4RIRA

Structural analysis of the unmutated ancestor of the hiv-1 envelope v2 region antibody ch58 isolated from an rv144 hiv-1 vaccine efficacy trial vaccinee and associated with decreased transmission risk
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
226
structure length
219
Chain Sequence
b'EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLGGRYYYDSSGYYYFDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH58-UA Fab heavy chain
publication title Structural analysis of the unmutated ancestor of the HIV-1 envelope V2 region antibody CH58 isolated from an RV144 vaccine efficacy trial vaccinee.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 219
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirA01
3VFGL 3O4OC 5CZXC 2X05A 5IHLB 1OAYL 1U8PA 3MRKA 1VFAB 1BFTA 4JREB 4JCLA 3C6SB 1T1XB 1ZT1B 4KMLB 5BS0D 5GS3A 3WHE0 4EIZC 1XR9A 4ZPVA 2V17L 5EOTB 4S1RL 1R0AL 3MJ9H 4QO1A 3BP5B 1WCBA 4PJGA 1S8DB 2VQ1B 4HPOH 1MIML 4K3HA 1XF2A 1CK0L 3DSFL 3RVXC 1NLDH 1QZ1A 4MXWH 4YGVA 5DMGC 5DQ9B 4WEBL 4H1LG 5FOBB 5EBMB 4NRXA 3GI9H 3IJSB 3PL6C 3S5LB 5KOMC 1FFRA 4KJYA 3TH4T 1NEZG 1I1FA 1T3FB 2NY5L 2UWEF 4OCWH 5E8NB 3LDBB 4LFHD 3OPZH 3I3DA 3BO8A 1AD0A 3BPCA 4EI5A 3EYQC 5EIIA 1XCQA 3GHBL 5C08A 3PHOB 4NRYA 1NFKA 2GKIA 4ODHH 2IFFH 4R4NC 3IFPA 4LBEB 3MACH 1JGVL 1YMMA 1WCQA 1S5HB 5DJCA 1AGBA 4M43H 3MLWL 5E5UB 4KK5C 4NHUB 3TBWA 1A7BA 3GSWA 4EN3D 4HULB 3RUGB 2V2TB 2WP3T 3LZFH 2H2PC 3BWAB 3TJEH 3VH8A 4PJ7A 3VFUB 4JM2A 3O2DA 1J8HE 4TNVK 3W11C 2NZIA 4DGVL 5GS2D 4OV5A 5F1NB 5A40E 2BNRA 4DUWA 1IEAB 4MB5A 1KC5L 4WWKC 4O2EA 4X6DF 1R24A 4JLRA 4DEPC 3L9RA 4DGYH 2BVPB 1HSBB 2YN5A 2RFXA 1KLGA 5DHYB 3RDTD 4UUJA 3VXME 3BKYH 1BFSA 4OJFL 1W0WB 1P7HL 4JO1L 5HJ3B 2Y9RT 1P5VA 2P45B 3ZT6A 1FV1A 3ECBA 4G3YL 1UZ8A 1S7VB 2JJUA 2W59A 3EBAA 3K7UA 4G6AC 4ODXA 5D2NA 5I1GL 1NC4D 5K9OA 4B41A 5KANI 3BXNA 2G2RA 4IRJB 3HZVB 1SYSB 4E0RA 1LE5B 4AQ1B 2ICWA 2VLRE 3FT3B 1Z2KA 3WN5C 3QZWB 4S2SB 4MXQC 1J8HD 1UKTA 1ZWIB 2OI9C 4U1LA 5TQ0L 4HUKB 2BVTA 2WSKA 3WIHH 3QDGA 1ZEAH 4OZGE 2F8XC 5KSBE 2VLLB 2B1HH 1QSFA 3I02A 3LKPB 1BOYA 1PEZA 3MRLA 5A16A 4Y2DD 2NXYC 4F7EA 5IR1B 2WNGA 2CJUL 2EEAA 3F7YA 3VXMD 1NFDA 5GS0C 1KUMA 2YWZA 3DX7B 5KVDH 1FRGH 1PYWA 1QPXA 5DSCB 2B2XH 3SY0A 4WI3A 3MV7A 3P4OA 3DTXB 3QUYA 4LKCB 4XBGB 3H7LA 3RIFF 3VA6A 5DWUH 3OR7A 2NW3A 4KKBD 3F12B 4I13B 5DQDL 4DCQB 4O5LL 2CDGA 2IALA 2VLRD 2VL4A 4U6HB 2ILLA 1RIVL 3IKKA 5HPMA 2X7LA 2VIRB 1F4WH 5IEKA 2XWBB 5E6IB 5GJSL 4GXUN 4JPKH 2JB6A 5I8CA 4WUKH 1IKNA 2VLME 4ZUSB 1CE6A 1LDSA 1D5ZA 3ZT5A 4X6CF 4Q9CA 1F6FB 3QFJB 5MEOA 2D7OA 1MCNA 4J4PD 3PNWA 5I66B 3L3DB 2UVFA 1MH5B 4LKXA 3TBVB 5DR5H 4I18C 5EO1A 3G5VA 1ZLWK 3RGVA 3DROA 3DBXA 4EUPB 5IVZB 3GI8L 4XNMA 5BRZE 4EVNA 4Z8FH 1NLBL 4M7JL 5CSGA 5C0RL 1HYRC 3EZ8A 5DRNA 2HYMA 1ONQB 1A3RH 3P0YL 1T0PB 5E56A 4YE4H 4RNRA 4PJBE 3O8XA 2CPCA 1GOGA 1A1MB 3SE9L 4YHPB 3U7YL 4ZFOL 4OZFB 1WWAX 5IW6A 3X11B 4GLRI 1OP3K 3Q6GL 2VLMD 1MIEH 3CFJA 4Y2OA 4UDTA 1WGOA 1A7NL 1NDMA 3O9WD 3PIQA 3IXAB 4ZFGL 2GIYA 1DBKH 4FQCL 4PV8A 4YK4B 3IDJA 4JZOB 1N26A 1AKJA 1S5IL 3PWNB 5EUKB 3FHQA 3RVTD 1TXKA 3WDJA 3X3FH 1FZKA 3TH3T 1DBJH 1RV6X 4WY7L 5BRZD 4FQIL 4GFTB 3GMNB 2J5LC 5DVLA 1DANT 1BZQK 1R5IA 3PDOA 4G9FB 1NGYB 2VXUL 2DQEL 2DQTL 2IBBA 3C9NB 5DK2B 3Q48A 3C6LD 2EDLA 3UJJL 1WFTA 1SY6A 5IVXB 4XPBL 2Y06H 4QY8A 1AD9A 4TRPH 3BQUD 2XNAB 2Z8VC 1BD2A 1T66D 1BZ7B 1H3XA 5E2TH 5CBEA 4Q6YA 3TYFA 2BY2A 4XP6H 2V5TA 2P7TB 3BEVB 2DIAA 3LKSA 2FO4B 1X44A 4D8PA 3DIFB 1IE5A 3V6FA 3DXAB 4JFFA 5F89A 2CUHA 1ZK9A 1CZ8L 2W9EH 4KGJA 3L7FA 4QF1A 3QDAA 1IZKA 3VWKD 5ADOL 5I0ZA 5HVHC 1KPRB 5T1MA 2FO1A 4HV8A 3L6FB 1HI6B 1X4ZA 5EUOA 1K5NA 1N5YL 2P5EE 3BSZL 3EOYG 3WDHA 4OD3H 1N59A 1WUNT 4KRPB 4P2OA 4WTWA 1T0NA 2XACC 4LGRB 5IVOA 4X9IA 2PKDA 5F7LB 2GITB 3EOAB 4HKXA 4X6FB 2K7PA 4EN3C 1E4XL 1C12A 3MNZA 3BGFB 2OK0L 1MAMH 1I9RH 1JVKA 1QRNB 1Z9MA 5DI8B 1KB9K 2H9GB 3HZKA 1QO3B 5I8EB 5I19L 4AJ0A 3AU1A 5T5FH 1G9MH 1Q9WA 1T80A 3MRMA 3ZDZF 1FFOB 1YZZA 4GKNB 4OZIA 3L5WB 4W4NA 1N6QL 1WIUA 2J8UE 5DD3H 1G84A 2JIXD 2P5ED 3OXRA 3RDTC 2YZ8A 1N4XL 1QNZH 1P9MA 2QQKH 2QHRL 3LIZH 3D3VE 3RVUD 3O2VH 3VFPB 5C6TL 3C60A 4YHKL 1HXMA 3NCFB 1JGLL 5ITBH 2I26N 5I73B 2ZCKL 1VFMA 4L9LB 4NQDB 4NO2A 3OR6B 1MVUB 4YDLC 3B5GA 5JDSB 4Z76B 1ZA3A 1T89C 3TPUB 3KS0H 1HHGB 4D9LH 4MD4B 4LSDA 1FE8L 2UZXB 4HJ0D 3O2DH 4ERSL 3RPIB 4PY8I 5IBUB 4KQ4H 4Y2DC 4Z7OE 1ULVA 4YXLH 1ZAGA 1R3JB 1PVHA 3AXLB 1LQSR 3UBXB 1E6JH 4YHLH 2IANE 3ULUF 4YBLB 3T4YB 1G7QB 4O9HL 3O4OB 2QR0B 3D3VD 1AY1H 1SJHA 5H94B 1JFQL 5C7XL 4U1IA 3FQRB 4KKBC 1PY9A 4RFNC 4GMSH 3D9AL 1RZKC 5JR1L 4FMFA 5DJ8B 4NQVA 5FYKH 3RWJB 5MEQB 1DBBH 2GI7A 4Q9BA 3SDXA 2FX9L 1FIGL 3GBNL 2I9LB 4Y4HA 3V4PH 2VN4A 3CLFH 1J05A 2A9NL 3D6GA 2FJFA 5DVNA 2HP4A 3PL6B 1RUPH 4NKDA 4F8TA 2E7BA 4OLUH 4K07A 1YNKL 4NUJB 3PWPE 4PD4K 2IAND 3V52L 2FGWL 4J4PC 3CMOL 4XMLH 4QCIA 1FL3A 4DOHE 4ZXBD 3BGAA 3ZDXE 2X1WL 5ISZE 2CO7B 5E8EA 3FRPG 1EO8L 4XNXL 3KXFA 2F5AL 4XP4L 4JCMA 5EZLA 2AXJA 1MCKA 2VL5B 4XP1H 1A7RH 5KVFH 1Q9OB 3DV4B 3RL1B 1AP2A 2A74B 4WCYH 5B22A 2RBLA 1I4FA 5C0IA 1DE4A 4Z78A 2UY6A 2YK1H 3HI1A 1ZANH 3GMMB 3V8OA 5DXWA 4AH2B 3GEWB 3WHXA 3O9WC 2VO5A 2DDQL 4DN3L 4OGXH 3PWPD 4WWKB 1PZ5A 3TO2A 3WJLA 4YHNB 3WO4B 3SQOH 4ZFOA 2AVGA 4YDVB 3RVTC 1A9EB 4OLVH 3NN8B 5ISZD 1VA9A 5DUML 2UZYB 5E8PA 1KFAL 1QR1A 5DRWB 4L29A 4J6RL 3DNKA 4M7LT 2AERT 4ZFZA 5KSVB 5A2LH 4LSQL 3VW3L 5IB2B 4JAMB 5DLMH 3RWGB 3C6LC 4I0PC 3IJHA 3ROOA 3JWDH 4WNQB 1U95A 2UZIH 2GW5A 4HJJH 4GSDH 1EFXD 5IM7A 4Y19E 3BQUC 3QO1A 1T66C 1ZS8A 3EYFB 1QA9B 1WIPA 2YBRB 1NCAL 4H8WC 1ZE3C 1D5XB 3VFMB 1KV3A 3V0VB 3WS3A 4YO0B 4YHIB 1OLLA 2EDXA 2Y7QA 4KRLB 1DN0B 4HS8H 1QFHA 3LQAH 5DD1L 5F8RC 3V7AE 5IMLB 1XIWA 4XP9L 3FO9A 4RFOL 3VJ6A 3VWKC 2HVJA 4P59L 1X5JA 1G7PB 3OBAA 4KDWA 4X5XB 4GAGH 5DURD 1HZHH 3MGTB 1TFHA 3TN0D 1AXTL 4YHML 5M95B 4R26H 1CG9A 2XN9E 1PG7X 1QLRB 3F7VA 1QHOA 3QG7L 3LN4B 3WL9A 4GKOA 3BX7C 3BUYA 1U92B 5ABDE 4E5XB 4L4VE 4LARL 2X4TA 4I0KA 5IGXH 4Y19D 5D7LB 2FX8H 3CK0L 2MQ3A 2OTPA 4XC1H 1SY6H 3OZ9H 1AGFA 1QYGL 5FDWB 4DVBB 3OAZH 1N3NA 4P0DA 3SKOB 3VRIB 3DV6A 3VFGH 5HHOE 1OAYH 2HG5B 3FT4B 4MWFA 3T0XA 4KUCF 1MJ8H 1DEDA 2VNCA 3ETBF 4NC1E 2V17H 4GT7A 4S1RH 1R0AH 4TSCL 2XN9D 5AWNL 4JFEB 1MF2L 5SX5K 4HUNB 1DUZB 1MIMH 1CK0H 1UXSA 4X7SL 4QXUL 4J3XA 1A6UL 4PRAB 4L4VD 3RY4A 1VSCA 5D9SB 2IAMD 3RVUC 1YYML 4FFZL 3SE3C 5IBLD 4WEBH 4LSUL 4NP4L 1AJ7L 2CR6A 1NFIB 4NN7C 1BVKA 2OM5A 2V2XB 4BK5A 4NFDA 2NY5H 4Y1AB 5FEBA 3LQZA 1X5GA 4XCEB 2ARJA 4X6BA 5HHOD 4JRYA 4QRQA 3GSQB 4I3RL 1BQHB 1YJDC 4GG6A 3GHBH 4HWBL 2GJJA 2P8MA 4HJ0C 4RAVB 4L3EE 3ILPB 1JGVH 3SE8L 1A3LH 4ZS7L 2DL2A 2J5LB 3MLWH 3ALXA 3FQWB 4HIJB 4M5ZL 3HCVA 4L4TB 3T0EE 1A0QL 4BZ2L 2XFXB 2E9JA 4GW5A 2JCCE 1TZHB 2HTKD 1P53A 2AKRB 4OZHF 4O2FA 3C5JB 3SDAD 5KG9B 1MCCA 1J0HA 1W0VA 2VDOL 4XCNB 5I1KL 3MRDA 4PRHE 3BH8A 1RJYB 3TZVB 5GIRB 3C5ZD 3HLAB 1A47A 1N64H 1UT9A 4OJFH 4MQXD 4JO1H 4L3ED 1E27A 4JGMA 3T08A 2LQRA 4OF7A 1TIUA 3H9SE 2HKHL 4DVRL 2A73B 1A14L 5HVHB 3MUJA 5I1GH 3B9EA 5C0AA 2XI9A 4EIGB 3T0ED 2BY0A 2NNAB 4K23L 4WU5B 3U83A 1U8LB 1FVCB 1L0XA 3FOLB 1S7TA 5D5MB 4FTVE 5FYJU 3WFZA 2YD7A 4ZXBC 3WV0A 1FN4A 5EO9A 3ULSB 4RMWA 1S7XA 4OFYD 5TE6H 4OGYL 2APXA 2AQ2A 4PRHD 1WF5A 1CGSH 1ZLVK 4PJIE 2HWZL 4U33A 4F7PA 5IKCB 1A1OA 4RWHA 4QRRA 2CJUH 4RZCB 1JHTB 1MI5E 4YFEA 3WFBL 4KC3B 1CU4L 4M4PA 2EYTB 4YDKL 5KTEL 2BZDA 1V7ML 5KN5B 3P0VL 4OBRA 1XR8B 3H9SD 4IS6A 4PJAA 1GGYA 2EDEA 1HQRB 3VRLE 1QBBA 3UJIL 4BK4A 1H0DB 2MHAA 3GKWL 4DUXA 2L7JA 1EBAA 4FTVD 4O5LH 5DQDH 4BQCA 1DL7H 3MRCB 1RIVH 5BZDB 3F6LA 3KYKL 2V2WA 1KPUA 3G08B 1BEYH 3K8MA 2KBGA 5GJSH 4BSWA 4NZUL 1U93A 3Q3GA 4CJ1A 4JHZA 3ZL4L 1JZ5A 2AP2A 4RMVA 3QXWA 4DK3A 4BSJA 2PTUA 3ZTJG 4BFBD 1MI5D 3AMKA 4KXZI 4YNYA 1J8HB 3K1KC 5ITFB 3S4SA 4ZOBA 5CMAA 1SBSH 3DRTB 3GI8H 3L5XL 1UH2A 2C3HA 3I6KA 3IDNA 1NLBH 4M7JH 5C0RH 4Y2DB 3IAQA 2BMKA 3DI2B 5SWSE 3X12B 3HA0A 4NFBA 3VXMB 2DM2A 3SE9H 4JHBA 1IEHA 3U7YH 3PHQA 1CGTA 4U1SA 2O26U 5IFAL 5GRYA 2X4UA 4NWUL 1X5XA 3BKJL 4PJDE 4HC1L 3Q6GH 4F33A 3QB7C 1NQBA 3TN0C 2ZOLA 2AJYH 1R3LA 4RFNB 1F3DH 1A7NH 3HHRB 2GYSA 1S7SA 4FQCH 2VLRB 3PXHA 4NJAL 5C9JA 1I7ZB 1JGUL 5CJXC 4RIRB 5CD3A 2SEBA 3QXAB 2VLKE 5GJTH 1KLUB 1NFDE 2YD9A 4FQIH 4WTXA 2Y1VA 5INDA 4AQOA 5SWSD 3Q2CA 1AGEB 4TUOB 2Q8AH 4XHJD 1MFAL 2VXUH 2DQEH 2DQTH 2XOTA 2IQ9L 1CDHA 4XC3L 2HJFB 3BDXA 3UJJH 1OHQA 5CCKL 3B6SA 3CDYA 4DK6A 3IS0X 3QUXD 3G6JE 4XPBH 2OZ4L 3WHE1 2XZZA 4JVPA 4LU5L 3SKMB 5GPRA 1FLRL 1VGEL 3QT2A 4ZAKA 5ICXB 3BRDA 2IAMC 5IBLC 5TF0A 4RAHA 5C71A 2HLFD 1KPVA 1UZ6E 4PJ5B 2VLKD 5C0FB 4E9LA 1OVZA 4DW2L 4G42B 2F53E 5D2LA 4G43B 2YPVL 5ADOH 2DICA 1J11A 4XPTH 3O9WB 5EBWA 1ACZA 1NL0L 1N0XL 1N5YH 2JK5A 1G6RB 4PG2A 2NTFA 1OTTD 4K8RD 1FFNA 1KTLB 5K9KA 4RGMC 5HDBF 1FVDB 5TDPB 1R6VA 3TVMD 5BRZB 1YEGL 4NC1C 4BQBA 1MCEA 5HI4C 2Q7YA 3LN5B 3VD4A 5ADPH 1ZHBB 1DCLA 1S7RA 5F1OB 1FBIL 3QCTH 4PJBB 3OKOA 2OK0H 2IGFL 3WJJA 4KMTL 1WC7B 5A1AA 2HTKC 4HWBA 1YN7A 1OB1B 1G7MA 4I0PB 4EJ1C 1KTDA 1EJ6A 2LV4A 3SDAC 4L5FL 2WBJD 4AM0B 2F53D 3QIWA 4HWZA 5JW4R 1MFDL 2BHYA 2CSPA 1N6QH 4IOFD 1JK8B 3C5ZC 5FUOL 1N4XH 4P46A 1HHJA 4MQXC 5HGDB 4PJ9D 1H3VA 3BOVA 3DUUB 1RZ8B 2OTUA 2QHRH 3SDDA 4XXDA 3G6AA 1I7RB 4CVZB 5C6TH 1A9BB 1VACB 4XZUA 1XF4A 4YHKH 2R2EA 3T0EC 3DYOA 4WJ5B 5FO9B 2EC9U 2ZCKH 1I3RA 3GSRA 3HZMA 3NA9L 4PJHA 1R5VA 1QBLL 2K9UA 3KPRB 3JTTB 4NM8L 1N2RB 3ZO0A 3HAEA 4CJ0A 4C59B 4ERSH 2R9HD 3GIZL 2FJHB 5SWZA 5DQJA 1UJ3A 3O11A 1VGKA 1OGAE 4HS6A 2P8LA 3MC0A 1DEEB 2XKSA 3FN3A 4JO4L 1KN4L 4MNQE 2X9WA 1J7VR 5EO0B 4O9HH 4UV4H 2VUYA 2ZSVA 5DMIL 2Z92A 3CH1A 1KLFA 2ATPB 5FXCH 1D6VL 1JFQH 5CJBA 5C7XH 3IS1X 5MHSE 2EE2A 4M7KL 3KS0J 4I4WA 5HYJA 5JR1H 4LHUG 2X4NB 4ZYKA 2DQCL 4DKDC 1I3UA 3IDYB 1EK3A 1FZOB 1ZT7A 2FX9H 1FIGH 3MLZL 4GH7B 4LGSB 1VPOL 1J12A 2A9NH 3C87A 3VDCA 5EIQA 1CD1A 4PJFE 4X6EB 4XGZA 4NN7B 3WLBB 3W2DL 1FP5A 3BVNA 1OGAD 3LV3A 2EYSB 2E8ZA 3EO9L 2FGWH 4MMXC 3V52H 1DSFL 4MNQD 3D1MC 3K8LA 2CDEB 5EC1A 3J7HA 4IMKC 3JWOH 4LCCC 4X5WA 5LWYH 4UDUB 2NY6D 3TBTA 4PGDB 2VXQL 1EO8H 2J8UB 4AEHL 5MHSD 4XP4H 4XNXH 1PGRB 2F5AH 3N1GC 4A6YL 4X7DC 3BGMA 4U6VL 2AJ3A 4NKMB 4R8WH 1XGRA 3OHXA 4UQ2B 2NW2A 4ONHB 4EI6B 4N8VG 4Y8DC 4AENA 4OF8A 1HH9B 1QD0A 1IGJA 1WAAF 4HFUL 4MAYD 4RDQF 5HHPB 3U2SA 4NBYB 3GMRA 2DDQH 4DN3H 2NTSP 3D85A 4XPFL 1KG0B 4F2MA 3QNZB 1C5CL 3DX9A 4FXKA 1Q9LA 3DVIA 1MJUL 3AAZA 3F62A 5JTWA 1NMBL 3FQTA 5LJYH 4OIAA 2BRRL 3LRSA 4CDGC 2PETA 4F7TA 2W0FA 3KNBB 4J6RH 2OJEA 1F4HA 5B39A 4XHJC 2IANB 1NGXA 4ODSL 5D1ZD 4LSQH 1W72L 3VW3H 3K3QA 1OQOA 4DQOL 4JKLA 4IMLA 5E00B 1CICB 3K0WA 3QUXC 4O2CB 2JJTA 4M61A 5L2KB 3SGEH 1WZLA 3BESR 3GB7A 1NCAH 4P23B 2YA0A 3MJ6A 4U0QB 5CBAA 1MHEB 3BZEA 1RJLB 1QLEL 2XWTA 4NQCA 5LGHL 2L4OA 5DD1H 1I9EA 2HLFC 3R1GL 4XH2B 1EUTA 4U1HA 3EAKA 4RFOH 3FFDB 4P4KD 3P4NB 2YPLA 4P59H 4ZNEA 4U49A 3O3EB 3KLAB 4ZUTB 4HUXA 5GRXG 4P5KA 2WINB 3KR3L 1AXTH 4YHMH 3BZ4B 1D9KA 1A6TA 1OTTC 4K8RC 4DOHB 3QG7H 4P9HC 1Q72H 3CFBB 5ISZB 3LB6D 3G9VA 3TVMC 4LARH 3FCTA 3MLRH 4E42A 1GPOL 4G6ML 1YQ2A 5TH2B 5HYSB 4U1MA 1WFNA 2IJ0C 1T04A 2DL9A 1HSAA 1MJJB 1I3GL 4CADB 2HMID 1QYGH 2AV7B 2NY2B 2W92A 2K3TA 3G5XB 1K9TA 2WBJC 5GZND 3C8KB 3LD8C 3OGCA 5AUMA 3WUWB 1NCWL 2VKXA 4LEOB 5F88A 1XGUA 4JGJA 5FKPA 1TNNA 4IOFC 7CGTA 5D1XA 4JRXA 4R7NB 5HY9B 3TLRA 3BN9D 3FB5A 5FYJE 2IH1B 5DA4A 1MF2H 2P1YA 5IMKB 5FM8A 1DUYB 1A6UH 2VAJA 5CJOL 3S37X 4HW6A 1YYMH 4FFZH 2EXYD 3DX6B 1S9KC 1J5OL 3SE4A 2Z91A 4LSUH 4NP4H 1AJ7H 1VFBB 2DKUA 2AEWA 3FB6A 1MCPL 3FHAA 3TN0B 3Q5YA 3UAJD 1JV5A 5B38B 1K8DA 2DTML 4I3RH 4HWBH 4X80L 3S96A 1B0RA 2F19L 2YKLL 2R9HC 1RURL 4MVBD 3SE8H 4UIMA 4ZS7H 5FYJD 1KXVC 1BJ1H 4QXTA 1QBAA 2MPAL 1A0QH 4BZ2H 2EDFA 2DMCA 2IC2A 5DDHB 4UBDD 1F4YL 1MRFL 4YPJA 3H9HA 3ARZA 5EG6C 1XAUA 5TE7L 3CFDB 2ADIA 3LEVL 4L8SA 1W0YT 4QOKA 3O81A 5DD6A 2VDOH 5I16B 3U4BH 5CHNA 1IGTA 3P9LB 5E24E 2ESVB 4TUJB 1B4JL 3D5OF 2EZ0D 2HFEB 4V1DB 1EH9A 1KT2A 2QL1A 1S9XA 3DMMD 4H5SB 2AJUL 1YY8A 3V5KB 3TH2T 3FB7A 4K55A 4P3CH 3RZCD 3ESUF 4M1GH 1JPGB 2HKHH 4DVRH 4WW2B 3B8SA 2E7CA 3HAEH 3QDMA 2R0LL 2IADB 4K23H 1I8IA 3HN3A 4UT7L 4OM0L 1U8IA 3QRFM 5JHDD 4JFOB 3FQUB 4ODVL 1P84K 2NLJB 2NY6C 4MJIB 1IGML 1YEDA 3LS5L 1A6PA 3P4LA 1HH6A 3L3IA 4PTTB 1C5BL 3SO3B 4P5TB 2A1WL 4LCUA 1DQJB 3S35X 4OGYH 5ESAA 2ZWLT 5GSRB 2NY5C 4PR5A 2HWZH 3O41B 4C83B 2P8PA 3QNXB 3TO4D 4Y5XA 3WE6B 1NBYB 2MMXA 1OF2A 4NO0A 2WWMD 3WFBH 4J1UB 1CU4H 2BX5A 4N8CL 4A6YA 2R56L 4MAYC 3PABB 1JPSL 3P0VH 2ZPKL 3LEXB 5DGRA 1CGXA 1F45A 4OTXL 2CMRL 4LCWA 5D1QD 2ZOKA 3UJIH 3PP3H 4O00A 5FYLE 1CI5A 2X42A 1I8MB 2I27N 2Q8BL 4PGBA 4QT5A 1MUJA 1MLCA 1LP9A 1Z3GL 3AY4C 4HDIB 3ZL4H 3MMEB 4LCIL 4UTBL 3UO1L 5D1ZC 3MCKB 3PQYE 5DJYA 3T0EB 1JRHI 1QPPA 4Z7WA 2AV1A 4FQJL 2P46B 5EU6A 4L3CB 1FAIL 1MCOL 4DTGL 4PJCB 1PKQA 2V7NB 3MOAL 2QADD 2YMXL 2V5RA 3L5XH 4LVHC 4PRHB 2XA8L 3MV8A 4F58L 3QUZA 2CLVB 1SEQL 5GGUA 5IB5A 4APQA 5I1AA 1TJHL 5FYLD 1INEL 5DJDB 3T1FA 1U8OA 4X8JB 3WEXB 1JNHA 1I1YB 5JHLL 4U3HA 3RWIA 2FIRT 2P48B 2XZQL 4P4KC 2F8OA 5IMOA 4CU6A 4HT1L 5IFAH 3BKJH 3CX5K 3MRKB 4JHWL 1KENL 4ZPTA 1KOAA 5DMKA 3PQYD 5BV7C 3VGAC 4YR6A 2P5WE 4I48A 5EZJB 3VFWA 3LB6C 2F8VA 4PJGB 3C08L 4NC0B 3F8UB 4BYHA 1JGUH 1MCJA 4JQXA 1XF2B 4WU7B 3I9GH 5JUEL 4YGVB 2HMIC 4TULL 1A5FH 3VXRE 1A6AB 1F4XL 1T83A 1MFCL 4NRXB 1P7QA 3QJHB 3T2QA 3S3JA 1MI5B 3MNWA 1MFAH 5GZNC 1I1FB 2IQ9H 5ALCL 4XC3H 1JF6A 1K6QL 3MROA 3BO8B 5JPNB 4LCCB 1AD0B 3BPCB 4EI5B 1LK2A 3L95A 5CCKH 3MZTA 5C08B 1A64A 3BN9C 1J86A 3MJGX 3GMPA 2IWGA 2YUVA 4IRZL 2P5WD 1FLRH 1VGEH 1EIBA 5DJCB 1AGBB 5T3XL 3QFDA 2LTQB 5TFSH 3GSWB 1UENA 2EXYC 1LE9B 5CSBA 2ZKHL 3MR9A 5FGBA 3QI9A 4RMUA 3VD3A 3VH8B 4DW2H 4PJ7B 4E41E 4JPVL 4PGCB 3VXRD 2YPVH 4PV9B 3UAJC 3I75A 1NL0H 1N0XH 3Q5TA 2BNRB 3R8QA 3P9MA 4O2EB 1BIIB 4JLRB 4MDJA 3L9RB 4X9GA 3QEHA 1DVFA 4G9DB 3KDMA 1G7HA 3BRGC 3FFCA 2QSQA 4MVBC 1YEGH 1GC1L 1TJGH 4RMTA 4PRPA 3A67L 4LEXL 2VAAA 2FLBT 1JHKH 4PIRF 3UTQA 1FV1B 1FBIH 2CRZA 3ECBB 2IGFH 1UZ8B 4KMTH 3MLYL 4ODXB 4UBDC 1JPFB 1FG2B 5D2NB 1X5AA 3MUGB 1TQBC 4L5FH 4PJDB 4DKAA 1JN6A 2H41A 2ICWB 4E41D 4C56A 4Z95L 3VXOB 5B8CA 1H8NA 1S7QA 2DWDB 3RWEA 4OB5L 3QDGB 2OTWB 2EZ0C 3I02B 1YEKL 4GW1B 2WAHA 4FQHA 5FUOH 3DMMC 5BJTA 5A16B 4FXLA 4JKPL 2N56A 3HE7A 4PUBL 4F7EB 3F7YB 4YWGL 1YEIL 3NFSH 1NFDB 1XIWC 2CLRA 3RZCC 2OCFD 3TP4A 3JV4A 1PYWB 1CXIA 4KXZH 5JW5A 3T3ME 1OGTA 3P4OB 3G04A 1K3IA 5IB4A 3NA9H 3DGGA 3OR7B 2NW3B 5K9QG 3WNMA 3NTCL 4LAJH 3S5LG 5GGSA 1YN6A 3L1OL 3TVMB 2IALB 4HFWA 1MQKL 4B7IA 5HPMB 2X7LB 3OSKA 5CJQL 5IEKB 5JORA 2JB6B 3GIZH 3M17A 1GIGL 3QH3A 4GRWE 3TO4C 3DECA 4C55A 1QVOA 3IGAA 1ZGLM 2ZSWA 2WWMC 2FL5A 5HBBA 4PJEA 43C9A 1KN4H 2AW2A 2OL3A 3OL2A 4S11A 4BH8A 2XTJE 3PNWB 5FF6A 2BDNL 2Q86B 1OAZH 2H2SD 4LKXB 5D6CA 4F3FA 1D6VH 5EO1B 1D5MA 1YEEH 5EU4A 4GS7C 3DROB 5LAXA 3DBXB 5D1QC 4M7KH 4XNMB 5TJWK 4MJ5A 3HNVL 3H0TA 1T03L 4QHLA 1WTLA 3TV3H 3FO1A 5IOPA 4QTHA 5C0DA 5DRNB 5FO7A 3MLZH 4RNRB 3FZUC 1P6AB 1VPOH 1G0DA 5IMMA 4OZHA 5IW6B 4MCZA 2WQRA 5F7HA 4M3KB 1A8JH 5ACZA 3W2DH 3W9EA 1IC5L 3A6CH 3CFJB 4W4OA 1DSFH 4X0KB 4UDTB 1NDMB 3PIQB 5BOPA 4NQUA 1ZLSH 1V3KA 2FSEB 3UMTA 2QADC 2XTJD 3WMSA 1KCUL 1FO0B 4XNYL 2E6JA 1AKJB 2VXQH 4AEHH 1ZVHA 3AB0B 4A6YH 1TZIA 1T4KA 1FZKB 1ADQA 1CE1L 4BQ9A 2OSLA 4CMMB 3EOBA 4EDXA 1U3HA 2FX7L 1OSPL 2ZJSH 3MLSL 3IXTB 3PDOB 5FK9A 3MJ7A 5HHQA 3PJSA 1WISA 4J2XA 1BF2A 5CEXA 3QAZC 5A2KH 4HFUH 1KCLA 4XPFH 3UXFA 4QY8B 2DQFA 1BZ9B 1M71B 1C5CH 1BD2B 4R96B 2I5YL 5I9QC 5SWQB 3TYFB 1MJUH 1ACYL 1BREA 1FYTA 3P0GB 1NMBH 3E2HC 5ECJE 5INCA 3WFCL 1YPZA 3PDGA 1XF3A 1QHPA 4OFKA 4CNIB 2UWEE 5T1KA 3RRQA 1KELL 3QWRD 5JW4M 2WV3A 3D48R 1EUUA 1P6FA 4ODSH 3QQ9D 5T1MB 1U9KA 3CPLA 4HV8B 5AYUH 4RFEB 1BX2A 5EUOB 1K5NB 5D4QA 2APWA 3IAPA 3O6KL 5CP7A 3UTZA 1WLHA 4YHYC 1N59B 1IBGH 5AD0B 4RGOL 1WBYA 5DT1L 4IRSA 4KUZH 4TYUA 1FH5L 1QLEH 2IQAA 5LGHH 5FV2A 3L3GA 1C12B 3MNZB 1I7UA 4EUPG 3DETD 2BSRA 2DD8L 2NYYD 2XXCB 3O6FA 3HZKB 4PJFB 1LVEA 1KIUA 1EMTL 1L7IL 1MFEL 4X6DE 4FQ1H 3AU1B 4Y16D 1Q9WB 4LHUD 4KVNL 4U4BA 4Z9KB 3KR3H 2CK0L 1F8TL 2MCG1 5C09A 2BFVL 4AIOA 4PREA 3QQ4A 2YPKA 3OXRB 2Z93B 5IB1A 1TCRA 4R2GD 1GPOH 4G6MH 3ARTA 3S37L 5B3NA 4NM4L 5D1ZB 1BBDL 3C60B 5E5MA 3QEQA 2A6IA 3PUCA 1OAUL 4AT6A 3WS6A 2BVOB 4NO2B 5DFVD 3W0WE 5F71A 2WLZA 1NCWH 4WGWB 1MEXL 3G5ZA 2X5PA 1M7IA 2QKIB 1GJIA 4ONOA 1X5FA 1ZA3B 2HFTA 1JBJA 1RFDL 4MDIA 2AJSL 4QXWA 2HRPH 4JFDE 5T3ZE 4D0CB 1WBXA 4KPHH 3KAAA 5IIEB 4FG6D 2AS5M 3NMEA 2EC8A 1EEUA 1VADA 4JPIA 5CJOH 3FO2B 4P4KB 1J5OH 4Y7MA 5IESL 4S10A 1RUMH 3JV6A 4LLYB 1ED3A 3HUJF 5KS9A 1SJHB 2B4CL 4MB3A 3DYMA 4WI7A 3P30L 4WI6A 3VGAB 4ZUWA 1JF1A 4TN9A 2DTMH 3W0WD 4NQVB 3LPFA 4X80H 5H2BB 5ESQB 3SDXB 3ARXA 3NIDF 1GOFA 4Y4HB 1RURH 4X6CE 5EPMA 5IFJA 3B4NA 2BSED 1J05B 4JFDD 5T3ZD 4PRIE 3I85A 2FJFB 1UB5A 2BSTA 4RMSA 5F9JA 2MPAH 1G9NL 1N8ZA 4XAWH 3EJZD 1F4YH 1ERNA 4QCIB 2H2SC 1FL3B 4UU9B 5IJVA 3LEVH 1OSZA 1KEGL 5E8EB 2NY4D 2PCPA 5JO5A 5I17B 4P2QA 1P4BL 3MRJB 1QLFA 1QFWI 3VFSA 5ANMA 5CKAA 1H15A 3S35L 4ZAKC 3ARFD 4I3SL 2AJUH 1VESA 1ZLUK 1NGPL 3V6ZA 1I4FB 1OAXL 3NFPA 5C0IB 3MRQA 1DE4B 3NCJL 5DS8A 3MA9H 1YECL 4PRID 2VXSL 3U9UA 5HGBA 1U8HA 2R0LH 4X8XA 5KZCD 4ZOEA 4HXBH 4UT7H 5E2UL 4OM0H 4JKMA 5H8DA 1JWSA 4AG4L 2XTJC 1PZ5B 3TO2B 4ODVH 4ZFOB 5I1CL 4G80B 4G8GA 2OL3H 1IGMH 3LS5H 2PUQT 1C5BH 2IMNA 5F7YC 1J0YA 1W8OA 3Q6FB 4C58B 3I50H 5C8JA 4L29B 1HHIA 1TTFA 3CVHL 4PJXF 2J6EL 3KG5A 4ZFZB 1NCDL 4J12A 2AJZA 4M7ZC 4N8CH 5I30L 5IBUG 3HE6D 5B3JF 3IJHB 1JPSH 3ROOB 3DWTA 2ZPKH 3FAWA 3LQMA 1PDKA 1ZT4A 3SDCD 3UBXG 1A6WL 2R29H 1T22A 4AL8L 5EA0L 4OTXH 2CMRH 2CDFA 1G7JA 2FYYA 1MY5A 2C5DC 1FZMA 4ELKB 1TTGA 1MWAL 5ACLA 3D0VA 2AEPH 2AK4E 3TF7C 2FHBA 2R23A 2Y7QB 3KPNB 1HILB 4G8FA 2VR9A 4OAWA 1XIWB 1QSEE 1Z3GH 1AGDA 3RZCB 4GBXA 3FO9B 5B4MD 1DANU 3VJ6B 2JF1A 4L8BA 2D0GA 2HVJB 3UO1H 3QQ9C 2DQDL 1N6VA 1ADQH 3LSOA 1A7OL 3ULVE 4WHTB 1T2QL 4QGTA 4FQQA 1FAIH 4JDZA 2Z35A 3OKLA 3F7VB 3NIFF 1MCOH 1RIUL 4DTGH 4UAOC 3A6OA 4Z77A 3OX8A 1CVRA 3MOAH 1IILE 2YMXH 2X4TB 2I25N 3FTGA 5E6ZA 2FBJL 3LEYL 1NANH 4YHOH 5C0CE 3OAUL 4M02A 3EYOB 2GJ6A 4F58H 1SEQH 4PJGF 1S3KL 1TJHH 3B8YA 3GSUB 5I71C 3DETC 1AGFB 4H25B 1INEH 5C0JA 2AK4D 3ZDZE 1AC6A 2NYYC 1N3NB 4HCRA 3M1BA 4XCFL 2Z8SA 2XZQH 3DV6B 4HT1H 1RULL 4FQ2L 2X1OA 1QSED 1RJZB 4P9MH 4Y16C 3LN9A 2F58L 4L1HA 2PO6A 4MWFB 4GS7B 5D1QB 4YDIL 1CFSA 4MA1C 4MQ7B 4Y5VA 3ULVD 5HGAA 2PW2B 1HN1A 4LSPL 2ZG2A 1FNAA 4R2GC 5DEGA 3TA3D 4P2RE 1E0OB 1TITA 3FRUA 1KIPA 3FB8B 3DO7B 1UXSB 3GJEA 3KYOA 5BW7C 3GGWB 5ID1B 4MNHB 3VMNA 5JUEH 2QJDA 3QA3A 1WAAA 1H5BC 5C0CD 4J3SA 4TULH 1R5WA 1F4XH 3JUYA 4WHYH 1MFCH 3T8XB 1RK0A 3WXWL 2C3GA 3ARBA 5DFVC 4R0LA 2ID5A 5F3BA 5TQ2L 5ALCH 5T1DL 1A1NB 2DTSA 3CFEA 2DM3A 4WDIA 5CIPA 4PJ7F 5BVJA 1K6QH 1KIRB 2QADB 4JM2F 3DVFA 4X6BB 4JRYB 4QRQB 3SBWA 1QFWL 4GKZA 1AFVL 4M00A 1YEHL 2ATKA 2BC4B 3ULUE 1PX4A 3ARGD 1PG7W 4CN6A 4IRZH 1RHFA 3QIBD 4RCAA 3T0AA 5IHUL 4NN6C 3HCVB 4P2RD 5FO8A 4K3GA 3MLXL 2ZKHH 4PRNB 4GW5B 5IB3A 4HUWA 3QAZB 5IHZA 1Y0LA 4JPVH 4B7LA 3A0OA 3UPAA 5FA3A 1EAPA 4U6XA 3OJDA 2F5BL 1I9IL 1W0VB 1C5DA 5I76A 5FV1L 3DVGB 4BZYA 1SJEA 4IIQC 1AQDA 3EOTL 2E6PA 4Y89A 1KCVL 1I8KA 3E2HB 4ZO7A 3UTSA 5I74C 3GIVA 1IAKA 1N5AA 4HGWB 5IJKC 4LLQA 5IUSA 3A67H 4LVOB 4N1CA 4LEXH 4Z7VA 3ULUD 4KJWD 2JELL 1C8PA 5DJ2A 2WMPA 2R1YA 3IVKB 4RX4D 3MLYH 3T0WA 2VLJA 3EJZC 5FGSA 4JFYA 2DRUA 2R4RL 5GS1C 4JN1L 1S7TB 4I2XA 3TCXA 1FN4B 3GKZA 2FJGB 5AG9A 1OD9A 5DRXB 2NY4C 4Z95H 1S7XB 2JJTC 4Y4FD 5KSUB 1QKZL 1UYWL 4XVSL 4OB5H 2P5WB 5IK3A 4CVWA 3VFOB 4I77H 5F7WC 1X5YA 5DJZA 3BP4A 3ARFC 3MRBA 4WV1A 4U3XA 1E4KC 4X7CC 5C0BA 1KCRL 1UACL 4JKPH 4Y4KA 4X5LA 2ZNWA 4ZD3L 4PUBH 4QRRB 1AO7A 4YWGH 2G5BA 3W39B 4CAGA 1EEQA 5JA8B 4BKLA 3VXRB 4DZBB 3U0WL 3PGCA 5D7IF 5DUBB 2X4OB 2H3NB 2KZWA 4IS6B 2VERN 3MFFA 2H26A 2R2BA 1KJVA 4PJAB 1CFBA 2KL6A 1OLZA 3E6FA 2ADJB 3MGAA 4AEIH 5J13C 4AIZA 1CDYA 3NTCH 2MHAB 4CKVX 3CFCL 3RP1A 3G5YA 4ALAL 1PBYA 3MRNB 4NSKA 5C07A 2V5MA 1MQKH 5TE4L 2V2WB 2FDBP 5F3HA 1QG3A 3UYRL 1ORQA 4BSWB 5E8OA 1GIGH 5FGCE 1BQHG 3Q3GB 2C1OA 3MLTA 4F7CA 1ITBB 2A6KB 4I5BB 3HE6C 2VQUA 2E7MA 4YNYB 3SDCC 2BDNH 2ITCA 3RBGA 4N0YL 3S4SB 4LPWA 3KPSE 5CMAB 3V9FA 4ZG1A 2J6EA 2XRAL 4BFIA 3I6KB 3HNVH 3IDNB 1T03H 2HFFA 5JPMA 5GGRB 3WSQL 2BMKB 4XTRD 1KJ2L 3QJFA 2DJUA 3SJVA 4HIIA 4N5ED 5B4MC 4ZDHA 3OKMA 2J8OA 4D3CH 2X4UB 3OKKB 2HH0L 25C8L 2VDLL 1MWAA 1PZUB 3DVNA 1EVUA 5F9AC 3N1FC 3BEWA 1S7SB 1INQA 1ZXQA 3SO5A 2PYFB 5CLWA 1Q0YL 1KCUH 3E8UH 1EXUA 4XNYH 5SX4I 3B9KD 1CDJA 1CDIA 4M62L 3KPSD 3X14A 5IF0A 1CE1H 4X99A 2ZNXA 1UA6L 4YH6A 1TPXC 3VXSA 5ELIA 2FX7H 5INDB 3HNTL 3IDXH 2BVUA 1OSPH 3MLSH 4RRPG 4FNLH 1GHFL 4XVTL 3CXDL 1A6VH 3MLUL 5KJRL 2J3SA 4LOUD 1JWMB 1I85C 4NZRL 5EUOF 5TDNA 4KI5E 4Z7NF 5JIHA 5IV2B 3FJTA 2I5YH 2V5SA 5DO2C 1GAFL 3TA3C 1XZ0B 1ACYH 4ZAKB 1R3HA 1QBML 1KJ3L 4HGKC 3WFCH 3FOMA 3RUGE 3QIUD 3MTRA 1JHLL 4GRWB 4C4KO 4ZO6A 1KELH 3QO0B 1JTOA 2H8PA 2ZUXA 2FNBA 4OIIL 2J1KA 3NGBC 2UVEA 4KUCD 2PYEA 3O6KH 2NPLX 5FOJA 4HCRH 3ARGC 4OZIF 3BPLB 4WENB 4RGOH 5DT1H 4ZSOE 1BP3B 3Q5OA 2Q7YB 3P2TA 4KI5D 5KAQG 3QIBC 4HZLA 1FH5H 1IAOA 2F9BT 1WT5A 4HBCL 3GJFA 4MD0A 4M7ZB 2DD8H 3CZFB 1YN7B 4PTUA 2YC1A 1EMTH 1KTDB 1MFEH 2FATH 3FONB 3UTTA 4GXVL 4KDTC 4KVNH 4HWZB 1V7NL 3MNVA 2X2YA 2CUIA 2CK0H 1F8TH 4F37F 2BFVH 5JQ6L 4JKKA 2VABA 2EDKA 4XVUD 2X4PB 1L6XA 4KKCD 4YFDB 3WIFB 3VFNA 1FNFA 3O0RL 4JE4B 4P46B 3G6DH 3ULUC 5CIPH 1NLDL 4HEME 4KJWC 3TIEA 2OTUB 5GSVB 1BVZA 3GMLA 1FNGA 2WQ8A 3B2VL 2E7HA 3SDDB 3S37H 4NM4H 1BBDH 4XZUB 1XF4B 2R2EB 1OAUH 1JYNA 4NQEA 1BPVA 1IMHC 2P24B 1I3RB 3GSRB 2GSIA 1MEXH 4PJHB 4R3SA 1U3ZA 3OXSA 1RFDH 4Y4FC 1WZMA 2YHGA 2VTFA 2FZ3A 2OP4H 2WBWB 3HAEB 2IFFL 3MACL 1FC1A 1PQZA 4LLDB 4M43L 5I71B 2AK1L 1LEKA 3O11B 3THML 1VGKB 3OAYK 4APQC 5IG7B 3BZFA 5J1SC 4OV6F 2OS7A 1MAJA 1HQ4A 1KTKE 3C09C 1SBBA 1IT9L 2ZZUT 3QFJE 3SGJC 1WTGT 1T6VN 4LHUB 4YAQA 2ZSVB 4NO3A 4Y5YC 1NMAH 5E1AA 3CX2A 5D7JD 1KB9J 4HAFA 3GSNL 5EU3A 3P30H 2Z8WC 2ZG3A 5D72L 4CBPA 1YDPB 4HK0A 1NC2A 5HYJB 3AM8C 4ZYKB 1LEIA 4R2GB 4NYLA 4Q2ZB 3S36L 3KPPB 4F9PC 1Q94A 3INUL 3TBYA 2D2OA 3S34L 1BVLB 1IARB 3OF6D 2P49B 3FMGL 5DZLA 1QSZA 1H5BB 3ZYZA 5E6ID 1CD1B 4QHMB 4IOIB 5I2IA 3LKOA 3BVNB 1Z5LB 3T0DA 3U0PA 4L9DA 2AQ3A 1G0YR 5T3XE 4X6DB 3QFJD 1YEFL 2IMMA 2CLZA 1B6UA 4X5WB 4OUOA 4ZQKA 5IROA 1KEGH 4N8VB 3SQBA 1ZEAL 3QUML 1P4BH 3RAJL 3EO0A 3ARDD 1MQ8A 2FECL 5KSAA 5AEAA 3QUKB 4XTRC 1BFOA 4IRSD 4WO4A 1JL8A 4JDVA 2NW2B 1HXYA 4M93C 4I3SH 4N5EC 3GRWL 4AENB 1NGPH 5JHDE 1OAXH 3R4DA 5BZWA 2C1PA 3NCJH 1J18A 1FRGL 5FM5O 4LSRL 4JFXA 1YECH 1FYHB 4XNQA 4RISH 5K59F 2VXSH 3X13B 3FAXA 3U2SB 5DGQA 1KJ2A 3GMRB 1LEGA 4F2MB 4R97C 4AG4H 5FAAA 5T3XD 5CJ5A 1KYOJ 1T1WA 4FXKB 1LO0H 3QXDA 2E9IA 3B9KC 5I1CH 1SQ2N 4PJ8A 3FQTB 3CIQA 4F7TB 2W0FB 1Q1JL 1LGVA 3OV6A 1ZA6A 1RUQL 3H42H 2BY1A 5JW3H 2OJEB 2J6EH 1NCDH 1NGXB 3JVGC 4BFEA 1C16A 1AC0A 3EJJX 4QHUB 3V5DA 4IMLB 1EO7A 5GS1B 3QDHA 5I30H 3GBML 4LCYA 4UT9L 4UTAH 3RNQA 4LOUC 3CSPA 1BQLL 2NY4B 4K94H 3U30C 3QRGL 1A6WH 3BYTA 4PD4J 4OUUB 4M61B 4AL8H 4RBPH 3BISA 5EOQL 1NMCC 1MWAH 3BZEB 2KQMA 5BXFA 2Q1EA 4YE4L 1XGPB 4ISVB 3WNOA 3QIUC 2WANA 1J0KA 4QRPA 2OR7A 3CDGB 4MNGA 2DM4A 2Q76B 4U1HB 2V7HA 4PRIB 3PWLA 5E7FA 3FT2A 2YPLB 5KSBF 2DQDH 1U8NA 1MIEL 4HUXB 2BOCB 1A7OH 3KLHD 2EKSA 1M1SA 4P5KB 1T2QH 5MENA 1A21A 3MRHB 2WBKA 1RIUH 3W9DB 3MOBL 2HJLA 5I1DB 3MBEA 2JJSC 3DRQA 3X3FL 5FHBL 3U4AA 1W8NA 4KI5C 2WUCH 3OAUH 3OJ2C 4U1MB 1LDPL 1DQDH 1S3KH 2DMBA 1HSAB 3MLVL 4W68A 2DJSA 5EB9A 3KYAA 1RULH 4FQ2H 1T5WA 3IFOA 5AUMB 4JFZL 2F58H 4M4RA 5T1LA 3SGKA 1RSFA 3GSVA 5F88B 4BUHA 1UCBH 1XGUB 4YDIH 4TRPL 3UROR 2Z31D 1A4JA 4XVUC 2V9TA 4JRXB 4KKCC 2XWJA 1S9YB 4LHQB 4LSPH 3VG9C 3BI9X 1T1ZA 3UBXI 4JO2L 4GG6F 2A0LD 4XP6L 2G9HA 1NBZA 2Q20A 2NX5A 4R4FH 4Q6IC 4ELMA 1QOKA 2E7LA 1TJIL 2X4RA 2Z91B 1AGCB 3I3BA 8FABB 5A2JH 2BNQA 4XNZB 3WXWH 3FB6B 4MHHI 2C9AA 1GGCL 3BKML 5TQ2H 1ODAA 1JV5B 3QEUA 3RIAF 3O2WL 3RJDA 4PLNC 1G1YA 4M1DL 1QFWH 2AQ1A 1AFVH 3GJFH 1YEHH 1OAQL 2Y5TA 2PTTA 5IW1A 2JE8A 3S96B 4XWGL 1MFNA 4HWEL 5CEYA 4J3WA 1MCHA 1TPXB 1BJ8A 2AK4B 4PLOB 5IHUH 1BLNA 2RB8A 1I9RL 3QISA 5GGSY 3MLXH 2JLLA 1OARL 1ITCA 2J7LA 1LD9A 3K4AA 2X10A 5BCAA 3H9HB 4P2CG 5CZXD 5E6YA 5D7JC 5HTSA 2F5BH 5D6DC 3OB0H 1I9IH 1VFAA 1QUNA 4QOKB 5DD6B 1FAKT 1T1XA 2MWCA 5CHNB 1IGTB 3MV9A 1MCBA 1S9WB 5L2JB 3FO0L 4O51B 1CGWA 2F54E 4GRLD 3EOTH 1KCVH 5A43C 1AIFB 2VDRH 1QNZL 3OG4B 3ZSSA 3BP5A 1S9XB 4HWUA 4C54A 2QQKL 5C0CB 4UIKL 3FB7B 2JELH 3O2VL 2GAZA 1IM9A 5DQ9A 3NA4A 5D93C 1NDGA 3WDIA 3QDMB 1CBVL 5ITBL 4MJ6A 3NGBB 3IJSA 5HYSG 3S5LA 1I8IB 4D0BA 4MA3B 3EHBD 2R4RH 4JN1H 5D8JL 1UB6A 3AROA 4P3WA 3BN3B 4KTEH 5E8NA 3MUZ1 5CUSL 3D18B 1YEDB 3ARGB 5I1IL 1HH6B 3WO3B 1QKZH 1UYWH 3ARDC 4XVSH 3B9DA 3CXHK 3BWUC 3WUWG 4IRSC 5ESAB 3QIBB 1RY7B 2W91A 1UQSA 2IBZY 4H26A 3T65B 4PR5B 1KCRH 1T6WA 1UACH 2F54D 2P8PB 4LBEA 4Y5XB 3ALPA 4ZD3H 5DFWH 1MAKA 4A6YB 3QUMA 1NUNB 1I3VA 2X4SA 2Y07H 3VFUA 1CVSC 5CEZE 1T0MB 5MP6H 3GRWA 4LCWB 2ZOKB 1MCIA 5F1NA 5FYKL 3CFCH 4DKFL 3OQ3B 1DBBL 4ALAH 4YK4C 1RIHL 1RUAL 5A2IH 2BOBA 1JNJA 5TE4H 2PF6A 3GO1L 3CLFL 4PGBB 4QT5B 4X4XA 3CDFA 3KLDA 1MUJB 5B38G 5MEPA 1H3TA 1JZ3A 1W0WA 3ARED 4WEUD 5DJYB 1CXHA 4AK1A 4Z7WB 2X70A 2DS4A 1ZSDA 1GC1C 3WNLA 4N0YH 1PKQB 4IRJA 5D70L 1IC7H 3M07A 1DZBA 1A2YA 4MXQD 2EDWA 3QDJE 1H3GA 2XRAH 5CEZD 3QZWA 4S2SA 1W72B 3E3QE 5GGUB 4APQB 1KJ2H 2VLLA 2D31A 4RGNE 1U8OB 1JNHB 4HZAA 4N90E 1ETZB 3RWIB 3C09B 5DC9B 5ESVB 5GGVL 5IMOB 3RNKA 4W81A 2HH0H 3NACL 4I2XE 25C8H 3DX7A 4OI8A 4Z7OF 2BNUA 5DMKB 5DSCA 1L4IA 3D0LB 5JLZB 4OGXL 3QWOB 1YUHA 3DTXA 4LKCA 5EBGA 4I48B 3VFWB 1HYSD 1U58B 1Q0YH 4JFEE 5DD0L 3F12A 3O45B 3V6OE 5C0BE 4DCQA 4M62H 3BAEL 1QACA 4ETYA 4U6HA 3QDJD 2MOVA 1MLBA 1UA6H 3BH9A 4CL7A 2APVA 3P40A 2VIRA 3HNTH 2YUWA 1IJ9A 2WIMA 3BGFC 3HG1A 5HHXL 3DHMA 4XVTH 1GHFH 1XMWA 3CXDH 3MNWB 5ALBH 4RGND 2FD6L 1K4CA 4ZUSA 5F97E 2EDOA 4N90D 1DBAL 3JWDL 3MLUH 3MROB 4S0TD 5KJRH 4MX7A 5D2LF 4GSDL 1LK2B 2Z31C 3UZVB 5JOPE 1MH5A 3TBVA 2UYLB 1T1YA 1A6ZA 5JNYA 2HLAB 3GMPB 2CIKB 5IVZA 1GAFH 3WNNA 5GRVL 5F6HI 2A0LC 3O3UN 4PJXA 4TVPL 4JFED 4M93B 1KJ3H 3LQAL 5C0BD 3H9YA 3MR9B 1PSKL 3QI9B 1JHLH 1A1MA 3C2SA 4YHPA 3AS3A 4OZFA 4EOWL 3X11A 2GSGA 3I75B 3KPQA 1U91B 4OLYH 1HEZB 1EDQA 3EGSA 2I24N 4PS4L 3P9MB 4MDJB 4R9HA 3RVVD 3KPSB 3QEHB 3HPLA 3KDMB 1G7HB 5FM5M 3T4AA 3VD9A 3EFFB 4JZOA 5JOPD 4OD1H 4PRPB 3GFUA 4TQEL 3ZE0F 3VA2C 5FGRA 3RWCA 5EC2A 3VXNB 3IFNH 4HBCH 1BOGA 3GMNA 5E70A 1DTUA 2NR6D 3DHJA 5F7EL 4CVXB 1I1AD 4G9FA 4TSAH 5D5ME 1NGYA 5DRZA 3C9NA 4GXVH 5DK2A 2JB5L 3MX0A 3U30B 3U48A 4C56B 1V7NH 5EH1A 1JGEA 1U36A 2ICCA 4KHTH 4M6MH 5B8CB 1MJ8L 1S7QB 5JQ6H 5GS0L 1WWCA 4OI9A 2VB5A 4GRLC 2BP3A 4PJHF 1NMCB 1JZ2A 5IVXA 4FQHB 3O0RH 3BD5A 3TZVD 3M8OL 3QIUB 4YUEL 5JXED 2XPGA 1MHCA 4JQVC 1F6LL 2Q6WA 4JFHD 3B2VH 4YPGA 3JV4B 2P7TA 2CH8A 2Q3AA 3DXAA 1OL0A 5JW5B 1UWEL 1BGXL 1OGTB 3G04B 5GGQH 1VDGA 2ZUYA 3EHBC 3LMJL 3ZT7A 4K3DL 1UXWB 1KPRA 5JMOC 3L6FA 4HSQA 4PRBA 1JMXA 5F7DB 5GGSB 3IKCB 4HFWB 2CRMA 3VWJD 1C08A 5JORB 1AI1L 1A3LL 2YWYA 1NCBL 5EOCH 3M17B 3QH3B 2AK1H 3THMH 3JTSB 1QVOB 1U8QA 2GITA 2VXTL 4X6FA 3D39A 4YJZL 3HRZA 2ZSWB 2YSSB 1IEBB 4XCYA 43C9B 1WICA 3ROLB 1IT9H 2VZOA 2JJWA 3HR5B 1GOHA 3OTTA 3E6HB 5I8EA 1QO3A 4D0DA 5D6CB 3D2UA 4LLWB 1D5MB 3CGTA 5EU4B 3GSNH 3IDGB 5D72H 5SX4H 4QKXB 2XYCA 3VH8G 4MJ5B 4NKIH 3L5WA 1S9VB 3WO4C 1GSMA 3VG9B 4UILL 5HI5D 2GQHA 3FO1B 5IOPB 4QTHB 5C0DB 3S36H 3BPNC 3I6GA 2VSDA 2VJXA 2E9WA 1N64L 3INUH 4Q6IB 4ZSOB 3S34H 1R3IH 3T2OA 3FMGH 3AREC 5IMMB 4OZHB 3VGGA 4FS0A 4P5MB 4MCZB 1DR9A 4HGMA 4UINH 3VFPA 4XMPH 1SMOA 1JPST 1GH7A 1YEFH 4NQDA 3OR6A 4WTZG 1P1ZB 3L3JB 2BVEA 5JDSA 4Z76A 5TE6L 3RAJH 3QUMH 2D7MA 3TPUA 1HHGA 4HLZH 3ARVA 2OSLB 1CGSL 3EOBB 2NMSA 3P9WB 3SCMA 1U3HB 3O4LE 2DIJA 5HGHB 3GRWH 2YD3A 3O6LL 4B53A 5FK9B 3MJ7B 5HHQB 3PJSB 4LSRH 2E9BA 5CEXB 2EH7L 3T4YA 1G7QA 4H0GA 5D7JB 2QR0A 3T3PE 2XY2A 5J6HA 4W6WB 1DFBL 1R3KB 1CTNA 5H94A 4YEEA 1HYSC 1AR2A 3FQRA 1DL7L 4ETQA 1DJSA 1KJMA 5INCB 1YPZB 1BEYL 1A3QA 2FB4L 1Q1JH 1XF3B 2B4CC 4RMQA 5J6GB 2CUMA 1RUQH 3E3QC 4PJ5E 5D7IA 5HI3D 1MPAL 2FIKA 2HT4D 2UV3A 5D93B 5IBTH 4RGNC 3O4LD 4FXGB 3PL6A 3CPLB 1KCSL 1OP9A 3GBMH 4UT9H 1GZQB 2DMKA 2DQGL 4NO5B 1F42A 4NUJA 4QTIL 4JFPB 3UTZB 1BQLH 3ZLQC 5DEZA 3QRGH 4WI8A 5B21A 1CIUA 1SBSL 3BUTA 2ADFL 3ARDB 4NZTL 3WLWD 1IGIL 2QEJA 4IRSB 4NRZA 5EOQH 1YY9D 1G9NC 4HH9A 3L3GB 3V6OC 3STZB 3V4UL 1Q9OA 2Q3ZA 3DV4A 4N9OB 2EXWD 4PJ5D 4I0CC 4OF5A 4LRIC 4MSWA 3GMMA 1AHWC 3HPJB 2AJYL 4OLEA 4AH2A 4PB9L 5J1AB 5C09B 2ARWA 4PREB 4KK6D 3MOBH 4HIEA 3RVVC 2QSVA 2VR4A 3QQ4B 3I3EA 4WWKA 3UDWC 5IB1B 1YNTA 3SOBL 5FHBH 4YDVA 3ZHKA 3H6JA 2BY3A 2R2HA 5GJTL 3RA7L 3K8KA 1Y6NR 1LDPH 1ZMYA 4R7DA 5ACMA 4X4MA 3MCG1 2NR6C 3MLVH 3QEQB 5E5RB 1QEWA 2Q8AL 1EJOL 5JHDB 1I1AC 1HOCB 1MCFA 3QQ3A 4MD5A 5AZEL 1ES0A 2GT9A 4TNVF 4JFZH 5IB2A 3G5ZB 4I0PD 3P77A 1M7IB 4U2YA 3RWGA 1EPFA 2EDJA 2FLRT 1IAMA 1YYLL 4MDIB 3KPRE 3WN5A 5ETUA 3FN0H 4OZFH 5LBSL 2NQCA 3EYFA 1WBXB 2CR3A 2MNUA 2YBRA 3TZVC 4JO2H 3UYOD 5JXEC 3UPRB 4OCXH 3VFMA 1SEBA 1VADB 3OAZK 1TJIH 3JXAA 2YRPA 3U4EA 1RZKL 1CL7I 3JV6B 1K2DA 2QBWA 1ED3B 5KS9B 4XPTL 1GGCH 3BKMH 4ZUWB 3O2WH 4X5XA 4L8CA 3ET9F 2FCBA 5E9DE 3MGTA 1IL1A 2V9RA 4M1DH 3EJYD 4NJ9H 2HTLD 1OAQH 1QLRA 1H3PL 3VWJC 1MHPL 4XWGH 4X7FC 5FYKU 3GZKA 1U92A 3KPRD 4HWEH 1NJ9B 5IFJB 4MZ2A 1CWVA 5ADPL 4QRUB 5D7LA 4Q7DA 1OP5H 5JW4Q 1E4WL 5C3LD 3QCTL 3VMOA 2WK2A 2BSTB 1X7QB 4S1DD 4HK3N 1OARH 3TEUA 3U0TA 1NBQA 4H88L 4JR9L 3VRIA 2BERA 1CQYA 1D3CA 2A6DA 2Z31B 2DQIL 4I18A 2PCPB 5JO5B 2DJ4A 4LSVL 2OQJA 1QLFB 5HI5C 3FO0H 4GUPB 5E9DD 5JOFA 4P4RB 3VXUA 5JZ7D 4UIKH 1DUZA 3V6ZB 3NFPB 3G6JF 4K9EC 3MRQB 1I1CA 5DS8B 1Z9SA 4F8QA 5D9SA 5IQ9A 1LK3L 4W6YB 1MJ7L 4G8IB 1NFIA 1CBVH 5F7MC 1GGTA 4X4YA 1JJUA 3WFDL 5E94A 3WCYA 1U3JA 2O5XL 5D8JH 4FP8L 4Y1AA 2VMFA 2ICEA 4G8GB 5CUSH 1GGIL 4F37K 5I1IH 2EKJA 4U0RB 3HMXL 1TETL 3ZYJA 2H32A 2OXGA 2KPNA 1LNUA 1LO2L 1CF8H 1F4AA 4RAVA 4Z7UA 2OR9L 5C8JB 1JF5A 1C1EL 1HHIB 3ILPA 4HLJA 4HKBB 3LKNA 5HYQA 2YXFA 3FQWA 4NIKB 4L4TA 1LP9F 4UV4L 1FL6A 1G7LB 5L6YL 2HN7A 1ZT4B 4UI2A 4Z7WF 5BS0A 5L2KE 1T22B 4YIQB 4L3AA 4GRLB 1QQDA 3H7BB 2FYYB 4TUKL 4DKFH 4XCNA 3K1DA 4HUUA 1RIHH 2KQNA 2RCSL 1RUAH 3D0VB 5GGTL 2R23B 4WEMB 4RSVA 3GO1H 4JG0L 1XH3B 1DN2A 4OAWB 3HLAA 1AGDB 3T77B 5HI3C 2HT4C 4UNUA 2L0DA 2XG5A 4EXPX 1FFPA 3LSOB 2BCKA 4WFHE 3GHEH 3M45A 1E28A 4NQSB 2ZCHH 2CRYA 1EGJL 4JDZB 1YQVL 1V3JA 3OKLB 3JWOL 4Z77B 3FOLA 3EDJA 3OX8B 5LWYL 1CICD 5D70H 3WLWC 3IYLW 1AXIB 5SV3A 5J9PA 3FTGB 5L2KD 1YY9C 5C0EB 1Y18B 3IRPX 3CCHA 4JDTL 4EBQL 4P23D 2F54B 1P84J 2GJ6B 4R8WL 1FPTL 5E4IA 3MRGA 2NY0C 4FRWA 4EN3A 5C0JB 1CL7L 3QNYA 4WUUE 3C8HA 2D0FA 1RVFL 3OMZA 1QSVA 3M1BB 3FQNA 4G6KL 5GGVH 5IKCA 2EXWC 4RZCA 1JHTA 4QNPE 1B6DA 3NACH 4UNVA 2PO6B 1JTPA 3EYVA 3PGDA 5KN5A 2KH2B 4WFHD 4KK6C 5C0GA 1FIEA 3LPGA 2VN7A 3BJLA 4NNYA 5HGAB 5JXAL 2LE9A 3R0MA 1ZTXL 5DD0H 2R4SL 3BPNB 4KZEL 3TCLA 3FRUB 1KIPB 2VSCA 3KYOB 3BAEH 3RDTA 1MREL 3MRCA 5BZDA 3AREB 3QA3B 5FB8B 4IDJL 4OCRL 4FQXA 2IPKA 3F65A 2EDQA 1YJDL 1RK0B 5HHXH 4HKZB 3ARBB 4WUUD 3L5IA 2FD6H 1NC4A 4R0LB 1NGZA 5F3BB 1DBAH 2NY2D 4N0UE 3CFEB 1NKRA 4WDIB 4XXCC 5CIPB 3HKFA 5F1SA 1IAIM 1J8HA 1IM3A 2ATKB 1T89A 1DBML 1U8JA 3DRTA 4L4JA 1NCNA 5KSAC 4TVPH 2VISA 2HT3D 2FR4A 3HUJE 4Y2DA 3EDKA 5DZNA 1PSKH 3VXMA 4F9LC 4U6YB 5IB3B 4HUWB 1AE6L 1YC7A 4XRCA 5I0DA 4PPTA 4GMTL 3DPBA 4EOWH 1EAPB 1JI1A 2M1KA 1P7KA 1HWGB 2ICES 1T21A 2EE9A 1CD8A 3EJYC 4PS4H 2HTLC 2ESVE 3CX5J 1C5DB 3BP7B 1Q72L 2ZUSA 5I76B 5J1TC 1SJEB 4GAJH 4QXGL 4V1DE 2ZUWA 2VLRA 1I8KB 5E7BA 2XKNB 3QDJB 4PJ8C 1KEMH 3DARA 3MLRL 3GIVB 1AR1D 1I7ZA 1IAKB 1N5AB 4KV5F 4LLQB 4TQEH 4OZGA 5KSBA 2EDDA 2YD4A 5KANG 1KLUA 4G6FB 4FA8A 4RGNB 4S1DC 2R1YB 1IQDA 2IBGA 2VLJB 5F7EH 3ZYIA 4JFYB 3MRFB 4J4PA 4I2XB 4AIXA 2JB5H 4MJIE 1JP5A 1KNOA 4KDVA 2R0KH 3RVWC 5IK3B 5GS0H 3RHWK 5DJZB 1IQWL 2ESVD 2BRQA 1ZHNA 3IDYC 5C0BB 1TVHB 3CUPB 4Y4KB 3SKMA 3M8OH 4V1DD 4YUEH 5JZ7C 3VXQA 5IVNA 4M9OA 5ICXA 1J1XL 1AO7B 2G5BB 5HDOA 2NY7L 3KPTA 4BKLB 1OPGL 3PGCB 4NDMB 1UWEH 1BGXH 5C0FA 1AHWB 4PJEF 2R2BB 1KJVB 4G43A 3LMJH 4ORZC 3E6FB 4K3DH 3O9WA 4DN4H 1D5BA 1NSNL 3G5YB 3VE0B 3OB8A 1IFHL 5C1MB 1Q38A 3C5SA 4MJID 3D25A 5ICYA 1KTLA 1CD9B 4P5TD 1ORQB 1AI1H 5HI4D 1FVDA 1NCBH 5EDXA 5E8OB 3ZHDA 5BRZA 1DQLL 1CCZA 2VXTH 3TWCL 4F7CB 2ADGB 1ZHBA 4OFPA 1I1AB 3MCLL 4HF5L 4PJBA 5FDYA 3PWVB 3S3PA 3HMXA 2Q7NA 2FH6A 1NGQL 2W65A 1JGDB 4PJCE 2ITCB 4XHQA 1OB1A 3VRJB 3C6LA 5F1IB 3CVHB 1JYVA 3U4BL 4AM0A 4NQTA 4BFIB 3BQUA 4N1HB 5I75C 4UILH 4HX1A 5JPMB 1A22B 4NWTL 2X44D 5EOCJ 1FSKB 3PWUB 3CFKB 3CLEL 3PV6A 4ZDHB 1GXEA 3OKMB 2A6JB 5I1EL 4P3CL 2X1QA 4M1GL 3BFOA 3BIBX 2H32H 4HPYH 1CFQB 4GQ9L 3VWKA 1MWAB 1UWXH 5GGTA 1A9BA 1D7FA 2Q87A 1H8SA 1P2CA 4WJ5A 3BEWB 5HDLA 1CICC 3JWNC 1INQB 1NUGA 3VFVB 4PJGE 3VWJB 4L1DA 3MLPA 5F21B 3C8DA 5FA4B 1MCWW 4P23C 5IF0B 2FEEI 2DYPD 3JTTA 4N8PA 1N2RA 5K93A 3VXSB 1EEYA 1IRAY 1EGJA 2AXGA 2HVKA 1YPZF 2YEZB 3O6LH 1MRCL 3JV0A 6CGTA 4CDHA 3BD3A 1DEEA 2GK0A 2PXYA 2EH7H 4YHZL 5F44A 2CRIA 2UUDH 1PKOA 1DFBH 4DAGH 5C08E 4LF3B 4LVEA 2ATPA 1AXSB 4YZFF 5HVFB 2I07A 1KN2L 4U1JB 3ZE1F 1YMME 2JIXA 2P5EA 3VU2A 2DB8A 3KVQA 1RU9H 4GRMA 1R3HB 4OKDA 3FOMB 3WFEL 4QYOA 1NCUA 2FB4H 1KCKA 4PJ7E 3SE3A 2LAAA 1MPAH 2PR4L 3U1SH 5CWSB 4B0MM 4HK3J 2D7PA 1SHMA 1CFNB 1I75A 2NY2C 4GOSA 2EO1A 1KCSH 3BT2H 1L0YA 1PJ9A 2APBA 2BNRE 4JJ5A 4A2LA 2DQGH 4G7VL 3WKML 2PYEB 2EDBA 5L0QC 4QTIH 3BP6B 3EFDL 4EI5D 3QBTB 4OT1H 2ADFH 4NZTH 4ZUUA 1IGIH 4F7MB 5C08D 4UDUA 3MREA 2IBZX 2J8UA 4XWOD 4DFHA 4N5UA 4HZLB 2HT3C 1CN4A 3S4SG 5GS2H 1YMMD 3V4UH 4NKMA 5FYKE 3GJFB 1F3JB 4MD0B 5D2NE 2IH3A 1INDL 32C2A 4EI6A 3NAAL 2ED8A 2YC1B 3D3VA 3HC0B 3LAFA 4WI5A 1HH9A 3UTTB 1ZHLA 4JM2D 5HPOA 1IZJA 1YMHA 3MNVB 5ILTH 4PB9H 2EDNA 5C2UB 5HHPA 3QDGE 4IJ3B 2VABB 3DI3B 2BNRD 4MXVF 1XF5A 1QSFE 1KG0A 1KXTB 4M5YL 3QNZA 15C8H 3TNMB 3SOBH 1AR1C 4PG9A 4XPAH 3I9GL 4EZMA 3RA7H 2AEIT 3GMLB 5BO1L 1A5FL 3O4LB 3SKUD 4MA8L 2XZCL 2DN7A 3AS2A 3MV7E 1EJOH 2EEBA 4NQEB 5FYKD 2VUOA 2IANA 4KRNA 4NOBA 2GSIB 4J8RB 5AZEH 4MCYA 3TBSA 3F6IA 4MAUL 4IBLT 5KS9F 3OXSB 4ZXBA 1YYLH 5E2WL 2FZ3B 1FHGA 2AAVA 5JQHC 4O2CA 5LBSH 5DVKA 4M6AA 4QHNB 3QDGD 1OWRM 3ZKND 1QSFD 4BSVB 1LEKB 5TFSL 2NY0B 1L6ZA 1RJLA 3GMOA 4W70A 4JB9H 1YNLL 1HQ4B 3QULA 1RZKH 4JN2A 3LCYA 4XH2A 4YAQB 1OD7A 3SKNA 4WW2C 5TF1H 4HH8A 5E1AB 4ZTPH 3MV7D 5EU3B 3SKJL 3QUYD 3O3EA 2C3VB 4HK0B 1NC2B 3PWPA 1BQSA 3P11L 1LEIB 1RZFH 4NYLB 1FDLH 1Z6JT 4TNWK 1H3PH 1I1RA 1MHPH 3SO3C 1Q94B 4P5TC 5ISZA 1S7WA 1TJGL 3TBYB 1JHKL 5GZOD 5JMRA 5FUCC 5F93C 1E4WH 1PEWA 1OT1A 4MB4A 3U0PB 2AV7A 3W5NA 1JIBA 4JZJA 4LMQE 3HC3H 4H88H 4JR9H 4UNTA 3G5XA 1CT8A 2CK2A 2NZ9D 2CLZB 3C8KA 3IU3B 2E3VA 4ZQKB 1EFXA 4NBZB 2DQIH 4LEOA 3WNKA 3RGVD 4LSVH 1OCWL 5KSAB 5J8OA 1BFOB 4R7NA 5HY9A 3UC0L 5I1HL 2OJZL 4JDVB 5AAWA 3NPSC 4KZDL 1SJVA 1OW0C 3CSYB 2V6HA 3RFZC 1G9EA 3NFSL 3O8XD 5BZWB 2C1PB 2BSSB 5LXGL 1ROWA 3RI5F 2GCYA 1T7YA 1LK3H 4XNQB 2W9DL 4JJHA 1MJ7H 2ED7A 3SPVA 3WFDH 1KJ2B 4EKXA 3TN0A 2O5XH 4ZUVB 1BD2E 4FP8H 1A4KA 3QXDB 1U8MB 1GGIH 3MXVL 1KF9B 3HMXH 4PJ8B 1TETH 1AKJD 4Y19A 5CJXA 1LO2H 1ZA6B 2OR9H 4JFFE 1C1EH 4HBQA 4OGZA 2GTWA 4GLRH 3HR6A 1J0IA 4ZMAT 5IWLC 4JPWL 1SVCP 3HAEG 5DK0A 4H8WH 5EUOE 3V5DB 4Z7NE 3EO1A 5ENWA 4BA8A 5L6YH 4GQPH 1OAZL 3QQNA 3B9AA 3IU4L 1YEEL 4ODTL 1B0GA 4M1CD 3GMQA 1U3YA 5E9DB 5GQBA 4TUKH 5SV4A 5I16A 4NZJA 4YBQD 3TV3L 2RCSH 2XN9A 1BD2D 3P9LA 5GGTH 5GHWL 35C8H 4V2BA 2GTZA 2W60A 4JG0H 1G9MC 2WIIB 2KUTA 2QSCH 4L4VA 4MNGB 2IAMA 1QFWM 2V5YA 2Y23A 4U05A 4H5SA 4K8RL 1NGWB 3PWLB 4P9HL 4JFFD 3FT2B 4KKNA 1U8NB 3TNNB 3A6CL 2EEDA 2VITA 2EKSB 4OZIE 1M7XA 1XCTA 4KKAD 1ZLSL 1EGJH 1YQVH 3PP3K 4ZS6D 2BXYA 5HHOA 4EI5C 2HJLB 4O58H 5J11C 3VXPA 4JFOA 4JFQA 3LKQB 3FQUA 3MBEB 2NLJA 3T3MF 3V0AC 5KVEH 5DD5L 2ZP0T 4NOFA 4XWOC 3VXUE 4P2OD 4PTTA 4NGHL 1HHKB 2MJWA 2FHFA 4JDTH 4EBQH 4YEFA 2DI7A 1FPTH 1PY4A 4Z7QF 2LTQC 3CSBA 4KK9D 1CL7H 2ZJSL 5GSRA 2IPUK 5L9DH 1RVFH 3O41A 4PLKD 2IPUG 4G6KH 3WE6A 1T5WB 3IFOB 4JM2C 4J1UA 1HINL 4UOW0 2CKBL 3PE9A 3SDAA 1JUFA 4TOYL 2D03L 1HWHB 1A4JB 1J9CT 5I75B 5JXAH 1URLA 2LU4A 3CC5B 2XWJB 1ZTXH 2R4SH 3PV7A 4GO6B 4KZEH 3DYPA 3C5ZA 4URTB 1I7TB 1MREH 5MERA 2NX5B 4QRSA 2GY5A 1HDMB 1WWBX 1FNEA 2AI0H 1ZHKA 3I6LE 1EEZA 2N7BA 3IDIB 2X4RB 4IDJH 4L3EA 4OCRH 3VXUD 2JJVA 4G8EB 2BNQB 1YJDH 2ITDA 1ZGLA 3BD4A 3C60D 3CMGA 4HDIA 5CGTA 3MMEA 5D2NC 5AYUL 2Z0BA 3MCKA 2M2DA 3T0EA 1WIOA 3QEUB 1RMFL 3NCYS 3CU1A 4OM1L 2JCCA 3UZQA 1RAMA 5B39G 3RIFK 2Y5TB 5IW1B 4YFLI 1IBGL 4BQ6A 1CS6A 3SDXE 4OFYA 1DBMH 5DEFB 4I3GA 4KUZL 5CEYB 3ZKNC 1KULA 4PRHA 2WWKO 2VDKL 4ODUA 3CVIL 1FCGA 3RL2A 5DJDA 4Z7VF 4X8JA 5J56B 1LD9B 1I1YA 1AE6H 3I6LD 3JBG7 2VC2H 4FQ1L 1IGYB 4GMTH 4TTDD 1IGCL 4JANB 5DJXA 3QUYC 3H9SA 1BWMA 4K7PL 3U36B 3KXFE 4OD2B 2QQNL 4OCSL 3MV9B 3ARWA 4FTVA 4QXGH 1OTUD 5EZJA 1DQQA 3JSSA 1DLHA 2VZUA 4H1LA 5GZOC 3AUVA 4F57L 4Y4HD 4ONGL 3GSNB 4WU7A 1IKNC 1NEZA 2GK2A 2GAZB 2Z8RA 1IM9B 4WUUB 4PJIA 1NDGB 5ID0B 4TVSa 1A6AA 4PFEA 4MJ6B 4TSBL 3QJHA 4D0BB 1MI5A 5FFLA 5L0QB 2NZ9C 1UB6B 1PD6A 5I15H 2VDNH 4IMKA 5JPNA 1DDHB 3RGVC 4LCCA 1HNGA 2ERJB 2HRPL 5FUZL 3HRPA 4ESKA 2DQHL 3KXFD 1IQWH 1UQSB 2XV6B 4H26B 4KPHL 5E95B 1FGVH 5K59E 3JWDC 1M7DB 3O8XC 1J1XH 2O61B 2NY1D 2XT1B 1UGNA 2NY7H 1LE9A 5ICZA 1RUML 4PB0L 1OPGH 2EIZA 3QUMB 1HKLL 2X4SB 3I2CH 3QHZL 3RWHB 4PGCA 5F96H 4N0UB 4PV9A 3CH8A 3ZKXC 2XG4A 3LQAC 1NSNH 1II4E 2R2CA 3UEZA 2ZCLL 2BVQA 1IFHH 1X9QA 1BIIA 1OM3H 5DYOB 2BOBB 5EN2B 4CW1B 3AB0C 4O02L 4G9DA 4X4XB 5MEPB 4ZFFA 4KROD 3ARQA 5HGGS 3H3PL 3MYJA 3RX8A 1DQLH 2P43B 1JWUB 5H35A 3HUJB 1B4RA 3TWCH 3MJ8A 4FQXD 5GGVY 3OKNB 5SWSA 4MQSB 3T2NL 5BQ7A 3MCLH 3ZSTA 2X70B 3BDYH 4HF5H 4XAWL 5DJAA 2LAGB 4WTZA 1XFPA 3WBDA 1ZSDB 2G75A 1JPFA 1FG2A 1NGQH 1RZGA 3MUGA 3R0NA 2D7TL 4M1CC 3N85L 1TQCB 5F8QC 4PJDA 1A2YB 4HUVA 3QUXA 2VZ3A 4F15B 4YBQC 3VXOA 1N0LA 3VI4F 3KYMA 2CD0A 2DWDA 1GZPA 4NWTH 3NIGF 3VFRA 1MNUL 2OTWA 1PX3A 4GW1A 2JTDA 2D31B 3CLEH 3S88L 5BV7L 1X5ZA 5I1EH 1XIWD 3MA9L 2VLKA 1IC4L 3RNKB 4K2UL 1E4XI 5TGBA 3LVEA 4GQ9H 2BNUB 3KJ4C 4LNRB 4KKAC 1Q0XL 4HXBL 3TIDB 4GXUM 4OIBA 1XGTB 1YUHB 4ZS6C 1ZVSB 2W9LA 4NNXA 2HJKB 3HC4L 4R6UA 2OL3L 1WQVT 4N0RA 1FORL 1MCLA 1P4LA 4PYGA 5LGJA 4P2OC 3AVEA 3EDDA 1UCTA 3SDYL 3TVMA 1A02N 1KB5L 3G6JA 3OKEB 1MLBB 3BH9B 3I50L 4KK9C 4IDLA 5K9JL 4OSUL 3HG1B 4PLKC 4U1GB 2YUXA 4RAUA 1MRCH 2R1WA 3V5HA 3IB4A 1K4CB 1Q9KB 43CAA 4N0FA 2KZ1B 3QHFL 2BK8A 3QP3A 4YHZH 4PY7A 5E1HB 5KW9L 2WBJA 4JRYE 4MX7B 3F5WB 2F53A 4OFIA 3RZWA 4GG6E 3UTOA 4KHXL 2B0SL 2R29L 2Q86A 4LP4A 1BMGA 1K4DA 4HEPG 1T1YB 1A6ZB 1WJ3A 5JNYB 5F6HJ 1KN2H 2W38A 3UX9B 2AEPL 4KJQD 4PJXB 3MGOB 3NPSB 4O4YL 1ND0B 1P9MC 1S7UB 2P4AB 3WFEH 2CKBA 4PJ9A 3FZUD 5CGYD 2WWKT 5FKAB 1H9VA 5GRZA 2C4FT 4NKOA 2XKUA 2PR4H 3EKCA 3C60C 1ADQL 2GSGB 5CSZA 3KPQB 5J12C 2VRAA 3EGSB 5FYJL 2YD5A 1HHHA 3DJ9A 4G7VH 3WKMH 4POUB 4X0KA 4RA3A 5J89A 3DUSB 3EFDH 1EX0A 4JRYD 4J3OC 3HPLB 2FSEA 3KGRA 5IP4A 2DYPB 3T4AB 1JYXA 1FO0A 4M9PA 4RA0C 4YHOL 3IF1B 5A3ID 4K7FB 2IG2L 4MLIA 1RZIA 1N6UA 4JZNA 3RWCB 1CFTB 4CMMA 5EC2B 3GNML 1BOGB 2AABL 4FFWD 4ZOAA 3REVB 5C0AE 1INDH 2O5ZL 3HS0A 3NAAH 1BM3H 4P9ML 3IXTA 4TTDC 5DRZB 1U8PB 2EIDA 1C7TA 4MYWB 4YC2C 1JGEB 1T2JA 4ONFL 1XR9B 1WZKA 2YN3A 4ZPVB 3ALWA 1OTUC 1B3JA 1WCBB 4M5YH 3R06A 1BZ9A 1M71A 2XQYK 3QPQD 4X9BA 3L5JA 3EIFA 2XQYG 4R96A 2YD1A 4LL9A 2XPGB 1MHCB 3H8NA 5SWQA 4Y4HC 4KKLD 1XGYL 2Q6WB 4QRRE 2D7NA 4YPGB 4KAQL 5BO1H 1K8IA 4MA8H 3OWEA 4CNIA 1PW3A 2XZCH 4GKSA 3S9DB 4KJYB 1OGAA 4PJAE 1CXFA 2PW1A 3LH2L 5C0AD 4MNQA 1F02I 4MAUH 4NFCA 4RFEA 5EIIB 4PRBB 4XB7A 5J11B 1XCQB 4OLWH 3WIIL 5E2WH 4JM4L 5JIIA 4NRYB 3VFTA 3ZDYE 1C08B 3KJ6H 5AD0A 3IFPB 1BECA 3ULVF 1YMMB 1CYGA 3TBWB 4KVCL 1U8QB 2J4WL 3BHBA 3U46A 3D39B 3K4DA 2NY1C 3HRZB 4XCYB 2EE3A 1YNLH 4QRRD 1Y6KR 1UEYA 4JM2B 5MI0B 4H1LH 3DLQR 4MAYA 2PXYD 4PJFA 5CILL 4D0DB 1FL5A 1KIQA 4OV5B 3D2UB 3SKJH 3GUTA 3VGDA 4Z5RA 4PLJD 1R24B 3P11H 3WJLC 3WXVL 2RFXB 1KLGB 4K71B 3WNPA 3I6GB 4OQTL 1B0WA 4UUJB 2Z93A 4XCCL 1CIDA 3SGEI 4KROC 1ZVYA 1U0QA 3BE1L 1BAFL 3BPOB 4M8VA 4FQXC 3HI6L 3P4MA 3AY4A 5C6WH 2EYRA 5K9OB 5D1ZA 1RZJL 3ARRA 5KBNC 2HFGH 4U2ZA 3BXNB 2G2RB 2VOTA 2C4XA 4E0RB 2BVOA 3VGEA 5FYLL 5HVGB 2BHZA 3GSXA 5E2JA 4U1LB 2QKIA 3BW9A 5HYEA 1OCWH 4I77L 1T20A 1EAJA 1QSFB 4Q9QL 1M05A 3UC0H 3SCMB 5I1HH 2OJZH 2N7AA 3MRLB 5HXMA 4KZDH 4D0CA 2VZ1A 5IIEA 1JRHL 2R69L 5LXGH 2XY1A 3FO2A 4IHOA 4P4KA 2W9DH 3NFNA 4Z0BL 3SY0B 4XNUL 3MV7B 3QUYB 4LLYA 3P73A 1CR9L 5J6HB 1KYOK 3MV01 4AEIL 4BFGA 5CINH 3E1F1 2CDGB 2RR3A 4ETQB 3MXVH 4X7TA 4CUCA 1KJMB 1RQ5A 3UP1A 5DJ0A 5H2BA 5ESQA 3WD5L 5I8CB 5DJ6A 5BVPL 4K3JL 5D7IB 2FIKB 5D2LE 5IFHL 1CE6B 1X5KA 1D5ZB 4JPWH 1CGVA 3L3OA 5MEOB 3HTLX 3FRPA 5I1LA 1KB5A 2EDRA 3IU4H 4D2NA 3G5VB 4ODTH 5BOZG 5CGMA 2COQA 4R4BA 5DHVA 3RGVB 4UU9A 5E08L 2KKQA 1CGYA 4EVNB 1F2XK 2D9QB 4NRZB 4KJQC 2CIIA 5I17A 3MRJA 4IOSD 4BZ1L 4HH9B 5GHWH 3BZDA 4MGXA 4ZAKD 5CGYC 4PP2A 3O8XB 2VKWA 4GW4A 4XI5D 4YX2L 4K8RH 1UM4L 5EBLA 1BWWA 4D3CL 2B39A 4AZ8A 4P9HH 1RHHA 4MSWB 3PF2A 2XTLA 2C3WA 3DURA 3ZKXB 3ZE0E 3ISWA 4HIEB 4PV8B 1CLZH 3ARYA 5DTFA 3IDJB 3E8UL 2VYRE 4GAYA 3N1QC 1YNTB 4OLZL 4DEPB 5M94B 3UJTL 3PGFL 4G80A 5DD5H 5A3IC 1ZLWH 2R2HB 4NGHH 5J57B 1SYVA