 5I1DB 2DIJA 3HZVA 3BD3A 4C4KO 5C2BL 5A40E 1WC7A 3BHBB 3GBLA 4UDTA 3W0WE 3D3VE 3MRJB 3IJHA 1UXWA 1T6WA 1BQLH 3KYMA 1HI6A 3GJFK 1U8LA 4K3EL 3UBXA 2QHRH 3WEXA 4PJ9B 4XH2B 3VFTA 4GBXC 1IC5H 3FQTB 4HUVB 1AGCB 3H8NA 2VR9A 1JMXA 2PTVA 4FNLL 4F58H 1S7XA 1L4IA 5F3HA 4Q97A 4JRXA 3LEYH 4QHMA 4KHXL 4OGZA 1XGUB 5L0QC 5B4MC 4JCLA 1NCAH 3IDNA 5DJ6A 4MJID 4XMKL 2DB8A 1D5IH 2YA0A 3JWDC 1QFUH 2DQDH 4AQ1B 2X4NA 4YE4L 3SGEH 5DJAB 4IIQB 3VFRB 1YJDH 1NEUA 3N85H 1HWGB 3HZMB 5FHAH 3SGEI 5JR1H 5T33H 4GRMA 3KPRB 2ZUQB 4CW1A 3UJIH 3OKLB 4JB9L 4XWOD 2UYLB 4M7KH 2NTFA 3SPVB 2D2OA 1ZTXL 4XP6L 2WP3O 3CFBA 1UZ8A 1YN6B 3DPBA 1T2QL 5CCKH 1ZLUH 1FIEA 2OL3A 1U8PB 3CLEL 5GGVH 2GHWB 2EO9A 4WW1B 3PG2A 2CXKA 5DC9B 1P6AB 3MRMA 2QHRL 4U0RB 4Z5RA 3L3GA 4XXCC 1L9MA 5AD0A 4K3JL 3MUHL 4P4RA 2A0LD 2XRAH 3G04A 4Y7MA 4HX1B 2IAND 1QG3A 3B9AA 4YHNB 2AK4A 5IHUL 3TN0C 4BZ2L 3FT4B 4LCWB 1CDGA 3PGCA 3ULUD 5FGCB 4WUUE 4XCYA 3MBEA 1TFHA 2ADIA 4KROD 5DEFA 3T3MF 4X7FC 1GGBH 1I1AA 5IMOB 3DUHA 3BXNB 4DZBA 4RX4D 3HE7B 4TVPL 1SY6H 1ZT7B 3F6LA 5CBAA 3T2PA 4GKSB 1M71B 4H8WH 4PBVC 5IFHH 2XZCH 5B39G 1HHHA 3EYFB 5ADPL 1P84K 2B4CC 4JB9H 4WIQA 3GJEB 2B2XH 3ZE1F 3BEWA 1SJEA 2X4RA 4AJ0A 1ZA6B 3OJMB 3PJSB 1N5YH 3BE1H 3KPPA 3SE9H 1GZQB 4NQEA 5MEQA 3NZ8A 4JHZA 2VIRA 2BERA 3C6SA 4CVZB 4B41A 1GSMA 1J1OH 1IARB 1RZGB 1EEZA 1T66C 2CIIA 4UNVA 5FYJH 3QUZA 2FBOJ 4XXDB 3TBWA 2XTJB 1G7HA 3RPIB 3BUYB 5GGSA 4AIOA 3EJZD 4UV7L 3UJJH 2XICA 3ARZA 3EYVA 5FGCE 2BNRB 2YD5A 2WNGA 2VISB 4JFFD 3MV7D 4NQDD 5BVPH 5EO1B 3RIFK 3KPRD 1LP9E 3C08H 4U1LB 3BDBA 1ED3B 4OGYH 5BO1H 4PJHA 4JFDD 4QNPF 3MA9L 2MKWA 1QVOB 3CZJA 1I1AC 1KPRA 4FQ2L 2E7BA 4U3XA 1JYXA 3A6BH 1CXFA 3EAKA 4F33B 3VXSD 2DQFB 4LKXA 2XY2A 1WT5C 3L5XL 4KUZL 1I1FA 4MMZC 1CIUA 1KCSL 1CR9L 2F5BH 2E27H 5IJKC 4XCFL 1IKFL 1OTTD 4OZHB 2FO4A 1F4WL 3OAYK 3FB7A 3RWJB 1X5LA 4QTHA 4ZFFA 4FQXB 4ORGA 5KBNC 1WICA 1WCBA 1MSPA 1AD0A 5C2UB 4HH9A 1YMMB 1I3UA 1VFMA 5K9JH 4PG9B 1YNKL 5ENWB 1MWAA 5D8JH 5KSUA 2V5YA 1JZ5A 4Z0XB 5DVNA 4P57A 4DCQB 4CNIA 3PWPA 4KDTA 2X41A 4HKJB 2AXJA 4P4KB 4LIQH 2DIBA 5C08A 4WY7H 1W72H 3ARDB 3D39D 2HKFL 1WAAF 2EDFA 4J8RB 2V2TB 4LSDA 1SBBA 1C12A 1O0VA 3FMGH 4JZOA 3TO2A 4D2NA 5FYJL 5GGRA 5I73B 3RWGA 2AXGB 4U31A 4C4KT 4M7JH 2BC4A 1AXTH 1YJDC 4OFDA 4ONHB 5ESVA 5HDBF 5AYQA 5T1LD 2DKMA 5MP6H 1L7TH 4JZNB 5C6TH 1KFAH 3ZT7A 4BH7B 1NCDH 3SDYL 4FQPA 5ESQA 4HKBB 2EEDA 5EO9B 2F19H 4Z18A 1EHNA 4DKFH 4XPFH 3T09A 3HI1A 3LKNA 5EO0A 1A14H 4AEIL 4URTB 5INDA 2VWEE 2HT3C 3ARDD 2OP4H 1PJ9A 2ATPA 2LFGA 1E4XL 3W39A 3VA6A 2L7UA 3B2VL 1U58B 1TITA 1JP5A 2A74A 3ECBB 4W4OA 1XAUA 5GGUA 3BKML 3UAJD 4H1LB 2BK8A 1IKFH 2BHYA 3QNXA 3GB7B 1MJUL 3FT2A 4YDIH 1K2DA 3KPQA 4M7LL 4ZAKD 4XVUD 3GM8A 4FQCL 3NAAH 4LMQI 5D71L 1DR9A 2DKSA 2F74A 3C9NA 4ONFL 1D9KD 4YJZL 4X8JA 5DD1L 3RU8H 3OF6A 4HQQH 3DSFL 2D31B 4WWKB 5L9DH 1ACYL 2DQCL 4P23A 4HIXH 2JCCB 4YC2B 3VXPA 3IU3A 1S9YA 4UTAL 1IKNC 1LK2A 1NCDL 3SDYH 4HEME 5LCVL 3UZEA 3WN5B 3ARVA 4U6XB 2GCYB 3WIIH 3HNTH 1F3DJ 4Q2ZB 5D7JA 5DR5L 5FYLD 4WJ5B 4RFOH 2NZIA 4U1SA 1G7QB 1NFKA 3LCYA 4BFEA 2AEIT 3ARTA 1BIHA 3CFEA 4WDIB 1YZZA 1A3RL 1ZE3C 4NSKB 4P59H 2NY5C 5TPWL 5EH1A 3QQ3A 2A73B 2VH5H 1PAMA 5B3JF 1A6VH 3SJVB 5CEXA 1M7DB 3SJVD 4LRNH 1JIBA 5DFWH 3PDGA 3QUXB 2OZ4A 3BRGC 2R0LH 4X4ME 3NACH 1E4WH 5D2LF 3HAEA 3QRGH 3EIFA 4HJ0C 1S7VA 4JO1H 4G8GA 3GI9L 3VXSA 5C92A 1DN2A 5DF0A 1D5XA 5C1MB 3BVNB 5KZCD 1Z3GL 2D4DA 4R2GC 5DDHA 4U1HB 1S7QA 4HIJA 3W0WA 2FJFA 4NJAL 2N7BA 4Q9BA 4I18C 4GMTH 5J11B 1BIIB 3ZYZA 4CBPA 4EIZC 4APQB 4H20H 1T1XB 3S37H 1FNGB 2QR0A 4KHXH 1KYOJ 1T83A 1HI6B 2D7OA 4XBGB 5EU7E 2ZCLL 4PJ8C 5KANI 4KZDH 4Y16B 4LBEB 4NQSA 5ELIA 5GSVA 3TBYB 2IH1A 4MB4A 3SKNB 4QXGH 4ZPTB 1TZGL 2OI9B 5CKAA 1UYWH 4YO0A 3LDBC 3MGAA 1N7MH 2SEBA 1FFNB 1NFDE 5FHAL 1QLEL 5JR1L 5F6IC 3LHPH 4ZSOB 1QRNB 3BP4A 3PWJA 3TT3L 1BF8A 1FVEA 3PWPE 3T4AA 3HRZB 2DQDL 1TENA 4G43A 3QDGA 4YK4B 1T2QH 2XG5A 4L4VA 2DQIL 3MLRL 3B8YA 1OF2B 4JRYD 2FSEA 3HMWH 4HDIB 3VDBA 5GS2H 1FJ1B 3P11L 1MVUA 4PJEB 2Z8WC 4BQCA 2VDRH 4F58L 3BGMA 1KCRL 3BMVA 4XP5H 4IMKA 4TOYH 4YFLI 1JUFB 3PGFL 4IHOA 1QFUL 2DL9A 2QQKH 2I26N 1NCNA 5ESAA 3T2OA 1PKQB 4NO0A 2R2BA 3UTTD 5GRVK 5BZWB 5A2IH 1N5AB 4NGHL 3F7RA 1LQSR 2ZCHH 2A6DB 2YD6A 4P4KD 2IGFL 1A5FH 2BCKB 2YPLA 5IMKB 4QRUA 3VCLA 4HWBA 3HC0A 2VITA 1QSFA 4JO2H 4GKSA 4NOFA 4S1SH 3SQBA 3KPLA 3HB3C 3LD8C 1Q38A 3JVGA 2B20A 3SDAC 5EZIL 3RBGA 4Y4FA 3CFJB 3SCMC 5B8CA 4PBWD 1K5NA 1KENH 1S9VB 4N9OB 1EH9A 1GGIL 3KPPB 1OAYL 4GW5A 2VWEC 3MOAL 2XZAH 4UZGA 3W9DA 3OKOA 4G8GE 4WTZA 5DJDB 5DLML 1NANI 4YDJA 4OFYD 5HGGS 1RIHL 2YMXH 1C5BH 2DQUL 1OSPL 4KK9C 4LPUA 1LDSA 5DJ8A 3MNWA 3C8HA 3EYVB 3KYKH 3MV8D 4YUEH 5EC1A 1ROWA 4ZXBD 4V1DD 5C7XL 3L5HA 1X5IA 4W68A 2B4CH 5DMKA 2QJDA 3NIDE 3I75A 2IEPA 3NH7L 1PG7X 3OKMB 3TYFB 1WC7B 5ID1B 1XCTA 2KPNA 4Y2DB 1UB5A 5H94B 5E9DD 1ONQB 3T0DA 3WXWH 2X89D 4P5TD 2BVOA 3FZUC 3CGTA 2DLTA 3RTQB 1IBGH 3LZFH 1FORH 1J8KA 3RWEB 5BRZA 2A1WH 4OTXH 1I9EA 4I0CC 1S78D 3QT2A 4RGNB 4KRNA 2OQJB 3TCXA 4PJAF 3WFEL 1A7QH 1C8PA 4XPAH 4MWFA 4NBZB 2C3VB 2O61B 5EN2A 4OM0H 5IV2A 3TN0A 4NRZB 2FECI 3H3BC 2ARJA 2VZ1A 1AO7B 3TT1H 2YUWA 2O5ZL 2YHGA 2HG5A 1TVHB 1IGFH 3QDME 2PETA 3VWJC 5TH2B 5IBLD 1LDPL 2WZPD 4GRWE 4HPOH 4L8BB 3PL6C 1TQCC 2E6PA 2C3GA 3CZFA 5EU5A 4ZOEA 4OV5B 1J8HD 4ZUVA 4FQ2H 1HQ4A 4XI5C 1IGJA 3V6BR 1MUJA 4ODHH 4N0UE 4P2OA 3RIAK 1N6VA 1OQXA 4HCRL 3WS3A 1BEYL 4ODXB 1CLYL 3D25B 4PLKC 3CLFL 4WFEE 3WNNA 1QRKA 4I48A 4NDMA 3O6KL 5I8CB 1VGEL 5J1SC 4TUJA 1I8MA 2NY6B 5D2LA 4OCLC 4ODTL 4GRLB 3QNZB 2IANB 4L4VD 4HWNA 5IFAL 1CDJA 4PV8A 3OWEA 2F5AH 3MLTA 2FJHA 1FNSH 3LKQB 4RWYH 4Y4FC 2WBWB 4PB9H 2ZOKA 3RVUD 4M00A 4AEIH 5HJ3A 4YR6A 43C9A 1ZT7A 3B5HA 1E0OB 1P9MA 2DAVA 2IWGA 2DYPB 3LIZH 3KYOA 3MRIA 2RGSA 5EU3B 5IVXF 2FGWL 3WFHB 5C0AE 1OTUD 3HPJA 3WUWG 2HKFH 3VE0B 4NNXA 1YEGL 1CTNA 2VLRA 4Y5YA 1FNEB 4EI5C 1NC4A 5E6IC 5TFSL 3WSQH 3L6FA 2R9HC 4YPGA 4HUVA 4YHOL 1U8IA 1DEEB 4OF5A 5F9WB 1IC4L 3U7WL 4OZIE 5JW4N 4GKZB 3RL2B 1MFAL 5E6ID 3WJJA 5F9WC 2NY3C 4CVZA 1QUNA 5CIPA 5CWSB 2F53E 1W0WA 2Y4SA 1AKJD 4XAWL 3ZE0E 1KFAL 3VGFA 2EH7H 3THML 4ACPA 2VABA 4I18A 3P0VL 2Z4QB 5BS0B 3I9GL 3T0ED 1SEBB 1CFSB 1QOKA 1XGYH 3BH8A 1CLOL 1T0MB 5ACLA 3DVFA 5CEYB 4LASL 4J3UA 3VGDA 5HHNA 3CFBB 3QDMB 1D6VL 5CLTA 3BYYA 4TTGA 1XR8B 2CK0H 4TN9A 4HZLA 4PRAB 1ADQL 3ZSTA 1F4YH 3MPCA 5C86A 2PYEE 4ZUUA 4NCDA 1CICA 1A4JB 4LRNL 3MROA 4MNQA 4OCSL 1G7IB 4RGNE 1IZJA 3BD5A 2F19L 5LGHH 1CL7H 4X6CA 3UTTE 4MS8C 1X4XA 2A73A 1HSBB 1FG2A 5F7DA 4FQCH 2AXFA 3CDFA 2ADIB 3ARGD 5DEFB 5D5MF 3E0GA