4RIRA

Structural analysis of the unmutated ancestor of the hiv-1 envelope v2 region antibody ch58 isolated from an rv144 hiv-1 vaccine efficacy trial vaccinee and associated with decreased transmission risk
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
226
structure length
219
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLGGRYYYDSSGYYYFDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH58-UA Fab heavy chain
publication title Structural analysis of the unmutated ancestor of the HIV-1 envelope V2 region antibody CH58 isolated from an RV144 vaccine efficacy trial vaccinee.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 219
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirA01
4FRWA 1M6OA 4UOW0 3QDGE 1IEAB 3RDTB 4KK8D 4JZNA 5I1GL 1TJHL 3LKPA 2BOCB 1IC5L 1W0WB 3G6DH 5CHNA 5E8PA 25C8H 3BEVB 1YMMB 3O11A 4JY6A 5JZ7C 1MNUH 3C6LC 3T0DA 3KG5A 1NAMH 3PWLB 1MELA 1UQSB 1H3WM 1FLRH 5J6HB 1AFVL 1T5WB 4U49A 4LSRL 5L2JB 5EIIB 4P46A 3VFWA 5B8CB 3X12B 3TIEA 4BK5A 2QQLH 4JO3L 4G7VH 4G9FB 1D5XB 1BF2A 4NNPL 4U1HA 1G6RL 5HYQB 5B38A 3KPNB 4TNVK 4PJ9D 5D71H 3RIFK 1OPGL 5CZVH 3QCTH 4OCWL 2X9WA 4DVBB 1FZJA 3FO9B 43CAA 3ARFA 1MLBA 3OKKB 4U7KA 1KT2A 3RWGB 3NFSH 4R8WL 4BSVA 3IB4A 1MCKA 1G7MA 1EAPB 5IVXB 1KACB 3THML 2A6IA 2VLMD 1OAYL 2AK1H 3PABA 4DGVL 1WTLA 5DEFB 4LSUH 5E00A 2ATPA 5DWUL 2JCCE 5DQJB 2R2HA 5J56B 3WHXA 4HIXL 4LVEA 3REVB 4X6BA 5DJAB 2P5WE 5BCAA 3HNTH 4NO5A 5AG8A 3PNWB 1BX2A 4PTUA 4WU5A 2FYYB 4HKBB 1QZ1A 4LEOB 1LE9B 1NEZB 2V5SA 3F7PC 2HWZH 4XH2A 4GMSH 3HUJE 2VRAA 4L4VA 5L6YH 3SE4A 4PJ9A 1QFWH 2ZSVB 5J12C 5GS2H 5CD5C 4HV8B 2VDKH 3GZKA 4I0CC 4JM2B 2HYMA 2Z35A 1IC7H 2ENSA 2VQ1B 3H7BA 4HC1L 4HZAA 2ILLA 1OP3H 3MRQA 3FQNA 1TQBB 3TBYB 2ARJQ 2AAVA 3P2TA 5FCUH 3RWHA 4BZ1L 4RGND 1YN6B 1EPFA 1U58B 4OZ4A 4G42A 3BPCB 3OB0H 4R90H 1S9WA 4XMLL 1CXHA 1A6UH 2VISA 3MACH 1FRGH 4TSCH 4XPAH 5SWZD 1JZ7A 2NLJB 3EYFA 4IM8A 4LPVA 1KGCD 1ND0A 4PLKD 1S9YB 4WFGE 4YO0A 4W70A 5DJ6B 2V9QA 4KRMB 5I1IH 4X6DE 5B4MC 1HN1A 3EJYC 5CSGA 4Z8FL 2WWMC 1D9KD 3QPXH 4PRDB 1SEQH 5IBUG 5LKNA 1NGZA 2L7JA 4AEFA 1L7TL 4ZOBA 4QRPB 2VZOA 3QG6A 5AZEH 4G80A 1BQLH 5CGTA 4F80A 3OKDB 3VXME 4LK4A 3GJEA 3LEYL 3HE7B 1A02N 3QI9B 2VXSL 1OTUD 4JLRB 1CK0L 5F96H 3RZWA 3DSFL 1SJHB 3ZYIA 4M7JL 3U48A 4H8WH 2AP2A 4L9LB 4JPKL 3H42H 3RWDA 4PV9B 3AREA 1QBLL 4ZO7A 4UAOC 1U41A 3FHQA 2GT9B 2D0GA 1PD6A 5SWZA 5F71A 3OXRB 1LE5A 1FVEB 4ZXBC 3WLWC 1I8LA 5TFSH 4YHZL 3DWTA 3O2DH 1UACH 2NY0D 4L29A 4RAHA 5DJ2B 4OCMC 1YMHA 4FTVB 4WY7H 5IIEB 5B3JF 5L7XL 4EI6B 1D9KA 3QAZB 3KS0H 4HD9A 4N9OB 4L8CB 5EO9A 3VXTA 4JDZA 4I5BA 1NCWL 1RIUL 2VSCA 1MJJA 4XNUH 2OTPA 5MHSE 4JN1L 4ENEC 5GISL 1AD0A 3FFCD 2O5YH 3TJHD 5FM4A 2XN9E 1ETZB 5DRZB 3GHEH 1D7FA 2CR6A 5ID1A 2MOVA 3H9YA 4D9LH 1ZS8B 1ZT4B 5BJTA 3MBXH 5CEYA 1TPXC 1YJDL 1Q9LA 3BP4A 2NY1C 3WFHA 4HIIA 4NJ9L 4JVPA 1XF5B 5I1DB 1JHTB 4ZOCA 2VTFA 5F70A 1QD0A 4DFHA 1YA5A 3CSYA 2HFFB 4P3CL 3HAEH 1M7XA 1T0NA 4PRBB 5JMOC 1CFVH 5HGHA 3Q6GH 1J10A 1WCBA 3ZKXC 4MA7H 4APQC 1XZ0B 2G60H 2X4QB 1YDPA 3EO0B 3IXAA 3PHQA 4JFXB 4Q9RL 4MJ4A 3EGSA 3ARVA 1CD8A 3OJ2C 1CDIA 3QDJD 4OI8A 1GVIA 5LWYH 2QHLA 4YEEA 3K8KA 4FABL 1ZTXH 5DHVH 3NZHL 3E6HA 3IDGA 3QUZB 2FX8L 4N8VB 4KTEH 3QHFL 2BMKA 4F9PA 3FFCA 3QIBB 4JHWH 3DUSB 2O5ZL 3HNVH 5D1XD 4CW1A 1UCBH 4AY0A 1CI5A 2D7QA 3P40A 3MV9D 4N0RA 3VXPA 5KJRH 1G7QA 1U3ZA 3FJTA 3MRCA 1KXVC 4LMQI 1I3GH 3MRHA 2Q86B 3A0OA 5TGBA 3VD3A 4ZG1A 4XNZC 1FZKA 5ECJE 4A6YH 4JQIL 4TVPD 4WWKD 4Y19A 2HT4C 3T1WA 2NW2B 4QXGL 4KKCC 5J11B 3N06B 4YHKH 4LLMB 4HX1B 3SY0B 2WBJD 3QDJA 5TF1H 1BEYL 2YWYA 3JUYA 3TBTB 3JVGA 4XHJC 3U7AA 4Q2ZB 1C16B 2E5EA 1EBAA 4QHUB 5DUPL 3KPSE 3MOBH 3KNBB 2VUYA 5D1XA 4JFDE 1PQZB 2PTTB 2D31A 1LO4L 1FO0B 3FFDA 3MV9A 2ED9A 3K4ZA 1U8KA 5A2KH 3HS0B 3HZKB 3QRGL 1OWWA 3G6JE 4CGTA 5EU7C 4Z7WF 5F9OL 5BV7H 4QT5A 1XMWA 5B3JE 1AP2A 1A1OB 4WNQB 1U8JB 3B5TA 2R2EB 1DBJH 1QKZH 2GSGB 4FNLL 4BSJA 3L6FB 5HTSA 1OAQL 1HKLL 4M03A 1DBBH 1OTSD 2HH0L 3HNSL 2D3VA 1TJHH 1IC5H 3QIWB 1H5BB 4PJ7E 4UDUA 1PGRB 4TUKL 2DTML 1II4E 4ELMF 3D69B 1FVCA 3LN4A 7FABL 1RK1A 1EJOL 4AK1A 1AFVH 2AQ3A 3E2HC 1A5FL 2J8OA 1C1EL 1O7VA 2WBJA 2EDLA 1OSZA 2BCKA 4HEPG 2VAAA 4TULH 2X40A 2MMXA 4U0QB 5FF6A 3S36X 3P9MB 1U3HD 3IU3A 2VC2L 4JO3H 5J3HD 1F11B 3U2SB 4WHYH 2Z4QB 3UYOD 2Q7YA 4IMKA 4NNPH 1EAJA 1NGPL 1KELL 4WVRA 1NCCL 1T1YB 2VL5B 4Y5XA 5BOPA 4LIQL 4MZ2A 4HXBL 2ICEB 5I30L 2F5BL 2F8XC 4X0KA 3V8OA 5IBLD 1MCCA 4OGAD 2ADGA 5D2LF 3G9VA 2B4CC 1JF6A 1HXYB 4Z95H 5C0BD 3DOSA 1CD1B 3THMH 4WO4B 4YWGL 3MLPA 5IMLA 1U8IB 1SVCP 4WU7A 3NCYP 5DWUH 4S1DC 2BSSA 4KJQD 4JHAL 1OGTA 4JO2H 4PJBA 1J8HD 1DTUA 1YY8B 4M1DL 3UCRA 1CZ8L 3D25A 4PLJC 1OCWH 2G9HA 5GIRA 3EIFA 4F7EA 3SDXB 4UT6L 3BXNB 5KSAC 1EDQA 1CN4A 2IAMD 1MJ7H 4PPTA 2FO1A 3WO4B 3CFEA 1GC1C 2E7HA 4I0KA 1UJ3B 4NZRL 5H94A 3ARGA 3I6GB 5HYJB 2O61B 1RI8A 4RNRB 4YPJA 3WMSA 3O4OB 4LCUA 4HULB 3VH8A 4AM0A 4H0HB 3OKNB 4X99A 4XPTH 1PW3A 1RZ7L 3RNKB 5TPWL 2W0FB 2RGSA 3ZHDA 2VWEE 1N64H 3W11D 3ZTNL 2VLRE 3NZ8B 5EOCL 2VR4A 5C6TL 5C0BA 2BSTA 1NLDL 1Y18B 4M6AA 3VDCA 1DLHB 1FHGA 5DZNA 4K3DH 4DZBB 2VITA 1AO7B 1F6AB 3NCJL 4ZUWB 1A2YA 3AAZA 3DROA 4RMSA 5IV2A 1QHOA 1CDBA 1TZGH 1F42A 3QEQE 2FZ3A 4XPBL 1J8HA 4LCCB 5FUZL 3ZHKA 3QNZB 5C07D 5F9DC 1ZLWK 4Z7WE 3QCUL 4S1RL 2DJ4A 4YR6B 4K07A 4Y5YC 4EQ2A 1R3IL 2IAMA 1KCUL 2OCFD 4PD4K 4XAWL 1S7RB 3DARA 1WC7B 5DFVC 4Z8FH 3ARDC 5MEND 4UMGA 2D7NA 3RY6C 1L7TH 1P7KB 2PW1B 4YDJB 4WFHE 3B6SB 4ELME 4AT6A 4CNIB 3JV6A 1G6RB 1YNTA 1EZVY 2BFVH 3GM8A 4J6RL 2E3VA 5E1AB 2VXSH 4PRPD 4XCEA 1UC6A 3OAZK 1CK0H 1NANI 4EBQL 4NZTL 5FYJL 1AGBA 1JGLL 2AABL 2BSRA 3RFZC 1GHFH 2XG5A 1MHEA 4NFDA 2G75B 1SYSA 3AM8A 4M7JH 1MFDH 4OIBA 4XHQA 4Y1AE 4WEBL 1U8PA 1QBLH 1QFUH 3V4PL 2IPTH 1VFOA 3PQYE 3ULUC 1GGUA 5C07A 1ONQB 2E6PA 1R6VA 3G5ZA 3KLSA 5IEKA 4P5MA 3QFDB 4XWOD 1D3CA 1GIGL 1PG7L 4YHZH 1TTUA 5CKAA 1YQ2A 4O51A 4UOW1 2VDOL 5M95B 5F88A 2P1YA 5DD6B 5D2LE 4RAVA 5E8NA 1EGJH 5A1AA 4YHYC 1J0JA 2UWEB 4K7PL 3TFKC 5MENA 4HAGA 4NNXA 3RTQB 2IQAA 4KJWD 2EXYC 1LQSR 2IGFL 5ETUA 4JANB 1NCWH 4W6YB 3PP4L 2LU7A 3P9WB 5JPMA 5FKPB 1FYTD 5AZ2L 4QCIB 4FQQA 1I3RB 3ZKQD 1BQHA 4QXUL 4U31A 4Z0BL 2HLFC 4PRPA 3P4NA 5FUCE 3MC0A 3MRBA 5E6ZA 4DEPB 5KVDH 4J8RB 2D9QB 5F89B 2IH3B 1FIGH 3RL1B 3WV0A 3KPMB 4LOUC 4P9ML 3HCVA 3AU1B 3O41A 2YK1L 1WBXB 4H1LA 4OIIH 5ANMA 5FUOH 2R8SH 4JE4B 5DK0A 2A73A 3VFGL 2BC4A 2V2WB 4GW4B 1RUKL 5ITBL 2IPKA 2VUOA 4LCYB 2P44B 5IROA 2NW3A 1KBGL 3QO0A 3X13A 4EVNB 4K3EL 4LKXB 4PLOB 5D1QB 2JELL 1UT9A 5GS0L 4FABH 4OLVL 5KSBB 5TE7L 3NZHH 1OT1A 1FYTA 2OI9B 3QHFH 1NDMA 3UTQB 3O3AA 4LSTH 5M94B 1T7XA 3IF1B 4LRNH 1VERA 3SGJA 3IDNA 2Q8AH 4L8SA 1R3KA 2ITCB 2D4DA 4M7LL 3O3BA 4JCLA 1NC4B 2YWZA 4YDVB 1FV1B 2QSVA 4HT1L 2Q1EA 5L0QC 1XR8B 4M5YH 3WLBA 3MV11 4HK0B 4PREB 3BPLC 1KIQA 5IOPB 5L9DL 4NWUL 4JQIH 1IBGL 4MQXC 3RWIB 4PJXB 1FGVH 4JJ5B 4Z7UB 3GSNA 4R2GD 3AUVA 2VZVA 4YXLH 5LGHH 3RZCC 3DURB 3I85A 4L5FL 4JRXA 1BEYH 4JZOA 3OZ9H 3LOWA 1NMBH 2DQFA 4GG8A 3EOBB 3RBSA 3WS3B 5I1LA 2Q87A 3BH8A 2B7DT 3U0WL 5JNYA 4NNYA 4N0YL 4V1DD 1ZXQA 3LY6A 2EDKA 1TETH 2H41A 1T1XB 4GRWF 5E9DD 3V6FA 2XTJC 3REWB 3MJGX 5FHAL 1RZIA 1G0XA 1CIDA 4OM0L 5T3XE 3BDBA 3HTLX 4MA1C 5F9OH 3EJJX 4NQVB 5IESL 1VGEL 1N2RA 1ZT1B 4FZ8L 3BIKB 4RIRA 4AG4H 1U92B 3DV6B 1OAZL 1WT5A 4YK4C 1JNNH 1H3UA 1WSST 4Q9CA 4GJTB 4ZYKB 2W9DL 1CG9A 4P3DB 4AIXA 4YEFA 5BZWA 1HKLH 2UWEF 2ESVB 3BESR 3R1GL 4XMPL 2HH0H 3HNSH 1JZ8A 5DJZA 4J1UB 4Z7QF 3HB3C 1MJUL 4FMKA 5IF0B 3LKSA 4WV1B 4TUKH 1T22B 2DTMH 4M5ZH 1CFTB 1E6OL 1KENL 5I19L 3D0VA 1OAXL 4F33B 5L2KB 2XQBH 4F7TA 3CH1B 43C9A 3JTSA 3SCMC 5F1IA 2WAHA 2AV7B 3QHZL 1QRNB 3O9WC 3T0XA 2H3NB 2M2DA 2YRLA 1BZ9A 3OL2A 1JHKL 5J1AA 3GMOB 1DQQB 4LAQL 4ODWA 3EDDA 3EOAA 3MLVL 3WJJA 5IBTH 3SKNB 1AIFB 1NSNH 2VC2H 2VXQH 1I1FB 1F2QA 5E9DA 1WZLA 3KPRB 5CEXB 4MNHB 1NCCH 2VLKD 4LLVB 5EUOB 1I9IL 5H37H 3HI6H 3GIZL 5DRNA 1SBSH 5TDOB 1DEDA 1YN7B 4HXBH 4JKPL 2XXMB 1ORQA 5T1MA 2FEDC 3HE6B 2J88L 5C0AE 1EFXD 1X6NA 5D8JH 4X4MA 4TUJA 4U6YB 1PKQE 1Q9KB 4XPFL 3ZT5A 2H32A 5I9QB 2OJEA 3SDCD 5DD1L 5FM5O 32C2B 1AO7E 4XCCL 4I9WD 4U0RB 1JZ2A 1KC5L 3CSBA 1XGUA 3CC5B 3LQZA 3QFJE 5KSBF 4LBEA 3EO9H 2AXGA 2X1WL 4H26B 4IRJC 5SWSB 2BNQB 4LPUA 1CZ8H 3VJ6A 1G7HA 2VERN 1XGPA 4MSWB 4JGMA 3BMWA 3AS0A 3V0VB 4L4TB 1DUYB 4IJ3B 4FN0A 1IRAY 1BOGA 4S1QL 3MJ7B 5C2BL 3PXHA 2FIKA 3HG1E 3EYVA 4H5SA 3RNQB 3HFML 2DOCA 1EMTL 2BK8A 4XTRC 1FAKT 3MYJA 2QR0B 2VLKA 2F54E 1IGIH 4JR9L 1S8DA 4B50A 2VOTA 2QKIB 3X17A 1MOEA 1MFEH 4IRSA 3VXUE 4UBDC 2FLRT 5IWLC 5TPWH 5A40E 2P8LB 3L3JB 1EFXA 4GAJL 2YRZA 3U7YL 4HK3N 5C6TH 2ZSWA 3HR6A 1NLDH 3MUGB 4Y4KC 4DTGL 3A67L 3SDCA 1BF8A 1DN0A 3PHOB 5DURD 1PZ5A 3I75B 3MLRL 3SE8H 3NCJH 2AEWA 1J0KA 1XGYL 3UJJL 4ZDHA 4LQFH 4P9HL 1YPZA 4FQIL 3VXQA 4GRWE 2YBRA 2F58H 5JPNA 1JHLL 3ZHLA 2WIMA 1MH5B 4LVOB 4RAUA 5CSZB 2XWJA 5FECA 4WUKH 4S1RH 4QRSB 1W2KT 5J6GB 1FC1A 2D0FA 3CVHA 2X05A 3P4OA 5FYKE 3PWVA 3FRUA 4HIHB 1GGIH 2RFXA 3P9LB 2Q20A 3QUYB 5KSVA 1G9MH 3H9SA 1KNOB 5ITFA 2DAVA 3VD5A 5DGRA 4ZQKA 4Z7QE 3RVVD 2DD8H 4GAGL 4KKLC 3BT2L 3GSQA 4R26H 1R24B 3ARBC 3NCCB 1CGWA 1KTDA 3MRIB 4AQOA 5IFAH 3DTXA 3X11B 5I1CH 4WJ5A 2OL3L 2CLZB 4L8DA 4Y4HB 3NGBB 2NY3D 4PJHF 4OSUH 5DFTA 5F7DA 4R0LA 5KTEL 3WFEH 4NZTH 5FYJH 1XGTA 2ZUYA 1JGLH 1P1ZA 2AABH 1EH9A 2ZCHL 2V2XB 4MDIA 3DXAE 2VN7A 4YDKL 3RUGB 5GSVA 4WEBH 5JQHC 4TPRH 3A6BH 3QUXB 4UUJA 1Z6JT 4XXCA 3V4PH 1N0LA 5EOQH 1FNSH 1C12B 2X4RB 1A22B 3ES6B 4ZSOB 3IAPA 3X14A 4GKNB 1HQRA 4DGIL 4HWBL 1PG7H 5T3ZL 2W1NA 3AB0B 1UKQA 4WI6A 2B2XH 4XVUC 5B39A 5I75C 5IQ7L 3TWCL 5IW6B 3TZVC 4CRPA 5FEBA 5K9JH 2MTPA 2FL5A 2NX5E 3AXLB 4P5TB 1GGBH 4K7PH 5F21B 4F57H 1AGFB 3I9GL 5TDPA 3W39B 1Q9OB 4X9FA 5KSBE 2IANE 2LTQC 5IM7B 3T0BA 1RHHA 1C5CL 4F8TA 1I1YA 4NDMA 4QXUH 1FAIH 4JPWL 1UENA 1K8DB 3W9EA 4MGXA 3ZE0E 5IFHH 5DMKA 3RP1A 5CGYC 2Z93B 4BKLB 2A6JA 3T0EC 3CZFA 3S3PA 4P9MH 4XGZA 3T09A 5LBSH 1BBJA 2H2SD 2IALB 2YK1H 1I1AC 3OAYH 3QDGD 1JWMA 5ICZB 1W72L 1DQJA 1F00I 5I8OL 3PIQB 5E2WL 1VACB 3MLTB 1YECL 2CDGA 4JKWA 2ORBH 2W0PA 5EU7E 3BP5A 4JFEE 4I3SL 5ISZD 2CDEA 3U30B 4UNTA 1NFDF 3VFGH 3S5LG 5I18H 2FECI 2Z31B 5BMFL 5ITBH 2NY4D 4X4ZA 5D2NB 3R8QA 8FABB 3CK0L 5DK2A 3RY5A 2R1XA 3HC3H 1KBGH 4RA0C 1JF1A 2W60B 2JELH 1IM9A 5GS0H 1T0MB 1QQDB 3W2DH 4P2QE 1DZBA 1ZLWH 3BO8B 1XF4A 3WHE0 3H9ZA 1BFOB 1NBQA 5ADPL 3O81A 3RJQB 2WBWB 2B1AL 4G6AC 4P46C 2AI0L 2XOTA 3N1FC 4NPYA 3FMGL 4LHUD 4PRIE 2AVGA 3KPLB 1U0QA 1KPUA 4OLZL 2LU3A 4I48B 2GAZA 5JIIA 2DQJL 2XWTB 5CCKL 4HT1H 1UB6A 4EIGB 2P8PA 3SO3C 3FQUA 1BGXH 3ZYJA 1FNFA 3GJFK 1HH9B 3MNWA 4OBRA 2W38A 3ARFC 3U0TA 3WIHH 5LXGL 1WWWX 5ISZA 4XWGL 3H3BC 3OAZH 4P0DA 2VQTA 1DBML 1LNUA 3GDBA 4PJHE 4LFHD 1I7ZB 4KK8C 2AJVL 4QRTA 2A6DB 4OLUL 2R2BA 3K74B 1CQYA 4L5FH 2BVUA 2I07A 2NXYB 5E94A 3WFZA 4MQSB 2XA8H 4OCNC 1TVBA 3HPJA 4NFBA 4YHNA 1J0YA 4GW1B 3AVEA 3U0WH 1FH5H 1CL7H 4IOFC 2J2ZA 4N0YH 1I7TB 2CKBA 3SJVD 4NO3B 3GBNL 1B90A 3W9DB 4L3EB 1V3KA 1ZAGA 1VEMA 4POUB 4FQXD 3RWFA 3TVMB 3LEVH 3BPOC 3G04A 4IHOA 1AD9B 1JPGB 4LHUA 1ZSDB 3RPIA 5DVMA 4S0TD 5TH2A 5IESH 1VGEH 3BUYA 4FZ8H 1WISA 1B6UA 3ET9F 2N4IA 3EYOB 3LSOA 1OAZH 2IFGA 4RMWA 4PJ9C 2W9DH 2V2TB 3EFDH 2EDNA 3HR5B 4JFYB 3DV4A 1G7LA 1JYWA 3RVWD 1IAKB 3MRRA 5D70L 1VFUA 1VFAA 1XGQA 1V7MH 1KB5A 1MJUH 3PDOA 2P47B 3CLEL 2JCCA 3BVNB 2NY5H 4TNWF 4X4YB 5HD8D 2EYTA 2XI9A 3QJFB 1OAXH 1T4KB 2DLHA 2LAGB 4RZCA 3EYQC 4LMQE 2OP4L 2IMMA 4PBWD 3ARSA 5HVHB 4JJHA 4NQTA 4WFGD 1JHKH 1CXKA 3WXVL 1LO5A 4WUUD 1XR9B 5SX4I 3VMOA 4IDLA 3SJVA 4GH7B 5GHWL 1MF2L 2ZG3A 3U36B 4MVBD 2ZUQC 4FQXA 3HUJA 1I9IH 5D7KD 1NFDE 2CK0L 1MSPA 2G5RA 4MD4A 4LVHC 1WIUA 2XICA 4PTTA 4WEMB 2Z91B 4JKPH 3VRLE 4DN4H 5K9OB 3P77A 3FCTA 3C5ZD 1ED3A 3GMPA 3C2AH 1YEEH 4NZDA 1QFWM 3NACL 3QPQC 2J4WL 3V6BR 3BEWA 3GMNB 2A38A 1JPFA 2H2PD 1TCRA 4HJJL 4MXQD 5D9SB 2GTZB 4LLAA 3CU7A 5IB3B 3JTTA 4KDVA 4XCCH 1H0DB 3TBVB 3C87A 4HXAL 4HUUB 5AAWA 1WZ1H 3QXAA 3MRDA 1XCTA 3LS4H 2AXJA 1KG0B 4RGNC 4AZ8A 3F5WB 4LNRB 2Z8SA 4PRHE 5C0EB 1U3JA 2APXA 4L8BA 4YQXL 4X6DA 4C54A 4C4KT 5C0IB 2C3WA 4XC3L 5C2BH 1HHIA 4WUUA 1EX0A 3T1FA 4K23L 3HFMH 4UV7L 2DQDH 4MA3A 3QIUB 1WWCA 4DUWA 1I8LC 4NQDB 3D9AL 3CDCA 2XYCA 1QR1B 4YDLC 4AMKL 4YGAB 1C5BH 2WMPA 4OBSA 3F7YB 1MHCA 4UT9L 1KYOJ 2FWOA 1MPAH 3IYLW 4JN2A 4OZHB 3C5ZA 2EDFA 1CFQA 1BP3B 1MCPL 4MMXC 4OT1L 4YHIB 4MNGE 3MRMA 2FJFA 5ICXA 1MY7A 3T65B 4WWID 3NA9L 3PDDA 2AJZA 2V7HA 3MLRH 3SDAD 1FVDB 3K8LA 4XP4H 3BIBX 1K4DB 1YYLL 1WBZB 4FQIH 1OTUC 1RD6A 1JZ3A 4HCRH 3IXTA 1HQ4A 2X44D 5F9JB 3N1QC 3HAEG 4ZSOE 5GJSH 3U6RB 3EDFA 5CZXD 2B39A 2XXCB 2VLJB 3L5HA 4YAQB 5HGBB 5IVZA 5C09E 2QJDA 3ULSB 3IU4L 1SY6A 1ZA3A 3B2UD 4WTZG 2R2CA 1X5XA 1CTOA 4JRYE 5EOTA 1TJIL 3BZEB 4ONHB 4KTYA 1ZHLA 3D39E 3GO1H 5FGBC 3ABZA 1AHWB 2NY0C 3NA4A 3S96A 2GJ6E 1S3KL 4GAGH 1A6VH 3GEWB 3MFFB 4NKDA 3QP3A 4NCDA 4F7PB 5CBEB 5EBWB 5FYJU 2K3TA 4I4WB 2ITDB 2FJGB 4JFPA 5I17B 4OF7A 3E1F1 4XPHH 2ICES 5D7JD 3W0WD 5KTEH 5T33L 5ESQB 3HMWL 4KROB 4BK4A 3MV8B 1BJ1J 1Y0LB 2ZCHH 2MCPH 3NH7H 1KLFA 2J8HA 4DWHA 3SDAA 2C9AA 4YBLC 2VDLL 4K9EH 1YEJL 3MMEB 4LASL 1D5ZB 4PJIF 5K9KA 2QEJA 1FFNB 5E2VH 1JJUA 3VFUA 1G7PB 3MLZH 4HBCH 1DBAL 1ZVHA 1FC2D 2VXVL 5EC2B 3WDHA 5T3ZH 1OF2A 3MLSL 3ALXA 1MVFA 3TWCH 1ZLSH 3UZQA 5FO7A 3BAEL 1AXSA 2YPKA 3FO2B 5F7FA 2YA0A 3VGGA 2B4CL 3RGVD 4GKZA 4KI5F 1T3FA 3BH9B 5ESAB 2EC9T 4ISVB 4R4BB 1YEGH 3F65A 1Y6MR 3I9GH 1MIML 2APWA 2FSEA 4UIMA 3C2SA 3QQ4B 4G9FD 4N0UB 4TRPL 3SKJL 1QA9A 4PP2B 4JPWH 3M17A 2ZUTA 5D7JA 3W0WA 4QY8B 3T0VA 5T3XH 4Z78A 1HSAB 4BUHA 5KAQF 4GUPB 3DVGB 2JIXB 3S98A 3LQAC 4M3KB 5D1XC 1JF5A 4MWFB 5DUBB 2G5BA 1GC1L 5D96C 5BXFA 3KWWA 1N5AA 4GG6A 4L3CA 4XCYA 4IDJL 4LSSL 1AGCB 3T2PA 1JK8B 2DJUA 1RUAL 2WLZA 1IEAA 3NPZB 3S4SA 3AS2A 4FP8L 4MJIB 5DR5H 1UCTA 5JOPE 2BOCA 4I3SH 1G7JB 5A43C 3B9VA 3JWOH 3BEVA 2A0LC 4O5LL 2ZCKH 5CLWA 3MOAH 2BERA 1QSZA 1OLLA 1NMCB 4HPYH 4XVTL 2WQ8A 3MRKB 3FRPA 4OZHF 4TNWK 1UQSA 5EWIH 3RGVA 4Y4FB 1J5OL 1IARB 4WWKC 3X3FH 2IPUK 4JY5L 3FN9A 5BQ7B 1T5WA 3KPOB 4BFIA 3MSPA 3B9DA 5L2JA 1GH7A 4M9OA 5EIIA 3GMQB 2NNAB 3B2VH 5B8CA 2PETA 1AY1H 2CKNA 1IAIL 2MWCA 4G9FA 5A2LH 1D5XA 1ADQA 1CBVL 5ADPH 2WBJC 3MNVB 4XVSH 2OJZL 5HYQA 1HYSC 4M1GL 2AI0H 4RCAA 3KPNA 3QEHB 1R5WB 3FMGH 2CGRL 4X8JB 4X6CF 1NPUA 3OXSB 3C6LB 3PWPE 2DQJH 2DIBA 3FO9A 4IMKC 2OL3B 4DVBA 4J3SA 3OKKA 4NSKB 4Y5XC 5EU6B 3RWGA 5I0ZA 1C5DB 1NMAL 1BJMA 3FOMB 1EAPA 5IVXA 3NIDF 1QVOB 1D5MB 5IMKA 3G08B 2YD4A 4P99A 5DEFA 5LXGH 1FBIL 2A77L 5K93A 4S2SB 4LRIC 1KTLB 2EYSB 5C0CB 3TJEH 5DQJA 1CLZL 1DBMH 3VI4F 2AJVH 4OLUH 3REVA 5DJAA 3DETD 3RVXC 4ODSH 4U1IA 4XP1L 3PNWA 3QQNA 4PJIE 1D5IH 1HH6B 4WW2F 3IKCB 5CEZE 3L95B 4LSQL 1LE9A 1NEZA 3ULUL 3GBNH 5C3TA 5JIHA 3FHAA 4YHML 5I2IB 2HA1A 4QRPD 2VE6A 2X1OA 4YH6A 4G43B 2ZSVA 4K71C 5MI0C 1U3HC 4HV8A 5J3HC 5EDXA 3AS3A 4M02A 3HE7D 2BVTA 2VQ1A 4DOHB 4KI5E 3CDGB 3QI9D 4JY4B 4PJGE 3UBXG 3TBYA 2XWBB 1UM5L 2Z8VC 2MQ0A 5D70H 3WO3B 2DQGL 1YN6A 5IEHB 1U58A 5IBLC 4OGAC 5IW1A 4X5XB 3BYTA 5IW3A 3BPCA 3G9AB 1GGYA 1W72B 3LKQB 4U33A 5D93B 4KDTA 5J12B 4JGUA 2ZWLT 4BZ2H 2W0LA 2NLJA 4QRRB 1F4YL 1L0XA 4UB0L 1S9YA 1Z9OA 1N6UA 4ZFGL 5DJ6A 5BW7C 3CFDB 4KJQC 5FYKH 2R1WB 1PAMA 2ARJB 3WXVH 3S37L 4FTVD 3T3PF 3MCLL 4PRDA 4NQSA 2HP4A 1MF2H 3P73B 3WIIH 3UTTB 1U8MB 2IAMC 5FAAA 3UTZB 4QRPA 3BE1H 5E08L 4WFHD 5HYIA 3OG6B 1RPQA 4RQQB 3OKDA 1OL0A 1YC7A 4OZHE 3HE7A 4DAGL 4QGTA 4YX2H 3QI9A 1A21A 4CVXB 4JLRA 1I85C 2VR9A 5F1SA 1SJHA 5F3HB 4ZO9A 2IG2L 3ILQC 4L9LA 2X4SB 1WFNA 2P8MB 4PV9A 1CXEA 3W11C 2YZ8A 3I3DA 1VEOA 3CX5J 3QG7L 3VXSB 3PQYD 4P2RB 3AM8C 1VFBB 4X6CE 4Z7WA 4MLIA 3OXRA 2BRRL 1FVEA 1YNLL 2PUQT 1LO0L 3GJFH 4YQXH 2E27H 5DJ2A 5DSCB 4FTVA 5IIEA 1E4XI 4EI6A 2DIAA 3ECBA 1CLOL 3NIDE 2FATL 3O2VL 1P5UA 3D9AH 4G8GB 4KK5D 1HINL 2B20A 4AMKH 3T0WA 4HWEH 1BJ8A 3QUZD 4ELMA 3CPLB 4WI2A 3VE0B 3QIBD 2FCBA 1CF8L 4U1MB 1ETZA 5DRZA 3ARPA 1A4KB 4WGVB 5F7YC 2VL4A 1ZS8A 2X41A 1ZT4A 4FHBD 2L0DA 3FKUS 5DO2D 3A6CH 3NA9H 1H8SA 3SGEI 2VB5A 2ENYA 5KW9L 2HJLB 4UQ2B 4QHNB 3J8F7 1ROWA 5EB9A 5BO1L 5I1DA 4WI9A 2GCYB 2A83B 3T2NL 4OFYD 2HFFA 3QEGL 4PRBA 1U36A 4FFYH 2N7BA 3LIZL 3IU4H 1XZ0A 1KIUA 4HUWB 3AFLA 5DJ8A 5GJTL 2X4QA 3LRSB 3EO0A 2D4FA 4JFXA 2SEBB 1S7WB 4KXZI 3I6KA 4KC3B 4XWOC 1TPXB 2I25N 3UJTH 2DQTL 5GZND 4FZEH 5FYLE 5KOMC 1IZJA 1S3KH 2NY1B 4HBQA 3QUZA 4N8VA 5C08B 5IROC 2CH8A 4QYOA 3QIBA 4KJWC 5EU4B 2I9LB 4HS8L 1ACYL 3KPPB 2QADB 4R7NB 5D5MB 1AE6H 2OR7A 3ZKXB 4Y2DD 1OARL 1F4WL 3T3PE 3V79C 3PV6B 2K7PA 1BQSA 4LASH 2Q86A 1J1OL 3PL6C 4NO2B 4OUUB 3SGJC 5DMJB 1CGVA 1X5YA 4NHUB 4OTXL 3EZJB 1DQTA 2FX9L 4L8SC 5IP4A 1DBAH 1IMHC 4N1CA 3MRPB 1DDHB 2PO6B 4OFYA 1EHAA 2VXVH 2X4NB 4PB0H 1INDL 5IB1B 4OQTH 1EO8L 1OB1A 1N59B 1K6QL 2NW2A 2EDOA 5I1AB 3VWKB 2B4CH 1OWRM 1AGEB 1BECA 2MFNA 1MWAH 4HX1A 5H35B 3SY0A 4OUOA 5GRJL 4KKAD 1JFQH 3SQOH 1A7RH 4RMVA 3TBTA 2Y25A 4PB9L 1OY3B 2QHRL 1FNHA 4Q2ZA 1MIMH 1X5LA 1QSFE 4HS3B 1C16A 4LF3B 4PS4L 4XNZB 5GRUH 4QHUA 1ZGLM 4HUXB 3KNBA 2P45B 3BFOA 3W5NA 2A6KB 2XY1A 1PQZA 2PTTA 4MB5A 3ZE1F 1JPTL 3HMXA 1FO0A 4J3UA 4F9LA 3HS0A 3HZKA 4NZUL 3T4AB 3AC0A 1VENA 1F58L 4Y2DA 3FONB 1A1OA 4OZIB 1DSFL 2C3XA 4WNQA 1U8JA 1HZHH 2R2EA 2WSKA 2GSGA 4BELD 4LSSH 3VDAA 4UNUA 1RUAH 1I9EA 3QBTB 4NQEB 2IQ9H 3RKDD 2EE6A 4FP8H 4WO4D 4AEIL 2DI7A 1EV2E 1SMAA 1H5BA 3VGHA 3MLYH 1EO5A 4O5LH 4LVNC 3PGCB 3D69A 3JV5A 1QP1A 4L4VE 2CUIA 5GGTH 4WHTB 2GQHA 4DN3H 3D18B 4JY5H 3V7AE 5D7IB 5D7LB 3RPKA 5GS1B 4R2GC 1AKJD 4G6FB 1PVHA 3P9MA 2GK0B 12E8L 1KLUB 1L0YA 1F11A 4M4PA 2Z4QA 3MUJA 1K8IB 4HPOL 5HYJD 2D7TL 3VXRB 3IDYC 1T1YA 2VL5A 5H37G 3NPSC 1PY9A 1WFOA 1FPTL 4M48L 3WJJC 4NQXB 4EIZC 5IQ9B 5E5RB 4NBXB 2ICEA 2EH8H 4DK6A 5C0AD 1B2WL 5HYSB 1IZKA 1NCDH 1HXYA 5BV7C 1V7NL 1T80A 1CD1A 1KIPA 4WO4A 1O0VA 1U8IA 1AO7D 4M93B 5BS0B 1HNGA 5JUEL 1OLZA 4BH8B 4LP5A 2A77H 4K7FB 2NY7H 3KS0J 4LLYA 2GY5A 1LDPL 2AKRB 4YFLI 1YY8A 1FDLL 5ID0B 2FH8A 3SDXA 3QJHA 2F53B 3BXNA 1S5HB 2EEBA 4XP1H 3QUML 3O4LB 4LLWB 5I15H 4HUMB 3OR6B 1A7OH 4G5ZL 5DA0B 3CNKA 4OF3A 4JFFB 2IFFH 5HYJA 4N0CD 2O61A 15C8H 4RNRA 3T8XB 1KN4L 1MI5B 1UYWH 3UC0L 3WNLA 4X7DC 4G8EB 3MXVH 3OKNA 1WAAA 3V5HB 3RNKA 4UTBL 2W0FA 4XCFL 5C0AA 4PLNC 5SWZE 3H8NA 3BWAB 3NZ8A 3UTPD 1DEEB 1Y18A 2PYEB 3MJ9L 1DLHA 1AGDB 3BZ4B 1TTFA 2DQGH 1AO7A 1F6AA 4ZUWA 2P5EB 4Z9KB 1OSPH 4UTAL 1SBBA 4KI1A 4HJGB 3V8CA 4HFWB 1B4RA 1I4FB 3QNZA 1UKTA 3N1MC 3SDCC 5TE4H 4ZAKD 4R4FL 4D9RE 4AL8L 4PBXA 4EI5C 1F4YH 4YR6A 5JOFB 1AQKL 2V5TA 5CP7B 4NKMB 3QHTC 3S37H 5EIQA 1S7RA 3OJDB 1WC7A 4OZIF 1KJ3L 2YUVA 4ODVH 1GOHA 1HEZA 3K4AA 4M7LT 4O2FB 4XNMB 1P7KA 3ZSTA 2PW1A 4KKBC 5E08H 1G7IB 3MROB 1QOKA 1U6AL 2FBJL 3B6SA 2MHAB 5H8DA 4CNIA 1G6RA 4NUJB 2PKDA 1AXTL 5E1AA 3Q6FB 4YZFE 1DUZB 5ABDE 1GPOL 3F7VB 4MJ5B 1KJ2A 2G75A 3DXAD 2R0WH 3B9AA 2IG2H 3ARDB 3DIFB 3GSVB 4LKCA 1AJ7L 1MCBA 2BVOB 3QG7H 3WNOA 5GZOD 3S4SG 1ONQA 1A6ZB 4ZAKA 1VPOH 3QFDA 3SGDI 2FD6L 1JGDB 1DVFD 3FFCE 4RGMB 1YNLH 5AG9A 1LO0H 2UZIH 2NX5D 4FOMA 1NBYA 4PRNB 1J0ZA 4LDOB 5IHBA 2UWEA 5GRXG 3RTQA 3ARXA 5D1QD 1HINH 5D7SH 4MHHG 4DVRH 1TZIB 1FSKC 5FKPA 2HRPL 3OSKA 1I3RA 1CF8H 3SBWA 1LK3L 2OM5A 1A0QH 3RVVC 3DGGA 1CDCA 4Y19E 4J8RA 4ZFFA 2IH3A 3DXAA 3RL1A 1F90L 1SM3L 4W4OC 2NYYD 4HC1A 3KPMA 4GKSB 5I1JL 1X3DA 5J06A 5I1HL 5SWQB 5BO1H 2D7PA 2H8PB 1VGKB 3AU1A 3QDJE 3GUTB 5GRVL 1WBXA 1TFHA 3OGCB 4GSDH 3C8KA 1NANH 3LIZH 5IBUB 2BNRB 4X8XA 1Q9WA 5F1KC 1KPVB 4F7CB 2V2WA 4GW4A 2FH6A 4AJ0A 5AD0B 2FHBA 4DQOH 4LCYA 3FN0L 4M43H 3MV9E 5ALBL 4YGVB 5DK3A 4PUBL 1AC6A 4LKXA 5D1QA 1KJMB 1A6TB 5DHYB 2Y36L 3VG0H 3UTOA 5CIPB 5F6IB 3JXAA 5KSBA 1FFRA 1OP5K 1RHFA 2A74B 4Z5RB 3U46B 1TVDA 2ICWB 3UTQA 2E8ZA 1YC8A 3ESVF 4D94A 2WUCL 1ACYH 3IF1A 4TVPE 1ZANL 3QXWA 3T04D 1UH4A 3W82A 1FZMB 4MXWH 4B41A 3SDYL 5TQ0L 4DZ8A 4XRCB 1GGCL 3STBA 2ITCA 3Q2CA 2ZCLL 3HRPA 1NC4A 4OZIE 4M6OL 4YDVA 1ERNA 2Y06L 1FV1A 5ALCL 2YEZB 1G0DA 1XR8A 2J6EL 4HK0A 1NCNA 4JFHD 4PREA 5EU3B 4OI9A 5IOPA 4OTXH 2ESVD 2FX9H 3V6OE 3HRZB 4LNVA 5E0QA 3RWIA 1O5DT 4PJXA 4KK6D 3MODL 2DLIA 1ZVSB 4JJ5A 2H2SC 1UWGH 5L2KD 1K6QH 4P48A 3C08H 4MB3A 1NL0L 4CDGC 5IMOB 5I16B 3DURA 3LPFA 5IMMB 1QRND 4OF6A 3BN3B 5E5UB 1H8NA 1S7VB 3UZEA 2DM2A 3JBG7 3EOBA 4PS4H 3TBSB 3WS3A 3BPLB 3EAKA 5LG1A 5CEZH 1NJ9B 1YEDB 2AGJL 3CFBB 3OX8B 1FQ9C 4PFEA 5DC0A 4PRAB 5IB4A 3L3DB 1T1XA 3KPRD 3REWA 1JGVH 1WICA 3ULVF 3AMKA 1P69B 1JZ6A 3U9PH 1DR9A 4WCYL 5D72L 1F58H 1RMFL 2YRPA 4KRPB 3S35L 4NQVA 3N85H 4O02L 1UVQB 1ZT1A 3BIKA 1DSFH 2BVPB 3K80A 3U4EB 2DB8A 3DV6A 5HHOB 1ZK9A 4HS6B 4M00A 4P3DA 5FGCE 5JW3H 2ESVA 3DGCR 4OZGB 4O2CB 4CAGA 5BZDB 4DW2L 2W07A 3FO1B 3WNNA 4XVJL 1N5YL 4GXVL 5M7QA 5IF0A 1I7RB 2J12B 4WV1A 1T22A 3TO4B 1CFTA 5L2KA 5C6WH 2JTDA 4F33A 2BNQD 3CH1A 5J4MA 4OLYH 1SYVA 3OKMB 1AR2A 4GBXC 1QRNA 2GEEA 3GSOB 3V5KB 2H3NA 4J7RA 1RJCA 4L4TD 5EZIH 2EDXA 4XNXH 4YK4B 3GMOA 3QEUA 5KN5B 1E27B 3TYFB 3DVFA 1JGUL 4JDVB 4M3JA 3SKNA 1AIFA 3NVQA 1I1FA 2LAAA 5C0BE 1FNEB 1P2CB 3MRLB 4HPOH 4P2CG 2APTA 4I13B 2D7TH 3QULB 3KPRA 4MNHA 4LLVA 5EUOA 4GOSA 4FMFA 4FXKB 1LP9B 4PR5B 1FL3A 5TDOA 1HYRC 3DUUB 1YN7A 2CIKB 1QYGH 5F8QC 1J8HE 3SCMB 3MBED 1E4KC 2FBOJ 3KR3L 5GGQL 2GTWA 3O9WB 3IFNH 4FQXC 2EECA 4U6YA 1Q9KA 1H3TA 1V7NH 2JB5H 32C2A 5JUEH 3LDBB 4RFNB 3WNPA 5KZCB 1U91A 4Z0XB 3BJ91 4H26A 5DT1L 1MCDA 5HHVL 1A3LL 2BNQA 5SWSA 1FDLH 3RVWC 2EIEA 4OCXL 1XH3B 3D85B 4MSWA 1GZPB 1PG7W 2VH5H 3FOLB 2JJUA 4PJDF 4PRHD 1I8IB 3V0VA 2QV2A 4RSVA 4L4TA 1DUYA 5HD8C 2Y72A 1BREA 2AJYL 3MJ7A 1QSEB 3QUYD 3RNQA 3TEUA 4G5ZH 2F74B 2YPLB 3WJLA 3BWUC 1YNKH 4MCYB 1OM3H 2QR0A 4I2XB 1KN4H 3BDYH 3UC0H 4ZTOH 2QKIA 4IRJB 4N90E 3VFOB 3MBEA 5FK9B 3UYRL 5C07E 5L88H 3N9GL 4UTBH 2ADIB 1J1XH 4MVBC 2P8LA 3L3JA 2AS5M 2LV4A 3MA9L 3T08A 3MJ9H 4G6MH 3PHOA 4H88H 3I75A 4GQ9L 3EJZD 1IGTA 3DYOA 1S9VB 4U1KB 5MENE 3ULVE 2H2PC 1MH5A 4MXQC 2ZG2A 5CSZA 1X5JA 3HZVB 5C70A 1MVUB 5KG9A 2I24N 3DVNA 4AL8H 4EZMA 4QRSA 4GMTH 1RIHL 4PRHA 1B0GB 5J6GA 5C09D 3GBMH 2A9NH 3LQAL 4JGJA 1N3NB 1RU9H 4M61A 4HIHA 3EKCA 4PRPE 3L3GB 4L9DA 3P9LA 1K4CA 3QUYA 4P5TD 4ERSL 1KJ3H 2OBGA 4M7ZC 4PY7B 4Y4KB 2WP3T 1ZLUH 4KY1H 5AWNL 3RX7A 3BSZH 3D39D 1I7UB 2W59A 3WUWG 2PF6A 4OCRL 5FYLH 5CBAB 4NM4L 5AYUL 1R24A 2VLLB 2HTKD 3V2AR 1HOCB 3BIAX 5A3ID 1P5VA 4N1HB 1QO3B 1Z2KA 5E8DL 3S88H 2ZJSL 3X11A 2CSPA 3BGMB 1AXTH 4AEHL 2CLZA 4TVPL 4KV5F 4Y4HA 1H3PL 2VYRE 4OCSL 3DX7B 5F7HA 3MJ6A 1A1NB 4IMLB 1CDJA 2V2XA 4IS6B 4MXVF 3RUGA 5KVGH 3VFRB 4JZJC 1AJ7H 2OR8A 2BP3A 3MRFA 1C12A 2X4RA 3ES6A 1T1ZB 4ZSOA 3ARBB 3LZFL 3SDAC 1PY4A 4GKNA 4POYA 3Q1SL 3R06B 5C09A 5JDJA 4JFOB 3UAJD 4OQ1A 1FN4A 3AXLA 3ARUA 4P5TA 3WDIA 3BPNC 3LKNB 4P5KB 4GRLC 4NIKB 3GSRB 3D39A 4U7SA 1IEBB 3QUMB 3DYMA 5ERWB 1AGFA 4NT6B 3W39A 3B2UC 2QLVB 5FGSA 5IM7A 1MEXL 2JJTA 1G9MC 2HRPH 2DQIL 2XRAL 4TQEH 1FNGA 4OFIA 5IGXH 2X4UB 3QYCA 1K8DA 3UPRB 4PJDE 4CMHB 5C9KA 3BRDA 5KANG 1FCCA 5I75B 1YEIL 4JQXC 3IS0X 4LLQB 2Z93A 1CGSL 1F90H 1MNUL 1BD2B 1M05B 1CFBA 1MFCH 5TF0A 3U7WL 5C0NC 5I1HH 3ILPB 1SJEB 2UZXB 4JRXE 2IALA 2M26A 2PXYD 5ICZA 2LTQB 3KYOB 3PIQA 1DQLL 3MLTA 5AYQA 5JOPD 2QQLL 1RY7B 2HG5A 1YPZF 3D0LA 1P84J 2Z31A 5D2NA 8FABA 1BFTA 3GIVB 4DGYL 3HI5H 5D71L 1JPSH 1OHQA 3M45A 2WW8A 2E7BA 5CP3A 3T0EB 3NCBB 5CZVL 2NXYD 3QCTL 3HC4H 1SJVA 5DEGA 2W60A 3VI3F 1TMCB 1Z9MA 4WI3A 1T0MA 2HFEB 1QQDA 3SGKA 2UV3A 4X9BA 3NFSL 5KVEH 3RGVC 1I1AB 1BFOA 3HZMB 4L3ED 1J0IA 4FS0A 2AK1L 3TVMD 4LSUL 4E41B 5FV1L 4S10A 4G7YL 3LCYA 3SDYH 2H6PB 1GGCH 4I48A 2V17H 3S36H 2Y06H 4TOYH 5HHOE 1OW0A 1X5GA 3EDJA 4JM4H 5EFIB 3O11B 3HNTL 2PXYA 1HH9A 2AQ2A 3KJ6L 1VSCA 3B9KB 1LO2H 2BX5A 3SKMB 1BAFL 2YSSA 1FCGA 2HWZL 4GMSL 5E9DE 4ONFH 5JHDB 2DM7A 1I7ZA 1QEWB 4Y16B 3TIEB 1QFWL 1HHJB 1UEMA 2A6DA 4MXVE 4RMQA 2VDKL 4DFIA 3MV7B 1IC7L 3ZKMC 1LMKA 3SO3B 4GW1A 1QACA 3QH3B 5EOCJ 1J1PH 1I7TA 1JWSB 2YUWA 5FCUL 1DE4B 4NO3A 1JZ5A 3W9DA 4L3EA 3LRGA 2FEEI 3TVMA 1KT2B 4WCYH 5D72H 5T5NF 4HIJB 1AD9A 1JPGA 3K7UA 1ZSDA 4KAQH 1RMFH 3S35H 3RX5A 1BWMA 4ZPTB 1A6UL 3MACL 4J23A 1FRGL 3EYOA 4OJFH 4TSCL 2I9TA 4XPAL 4KI5D 2RJMA 4N5ED 4BM7A 4EN3C 2V2TA 4LSDA 1CR9L 3HR5A 4JFYA 2R2HB 2FHFA 2XZCH 3LAFA 4FQLL 3VWJC 4RWYL 5I1IL 1IAKA 3JWDC 3QDAA 2DM3A 3LPWA 4KJPC 4YFLF 5DC9B 4ACPA 1N5YH 1IAMA 5HJ3B 2Y5EA 3QPXL 3RI5F 5MEOB 4X6BB 3WNKA 1SEQL 1X4YA 3I84A 4LSVH 3VD7A 3BVNA 1TQBC 4X4YA 3QJFA 1T4KA 1A9BB 1HI6B 2VLKE 5EN2B 4E9LA 1DFBL 4P2OD 3P4LA 4E42B 1DL7H 1NC2B 4JO1H 4XH2B 1X5IA 5A2JH 1MY5A 1T20B 4QRUB 2MJWA 3TN0D 5DTFB 3MXWH 1JGUH 1QSEE 1S7TB 1MCIA 4I18C 3IDIB 1XR9A 5F96L 1TQCB 3QIUD 3IDJA 1MJ8H 4NQDD 3U36A 2YN3A 2EDTA 3H42L 3UJIL 1LEGB 1YPZE 4FQ1H 4PGJA 2XZAL 1M71B 2Y07L 5EZOL 2C3HA 1UEYA 5JQ6H 2Z91A 3M8OL 5K9OA 1QBAA 4PGEB 4ODUA 2VDRH 2ZG1A 2VXTL 3V0WH 3VI3E 4G42B 1OP5H 3GMNA 5TFSL 5SV4A 3O2DL 1UACL 3ARQA 2GTZA 2VISB 5D9SA 4U6VH 5IB3A 4BH7B 1EUTA 4WY7L 1H0DA 3QI9C 5JO5B 3TBVA 3H9SE 2C26A 2VWEC 3OKOB 3GB7B 4HUUA 2EICA 4WI5A 1T2QL 5HHVH 1MRCH 1A3LH 3OKLB 4P2OA 4MCZB 2NY2B 3BKYH 2FGZA 2VLJD 3F5WA 4LNRA 5C0EA 1UG9A 4FXGB 4JCMA 2O5YL 2R1YB 3MCKB 3KJ4B 1T03L 4NHCL 2AJYH 3GHEL 5B22A 5C0IA 4UIKH 3SDDC 3QG6B 4ZS6D 5CJ5A 4G80B 4LP4A 2GIYA 3EYUH 3QIUA 4QTIH 4NQDA 5CKGA 1QR1A 1RURH 3F7YA 4G6JL 2AXHA 3CFCH 2KL6A 4Q9QH 4P59H 4NC1E 3QAZC 4OZHA 3UYRH 1MCSA 5C7XL 3O6KH 1L6ZA 1QG3A 4JDTH 3C6SB 3MA9H 1O7SA 5SX4H 4WGWB 3T65A 3Q6GL 3WXWL 3MV8D 4JEGB 4MA7L 1VFMA 2G60L 1ZGLP 1FVDA 1K4DA 1WBZA 4X7SH 4M8VA 1CE6B 4Z7VB 4YDLB 2XNAA 3UDWA 5LWYL 3NFNB 2Q6WB 5F9JA 2DIJA 3GI8L 2BDNL 3FQRB 5DQDL 1Z0MA 3U6RA 5KS9B 4U1NB 4ELKB 4KTEL 2VLJA 4YAQA 1YEKH 3O3DB 3ULSA 2ZNXA 1G9EA 1UCBL 1UWEH 1B0RB 3J7HA 1IGCH 4DUVA 1A64A 3BZEA 3LD8C 4X83A 4ONHA 1JYVA 5AWNH 1JNLH 3U9UB 4LGSB 1AHWA 3QCVH 1FIEA 3OKYA 4NM4H 5ID1B 3MFFA 4F7PA 5CBEA 5EBWA 1A9EB 1OGAB 3EBAA 4I4WA 5E8DH 2ZJSH 2ITDA 3HHRB 4KK5C 4MJ2A 4A6YL 2FJGA 4CU8A 4TVPH 3V95A 5I17A 1E4XL 1MRDL 1H3PH 4OCSH 3QUZC 5ESQA 3MV8A 1Y0LA 3JSSA 2CRMA 3QIBC 4WW2A 2XZQH 2JIXD 3QZWG 3CSYB 3V4UH 1GAFH 4CJ0A 1D5ZA 1QFHA 2DWEB 1FFNA 1JNHB 2NY0B 1G7PA 1JGEB 5DO2C 3IXAB 5EC2A 2LABA 4PJ8D 4NUGL 2HTLD 3WFDH 1Q38A 3MOBL 5F9WC 3V5DB 2CLVB 4UILL 1JWUB 3FO2A 1ORSB 3O6LH 4Y4FD 4JQVA 1MAKA 3O2WH 5BV7L 3BH9A 4NQCB 4ISVA 4YBLB 4BFBD 2APVA 5HDBF 1QSFD 5J11C 1KIRB 2Z92B 2XRAH 1ZLVH 3QQ4A 1PG7X 4N0UA 4OB5L 3L7EB 1DBBL 4PP2A 3WKNA 5GZNC 3WIFB 1OAUH 5ISZE 2JJSC 4K7PX 1YEIH 5F7KC 5JZ7D 1HSAA 5E99L 1JL8A 1CGSH 2Z0BA 3C6LD 5CSBA 3DVGA 2JIXA 5DUBA 4MWFA 3EOTH 3U7WH 5DD0L 5EU6D 1LILA 5IFJA 5HPMA 3ARWA 4F9LC 4NBYB 1AGCA 1JK8A 3BGAA 4Y2DC 3B3IB 2YC1B 4TULL 1PYWB 1DQLH 4YUEL 1ZHNB 4PJ8A 4K9EC 2EE2A 5L8KB 1G7JA 4DKAA 5EZJB 4BZYA 1FNLA 3RI5K 2OTUA 3MRKA 4DGYH 1YUHB 4L4VD 1CFSB 4Y4FA 3TM6A 1J0HA 2ZNWA 4J4PD 1H5BC 4OLEA 2P49B 3KPOA 3ZDZF 5D1XB 3VXNB 4EXKA 5C0GB 3GMQA 2NNAA 2D31B 5T1KB 1EHNA 1QSFA 1RFDL 2YD7A 4RA3A 2J8UF 2R4RH 4EUPA 4Z95L 4JFQB 4KKAC 1PLGH 3MNVA 3L1OL 1YZZA 1NFIA 1R5WA 4X8JA 4G7YH 2V7NB 5KS9F 3NFPB 3OXSA 4JO2L 3C6LA 4OI7A 2OL3A 2DMCA 1OCWL 1WLHA 4PGDB 4WWKB 5EU6A 1QNZH 3QXTA 1C5DA 4RRPA 3CFKB 3LMJH 2YA1A 3LEXB 2Q3ZA 1MJ7L 1WV7T 1D5MA 3KJ6H 2V9RA 2WBJB 2QSCH 2J5LC 1BAFH 2EYSA 4D0BB 5ICYB 4UI2A 3SJVE 3HPLB 3FZUD 2NR6D 4K8RD 1MCLA 4HWBA 2GJZB 3WFCH 4QRRD 3QWQB 4J4PA 2LVCA 5SX5K 4XPTL 5I66B 3JWOC 4MNQB 1MAMH 4BQ9A 3STZB 1HH6A 4RBPH 5DMYA 1N64L 3IKCA 4QKXB 3L95A 5BRZB 1R5IB 3P0YL 2OTWB 1A7PH 4K3DL 2DDQL 5I2IA 4RFOL 1RZGB 4R4ND 4UT7H 1IAIM 4G43A 2EO9A 1TZGL 3ARED 3SQBA 1CLYL 1ITCA 3BISA 5IMLB 1WIOA 3CDGA 3O4OC 4JY4A 3GM0A 1TIUA 1E6JL 3O6MH 5IK3A 5KSUB 1S9XA 1WGOA 1CICB 1CR9H 3F62A 3H9HB 3TBWB 4Q0XL 4GAYB 5HDBE 3S5LB 2Y9RT 1HSBB 4PJBB 5B4MD 5KVFL 4D3CL 4RWYH 4FQLH 3D25B 1NAMB 4PJFB 5IEHA 4WUUE 2HLAB 1U8QA 2VDNH 3TT1H 4X5XA 1NFKA 4GG6F 1W72A 4ZO8A 3FB6B 3LKQA 5IHZA 1HHGB 1URLA 1DFBH 4K71B 3CFEB 4NOFA 5D7KE 4D9RD 5I8CB 1U3HB 4LPTA 4QRRA 2HJFB 4MAYB 5DYOA 5HHMB 1MFBH 1FFOB 2BFVL 3CFDA 4LARH 4TSAH 2R1WA 3IDMB 1KYOK 3MV01 2KQMA 4E5XB 3BN9D 4AM0B 2XQYK 1GHFL 4G8GD 3UTTA 1MFDL 3UTZA 1MUJB 3HI1A 3UJIH 2XZAH 1PZUB 5EZOH 2Y07H 1UM6H 2GITB 4RQQA 3OPZH 1QFUL 2IPUG 2IPTL 3M8OH 4H1LH 4KPHH 1UM4L 1WIPA 1E4WH 3AAZB 2VXTH 1X5AA 1SVZA 5DJYA 3GHBL 3ZDZE 4CVXA 5FHBL 3WKMH 4GS7B 4HHAB 5MP6H 1ZWIB 5F3HA 3C60C 4UNVA 1BIHA 4RWHA 2OX5A 2J8UE 3UP1A 1EGJL 2X4SA 1UH3A 3G5VB 2P8MA 2X1XR 1TJGH 1A14H 3OB8A 5HDQL 1T2QH 2YUZA 3VXSA 4P2RA 1X5KA 3IJYA 4M7KL 5IVXF 4QF1B 5E8OB 3H2WA 3GSXB 1UXSB 4XP6H 5H2BB 3MLUH 1T03H 4NHCH 5DSCA 1TENA 4ZAKC 4F15C 5KVDL 1M7IB 1YNTB 5GRWA 3PWJB 4G8GA 1FIGL 4BSWB 3PJSB 1CD0A 4G6KL 4G6JH 1RUMH 4X4XA 5C86A 3I6LD 3MPCA 5C08D 3CPLA 3KYNB 4HIEB 3T3MF 3ZDYF 3FT4B 3VE0A 3WN5A 3KVQA 2YUXA 1R0AH 4U1MA 4OIIL 5C7XH 2QADD 5FUOL 2HT3C 2R8SL 1A4KA 3MUZ1 4NM8H 4Y19D 2LQRA 3C5SB 4R97B 3WXWH 2C3VB 3TA3C 3PWUA 4JAMA 3QR2A 1S7QB 3GSNH 4JM2F 4P5MB 2HJLA 4UQ2A 4QHNA 4C57C 4ALAH 9CGTA 3DO7B 1T04A 2GCYA 3GI8H 3L3OA 2BDNH 2A83A 3H6JA 5JW4Q 4ZUTB 5DQDH 2PO6D 5JIKA 4X6FB 1U93B 1MHHB 1FGNH 5ADOL 1UZ8B 5ETUB 1JYXA 1S5IH 4U1LB 4WI8A 4BUGA 4LSTL 5GZOC 2KDGA 4LRNL 1GRWA 3UPCA 3OJMB 3LRSA 3OKEA 2PCPB 1S7WA 2SEBA 3L3HB 3VWKD 3W0WE 3MLWH 3GK8H 1MHPL 1U8LB 2C4FT 2GK2A 1U8OB 4NP4L 2Q8AL 1DVFC 3HA0A 4QTHB 4IRZH 4GG6E 4M5YL 5C08A 2XPGA 2I9LA 3K1DA 5D1QC 2EEAA 1GXEA 4LHQB 3KPPA 4R7NA 1E4XH 1NGYB 1MRDH 4NN7C 5D5MA 2DTSA 1FGVL 3KDMB 5HI3C 2OI9C 1YMME 1KFAH 1EEZB 5ANMB 4YXLL 5C0JB 5LGHL 4IOIB 3KHQA 2EDYA 4QRQB 4NO2A 4OUUA 4X80L 4UINH 5CWSB 5J89A 1WJ3A 4NHUA 3OZ9L 1NMBL 5IB5B 1DDHA 1REIA 2PO6A 2NYYC 1NGQL 2NW3B 1U9KA 5IB1A 4NUGH 2ZP0T 1JCKA 4OGYH 4G9FE 4F37F 1JE6A 1H9VA 1TETL 1T1WA 4UU9B 5DVLA 1N59A 3HN3A 4UILH 1V3LA 5DJCB 3SGEH 4EOWL 5I1AA 1RJZB 4GT7A 3VWKA 1MREL 1AGEA 5GGVY 2X70B 2EXWD 2QTEA 3EZ8A 4JPVH 5H35A 2BVQB 5D7LD 4AG4L 1HDMB 2VDPL 4C56B 2CIIB 4HS3A 4LF3A 1JNNL 3PL6B 4G6FD 4MDJA 3IFPA 4ETQB 3LKRB 2M1KA 1X6LA 4HUXA 2H32H 1SJXA 4OB5H 5IVXE 2PR4H 2A6KA 2C7UB 4YDIL 5EA0L 3QQ3B 4L1DA 1UA6H 3WLBB 4KXZH 4G8FA 4CJ1A 3T4AA 1Q72H 2RAMA 4M5ZL 5E99H 3FONA 3VGDA 4ZOAA 1W0VB 2XQBL 4OZIA 1UB5B 3ZL4H 5E70A 3HAEB 5DD0H 4LEXH 1CE1L 2ERJB 1EEYB 2YD3A 2V5MA 3ETBF 3P11L 3V6OA 4YUEH 5BS0D 3ZDYE 3T3ME 5IBTL 4V2CB 1NSNL 2VXQL 4JHZA 3L9RB 3ARGD 3PGCA 1Q0YH 5DHVB 4Q6IA 1JI2A 4CVWA 2I5YL 3WE6B 3GMRA 3HI6L 4NNYB 4WHTA 1SBSL 5KAQG 1BFSA 4KK6C 2F53D 2BRQA 3B9EA 4MNQE 5D7IA 1HK6A 3TT3L 5D7LA 1MCOL 3EFFB 5HHQB 5GS1A 1A6WH 1RZIB 1RFDH 4NRXB 5D8JL 2FJHB 2GK0A 2B5IC 1K8IA 1T7WA 1V5JA 5J7CC 3L1OH 4NCC1 3TIDB 4M6NH 1F6FB 4U2ZA 4LVNB 4P23B 4NQXA 4KGLA 5IQ9A 3EO9L 4A6YB 5DJZB 3IRZA 5E2UL 4MQTB 5FB8B 5HYSA 2WIIB 1CDHA 1KF9B 2N1KA 1MQKH 4YXHH 4RMTA 2OR9H 4HLZG 3CVHH 2PYED 4V2BA 1SY6L 3VRIB 4MJ6B 5F1IB 5BS0A 5IHUL 4BH8A 4K7FA 1JV5B 3TGXA 1T6VN 3IDYB 1OP9A 2IMNA 4FQHB 2AKRA 1KCVH 1RIVL 4QOKB 1B0WA 4QRPE 4X9HA 1IGIL 3I2CH 3KPQB 4HK3J 4U0RC 4V1DB 5E6YA 2F53A 4X5LA 1MFEL 4HFUH 1S5HA 4F58L 3VFTB 3O4LA 4LLWA 4U05A 1P7QB 3TH2T 1F3DJ 3EHBC 4IIQB 4F8QA 5BV7B 3OR6A 4HWUA 5GRZA 5EC1A 3IJSB 1N8ZB 3S97C 1UWXK 3P0YH 4DKFH 4JFFA 1J9CT 2DDQH 3T8XA 3SE8L 3ISWA 4IJ3C 4RFOH 1MI5A 2ZUUA 1RZKH 4LQFL 4G8EA 5CJOH 2F58L 1U42A 2F19H 4U1SB 4N90D 1CLYH 3UROR 3WJLC 3WCYA 4WUKL 3ARYA 1E6JH 1FZOB 3K46A 3CX5K 3E3QE 4Q0XH 5HVWA 5KVFH 5DGQA 2PYEA 4D3CH 2P46B 1KPRB 3MBEC 1L6XA 1AGDA 3BZ4A 4FTVE 1GGIL 4JG1H 5E2TH 3VMPA 3ARDD 1QPXA 2P5EA 2QQNH 1XGPB 1G9ML 4HJGA 1CD9B 4HFWA 3ULVD 1I4FA 2R0KL 5T1DH 2MNUA 4QWWC 2J1KA 1I1RA 2DD8L 1HHHB 2XY2A 4R26L 3U1SL 5JOFA 5IFAL 1E0OB 5CP7A 4LVOC 5I1CL 3I3BA 2LU4A 2Z8RA 3BKMH 5LAXB 4OSUL 4XT1C 3WFEL 4JVWA 4XZUB 1X5ZA 2DM4A 5IG7B 3D1MC 4O2FA 3NIGF 4H0IA 4KVNH 4Z7NF 3Q5TA 4XNMA 4TPRL 1G7IA 3A6BL 3LH2H 3MROA 4CL7A 1FG9C 2MHAA 3TO2B 4NUJA 5EOQL 1FNSL 2AK4B 1UM4H 2NZ9C 5J1TC 2CRIA 1OAKH 1PX3A 3Q6FA 4R96B 4EI5B 5E6IB 5I1KL 3GHBH 3ZSSA 3A6OA 5FHBH 2YZ1A 1DUZA 2B2XL 3G5XB 3IS1X 3HLAA 3W81A 5I1EH 4MJ5A 4U6XB 5K9JL 3QNYB 2R9HD 3DBXB 3ARDA 1GGBL 3DIFA 3GSVA 3NGBC 4HUVB 3MGOB 4F7MB 5HDQH 1QTYT 2IC2A 3ALWA 2BVOA 5CILH 3RY6A 3BRFA 3P4OB 4F57L 4XB7A 4M7KH 5E8EB 5EBLB 1M7DB 3EJZC 1JGDA 4D2NA 2AERT 4Y88A 1FAIL 4PJEB 4F37K 2K9UA 5B38G 4OZFA 3UO1H 5IFHL 2BOBB 3SDXF 4C4KO 3DTXB 3PDGA 3WUZA 3GSUB 1QFOA 4G6KH 1TZIA 3UBXB 5HBBA 2FX7H 4FQJL 5HY9A 4EUPG 2AQ1A 5LBSL 4KHXH 4O9HH 35C8H 5SX5H 4WEUD 2GFBB 1NQBA 4FQ2L 3RA7H 4WW1B 2ORBL 2VMFA 3TP4A 1HXMA 5AEAA 3W5MA 2HTKC 2ATKB 3CD4A 5I18L 2LVEA 2WWKO 3IJHA 2AJ3B 1WAAF 4GKSA 3HC3L 5K33A 3K8MA 3ZTJG 4JRXD 2H8PA 1VGKA 4RRPG 2YOCA 3VXOB 3GUTA 4X6EA 3OGCA 4U3CA 5J13C 1FSKB 4CADB 3W2DL 3QRFM 1CDGA 3P0VH 4W6XB 1BOYA 2BNRA 3D3VB 4KZEH 5ADOH 1KPVA 2CKBH 4F7CA 2K7QA 2E7MA 1JUFB 2VQUA 4PY8J 4YHPB 5AD0A 1V3JA 2EYRB 2BY0A 3TH4T 1UH2A 3WL9B 1MHPH 2M8XA 3MGTB 1I1YB 4ZPVA 1MAJA 4NP4H 3V7AG 5GGRB 1KJMA 1A6TA 5DHYA 3QDMB 4QEGA 3UAJC 3OBAA 5CIPA 5D2NC 1JRHI 5HYEA 3SGDH 5C71A 5JHLH 4Z5RA 1BGXL 2ICWA 3LQMA 2A6JB 2H1PH 4ZFZB 1L4IA 4PJDA 3VFSB 4DK3A 3WIHL 2E7LA 3SGKC 1KB5H 4W6WB 1BBJB 4JB9H 1FZMA 1INQB 4KRPD 1CWVA 4XRCA 4FA8A 2OLDA 1F4AA 2GUOB 2W9EH 2YEZA 2YHGA 3QQ9D 5HHOD 3BP5B 1KCRH 3NIGE 4Z7NE 2CDEB 4X80H 2B0SH 4S1SH 5E95B 3BMVA 1HKFA 5EU3A 1I9RH 2XA8L 5EBMB 4TYUA 2WANA 3KLHC 1NCBH 3HRZA 6CGTA 1NGQH 2VDQL 1U3YA 4CU6A 1FH5L 1CL7L 1IL1B 4PJCB 1ZVSA 5DA4A 3TO4D 2PXYC 4EOWH 2HN7B 5IMOA 3LEVL 1CQKA 1MREH 5I16A 4PJ5B 4MS8C 3D2UB 5IMMA 1N26A 3QT2A 1S7VA 1ZKAA 2DWDB 1QLFB 2CJUH 2HAZA 2MQCA 2VDPH 1Q94A 3TBSA 2AXFB 3CMOL 5CD3B 1NJ9A 1YEDA 3CFBA 1KPUB 2X5PA 2IH1B 1FLTX 3EFDL 3OX8A 5GSRB 4LU5H 2NXYC 4PRAA 2ARWA 4YDIH 5EA0H 4XC1H 1V7ML 2ZUXA 2P8PB 1DN2A 3KXFB 2NY5L 3QDGB 5JA8B 5JORB 1GZQB 2UVFA 3MRGB 4JG0L 4RGOL 5FO8B 2BVPA 3EOYG 3M1BB 3U4EA 5HHOA 3O9WD 1CE1H 3AS1A 4HGWA 3SDXE 4EKXA 4PJEF 4HS6A 2YD5A 3P11H 4LPYA 4OZGA 2CRZA 5SV3A 4R7DB 4O2CA 5FDWB 5BZDA 2RIKA 3FO1A 3H0TB 1ZGLB 1I7RA 4I8DA 5KZCD 3O6FB 4M6ML 2ICWJ 5GGVH 3TO4A 4HZLB 5HYJE 3INUH 1QPPA 5FV2A 5LCVH 4QOKE 3CVIH 4AH2B 4LLUB 1Z5LA 4M9PA 4C59B 2I5YH 2DQHH 3OKMA 1OD9A 3D85D 1Q0XL 1ZHKB 3GSOA 3V5KA 2FEDD 4DN4L 1LD9B 4IRSD 1WAAE 3TT3H 2ZUVA 4QHLB 1MCOH 3C2AL 5KN5A 1YEEL 3TYFA 1QSED 4JDVA 3RPIB 4KK9C 3HKFA 1FNEA 2X1PA 1P2CA 3MRLA 3P4MB 3ROOB 1NCUA 3QULA 3AROA 1JTOA 4NN5C 1LP9A 4PR5A 5EU5B 5LGKA 1J05A 3DUUA 2CIKA 4IRJD 1DANU 1WZ1L 2AEQH 2OMNA 3SCMA 1VFAB 5E2UH 3ZKND 3LS4L 4GBXB 4OLWH 3O9WA 1FJ1B 1U8HB 4L1HA 1M1SA 1T5XB 1SY6H 3I50L 3BQUC 4Y5VC 4KI5C 5IHUH 4N5EC 3H9SD 2DQDL 2P5WB 4Z0XA 1H3VA 2EC9U 3CCHB 2CUHA 1RIVH 1C5BL 1F5WA 1X9QA 1GGTA 1XIWC 1MPAL 1XH3A 3D85A 3MNZA 1GZPA 3FOLA 4PJXF 3TPUB 4HDIA 1I8IA 3ORJA 3RIFF 4KUZH 4F58H 4KMQA 3HUJB 5EORH 4Z7UF 1QSEA 4P2OC 3VG9B 2OXHA 2F74A 4X9GA 2Y7QB 4Y4KD 3UTPE 4PTTB 2ZPKH 5DD3L 3BZFB 3P77B 4MCYA 1ED3B 2R39A 3TN0C 4XP4L 3WDJA 3RVTD 1TCRB 3GRWA 4IRJA 2QQQA 4HCRL 3VFOA 1FL6B 5FK9A 3DX9B 4PJCF 2ADIA 1Y6KR 2DL9A 4QXTB 2HMID 5GJSL 3WEXB 1AI1H 2AV1B 2J7LA 4OV6F 3F6IA 3O8XB 2UWEE 1S9VA 4U1KA 2R0KH 3GO1L 2UYLB 4FFWD 1NAKH 3DMMD 1GOFA 1MVUA 1I8KB 1A6VL 4KWUA 4UZGA 3OF6D 3U1SH 1MRFH 2ED7A 4MA3B 2P43B 1KB9J 2DJSA 4Z77B 1B0GA 4ODXB 2OQJB 3UDWC 3NIFF 4AEEA 1NBVL 4EQ3A 4TN9A 4PJEE 4XPHL 2Y4SA 4OAWB 2FWOB 4JN2B 5F7LB 4PY7A 1C08B 1EEQA 4Y4KA 5GGSB 3VXMB 4Y7MA 2BVYA 5IT2H 3K2MC 2MCPL 5JMRA 1I7UA 1HIMH 3SPVB 3NH7L 2KPNA 4CBPA 5CBAA 2XKNB 4K9EL 4ZS6C 1TZHB 2VLLA 1HOCA 2CLRB 5E2VL 2C1OB 1QO3A 3MLZL 1QBMH 4HBCL 3BGMA 3VA2C 3S37X 5I1KH 1DQDH 3MRNB 3DX7A 5EUOF 2P24B 1A1NA 4IEFB 4IMLA 1ZLSL 1F3JB 1ZT7B 4IS6A 2I27N 4M7ZB 5DQ9B 3DECA 1BD2D 1KUMA 3ZYOA 3QXUA 1G84A 3VFRA 5HGAA 2EIBA 2CR3A 4XBEL 3TNMB 4O4YL 1IM9D 1UZ6F 3BHBA 3DMMA 1YEGL 1RQ5A 4NC2B 3STLB 1KCLA 3RWJB 1T1ZA 4MZ3A 3ARBA 4WW2C 4MD0B 3UX9B 3OF6A 4JKLA 5I0DA 4HQQL 1T2XA 2E9JA 3R06A 1ADQH 1LK2B 4MB4A 4CMMB 4JFOA 3TNNB 3VGFA 2CO7B 4PYHA 5C9JB 3FB8B 1HHKB 4UQ3B 4P5KA 1D6VL 5CGYD 5T3XL 3GSRA 2F9BT 2NXZB 1IEBA 2XN9B 3QUMA 2AJXH 3P3YA 2QBWA 2Z9TA 5ERWA 4NT6A 1MCHA 2AEPH 4JZJB 1JNJA 4FQJH 2PTVA 3G5YA 5EO1B 2DQUL 3CXHJ 2F5AH 3K0WA 4URTB 5LVEA 2X4UA 5DR5L 4AQ1B 3UPRA 4FQ2H 4PJXE 4HMDA 2OK0L 3JWOL 4LLQA 2ZCKL 4RX4D 4D0CB 3MOAL 1UWXH 4HPYL 4Z7UE 1BD2A 1M05A 5HYSG 1EA9C 3FTGB 4GRLB 4GRMB 5EWIL 3V7MA 3BI9X 3ILPA 1SJEA 5F7UA 3X3FL 3IKKA 1NBZB 3KYKL 2ZKHH 2X1QA 4EDXB 2HKHH 5CGMA 3KYOA 3B2VL 4H20L 1AY1L 3B9KD 4OM1H 5DJ0B 3GKWH 2FLBT 1ES0B 2H26B 4OD2B 4G6AD 4XVSL 3LS5L 3GIVA 4Y16D 1WEJH 3NBNA 4I0PD 3VH8G 1RULH 3OJVC 4P9HC 3K4DA 3IETB 4LSPL 2IADB 2JB6B 4PJ8C 3T0EA 2HTLC 3OWEA 3RU8H 3MV7D 2FRGP 3JWDH 3RWEB 3OTTA 2HFEA 5DJXB 2EDQA 1KEGH 2GSIB 2DMBA 1A7BA 1Q1JL 1INEL 4ZNEE 4JFHE 4YXKL 2PYFB 5BVPH 2ESVE 1LGVA 3HZMA 3CFJB 1YQVH 3WNMA 1F97A 4XCYB 5CZKA 2IWGA 3NIFE 3TJEL 4RX4A 3S4SB 2H6PA 5L2KE 2NY6B 5J9PA 3Q0HA 4ODTL 2OZ4A 5JR1L 1QRNE 5C8JB 5EFIA 2R4SL 4ODSL 1D5IL 3GMLB 3RGVB 1OTTD 3B9KA 4IOFD 4O58H 3FAXA 3RUGF 2VDQH 1T2JA 2O5XL 3JV4B 5F72S 1U95A 4B0MM 2ADFL 1E28B 3SKMA 4BFIB 2V6HA 3KPRE 5JHDA 3CDFA 1QEWA 3K3QA 4Y16A 5EUOE 5D1ZB 1EXUB 4U3XA 4I0PA 1HHJA 1NC2D 3B4NA 3KPSB 3VGAC 3DPBA 3OV6A 1I8MB 3MV7A 4JFDB 3SOBH 3NOIA 3CMOH 1A7NH 3QH3A 3G6JB 3SE4C 5JLZB 1UZ6E 4POZD 2YR3A 1JWSA 2B1HL 2N7AA 4J4PC 4MLSA 1EHLL 1DE4A 1KJ2L 3ROLA 4Q7DA 1A4JB 2R29H 4QHMA 4P4KB 4HIJA 3ZKSD 1S7UB 4TTDD 4ZPTA 4HKXB 2QQKH 5SWSE 3EYQD 2BNQE 4JG0H 4RGOH 1EERB 3VGBA 3UYPA 5IMKB 4MMZC 4BZ2L 4HG4J 4PJ7B 4XMKL 3H7LA 4F2MB 5I8EB 1RVFL 3MUY1 1TCMA 4L4TE 5FYKL 3NAAL 1IC4H 5EH1A 4PYGA 5HJ3A 5MEOA 4M6MH 5MERA 3OHXA 4U1IB 3WIIL 4CN1A 4JO4H 4CN6A 1A9BA 1HI6A 5EN2A 1KCKA 3BE1L 4P4RB 5C0FB 5F7MC 4E42A 1ZA6B 1NC2A 4LLDB 1FFPB 2NY2D 1Q0XH 1J11A 1B4JL 1BQHG 1T20A 2IEPA 4QRUA 3JV0A 5JW4R 2FGWH 4K3HA 4KTDH 4XAKD 5DTFA 4YX2L 2JK5B 3ZYZA 3QPQD 3FZUC 2VE6B 5D93C 2NR6C 4K8RC 4EN3B 4OZFG 4MQ7B 3BJLA 1S7TA 3IDIA 4ZTPH 4L4JA 3VWJB 4KDWA 3QUKB 4PIRF 4XBPB 3L5XL 1LEGA 4NFCA 1M71A 5GGRY 4NRYB 4H1LG 1EEUA 4PGEA 3TCLB 1DQML 2E9BA 5IW1B 4R4NC 5HXMA 2UZYB 5DMGD 3AREC 1BBDH 3R8BB 1D5BA 5DDHB 2E27L 3I50H 3LN5B 4BH7A 1LO3L 4I18B 4UV4H 1G1CA 2J6EA 1KJVB 5JO5A 3OKOA 1A6PA 3C9NB 3GB7A 4PLKC 1SEBB 1T21B 4HWEL 3OKLA 4MCZA 1G0YR 1D9KC 4NQSB 1RZJH 2QSQA 4FXGA 3CJJA 3IFLL 2R1YA 3MCKA 4LIQE 3FQXA 3NTCH 5FKAA 2HT2D 1IQWH 1RUQH 1FE8L 2EH7H 5DD3H 3A6CL 1R3LB 1OQXA 1SHMA 4NYLA 3RUGE 1C8PA 5E1HB 1QUNA 1CU4L 2C4XA 2VLRB 2X4OB 1PFCA 2A9MH 3BN9C 2R0ZH 1MIEH 4X9IA 1A3RH 1OGAD 2NTFB 1IM3A 4J3OC 4KRLB 1NUGA 2D0HA 3C6SA 3QEQB 4FFYL 5IJKA 4G9DB 5HHNB 4X7TA 3SDDB 3WN5C 5T5FH 2J8UA 4Z7WB 4YBQD 1CVSC 1CE6A 1L9NA 2VR5A 4GFTB 3UJTL 4Z7VA 5HHPB 3TESA 4X5WB 3G6JF 4HUKB 4IOSD 2HRLA 3NFNA 2Q6WA 4FZEL 1H3XA 1OQOA 1GCFA 3FQRA 3ECBB 5KS9A 4U1NA 4ELKA 3VCLB 2BXZA 1WFUA 3L3IB 3O3DA 5GRYA 1S9KC 1B0RA 1WUNT 5JDSB 1NBVH 3FO0H 3HMXH 1FO0H 2MPAH 3RVUD 1AE6L 1F4HA 2GY7B 4ELMB 2DKMA 5JW5A 3LHPL 4N8CH 3Q3GB 4NQCD 1IILE 3U9UA 4PJ7F 4F9PC 1QRKA 3TJHC 4NO0D 4ZS7L 2CMRH 2XFXB 2JJVA 2VKXA 1NCAL 1ZEAH 1A9EA 2PNDA 1DANT 1OGAA 1R3JB 2X4TA 1XF2B 2C1PB 2Z8WC 3RDTD 4Y1AB 5CMAB 5D6CB 4PB0L 4ZMAT 5MEQB 5TDNB 4NBZB 4C83B 4OQTL 1J88A 1YMMD 3PQYB 5LGJB 3U0PB 1IKFH 5D2NE 3LD8B 2QADC 4K3JL 5FM8A 1A7QH 5FGBA 1MWAL 2DWEA 1JNHA 4XBEH 1P84K 1JFQL 1TVHB 1WWBX 1ZE3C 1A7RL 4O4YH 5ELIA 5D2LB 3SQOL 3VFNB 1JGEA 4Y8DC 2W9LA 5DJ8B 1BIIB 3I6KB 4HQQH 5GRUL 2VKWA 4LPXA 1S7SB 5ESVA 3V5DA 2CLVA 3ZE2F 2CO6B 3JVGC 1JWUA 4KMTH 1ORSA 4Y8AA 2PO6C 1D6VH 4YE4L 4PBVC 4QYOB 2PW2B 2CD0A 4NQCA 3S34L 1IJ9A 3FB5B 1W0YT 3LB6D 5F7EH 4NO0A 2R56L 1HZHL 5T1KD 2VZ3A 4S11A 4WDIA 1KXQE 1KIRA 2Z92A 1MCJA 5FYJE 3VWKC 5ILTL 5T1LB 5GQBA 4LDLB 2XG4A 2DQUH 2IQ9L 3L7EA 3ESUF 1BFVH 4RDQF 3RDTA 2QSTA 1L7IL 5DVNA 3FN3A 3WIFA 1W0WA 2OK0H 2A0LD 5HI5D 5F9WB 3MLYL 4Z18A 1YMMA 1J12A 1K9TA 3PWLA 1CDYA 5GGTL 3PE9A 4B53A 5J6HA 1IAII 4DN3L 1V3MA 1OB1B 3KYKH 5IJVB 5FA4B 3B3IA 2YC1A 4PY8I 1CT8B 3GSWB 4H20H 1PYWA 3X12A 1TXKA 1ZHNA 3MA7B 4CVZB 1PX4A 5HVGB 5EZJA 1ITBB 3MLXL 1HYSD 2GJJA 4L3EE 3LS5H 3WUWB 4GLRI 5JA9A 4KMLB 3V6OC 1GL4B 1YUHA 1CFSA 2P48B 2W92A 3CUPB 1M4KA 4LSPH 4Y2OA 5HSFA 3RQ3A 4HH9B 4LQ1A 5ACLA 5EZLB 4MNQD 5C0GA 3VXNA 4JM2D 3WYRA 4TSBL 2EH8L 4M62L 4DKDC 5T1KA 4Q6IC 4BYHA 2D7MA 1Q1JH 3ALPA 2EDRA 1INEH 4Y2DB 3VW3L 5BRZD 5EIVA 1NCDL 4YXKH 4JFQA 2EXWC 4OV5B 1I3VA 1B9ZA 3T77B 4KJYB 4U4BA 3BKJL 5GS1C 5DRWB 3MGAA 5GGSY 2NY7L 1BVKB 2V7NA 2DYPB 3NFPA 2VJXA 4XX1E 5I1GH 1OTSC 4ODTH 5DS8B 4PGDA 4WWKA 5JR1H 1JVKA 4PGCB 3RVXD 1CICD 3CFKA 2R4SH 2EE9A 3CZJA 3LEXA 5I15L 5IR1B 1K2DB 4ZFOL 2FB4L 2O5XH 2FYYA 1A7OL 4HKBA 2ADFH 4LEOA 5I76B 4LSRH 4D0BA 5ICYA 2IFFL 3HPLA 15C8L 5B21A 3F6LA 1UYWL 5E7FA 2GJZA 4JREC 3MXVL 4M93C 5GGUB 5J57B 3WS6A 2NMSA 4MAYD 5I66A 5HHMD 4NRZB 4MNQA 1G6RH 4JM2A 5E4IA 3ARGC 1KTKE 3STZA 2BSED 2X7LB 1ZHBB 1OPGH 5BRZA 1R5IA 2B1HH 4OCWH 1EHLH 2OTWA 1KJ2H 1HILB 1OSPL 1RZGA 2J5LB 4LRIA 4R8WH 4GRWH 3EYSL 3ZE2E 1KIPB 3FB7B 1OAYH 3B8YA 5TE4L 1J18A 3RJDA 4DGVH 4XMKH 5KSUA 4LLYB 5EO0B 2XACC 1CICA 3H9HA 1RVFH 2ICWI 5B39G 3TBWA 4GAYA 3S5LA 1HSBA 4JKMA 8CGTA 3FQWB 3L5WB 2X6MA 1NAMA 4YNYB 4Z7OF 4PJFA 3Q5YA 3NAAH 2HLAA 4HIXH 3QJHB 3FT2B 4ODVL 5F7WC 2OSLB 4NQDE 3S35X 1OT2A 3FB6A 4QHKJ 5T5NG 1AKJB 4WIQA 1HHGA 3QWOB 4YPGB 5I8CA 1U3HA 1B4JH 2HJFA 4MAYA 3V4VL 1CXLA 5J8OA 1CFNB 4BFEA 1FFOA 3CDYA 3IDMA 1IAOB 5A16B 5IB2B 5GS2D 4E5XA 3OAYK 4P3WA 1KSRA 1X4ZA 2XV6B 5I74C 2EO1A 2J3SA 3ILQD 2R0WL 5C0AB 1MUJA 4HF5L 4HC1H 3BOVA 3L5XH 3S7GA 1T83A 1PKQB 2GITA 2Y5TB 4BZ1H 2GT9A 3OQ3B 1DQMH 4KHTL 1VPOL 2VLJE 3QFJB 5BW7A 4HHAA 4XMLH 4GXUM