4RIRB

Structural analysis of the unmutated ancestor of the hiv-1 envelope v2 region antibody ch58 isolated from an rv144 hiv-1 vaccine efficacy trial vaccinee and associated with decreased transmission risk
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH58-UA Fab heavy chain
publication title Structural analysis of the unmutated ancestor of the HIV-1 envelope V2 region antibody CH58 isolated from an RV144 vaccine efficacy trial vaccinee.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirB01
3BISA 5TF1L 1U8OA 1NUGA 1Y6NR 2F74B 3BGMA 3L3GA 3ULUL 5F93C 3QIWA 2CKBL 1MREL 1QHPA 3OAYK 3CH1B 1ZHNA 2OI9C 4R0LB 5IKCA 2VO5A 2KBGA 3W82A 2CDGB 4BKLB 3V0WL 2X1XR 3MJ9A 5TF0A 4NJAL 1OW0A 4ODHH 5TE6L 1ACYH 3H9ZA 4CNIB 4WEBH 4G6KL 2X9WA 5IW1A 3V6OC 1AE6H 4RFOL 5DHYA 2Y36L 2E9IA 2X41A 4NQDE 1D5IL 1VGKA 2M8XA 3BE1L 2NXYD 4X5WA 4DVRH 1I3GH 4BH7A 3RIFK 3TNMA 1EBAA 3UTSE 4MD0B 4BYHA 3MV8D 4IOIB 4ZFOL 3T2NL 5HBBA 3PGFH 4NCDA 3RU8L 5IJKC 1G7PA 2DI7A 1GH7A 5JW4N 2Q7YA 1H8NA 4KY1H 4ZAKA 5LCVL 3SDCA 1JNLL 1FN4A 5MP6H 2HT3D 1HH9B 1UCTA 3LRGA 3MLWL 4G8GB 4GSDH 1MFAH 3FOMB 4LPCA 2QJDA 3O3BA 4I13B 1Z9LA 1KTDB 2EIZA 1SMOA 1AXSA 1RFDL 5CHNB 1ND0A 4YX2L 2C7UB 5E6IA 3KJ4B 2W9DH 4JHWH 2DLHA 4PJGF 4XVJL 6FABH 1CXFA 3CX2A 5F7HA 1E27B 1N26A 1NCUA 2SEBA 1GVIA 3L3OA 3CSBA 3KDMB 5E2VH 2IBZX 2GJJA 5C8JB 4KJYA 1CICB 3FMGH 1CF8H 1X4YA 2IQ9H 4OZIA 1TQCB 3NN8B 4XP9L 4HUWA 4AENA 4ZUUB 4B41A 2A1WL 3OAYH 3C8DA 3TM6A 2OP4L 4XBEH 4ZQKB 4MCZA 1BZ9B 1CGVA 1JPTL 3QUZB 1FZOB 4JPKH 1IBGL 3AREB 1A6ZA 3W9DB 4ERSH 2EXYD 4FZEL 1P2CB 4D8PB 2Z8VC 5JHDD 4W4OA 2XQBH 3HNSH 2EDXA 4JRXD 2IMNA 3OKDA 5F9JB 5IFAL 4OFVA 2ESVA 1V05A 4KXZI 3QNXB 5DFVC 3GGWA 5GGVY 2DLIA 4ZOEA 3VWJC 4O9HH 4P2QA 2VDQL 3NABL 3TEUA 2DQEH 4G8GE 1TZHA 4GXVL 4FQLL 1RK0A 4DKFH 2YUXA 4YDIH 1Q9OA 3E6HB 4JFDB 4YHNA 4M1CD 5DMIH 1MJ7H 1GRWA 4Q2ZA 1DUZA 1R5VB 1ZOXA 3MXVH 1JP5A 5GIRA 3WJJA 1Z3GH 4P3DB 1GC1H 1HHJB 2BNQD 4JKMA 4DGVL 5FO9A 2APWA 3WIFA 4CN4A 4PLNC 2XXMB 5FB8A 3QDJD 1D9KD 4IRJB 5C0FA 3IDNB 5HHPB 2CKNA 5C0CE 5EU4B 1CLYL 2QHRH 1A14L 1NMCB 2R56H 5IESH 3FJTA 3VRIB 4EVNA 1FNSH 2VZVA 4GMTH 1A02N 3KPNA 1HXYA 2XICA 2J4WL 4P2OC 1WCBB 5ETUA 1L7IL 3F65A 2XYCA 3VH8B 3KNBB 4NKIL 5D5MF 5CBEB 4NZJA 1J0ZA 3P4MB 5C0BB 2VC2L 3U7AA 1U3HA 2VXUH 5H35A 5E8NB 3B4NA 1CN4A 1GAFL 2W0KA 3JTTB 4P46B 3WXWL 4YHZL 2W0LA 4U05A 2FJHA 3OR6A 3O4LA 3OWEA 5IHZA 3KPRE 4LGPB 2AEPL 5EBLA 4Q97A 3SBWA 5J9PB 4OFPA 4RQQA 1ZLSL 4LVHB 1AGBA 4YIQB 4Z7NE 1SY6L 5E1AA 5C7XH 1NGWA 3ZMRA 1TITA 5BZDB 2NZ9C 1RHHA 3BP7B 3BZEB 2VDMH 3FQXA 2E7BA 1SJHA 3FQRA 3VXTB 5DQDL 4IS6A 3WO3B 2EIBA 1OAZL 4LSTL 5EPMB 5T5FL 4HZLA 2BRRH 4JHBA 1LDSA 3CXHK 3UMTA 1JPSL 1P5UA 4HPYL 5C08B 1ZHKB 1RIUH 3MJ7B 4YHPB 3THML 4JRYB 4MJ2A 2ATKB 3GMLB 3DIFB 3DRQA 2CRZA 3JUYA 3QUXA 1T80A 4MAUH 4UDTA 1FFOB 2HFEB 4P2RD 3CU7A 2CKBH 1MREH 1WZLA 1PKQB 4R4NC 4YDJB 4CJ1A 2JB5L 4YHYC 4I2XB 3CSGA 4KV5F 3V0WH 2AJVH 3QXAB 4NJAH 2YUVA 3DPBA 4LEXH 1UFUA 5FO8B 2Y4SA 2VQUA 4Z7WF 5C0BE 4RFOH 1EX0A 1WWAX 4L8SA 2VUOA 1G6RH 4K71B 4XPHH 4Y1AD 4YHKL 5J11B 1HQ4A 1PSKH 3V4PL 4PRBB 1FCGA 3PV7A 4GKNB 5LCVH 5CGTA 1DZBA 5IK3B 4DN4L 2KQNA 5L8LB 1HSBB 5DRNA 5J0BA 4X7EC 1FPTL 1KLUB 2V2WA 1NANH 3L5WB 5CEXA 3WLBB 4LLQA 1RFDH 5GS3A 5GS0C 4PJ7E 2D31B 4D0CA 4YX2H 2H2PC 4KKCC 4EUPH 3GMNB 4OZHB 4XVJH 4E5XA 1NC2B 2G75A 1I7ZA 4ENEC 2VITB 4MWFA 5C08E 3U9UA 4IOSD 1NFDF 3H7BA 4BQ6A 5DMYA 5CWSA 2EH7L 3O3UN 1A9BB 1JZ2A 1LGVA 1A4KA 3ARGB 4JRYE 5I8OL 1SBBA 2AEIT 5D7SL 4GLRI 3AU1A 1BM3L 4UZGA 3IXTB 1JTPA 1AKJA 2OL3L 4HBQA 3LB6D 4LLUB 3RVWD 5C0JB 3T3PF 4QHMA 4Y4HB 4I2XE 5DR5L 3O45A 5B3JF 5LXGL 5KVMC 2A1WH 5HHOA 2OP4H 2ZUVA 3AXLB 3DUSA 4NNXA 4HWNA 3VXMB 1IBGH 2NY7L 5ESVB 5DD3L 1QFUL 4K07A 5CJXC 3ZDXE 1ORSB 3C5ZD 4FZEH 4ZFZA 3BVNA 4JG1L 4PJGA 3SKOA 4PRDA 1DANU 5CGYC 3NAAL 1ZLWK 1YDPB 1A3LL 3VXSD 4JB9H 4S2SA 4AH2B 4PGBB 2GFBB 1T1YA 3EOBB 2XTJB 3C5SA 4FQLH 1YECL 4I9WD 4CVZA 2PR4L 5IT2L 5JQ6L 3IXAA 3BIBX 3T0AA 1FSKC 1LEIA 2PYFA 1W8OA 4NBXB 4LHUD 3SJVE 1QEWA 4X9FA 12E8H 3B9DA 3S34L 3ZTNL 4DGVH 4XWOC 4OZHE 2J3SA 1S7UA 1UVQA 3RNKA 1N0XL 3S4SB 3EYFA 4OLUL 1K8IB 4RFNB 2Z8RA 1JZ5A 2VLJB 4PRID 3V5KA 1CLYH 3DROA 5FGBC 4EDWL 2V5YA 2N4IA 2V2TA 1A14H 2XFXA 4PJ5B 3UTTA 3VJ6B 3L5JA 2R9HD 3S3SA 5H8DA 3T2PA 4HFUH 2HLAA 4GW1B 4OTXL 3GSRB 4N9OB 2J4WH 2P5EA 5L6YL 3LN4B 1I4FB 4JFHE 4P4RA 1G6VK 1P9MA 4NWTL 1I1AB 1UQSB 3OB8A 3NCMA 4I5BB 1K5NA 4MS8D 2YA2A 3F6LA 3FHQA 4ONHA 3U7YH 5B39B 5GXBB 4H0HB 3OMZA 4K3HA 2VC2H 3VXME 2MJWA 3RZCB 3K4AA 4GLRH 3ROOA 4YHZH 3WXWH 3VXOA 1T7VA 2ICWJ 4TTGA 2WBKA 5HYEA 4GAJL 5LQBL 3DVNB 2AEPH 3T4AA 1GCFA 4JDVA 4GBXA 4M7LT 1P6AB 2L7JA 3U83A 3L7EB 1I3VA 5FYLL 4AEHL 3K8KA 4IOFD 2ICEA 4FOMA 1ZLWH 2XTJE 2CLZB 4LRNL 2E27H 3VXNB 3TCXA 1HEZB 1DQDH 3KJ4C 3MGOA 5IB3A 5DQDH 1KB5A 4E41D 3P73B 5C0RL 1OAZH 3U0WL 5T5FH 1I1YA 5D2LF 3BH9B 2GCYB 3KPOA 2G5BA 3HZVA 5H37G 1OD7A 4H88L 4I1NB 5LKNA 1FV1B 4TUOB 3O3DA 3EJYD 2VLJE 5KVGL 1E4XL 4PJ5E 3BQUD 3FFCD 4PD4K 4L3ED 3SDXB 4PJEE 1U92A 5KTEL 1KCKA 3F58L 3E3QE 3QUZC 1RAMA 2IFFL 4F7PB 2BNUB 4NRXB 4GJTB 1PD6A 1RQ5A 4OLXL 5GGQL 5KG9B 1G7IB 1OSZB 1FVEB 1RZ8A 1LNUB 2EO1A 1BFVH 4XAWL 3TO2B 4EI5A 4H26A 3DBXB 2PO6D 3JSSA 2VDRL 3T1WA 4QYOA 1ZHBA 5HD8D 2HMID 2R23A 5EZJA 3U36B 5C6TL 3F62A 1R3HA 5D1XB 4YHKH 1A6PA 5ESAB 4JCLA 4KK9C 1ZHLA 2YPKB 4NQEA 4DN4H 3BIKB 5I76B 5EU6A 1YY9C 2NW3B 4D0BA 3VE0A 5E8PB 2DLEA 3PDGA 5K9KB 1Q9KB 4M00A 2F54A 3N0PB 4U1IA 4CBPA 4L29B 5T5NG 3SO5A 5E2WH 3V0AC 1PZ5A 1U8NB 4P4KB 1FVCA 4I3SH 1KPUA 4IRJC 2EH8L 2ZZUT 4WTXA 2NW2A 3WDIA 3KPQB 3L3GB 4HKZA 3SDYL 3QIWB 1FORH 5LWYH 2V5TA 3NZ8A 4Z7WA 4PJ8D 5D7SH 4J23A 2D7NA 2DM2A 2PXYB 1BM3H 4FFWD 4G6FD 5A2LH 4X8XA 3JTSA 3HZYA 3RNQB 4ZFFA 4XAKD 3WIHH 1U8IB 2RFXA 1CD1A 4UAOB 3D87B 3PDOB 5EBWA 4PJFE 5DR5H 5LXGH 2F8VA 5F9DC 1Q9LA 2GYSA 4KC3B 4U1NA 3D9AL 1VGKB 4X5WB 2EDWA 3K2MC 3RBGA 1VB9A 3EFFB 2XPGB 2NY7H 4P46C 4ZYKB 2WUBL 4Z95L 4OD2A 5MHSD 1MWAB 3BRFA 5GGUA 2DOCA 2NR6C 4FFVD 1CGWA 5FYKD 4OLYL 4M1GH 4OJFL 1MCPL 1XMWA 2Z35B 2VJXA 3MRRA 3PL6D 5D2NA 5C09D 5T3XL 1A3LH 5CJQL 2MPAH 4ORZC 1JMZA 3TBVA 1JZ3A 1JE6A 1ND0B 4I0PA 3S98A 4O2EA 5K9OA 1A22B 4PTTB 4XVSL 2PR4H 2QKIA 2XKNB 5CIPB 4XNXL 5JQ6H 2VE6A 1MCBA 2VR5A 1F11B 4IMKA 2FH6A 4PJ9B 1XZ0A 4U6HA 4ODTL 5JOPE 3H9SE 4OCLC 4GRLA 5E6YA 3S34H 3ZTNH 5AZ2H 4RIRB 4UT6L 1N0XH 3CVHB 4NHCL 4KJYB 1J11A 4OLUH 5C6WH 5EG6C 1NUFA 3P30L 3PJSB 4NC0B 3U0PA 4OZIB 3EYSL 4PG9A 4EDWH 4CW1A 3MRFA 4HUWB 3CZJA 2YC1B 5CINL 3KPSB 2H3NB 2F58L 1IGIH 5IVXF 3AS1A 2FIKA 1R5WB 4MCZB 5DK3A 5IFHL 5L6YH 3LPWA 4X6CF 4NWTH 4LDOB 1A6ZB 3ULVL 5JZ7D 3WXVL 1DEEA 4MVBD 2Q8AL 1JPFB 2YRLA 4N0CD 5FHAL 5J13B 3OKDB 2ESVB 2LE9A 4XNZB 4K71C 2FX8H 2YD2A 5J11C 2BVQB 4NKDA 4DUVA 1VSCA 5GS0L 2P43B 2K9UA 2NPLX 4WJ5A 1J7VR 3VA6A 1A1NA 1UB6B 4GAJH 2XN9D 3PP4H 1P7KA 5B4MC 1JNNL 4YHNB 2RIKA 2VQ1A 35C8L 3EO1A 5GIRB 5FYLH 4AEHH 1UACL 5EORL 1LE5A 4ODVL 5KS9A 3GRWL 4LRNH 5FO9B 3C6SA 3FOLA 5B21A 1Y0LA 1QVOA 3OHXB 4G7YL 5FB8B 2X4NB 2XI9A 3MRMA 3O9WA 4MJ5A 4YUEL 4HKBB 4KJWC 1A6TB 4BQCA 1I1CA 3VRJA 4AT6B 4X7SL 1QRNA 1LO2L 4H88H 4LVOC 4GRWE 3FB8B 1SYVB 3GSNA 5FYKH 1GOHA 1J1OH 1S7TA 1EA9C 3DSFH 4QKXB 4OZIE 1PFCA 3PUCA 4P48A 1HXYB 1E4XH 5ETUB 3GI8H 3MO1A 3IU4L 2FHBA 3LEYH 4U4BA 5I9QB 4ZUSA 3NFPB 3C6LB 2E6PA 4G5ZH 5KTEH 5I1HL 3ZE2E 4YLQT 3T65B 2HP4A 4KTDL 2BC4A 7CGTA 2NLJB 4LLVA 1NMAL 3O4LB 3OR6B 2DB8A 1Q0XH 2AW2A 2ESVE 1IAKB 4RQQB 3DMMA 5DD0H 4MD4B 4Z7QE 4Q9RL 2GJ6D 1WICA 1CXLA 2NY3C 4P2QE 4HK3N 4M62L 5C6TH 3BEWB 5D2LA 2FX9L 5DRZA 5E1AB 5EOCH 4HDIA 4WUUA 1NGWB 3QA3A 1VFAA 5CP7A 3VDAA 2QLVB 2OK0L 3NA4A 3MODL 2KUTA 4Z5RB 1Q94B 4OLWL 5MERA 3FQXB 1SJHB 3FQRB 4IS6B 4L3CA 5KSUB 4HZLB 3GM8A 4KUCF 4LQFL 4Y8AA 5DI8A 3LKOB 2YS4A 4J4PA 3ORJA 3Q48A 4ONOA 4RFNC 3DRQB 4LHQB 3O6LL 3QUXB 2IPTL 3QWQB 4ZSOB 1RSFA 2C26A 5CMAB 3LDBB 3FN9A 3Q6FA 4FG6D 1P5VA 3CXDL 3SQOH 3HB3D 4M93C 1V7ML 3P4LA 2K1MA 1KIPB 1DQML 5I2IB 1XF4A 4LFHD 1I1AC 4WO4D 2DWEA 2MOVA 1MFBH 5KSAB 4HUXA 4RGMB 2Z93A 5T33L 1YMHB 2UWEA 1JGEA 2W59A 1HK6A 2P8LA 2YPLD 3D9AH 1L6XA 3RJDA 5CJOL 1FIEA 2R15A 1UYWL 3S5LG 5FYKU 2C1PA 3O4LE 2Z31B 3CCHB 1HQ4B 2WUBH 4Z95H 4I3GA 2JK5A 3GNMH 4WI3A 32C2A 4NHUB 3EIFA 3HE6A 4PRAA 3QNZB 5DRNB 1T21A 3TCLB 2V2WB 4HH8A 5E2TL 5E8OB 1U8QB 3F7PC 1GGIL 4D0CB 2XA8L 2CK0L 3LPFA 3K0WA 2ED8A 4E5XB 2QHLA 3FT3A 2K3TA 4XNXH 3RWGA 3RDTB 4MWFB 4OBRA 3WJLA 2AAVA 5TPWH 4CAGA 1I9IL 2I60H 5GGSY 1A4KB 2KL6A 4QF1B 4UT6H 3UO1L 1YEJL 2DL9A 3AU1B 4NHCH 5E5UB 1TCRA 3U2SA 4XHJC 2D4DA 4OLZL 3MGAA 3EYSH 1AKJB 1KYOJ 4AL8L 1ZA6A 3L3JB 1J88A 1MCSA 3BZ4A 4G8IB 4QHMB 5D70L 1OARL 1T3FA 1UZ6E 5CINH 3O45B 2ZUQB 3SKNA 4P99A 5HHOB 4P23A 3DUSB 4NNXB 5AYUH 5IMLB 5IFHH 2HRPL 2HH0L 3DLQR 3T09A 1T2QL 3BZFA 3VFWA 4R97C 3ULVH 2WBJD 1D5ZA 2EXWD 5AG8A 2D0FA 4ZFZB 1OWWA 3RFZC 1EK3A 2CIKB 5FHAH 3RBSA 3C5JA 4PRDB 3DURB 4LNVA 3P4NA 4OCWL 2R69L 4I77L 5JXEC 2ARJA 4S2SB 1G0YR 1UM4H 4U6TA 4QXTA 1T1YB 1EMTH 3C5SB 5D1ZC 4XP4L 3VMPA 3ZKMD 4CVZB 5I15L 1U9KA 3IXAB 5F6HI 1LEIB 5DFWH 2F15A 1N6QH 5IQ7H 3LEVL 3JVGC 4NJ9L 1MVFA 5EORH 1KELL 5ICZB 1BFOA 2GUOB 4ODVH 1VPOL 4PY8I 3GRWH 1S7UB 3QDGA 3NIGF 2IH3B 5IVXA 4G7YH 3EYFB 5DQ9B 1MHCA 1FBIL 5F7KC 4FFZL 1T7WA 4RRPG 4YUEH 1DVFA 1RUAH 1ZLUK 4YFLF 5B38G 1IRAY 3T0WA 1U95B 4ZS6C 1PYWA 3MACL 4EN3D 4WNQA 2PXYC 5INCA 3SN6N 2P5EB 3OL2A 1OW0C 1ZAGA 5J6HB 4NIKB 1DEDA 5C0CD 2C4FT 1INQB 3MUHL 4ONHB 2AKRB 5HHOE 2HVKB 1UXWA 3NFSL 4Q6IA 4HSQA 2AEQL 4DFHA 5K59F 3O8XA 1IEBB 5DLML 1CICD 4LSPL 1H9VA 1RZKH 3MR9A 3ROOB 1R3JA 2MNUA 3Q5TA 3Q5YA 1NMAH 1NKRA 3T4AB 4PJGE 5D96B 3BO8A 2XG5A 3BPNC 4JM4H 3QUKB 4L8CA 4KPHH 1QLEL 4Q9RH 3BP4B 4M62H 4RISH 2AVGA 2V2XA 2FX9H 2ICEB 1QACA 3ARED 5ACZB 1WT5A 5C0DA 2Q86B 2OK0H 3MODH 1JWSB 1C5BH 1A2YB 3BD4A 4OLWH 3MGOB 3OQ3B 5IB3B 1EPFA 1X44A 3KPRD 2XZCL 1BFTA 2IADA 4NP4L 2H32A 1VACB 1I1YB 1CVSC 5E4EB 4PJ9C 5GZOD 1ZKAA 5D1QD 2G5BB 3HZVB 5GJTL 1KC5L 3LN5B 2VL4A 5FK9A 5IMMB 3W9EB 1TJGH 3O3DB 4W68A 3WNKA 1T1ZA 2IAMA 3O6LH 3ZYOA 5D7LA 3FQNB 3PP3K 3UTTE 3IYLW 2BFVH 1ZLUH 4N0FA 4E9LA 5LGKA 1BD2A 4FQ2H 1S78C 4EXPX 1HI6B 4K94C 4KVCL 4U6YB 3MRHA 4LKXB 2EDEA 3I3BA 3LS4L 4NQXB 4XP6L 4U1SA 2P5EE 1IC5L 1KJ2A 3TBWA 1DQMH 5F7MC 3B3IA 1ADQH 4Y16A 1NSNL 5DURD 4EI5B 2WUCL 2OMNA 4H26B 3B5GA 2JTDA 5J13C 5CJOH 5BQ7B 4QYOB 4FQIL 4XNZC 5FECB 2R23B 1EAJA 1UYWH 1JHTA 1R3HB 2A0LC 3ARFD 2A73A 2D9QB 1T7YA 3NIFF 5C0BD 3H8NA 2C4XA 3VE0B 1JGUH 3BN3B 3CPLB 2GSIB 5E2TH 2F54B 1ES0A 4LLWA 4Z7VF 1GGIH 3RVVC 4HIIA 5TDNA 1NQBA 1YEDA 3G9AB 4MA7L 1KPRB 1PZ5B 2HG5B 2CK0H 1FVCB 4XP1H 4D9QE 4N8CH 9CGTA 4ETQA 1INEL 4Y7MA 1UH3A 2A6KA 4ZUWA 4HKZB 2YK1L 1MOEA 1AQKH 3L1OH 3NZ8B 4WDIA 5KVFL 3H3PL 3RWFA 1I9IH 4GG6B 3T0EA 4FQ1L 3RX7A 1FLRL 3JTSB 3HZYB 5ILTL 4ZFFB 4OLZH 4AL8H 2HWZH 5ADOH 2RFXB 1PG7X 5EBWB 3PP3H 5D70H 4MB5A 1OARH 5I9QC 3DTXB 2FGWH 5ICYB 5SX5K 3C6LC 4NCC1 4JKLA 4NBYB 1U2HA 1W72A 1MUJA 1NBZA 3LZFL 5TE4L 2DQFA 1X9QA 2NMSA 4L4TD 5GS2H 2EECA 3Q5OA 5GGUB 4BSVB 3PDDA 4FXGA 4M6OH 1F3JA 1ZANH 2DMCA 4NT6B 1XF1A 4O51B 2CDFA 1Z5LA 1RK1A 3P9MA 3SDDD 1WAAA 5A2FA 4OCWH 2JELL 3D6GA 4I77H 2MTPA 1N4XH 5CZVH 4U1JA 4Z7UB 4NQEE 2ZKHL 4I0PB 4JZNA 5EU6E 2P42B 4OV5A 4YXLH 4O2EB 1NBVL 3QJHB 4YH6A 3H2WA 5C2UB 2LVCA 5I15H 2QKIB 3QUYA 4JO3L 2F54E 3GIVB 4BJLA 2J1KA 3VD5A 1A6WL 2ORBL 3GK8H 3LEVH 4YO0B 4NJ9H 1XZ0B 3QEQA 5I1DB 2XKUA 4JANA 3FHAA 3RWDB 3S8WA 4KRMB 3AAZA 1FBIH 4Y89A 3TT1L 4H25B 1MRFL 2FWOB 3QUXC 2H6PA 4WFED 1H3PL 1FHGA 3LDBC 4CW1B 5MEQB 1P4LA 4Z7WE 1IM9A 1JHLL 3SJVD 5BS0A 4NKOB 1OGTA 1YNTA 3S35L 1BGXL 3J8F7 3VGBA 3V4UH 5HHQA 5HDBE 1EHAA 1EXUA 5KZCB 3ZE0F 2QADD 5IIEA 5KSAC 1C5DA 4RGMC 4MXQC 1DEEB 4LAQL 1A9EA 3LOWA 1U8JA 2RJMA 5SX5H 2QEJA 3SE9H 5DLMH 3BAEL 3QI9A 1CR9L 3VXRA 1JUFA 2Z31C 5ENWA 2I26N 4KMTH 4ELKB 1V7NL 2VB5A 2VL5B 3D0LB 4WFGE 1AP2A 4Y4HD 1MAJA 4KKBD 2PKDA 3QG7H 2XG4A 5D2NE 2NX5D 3PABB 3PE9A 4XNUH 2VQ1B 3LQAC 1G7QA 4JFXA 1DSFL 1LE5B 3MMEB 3EYOB 5KS9B 1EJOL 1XGUA 3WFBL 4XGZB 2ZCKL 1A7RL 1QVOB 4HXBH 1NGPH 3O9WB 5D8JL 4DOHB 2K7PA 1HDMA 1E4KA 4MJ5B 1MF2H 4NP4H 3ROLB 3RDTC 1P4BH 3VRJB 3L3IA 3V4VL 5EBMA 1I1FB 5B3JE 5GJTH 2W9EL 3FTGB 1ZTXH 4NUJA 1R3LA 1S7TB 2XTJD 4C57C 1UJ3B 3IFOA 4Y2DB 1BVZA 1UA6L 1S7WB 3ARDB 2EO9A 1LMKA 3Q1SL 5FAAA 1RJLB 4ODSH 3GJEA 4UBDC 4F2MA 2YEZB 4YHLL 4ZUSB 2ZUQC 1GSMA 2FO4A 1JF1B 4JKWA 1F3DH 1ZSDA 2VDNH 4GO6B 3N06B 4KK6C 1IC5H 4PLKC 4X9IA 2C9AA 2BC4B 5E03A 1KLGB 3S5LA 4GMSL 2D7OA 3HRZB 3MFGB 2X4OB 4LLVB 4PJ5D 3IRPX 2WUCH 2I9LA 4HKXA 3DMMB 3JV6B 2GTWA 4S1DC 2DTML 5CP7B 1CZ8L 4KJQD 5MERB 2ICWA 4MZ3A 4L3CB 3HZMB 4EBQH 3BZDA 2PUQT 3PWLB 5CEZE 5KS9E 2OM5A 1WIOA 5H94B 3RZCD 1MQKL 3K2UL 1F02I 1KCRL 4ALAL 3BRGC 3CSYA 5KSBB 1CBVL 4MA7H 4DOHE 1J8HD 3EDDA 4MXVF 3TN0D 1AI1L 3M17A 2O5YL 3SHSA 3SKUD 4LOUC 1QRNE 1X5LA 2PTUA 1IZKA 3Q6FB 4LLMA 1BEYL 4R90L 3UBXI 2R4SL 1NDGB 1NL0H 2QBWA 5DRXA 1J87A 4D9RE 43CAA 1W0WB 2NY6B 1FLRH 5ILTH 3IAPA 1XF4B 5F89A 1CDGA 1MWAL 5FUCC 5F72S 1P7HL 3LQZA 2UWEB 1JGEB 1ZEAL 1R3IL 4ZTOL 4MA1B 3WUWG 1S9YA 1NDMB 5ECJE 3ZDZE 4S10A 4X5LA 5I8CB 3FB7A 1W8NA 2YKLL 1U0QA 4Z7VA 5GGTH 4Y4KA 1U2CA 32C2B 5D96C 4PRAB 4OFKA 2J5LC 2EYSB 3I02B 3V5DB 2P24A 4NQVA 1CE6A 3D1MC 3WMSA 5D2LE 5C0EB 4PJAB 4WUUE 2JELH 1T5WB 4KAQL 1UH2A 3T0VA 3O6FA 3DUUB 1WF5A 3N85L 1FCCA 3IDUA 2VIRA 3CVHL 3R8BB 1JIBA 5EZIH 4OIIL 3LD8B 4JO3H 4RRPA 1KBGH 1NCBL 5E4EC 5F7NC 5B38A 3M45A 5D1XD 5KN5A 2DYPA 1GGTA 1RZ7L 5E24E 2LU7A 4TQEL 2FYYA 5SWZA 1T83A 1FFNA 3MUY1 4K94L 1EZVY 4J2XA 2CPCA 4F7TA 3W2DH 3OG4B 1MRFH 1LILA 1MI5A 1TCRB 3U2SB 2ED7A 1CFTB 5EH1A 1H3PH 5DMKA 1ZA6B 3P11L 3V52H 1BBDL 1CGUA 4C56B 3BZ4B 1U36A 1UC6A 1D5BA 4N0RA 4WI2A 4NKMA 1G9NC 3AY4A 3SKNB 4HPOL 4WHDA 4M6ML 3OXSA 4K8RD 3H9SD 4P23B 3S35H 1FLTX 1TJHL 4M5ZH 3HG1B 4R9HA 4POZD 3BZFB 1JYVA 5HYJB 2UWEE 1JZ6A 3W5MA 4LAQH 4JY5H 4R96A 4KRPB 4JQXC 1QSFB 5EOQL 3QFDB 1RJYB 3C5JB 5FEBA 4GXUM 4ODBD 5TQ2L 3L3KA 1CR9H 2ARJB 3DX6A 2CO7B 3T3MF 3UCRA 4U7KA 2CXKA 1KEML 1OD9A 1V7NH 1K4DB 1T0PB 1J86A 1MNUL 2B4CC 4QXWA 3GI9H 2P45B 1BFOB 4F7MA 3WFBH 1EEQA 2ZCKH 4ZAKD 3SDCD 4R8WL 2IF7A 1MHCB 3ELAT 3T77A 1NFIA 1OP5K 4WWKB 5D7IA 5JR1H 3V4VH 2W9EH 5BO1L 3JWDC 2DLFH 2ADJA 2V17L 3QIUD 5E6ID 3ARVA 1A4JA 1FNHA 1ITBB 3BX7C 4JFEA 3Q1SH 5GZND 3TFKC 1BAFL 4IDJH 4YZFE 2R0WL 5F6HJ 5LJYH 3OKMA 3MV8A 4YHLH 4MGXA 3HE7A 3D39A 1UXWB 3HG1E 3RWJB 4V2CB 3GBNL 5CLTA 3BJLA 5J57B 1UZ8B 5GRJH 5HYJE 3R4DA 3HAEB 4JQVA 1A7NL 5D6CB 1CK0L 4PGJA 1UWEH 3BO8B 3WO4C 4L8CB 2X10A 3M1BA 4RMTA 3NGBB 4AJ0A 4PJXF 3CFKA 4QNPF 1ULVA 2CK2A 2F53B 2BOBA 2IADB 2XZQL 2H32B 4PBWD 4P9HL 4Y4FA 1G7LB 2ESVD 5BRZD 1RZIA 5IJVA 3TNNA 4WFHD 5DTFA 4CJ0A 4P2QD 3I3DA 1YZZA 1IAIM 3QDGE 3WHE1 2WINA 1KCRH 4DQOL 5IVXE 1CBVH 5FK9B 2ZCLL 2OJEA 4IIQB 5CUSL 3TPUA 4OGYL 1ZT1B 1YPZB 1OTTD 3EYUH 2O5YH 3MJ9H 5D7LB 5DGRA 4HAGA 1OP5H 2A6IB 4R90H 3ZT7A 4N0FB 1BD2B 4JHAL 1RJCA 2R4SH 1QNZL 1S7XB 4FZ8L 3VGFA 3MRHB 1J1PH 4ORGA 4LHJB 4YBLB 1BVKB 4BZ1L 3PWUB 5JHDA 2OTUA 1KJ2B 5HGHA 3WS3A 1NGQL 3B3IB 4Y16B 5C07B 3BKCL 5HI5C 3REWB 1FYHB 2X1WL 3LIZL 1ZEAH 1R3IH 4ZTOH 5CKAA 4CDHA 1EHXA 3MV01 5FUZL 1CIDA 3LQAL 4HD9A 3SCMA 5JA8B 3QYCA 2A83A 2COQA 3QO0A 1Z9MA 3G5ZA 2BNQA 4PTUA 3WFDL 1P1ZA 1TZGL 1U3HD 3QDJA 4F8TA 4Y5VA 3QDMB 4MQSB 3OV6A 4R2GB 4MA8L 3UPAA 4K7PH 1ES0B 4LLWB 5DT1H 1WBYB 1G9EA 5TDNB 1YEDB 3O4LD 3ZT6A 3RVTD 4QHUA 1CE1H 1UGNA 3TT3L 4EQ2A 4WU7B 4EOWH 4ETQB 1FFRA 2VUYA 1NCBH 5L2JB 1OAXL 2A6KB 4ZUWB 3DX8A 2O61A 1YA5A 4TQEH 1NC4A 4HMEA 4X83A 3OTTA 3DV4B 1UJ3C 1YPZE 4Y2DC 5D7LE 2WP3T 1DDHA 1TMCB 3ARDC 1TQBB 4WY7H 3O2DA 4TSBH 1BD2E 4QRPA 2VDLH 4QHLB 5IB5B 3QUMB 5GPRA 1D5XA 4ISVB 1K8DA 4HPOH 1BPVA 2VDPH 1VFBB 3IS1X 4ZPTA 1TJHH 2LU4A 4LASL 4BFGA 1VADA 3PWJB 5C07E 1XR8B 2YN3A 5E9DD 1QSEB 3PWPB 4HBCL 3U4AA 4MX7A 4PUBL 3FZUC 4FXGB 1KB9K 5IWLA 4YK4B 1F3JB 1DBML 3MYZA 2E6JA 2XY1A 4RMWA 3LKQB 1UT9A 1RK1B 1BF2A 5HGDA 3P9MB 2DM4A 4X8JB 4F58L 1D5MB 3LKSB 4XPFH 3ABZA 4ZNCD 2IMMA 4XZUA 4CDGC 1NGZA 2XNAA 2VLKB 4PJDF 4U1JB 3VI4F 5GGSA 2QQKH 4OF5A 5HTSA 1GOFA 2A77L 4OV5B 1VHPA 1MNUH 5C0NC 3LN9A 3CLFH 3QUYB 1M7IA 2V5SA 5KJRL 4PP2A 2HAZA 4ZTPL 4NWUL 2X4QA 3V5HA 3OXRA 4R7NA 2X89A 4YFDB 3ZYJA 4JANB 3HZKA 1WITA 1YC7A 3TO4A 4ACPA 3AAZB 4CUCA 4JFQA 3FN3A 4XB7A 3TESA 1OB1A 3VG0L 5MI0B 3C08H 4XI5C 1F6LL 3MGTA 3ALPA 3MBED 5JPNB 1JL8A 2DJ4A 3T0EE 1OGTB 5JQHC 1YNTB 1FNGA 1EAPA 5J4MA 5BOPA 2NY6C 4PBXA 3RUGF 3WFHA 5HPMB 5HHQB 1FVDA 3F7QA 2B1AH 1BAFH 5DEZA 3ES6A 1DN0B 4D3CL 1CGXA 1I7TA 4MA1C 4QRTB 2DWDB 2XV6B 3MLVL 3ET9F 1AKJD 3MNVA 3QI9B 1LK2A 1ROWA 2AQ3A 4M4RA 1A7NH 1MCKA 3VWJD 3VWKA 1CK0H 4TULL 5EOTB 1AP2B 4HUMB 3MOAL 2DQTL 1IAII 1S9VA 2W65A 1WAAE 2EC9T 2ZCHL 4WGVB 1E4JA 4HCRA 1GHFH 2GAZA 4W6XB 4HWBL 2ZG2A 1G7QB 2IEPA 3TVMA 3QQ3A 4L8BA 1XGUB 4NYLB 5GGRY 1T22A 3MCG1 1KXTB 5DA4A 1PQZA 3HR6A 3MBXL 1B6DA 5C0AA 2XZQH 6CGTA 2D0GA 1TVBA 3SE3A 4P9HH 5DMGD 3WJLC 1PGRB 4DAGL 2I27N 4LLDB 5EBMB 2X05A 4DQOH 4HKJA 1G9NL 2VZOA 2ZCLH 5FM8A 2HJFA 3IFOB 1MHEA 4Y88A 1VENA 4OGYH 1MEXL 1WZMA 3EBAA 3S97C 3PV6A 5AD0B 3FN0L 5ITBL 3O0RL 3QCUL 1QA9B 1GJIA 5JDSB 3GJEB 5D6DC 4F2MB 3U6RA 4MAYA 3QIBC 4FZ8H 4G9DA 3C5ZA 1N64L 4BZ1H 4WUKL 4F37F 3D2UA 1TLKA 3WUWA 1QLRA 1NGQH 4YPJA 2FJGA 3RJQB 1CL7I 1ZA3A 3VXSA 1H15A 4H8WC 3UTTD 4Z6AT 3TA3A 4LLAA 1B4JL 4KRPC 2I9LB 3W81A 3O3AB 2B4CL 3L6FB 4KRNA 2YD4A 3QJFA 5FUZH 1TTUA 3VXRE 1XF3B 2YD5A 3UDWC 1GZQA 5LGHL 3TBSA 2P5ED 3LQAH 4P57B 2VXVH 2VXSL 3B9KB 3NIGE 5FDYA 4HK0B 2ICWB 1T66C 4F9PA 2JJTC 3MRBB 1H5BC 4HIXL 3CUPA 3NOIA 4MCYB 4OQ1A 2VXTL 1IE5A 5FYJE 4OUUA 4MA8H 1LEGA 3EHBC 3RVXD 4MQ7A 3JWDL 2ENYA 5K9JL 2PTTA 3TT3H 1X5IA 2LQRA 1HYRC 5E8DL 3U82B 3K3QA 3M17B 2OS7A 3L5XH 4GBXD 2PYEB 1IAIH 1OAXH 4WWKC 5I66B 3EDKA 3NH7L 5CD3A 3MROA 5DRXB 1I8MA 5K59E 5C70A 4MA3B 4D9QD 1WISA 4K3JL 3RWIA 5CZXD 5HXMA 4M9PA 5TDOA 1UB5A 5BW7A 5I6XB 4YGVB 3VGAC 4WI9A 2VN4A 1OAKL 1S9YB 5KBNC 2PF6A 3CFBB 1CDYA 5ABDE 1AHWB 2C3WA 4LU5L 3RL2A 1J18A 5GJSL 3U79A 4AEIL 5IHUL 1KV3A 2FL5A 4D94A 4S0SD 1ONQA 1DBMH 4HXAH 5DO2D 3ZTJG 5GRWA 2P24B 1CE6B 4IRSA 4ZXBA 1T89C 1J12A 5KW9L 1K85A 4E41A 5FM4A 2EDYA 1JN6A 3MFFA 4YC2B 4P9ML 1WT5C 4WV1A 4WVRA 3O6FB 1MIML 2VIRB 1CL7H 1T2JA 2CO6B 4JM2F 3FQTA 3VFUA 5AUMA 3GSOB 1XIWA 4Y0GA 3EO9H 3N50A 1MH5B 5KJRH 3P9LB 1GGUA 5B38B 1YMMA 4NWUH 2DYPB 3BWAA 4H0GA 1X5YA 3FFCA 4U2ZA 5SWZB 1FFNB 4O02L 4IIQC 4NQED 3STZB 4MDIB 1FIGL 5EU6D 2H41A 1XF2B 5DMKB 3VG0H 3QHFH 3EW3B 2HVJA 4LCWB 4OB5L 1D5BB 3V6ZA 4NQTA 3O6ML 4NKMB 1CDHA 3RZWA 4N0YL 3OXSB 4YBLC 1HCVA 4KJPC 2QR0A 2VLLA 4YDLB 3VFSA 4PREA 2NNAA 1P7QD 1DP0A 1KJ3H 3FCTA 4L5FH 4PJDA 3IF1A 3NIFE 4R96B 1WC7B 5IR1B 4JKPL 3UTQA 4D3CH 1I3UA 1KCVL 1Y18A 4WI7A 4HHAA 1U8KB 4Q74A 2GITA 3PGDA 3L3KB 3NFNA 1C1EH 5J7CC 3GSWB 1Y6MR 2OQJA 3J7HA 4P59L 3MOAH 2DQTH 3EYQC 5TE7L 1KB5H 2ZCHH 5CP3A 2ADIA 2DQJL 2X4PA 2P8PA 4DEPC 3KPLA 2OZ4A 3V8CA 4X4MA 4F15B 3K1KC 1I85A 3F7YA 1EUTA 2AK4A 2IFGA 4QWWD 4WFGD 3BUYA 3MBXH 1LEKA 1YEIH 3O2WL 3WUZA 3O2VL 1UM5L 2ADGA 2E7LA 4V2BA 4RDQG 5D7IB 4DAGH 5EFIB 5SWZE 4KROD 3VD3A 1G9NH 4I0PD 4Z0XB 1JF6A 4M7JH 1MI5E 1A6VL 3SE4C 5MEND 1MEXH 1A4JB 2NXYB 3FN0H 5ITBH 3O0RH 5F7EL 3SGDI 1K2DA 2IGFH 3MV8B 2V6HA 5EBGA 1I8KA 3HE7B 4GRLD 4APQA 5ID1A 4M3KB 4BFBD 3H9HA 4PB9L 4MLSA 4WUKH 3RPIB 3R0NA 2B20A 4XXDA 1EFXD 1LO0L 4CVXA 5I71B 4HFWA 2YSSA 4Z78B 1ED3A 4NO3B 2CRYA 1J0IA 1B88A 1UWXK 2OSLB 2R8SL 4OZFG 5I1KL 4G6AD 1CDCA 1JGDB 1S9WA 2Y6SC 3KWWA 4HIXH 1T03L 3P0YH 2ADFL 5I1AA 4NO5B 2VXTH 4WWID 5IJVB 4JFPA 1RZIB 3A6CL 5I1GL 5E2UL 2QSTA 4PGZA 4FNLL 4B53A 1SEQL 5F1SA 2WINB 1K9TA 5SWQA 2XWTB 4WW2A 3JWDH 4GS7C 1F4XH 5C92A 5JW4M 3TPUB 5K9JH 5E8DH 4MJ6A 2Q1EA 4QOKA 3TWCL 5D7IE 3K4DA 4K2UL 2DL2A 3BUTA 4IHOB 1TTGA 4KDTC 5CEZD 3IRZA 3CC5A 4FQCH 5I18L 4Z0BL 2ENSA 5JHDB 4JFEE 3UTPD 2D7QA 3O9WD 3O41A 3ULSA 4JRXB 1DN2A 1U6AL 4K3JH 4U49A 4K3DL 4S1QL 1QTYT 3MV8E 1U3YA 5F6IB 4G3YL 3WN5A 4JFFD 1QRND 3D39E 2CR3A 3BKML 1U8LA 1OAKH 1HXMA 1JV5A 5JIKA 4M7LH 3QO1A 4JDZA 4D9RD 3QI9C 4LU5H 4UV7L 5IHUH 4AEIH 2A83B 4KKLD 4UTAH 3QO0B 2XWBA 3G5ZB 1XFPA 2BNQB 1CTOA 4PTUB 1P1ZB 4OI9A 3E0GA 2Y7QB 3QDJB 1D9KB 1UWXH 3OJMB 1MAML 1XF5A 5T3ZD 3DGGB 4P9MH 5MEPA 1MIMH 1BQSA 4TRPL 2W1NA 5HGBB 3DMMD 3NTCL 1RHFA 2V9TA 3I9GL 4M8QB 1J8KA 4AG4H 5DSCB 4G8EB 4OCNC 1CDIA 4WUUD 4WHYH 3KHOA 3BXNB 5EIIB 3UZEA 1TETL 3QT2A 4XCYB 3HMXA 3VRLF 3IJSA 1QFPA 2F5AL 4EUPB 4DN3L 3RTQA 2WNGA 4RDQF 1HH6A 5J1TC 2FEDD 4OB5H 4H8WL 4J4PD 3D18A 5BV7H 4UQ3A 1D5XB 1K8DB 5JHDE 1ERNA 4TVPE 4JRXE 3GMRA 1VADB 5JW3H 1PW3A 4MX7B 4U3XA 5DS8A 1QSZA 3OKNA 4JKPH 3AMKA 2P8MA 3FO0L 5ACLA 4JM2A 1DUYA 5BXFB 4FTVA 3DOSA 2H9GB 4XZUB 1NGZB 3B9KC 2BNQE 5HGAA 3BEVA 4UILL 3OKKB 4MXVE 5AZEL 1OSPL 3QDJE 1K4CA 4PJCF 1M7IB 2RAMA 2HT4C 4O58H 2FIRT 2QV2A 3NA9H 3ZKXB 1JZ4A 3OXRB 1OOAA 1U91A 4R7NB 5DQJA 4DTGL 3GSNH 5TQ0H 1FG2A 3HZKB 2CIIA 3MRLA 3H42H 1U3JA 3HE6D 3B2UD 3RX5A 5HHXL 4I4WB 3X13A 3O2WH 3O4OC 1OB1B 3BWUC 3O2VH 3UTZB 4N8PA 1UM5H 1MCEA 3TV3L 3MGTB 2F8OA 5EUKA 2JJVA 2BCKA 5DJZA 3A6BL 1A6VH 1D6EA 1FNGB 1KPVA 5JMRA 3U30B 4AEEA 3WFHB 4QRPE 5DVKA 1NMBH 1FVDB 3MRGA 5F7EH 5IB1A 3SGEI 1I1RA 3MOBL 4Y1AB 5I6XC 2X7LA 3EYVA 3NCCB 1I7TB 4HUUB 3QXTA 4PB9H 1MCCA 3IKKA 4LBEB 2AJXH 2AJZB 2D3VA 1S9XB 3QPQD 5EUOA 3PWNA 5EB9A 3UPCA 1HIML 3B9AA 1AHWC 4WTWA 4J12A 4KHXL 3IVKA 2CR6A 1LK2B 2WIMA 1C5CH 3GHBH 2R2EB 1S9VB 1F4WH 4P23D 1A47A 2UZIH 4NZRH 5BZWA 1N2RA 2R8SH 4Z77A 1N5YH 1G0DA 4YC2C 1HSAB 4GW5B 4LPYA 3QQ3B 3WIIL 1JPGA 1T22B 5SX4I 2EDHA 1FE8L 5CJ5A 4U7SA 1D3CA 4KK8D 4DZBB 1RMFL 1T03H 4NRZA 2ADFH 2FECI 1NAMB 3LSOA 3OZ9L 3JV4A 2EDTA 2NY2D 3A6CH 3MX0A 5I1GH 3TYGL 4FNLH 1UENA 3QQ9C 4HKJB 1T83C 4UIMA 1LK3L 2HJFB 3S36X 2VKXA 3JWOC 4OCXL 1P69B 3BESR 1I9RL 2JJUA 4BFIA 2FSEA 2X42A 4NQSB 1MCFA 1BQHG 4XB8A 4X6DB 3DVFA 4MAYB 3G08A 5I18H 3RY6A 3ILQD 5EN2A 3C5ZB 3QDGD 4Z0BH 3D0VA 3I6GA 1QLFB 1QLRB 1U6AH 3BOVA 1DVFD 4S1QH 3T3ME 4P5TA 4DUXA 1KCUL 1ZA3B 4G3YH 3VXSB 1F42A 3MLZL 3MTRA 1UG9A 1AD9A 3G04A 3BKMH 5I8KL 3QJFB 5JIHA 5CAYB 2F8XC 3NPSC 2NY3D 1L6ZA 4UV7H 4LHUB 3CFDB 3K7UA 1DQTA 4NC2B 5F1IA 4JO2L 3ARBA 3SGEH 4HW6A 3HUJF 4AIOA 1ODAA 1DLHA 2VAAB 2VR4A 4OCYH 1F90L 1T0MA 3O8XD 4NQUA 4OUUB 1JNHB 1LEGB 4PRIB 4F15C 5F7UA 4LDEB 4HGKC 2P1YA 1OT2A 2MCPH 1BIIA 2YUWA 2JB6B 3DX7B 4G8FA 5C0AE 2BY3A 3S88L 4MNHB 4O4YH 5ISZA 3WS6C 3NTCH 4EN3A 4HIEA 2FB4L 4DGIH 1OL0A 2ZJSL 4WHTA 1ZVYA 2CXGA 5I1LA 4JAMA 3QUML 3CFEB 3S3JA 2IQAA 2VERN 4X0KA 4UOW0 1TETH 2ZUWA 2EIEA 1QUNA 5SX4H 2X4TA 2FBJL 2F5AH 2NXYC 3W11D 4DN3H 3RWIB 1ZGLA 3S9DB 4X6DE 4LIQE 2GT9A 2G60H 4OZGF 3ULUF 3TP4A 1JJUA 3G5YA 3F8UB 3VFNA 4QHNA 2NY1D 2XQYG 5DJ0B 2YBRA 2IAMD 2CRMA 2NXZD 3QWOA 3VXSE 4HS3A 3RL2B 4PJIF 4JQVC 1U8HA 2FL5B 4YXKL 4G7VL 4QNPE 1BD2D 4RZCA 1ONQB 4C54A 1BX2A 3O3EB 4I9WE 4I3RL 3FO0H 5DJXA 4JPWL 2EEAA 1FO0A 4XTRC 4E41B 3OF6A 3MFFB 3FT2B 4JFZH 4Y16D 5E8EA 4B7IA 5H37H 1JWUA 2MKWA 4UILH 5DJDA 1E4WL 3NVQA 3CAFA 2EDRA 5F96L 5AZEH 2IH1A 1OSPH 3FQTB 3VFUB 2O5XH 2CGRH 4Z76B 3B9VA 4KUCD 3BWAB 3BQUB 4DTGH 1CLOL 1XT5A 3FFCB 4L3EB 1B0GB 1EGJL 1L0YA 3ARUA 5HHXH 5EO1A 4NZTL 2C1OB 4ZDHA 5D4QA 2EDJA 3MRQA 4A6YA 2HVJB 4R2GD 3TV3H 3V6ZB 3QZWG 3RWEA 3T1FB 5L2KD 3DECA 3A6BH 4J1UB 4JFYA 2EXYC 1T1WA 3U1SH 5DK0A 5IMOB 1EEYA 4XPBL 2PO6B 3BT2L 4PREB 4H5SB 1DQLL 3B5TA 4OSUH 4NPYA 3HAEH 3R0MA 1IT9L 3FB5B 4NCC2 4RGOL 3VI3F 5ALBH 5T1LD 3MOBH 5F3BA 2BSRA 3IF1B 1LVEA 3UTQB 2FDBP 3E2HC 3EJZD 2VDOL 3T0ED 2DI8A 4PJCA 3RA7L 3NFNB 4JREC 1HIMH 2OXGA 4OZFA 5EZOL 1MRDL 4QT5A 1F4AA 1XGQA 3HN3A 5FYJL 5DUPL 4YWGL 5DUBB 2NY0C 5IW6B 5EC1A 2DKMA 3PNWA 4X98B 2FR4A 1KTLB 2FBOJ 3MRNB 4KFZC 2JIXD 4E41E 5DJYA 5D1ZD 4PV8A 2H32H 1D9KC 2X4PB 5EZLA 3KPLB 3W39A 1AD0A 4XC1L 1Q38A 1GXEA 4XVUD 3WIIH 4FQXC 1BBJA 1RZGB 1FE8H 2AK4B 5LGJB 1FJ1A 3BUYB 1LEKB 5I17B 3BIAX 4PJ8B 2QQLL 5EO0A 2CRIA 3OZ9H 5M94B 1C12B 1MFDL 3FFCE 1IEAA 2DJSA 2VWEE 2O93L 2AEWA 1LK3H 1HILB 5JOFA 4UTBH 4OCXH 1KJ2H 4JG0L 4KI5F 1I9RH 2Z92B 3G6JB 1RVFL 2XRAH 3UTOA 3QEQD 3IAGC 4H1LB 4L4TA 1GYAA 4ZUTA 4LEOB 4WI8A 4MSWA 1E28B 5EIQA 1LDPH 1SQ2N 1G9ML 3QXDA 4I48A 2VZSA 4PJDE 3PL6B 3VI4E 5C09B 1KCUH 3MLZH 1IM9D 1PX3A 5BS0D 2AK1L 3HNTH 4M8VA 4N0UA 4BM7A 1QR1A 2P5WA 1RU9L 3ILPA 4Q9QL 3V8OA 1UWGL 1S7SA 4UNUA 5A16A 4JO2H 3MCKA 4OI7A 3KWWB 3RIAK 3VA2C 1ZVHA 4MB3A 4XT1C 1FGVL 1BZ7B 3QDHA 3SY0B 1F90H 2XZAL 4JFPB 4X4ME 3ZKXC 3OBAA 4HH9B 4OKVA 3VXRD 1M71A 2AK4E 3N1PC 5SWQB 4WW2B 1UXSB 3K81A 3S88H 3GSQB 5LAXA 3HC3L 4MJ6B 2O26U 3FO9A 3I3EA 4HAFA 2WZPD 3HR5A 2ZJSH 1F97A 3Q6GL 4PYHA 1JWMB 3QUMH 4UB0H 1JZ8A 3CC5B 3NCYS 3MLTB 1K3ZA 4RWHA 3IDGA 1ZE3C 2AXFB 5C6PB 3O41B 1W72H 2FRGP 3G6JE 4YFLI 4AM0B 2FBJH 1QG3A 3ULSB 3SGJC 4GKZB 3FB6B 3O6KL 5MHSE 3WN5B 3QWRD 2VKWA 4ODHL 2AJ3A 1ACYL 2C3VA 5JW5B 1MCWM 4RNRA 5HHMD 2KZWA 1IGCL 4JZJA 5F8QC 3HUJA 5DDHA 4MQXD 4X6FB 4X6EB 3SKMB 4ODUA 4Y5YB 2NX5A 4DVRL 3QR2A 1I3GL 5F21B 1HWHB 4EDXB 1BWWA 4G7VH 2A74A 3OKOA 4I18A 2JJSA 5IUSA 3QH3A 4CVUA 5D7JD 4K3EL 4I3RH 4JPWH 2IALA 3T08A 1LO4L 5MP6L 4GSDL 3ARZA 1MFAL 4QTIH 4LQ1A 4F7CB 4XNYL 4HGWA 2Q3AA 3RGVC 5MEPB 1G7HA 4NRYB 3RKDD 1E4WH 4B50A 3JWOL 5F96H 5IG7A 1EUUA 4YPGA 5DEGA 3AM8A 1IKNA 6FABL 3VFOA 3GBLA 3LB6C 3TH2T 3RVWC 1CLOH 4OZGA 1UKSA 2CKBA 2ZP0T 1EGJH 4ODXA 4QOKE 1I7UB 4NZTH 4RX4D 1IM3A 1HH6B 2AI0L 5T1DL 5KVEL 2RGSA 2ICWI 3TZVA 1CF8L 4PJIA 4UQ3B 2YD1A 1QD0A 1VFMA 1YY8A 3BD5A 3P3YA 1CFBA 1A3RL 2HKHL 1NEUA 5HYFA 4XPBH 5C0GB 4RGND 3N9GH 4XBEL 1AGCA 2GJ6B 5DS8B 1IT9H 4JPKL 3S37H 5JUEH 2P8MB 2BX5A 4JM2B 2E9BA 1DUYB 3IKCA 4UDUA 2XQBL 2GTZA 2M1KA 5FOBB 1SM3L 5EZOH 2C4FU 5FYJH 2Y07H 5DJAA 3SKJL 4YWGH 1IGYA 3RI5K 4O9HL 3OKEB 1SJEA 1K4CB 5DEFB 3MA7A 4UIKH 1AQDA 4Y8DC 1J8HA 4DKFL 5B8CA 4ZMAT 3GIZL 4YDIL 2XKSA 3G6DH 1X6NA 1F00I 4XC1H 1CFSA 2C3HA 3HI5H 5DMIL 1TZIB 1U91B 5DQJB 1G0XA 4XCNA 3GMMA 3PHSA 5FM5M 4Y4KD 3DHMA 4CN1A 2CIIB 3MRLB 2J8OA 2R9HC 3HC0A 3X13B 2QQLH 4PG2C 1MFDH 4LP4A 1BQHA 4IEFB 2ZSVA 4D0DA 3SDAA 3DI2B 3WCYA 1J10A 1IC7H 2JCCF 3VFPB 1CCZA 3HMWH 2BCKB 3IU3B 4WO4B 5DJZB 1FZKA 5FF6A 3OAZK 4MS8C 5IESL 3TPKA 4X4YA 1R24B 1Y6KR 3GJFA 1LP9F 2YPLB 4JG0H 3KYKH 1WBZA 4GMTL 5J1AA 3MRGB 5BJTA 4PJHF 2DYPD 2DD8L 1SYSA 5DD6A 5F7WC 2VZ3A 3EYVB 4MXQD 1S7VA 1IARB 5D9SB 2GJ6E 5EUOB 1MI5D 1G9MH 4JE4B 2VXUL 1DJSA 2N1KA 2RCSL 4IOFC 4W6WB 4U6VL 3BPLB 3P4OA 4BZ2L 4JR9L 3DNKA 5J3HD 1A7OL 2XTLA 4FTVE 5BZWB 4MD5A 1N2RB 4G43B 3WD5L 4Z77B 3U7WH 2W60B 5HVHB 1LE9B 2R1YA 4XXCA 5IFJB 4JZOA 4NRZB 1FGVH 3EJYC 3UC0L 3LSOB 2XZAH 3JV4B 3P40A 3MZTA 5JXAH 1RD6A 5FGRA 4DZ8B 1K3IA 1MLCA 3BQUC 3K1DA 4WI5A 3S96A 2BRRL 4UIMB 1OY3B 5L7XH 2DQUL 3KYAA 4PGDA 4BFIB 1G84A 2FSEB 2NTFB 2W0FA 3Q6GH 3VD9A 4OUOA 1I9JL 1OAQL 4MAUL 3AB0B 4ZPVB 4P3WA 5EN2B 2WBJB 1S7RB 2YPLE 3D0VB 3OAZH 3JXAA 2PO6C 3C2SA 2QSQA 4OKDA 5HD8C 3O6KH 2W38A 4DWHA 3AMLA 5FGCB 4P5TB 1BJ1J 2AJVL 3L5IA 4LEXL 4RMVA 2AV1A 2G2RB 1F3RB 2EZ0C 1IGCH 3G04B 5EUOE 3GSVA 3ZKSD 4MJ4A 4HS6A 2J8UF 3LPGA 1YEFL 4JFED 3QXVA 4LSVL 1G6RL 4XPHL 3JV0A 3ARBB 4L4JA 1SY6A 1PSKL 2WLZA 3HE7D 1VESA 3KJ6L 3D39D 3L7FB 4K3EH 1LO4H 1T0MB 4FXLA 3RKPA 1MY5A 8FABA 3LKRB 3EAKA 3MRPB 4XNYH 3DX9B 1BIIB 1FH5L 3L5HA 1ZWIA 3JWOH 3RWCA 4M5YH 4PJ8C 3QIUA 4EN3B 5EO9A 4HIEB 1FL6B 4Y5XA 4FFWC 4WHTB 4W81A 3B6SB 2FEEI 1XEDA 4JAMB 1A7PH 4LPWA 3SPVA 3QZWA 3OJ2C 1NLBH 5C0CB 1JTOA 3BDYH 2XACC 1P53A 2VSCA 3IGAB 3KLAA 2X4TB 1OVZA 4UV4L 2EE3A 4Y4FD 2AI0H 5T1DH 4DVBA 3KYMA 1I8LA 2V7NA 5KVEH 3TIDA 3L9RA 4UQ2A 3OKYA 1ORQA 3G5YB 1FAKT 3VFNB 4M3JA 4FFVC 1A3RH 2HKHH 2WP3O 2D7PA 2YBRB 5FGCE 4HWEH 3KYNA 2Y06L 4HX1A 4HS3B 2DQGL 1J1XH 3PL6C 4OCRH 1OTSD 3UX9B 5ESQA 4UUJA 2ZUTA 3RHWK 3BFOA 4RZCB 3ZKNC 5CLWA 1AO7A 5JW4Q 5DJXB 4TVPD 4U1HA 5CS7A 3STBA 3KPRB 4NOBA 1SM3H 2Y1VA 5IROA 3UYOD 5E8EB 5BRZA 3SKJH 5DJDB 4JB9L 4N9GA 5D1QB 5I1CL 2IH1B 2NY5C 5ID0A 1AC6A 3GIZH 2GQHA 1FNFA 3SCMD 4X7DC 1NCWH 2ARJQ 3B2VH 4WW2C 1PJ9A 3HPJB 12E8L 5FKAA 5JORA 1Q1JL 4ZDHB 4TOYH 1E6OL 3MRQB 4A6YB 5DJCB 4OAWA 2OL3A 5JZ7C 2WQ8A 2X70A 5DK0B 5DURB 4LVNB 1T5XA 1OHQA 1OGAA 3LKPA 4N0CC 3MV9D 1MFEH 1CG9A 4HFUL 4NPYB 5J12B 4G6JL 3V0VB 2AXHA 5J6GA 2PCPA 2DD8H 2BSRB 4ELMF 2H45A 1EZVX 3ARFB 5TDPB 1NC4D 3IDIA 3WHXA 3GMQA 2I9TA 3CSPA 3U7YL 2X1PA 3MLRH 4XCCH 1YN6B 4Y5YC 3EOAB 1I8IA 4OZFB 1FL5B 1RZFL 4QT5B 1F8TL 5A1AA 4QRPD 2RCSH 4QRRA 5EC1B 4LCCB 4U6VH 2R4RL 3PNWB 2FR4B 4BZ2H 4JR9H 3KXFD 3ULVF 1A6UL 4F80A 1A7OH 5DJYB 1J05A 4PV8B 1QQDB 4YQXH 1NAML 4F57L 5EZLB 3W39B 1AD0B 3C60A 3WD5H 3V7MA 4F3FA 4WRLA 1BBJB 3MUGB 2JCCA 1HHGA 2HKFH 1NGXA 3VRLE 2E27L 2AERT 4JN2A 1KT2B 1J0HA 4L4VA 3RY5A 4PJ7B 1DQDL 1LP9A 3UC0H 2YA0A 3GB7B 3V6BR 4U1MA 5DWUL 3R1GL 4LIQL 3FAXA 2X44D 3BGFB 5JOFB 4KXZH 3KG5A 2YMXH 5GRXG 3V6OA 2DQUH 3A67L 3D3VD 3TH4T 4R4BA 5E9DA 1I9JH 1OAQH 1NBQA 2X89D 4L4TB 3EZJB 5E6ZA 4NZUL 4ZUTB 3PG2A 4MSWB 3OX8A 5IJKA 3U9PL 4AZ8A 3TO4D 5L0QB 3OPZH 3MRDA 3MLUL 3QXDB 5ERWA 2NYYD 3L3HA 4I48B 4TUKH 3SDDB 5AYQA 1HOCB 3BJ91 5EU7C 1EERB 2FHCA 1BFVL 1H3XA 4PJCE 2ILLA 4LK4A 3ILPB 2E5EA 1ZT4B 1KIQA 1YEFH 4LSVH 2UVFA 1Q0YH 1YUHA 1CD0A 1ZLVK 3GMOB 3RWHA 3ULVC 3KJ6H 1I7RA 1N5AA 1TVHB 5GS1C 3GZKA 4HMCA 1U58A 4LCUB 4OKVB 1MCDA 1RI8A 4U1KA 1M71B 4DK3A 3MJGX 2I25N 4XMLL 4FG6C 3VWKD 3MBEA 2A38A 4NZDA 1FH5H 3VFGL 3HI6H 5LAXB 3SJVB 3OSKA 3HB3C 1O7VA 5E2WL 2BHYA 4BQBA 3O2DH 1KYOK 4I3SL 3VFVA 4FQHA 2EIDA 4QO1A 3QSKB 3TVMD 4OF3A 1WWWX 4WO4C 2QADB 43C9A 3IDGB 1FORL 5LWYL 3PWVA 5HJ3B 3VH8G 3UEZA 1EFQA 5I16A 1T2XA 3MA9L 3G5XB 5C0AD 1RUQL 2AJUL 4UV4H 3JBG7 2YZ1A 3QQNA 4L4TE 2AV7A 1ZV5A 5D71L 4KZDH 4NSKB 1F58L 3IB4A 5EC2A 3WIHL 2PETA 3BYYA 2LFGA 4ZUVA 4RNRB 5HGGS 4JN1H 3VWJA 1F5WA 4JZJB 5DDHB 2ITDA 3IDJB 1HN1A 4C83A 4ODUB 2NX5B 2Y06H 2HJKA 1TCMA 2DQGH 4BQ9A 1MSPA 4Y19A 2A74B 2IBGA 3OKOB 3OKLA 4MAYD 5FKPA 3MRIA 3CFCH 1FC1A 5IEKA 1T04B 4N0UE 1FGNH 5E94A 1N3NA 3U0TB 2P5WE 2FX7L 3D2UD 4M1GL 4RMQA 1BWMA 4HGWB 3DWTA 5FXCH 1RZKC 1G7HB 1Q9WA 2MPAL 2R1XA 3DJ9A 3MJ8B 3TA3D 4JLRA 5I1CH 1ZLVH 3VGEA 3MRCB 4YPGB 5DEGB 2ZG3A 5EU5B 4WFEE 3VFOB 2APFA 4YBQC 4RWYL 1GPOL 4P2OA 4ODXB 4K7PY 2DQCL 3MLYL 5AZ2L 3QFJD 4H20L 4ODWA 1X7QB 3MOQA 1IM3B 1Q1JH 2NQCA 1E6OH 3FRUA 1DE4A 2L7UA 1YY8B 2VMFA 3W0WA 2WBJC 2EXWC 5BVPL 3R06B 4R0LC 4OI8A 1IGIL 4PJEB 2RQ8A 3QEUB 1X5KA 4G6JH 3FFDA 1PX4A 4ONFH 5DD1L 3FZUD 4IDLA 4CL7A 3HUJE 4HUKB 3NIDE 2NX5E 3QXUA 3ZKMC 4JGUA 1NCDH 4LNRA 5KANG 4HCRH 2DBJA 2BVPB 1F4HA 1RZFH 5DJAB 1F8TH 2FX8L 4PIRF 3WSQH 1MLBB 1X6LA 2R4RH 1SJEB 1CDBA 3ARQA 4AQOA 1AQDB 1A6UH 2A6DB 3PP4L 1J8HB 5B8CB 3UBXB 3HHRB 1NAMH 1V8HA 3TN0B 4F57H 4R7DA 2B2XH 4BSWA 2WK2A 3VXPB 1CFSB 4P5MB 4LPXA 5CEYA 1AGFA 4F9LC 2ZOKA 4Z7OE 1JRHI 5DVLA 5IOPB 3UYRH 3FQUB 2Z4QA 3HC0B 4BZYA 1QOKA 3X12B 4IRSD 1CDJA 1KOAA 4ZXBD 1LQSR 5HY9A 3GMPA 5IBUG 1BQHB 4OZGE 5DWUH 5F3HB 4D0DB 3ULUE 3BPCA 3R1GH 2IBBA 4LIQH 5MEOA 1IL1A 4ELMA 1CFNA 1EEZA 1GZPB 1OF2B 4X4YB 4JPVL 5FYKL 4ZFGH 1F6AA 1A64A 1J1OL 3GJFB 4XNQA 5D5MA 3DSFL 1TPXB 1XIWD 1WBZB 5IV2A 3A67H 4PJIE 5DYOA 4NN6B 1CICC 2J6EL 3BHBA 1YMMD 1TQCC 1SYSB 5FDWB 3GI8L 4NZUH 1AGDA 3ZL4H 3I6LD 1N8ZA 3LEYL 3U9PH 1BREA 2BHUA 4PJFB 3MNWA 3MLUH 4G5ZL 1IGTB 3F7RA 5FA3A 3BMVA 1VGEL 4HT1L 4XBGA 3P4OB 3AREC 4LRIC 5E08H 4GQPH 4PRPA 2NY5L 3I75A 2VH5L 1Q0XL 1QO3A 3B8SA 4G6ML 5DD0L 3GUTA 2A2QT 1MJ8H 3L3DB 2OTPA 4JJHA 3DO7A 5GZOC 3QB7C 5D1QC 2R1YB 1IC1A 5EOCL 4XHQA 1J8HE 3T0BA 3H9YA 2UV3A 3DXAA 3S4SG 3VXQB 4X9BA 1DBJL 3L95A 2HLFD 3OJDB 3HRPA 1MIEH 1MLCB 3S96B 4NM4L 4XMLH 3MPCA 3SO3B 2Z91A 3VFGH 4DKEH 3HI1A 4C58B 3H9SB 2UYLA 5GRYA 1CFVL 1S5HA 1QKZH 1U8OB 1P7QA 3BGMB 2R1WA 3F5WA 5SV3A 1EO8H 1NMCC 3D25A 1ZHNB 2AK4D 3QIBD 1TFHA 4LVNC 5CJXA 1JRHH 2BVYA 4X7TA 3SQOL 5IKCB 5ICXA 3MA9H 3MREA 1RUQH 2AJUH 4EJ1C 2EDBA 3UZVB 5D71H 1Z0NA 1F58H 3OR7A 1N0LA 3ARFC 4OM1H 2ZUUA 3RX8A 4BQ8A 2YRPA 1MFBL 4XMKL 5IW1B 1V3JA 3GSVB 5DHYB 5HYSG 4HS6B 5EU3A 5T1KA 3WV0A 2I5YL 4E42A 4BH7B 3TNMB 2WMPA 4LCCC 4YHMH 3CDGA 4APQD 4KHTL 1G7PB 1FYTD 1C08A 3GNML 2Q7YB 4ZAKB 3SDCB 4YHIA 2R29H 4C59B 1FN4B 2FX7H 4O5LL 5ALCL 4WEUD 4LVHC 8FABB 3O3BB 2I07A 4OQTL 1KCSL 1CD9B 2EIZB 3OAUH 3EHBD 2R0LL 2YUZA 2E7HA 1AXSB 1M1SA 5FGBA 1CT8A 1NFDA 1WEJH 3E8UH 4KI5E 3QIUB 4G42A 5EO9B 3SGKC 4JVUA 5E6IB 2G9HA 5MENA 2OR9H 2E8ZA 4RWYH 1GPOH 1RIVL 2SEBB 3SPVB 2VXQH 3QZWB 5TPWL 2FO1A 3L3OB 3IDMA 4CNIA 2DQCH 2I60L 3MLYH 4H20H 3KLAB 4GRWB 1F4YH 2YOCA 4W70A 3LS5H 3KYMB 2V7NB 5IF0A 2M26A 3TIDB 3L9RB 1ORQB 3P2TA 1EFXA 4IOIA 4AENB 1NAKH 5BVPH 3MV11 5L0QC 2VRAA 5F44A 4QOKD 3KYNB 2EDFA 4U6XA 3SDDC 1FAIL 5AYUL 2W92A 5ESQB 3ZHDA 1KTDA 4EKXA 5DD1H 1AO7B 1BQLL 4MNGA 1BJMA 5CHNA 4U1HB 4QRUA 2C7UA 2OZ4H 3C87A 5DHXB 5BRZB 3FAWA 1E27A 3GGWB 4FRWA 1KF9B 2YD6A 4P2QB 4N9GB 1UM4L 5F9WB 4F37K 4LF3A 1KENL 1TZHB 1EMTL 1RK0B 3D5OF 1Q9OB 5LBSL 4U1GB 2ZUXA 1KACB 5DJ2A 1MFNA 4Q2ZB 1N6QL 5IQ7L 1DUZB 5F8RC 3NN8A 2EC9U 4RAHA 5IM7A 3WIFB 3EDFA 2OJZH 5C0FB 2BXYA 2GW5A 1BZ9A 2VABA 3QUZA 1L7TL 1RUAL 4H1LH 4M43L 1FZOA 3GSXA 4JFFA 1NLDH 2Q20A 4JPVH 4EVNB 1T5XB 3ARGC 1P2CA 3LKPB 2YD7A 4D8PA 1WSST 1CG9B 1JYXA 3KPNB 1AGEA 2J6EH 5F9JA 2PCPB 4RCAA 4I0KA 2DMKA 3IDIB 2IANA 4Y4HC 3WFCL 4KKBC 2AGJL 2OBGA 2BY0A 5CILH 1I8IB 3RTQD 1U3HB 5H35B 3E6HA 4JFDA 1AO7E 1VGEH 4HT1H 1RZKL 2AXGA 1R5VA 3KPMA 2FJHB 1HHJA 3LV3A 5IHZB 2NY5H 2VH5H 2DIAA 5EBLB 1IFHL 4M1DH 4XVTH 1UH4A 5CJ8A 5BRZE 4JM4L 4G6MH 3C60B 1GGCL 4KPHL 4IRJA 4WFHE 1AGBB 3O81A 4F3FB 2X4SA 1A21A 4RISL 5EU4A 4L9DA 3X3FH 3V79C 2IJ0C 2JCCB 3GSUA 1NBYA 2DIBA 1NGXB 5HVGB 3VRIA 4JN2B 1RHHB 2XTJC 1C5BL 4JM2D 4MXWL 3AM8C 4HV8A 1LD9A 1LP9B 1DBJH 3QCVH 4FTVD 2GSGA 4Z18A 4AEFA 1QR4A 4U1MB 3MSPA 1CVRA 1ZGLM 2E9WA 1ZVSA 4NM4H 2OYPA 2DIJA 2P49B 4WFFD 4J8RA 3VH8A 5JO5A 1TJGL 3P4MA 2GI7A 2ZPKL 5D7KE 1CFVH 5E9DB 5GISH 4UDTB 2F5BH 4PLJD 5HI4C 2BFVL 5HVWA 1QZ1A 3JTTA 4P46A 4FQ2L 3SDXF 3UJIL 2GJZA 3HC4L 3BP5A 2NY4D 1FNEA 2DBLL 3MRDB 5ERWB 3L3HB 5J9PA 3D85D 1OQOA 4IBLT 3E3QC 1ADQL 4YIQA 3EDEA 1VEPA 1IAMA 5HHVH 2X09A 4XMKH 1JHKH 4KJQC 3OG6B 5DJ6A 3E6FA 3BP7A 4M7KL 3BZEA 4L8SB 5DZNA 1IJ9A 3VXTA 1KIQB 5JIIA 2DTSA 2I5YH 4QRRE 3RZCC 1IMHC 4YDVA 3RWHB 3NCJH 4KHTH 3SOBL 2Y6SD 1I7RB 1QFWI 3MJ7A 4F8QA 4YHPA 5DC9B 4GOSA 4OCMC 3TN0C 4LSSL 4O5LH 5ALCH 3GMLA 3DIFA 3LQMA 1JGUL 1WTGT 2JCCE 4U1KB 4OQTH 1KCSH 4JFOA 2R0LH 2MHAA 5CEXB 3MBEB 1FFOA 1RURL 2HFEA 4LLQB 5EIVA 1V3KA 3UPRA 1PKQA 5FHBL 1LP9E 1JYWA 4M03A 4OFDA 2X40A 4XP1L 1INDH 4N8CL 2B0SL 4FQHB 2G75B 1I7ZB 4N5ED 3IDXH 3U9UB 1RIVH 3H7BB 43C9B 4HJ0D 5CWSB 5FO8A 3V6OE 1AQKL 3L1OL 3PWVB 1RPQA 2GK2A 5I16B 2Y9RT 1H8OA 4PGCA 1TPXC 1G1CA 4NN6C 5E9DE 2LV4A 4LSDA 4MNQD 1FC2D 4L3AA 2Y5EA 2EC8A 2HWZL 5ADOL 4ZUVB 3VWJB 1QBMH 4L8DA 1SVCP 4IJ3B 4JPIA 4NKQB 2FGWL 2ITDB 1MQ8A 4OCSH 1FAIH 3OKLB 2G5RA 3IFNH 3L5WA 1BF8A 1BQLH 3MRIB 5IEKB 5E94B 3BN9C 1N3NB 4M6OL 1FL3A 1ZANL 4WCYL 3BVNB 4L1DA 1IC4L 4PJGB 3SKOB 1J0KA 1NC2A 4M7ZB 3TJEL 3LMJL 4P5TD 5D1XC 1YNKH 2R1XB 1N4XL 5CZVL 5CCKH 3DRTA 1KENH 4YXLL 5LBSH 3I2CL 4A6YL 3DVIA 3N1FC 2PYFB 3IXTA 2C5DC 1KGCD 3GK8L 4LLUA 1QEWB 3ARBD 4GQ9H 5C0JA 1DFBL 5IBLC 4K8RC 1UVQB 3RNKB 4P4KC 2Q76A 1MCOH 4Z8FH 4Q0XL 3KYOA 1WFOA 3FRUB 4OGAD 3AXLA 2GK0A 1DE4B 4OZIF 4NC1E 1L7TH 4POZC 3CX5J 3V5KB 3DROB 4M43H 3QIWC 4WU5A 2V2TB 5ESVA 4X6CA 2XFXB 2V7HA 3UTTB 5SWSD 2BDNH 4S0TD 5ISZD 2HLAB 1MPAL 1WIPA 4U31A 3ZE2F 3FFDB 3KR3L 3V4UL 4P4RB 4KKAD 4UAOC 1OAUL 1K5NB 4J3OC 4PGBA 3WFCH 2AGJH 2QQQA 4HLZH 4Y19E 1WWBX 4QXGL 3SE9L 3GHEL 1MCRA 2FNBA 3UYPA 4KQ3H 3H0TA 4KMTL 3VXOB 4ZD3H 4ZAKC 3SDCC 3GDBA 1AXTH 1WFTA 3S4SA 1IFHH 3QG7L 4R7DB 4JDVB 1GGCH 4GBXB 1K8IA 4XNUL 4XNMA 4QY8A 2VLJA 1B4RA 4UT9L 3ZYIA 5ELIA 2Z4QB 3VJ6A 4MXWH 5E6IC 4HXBL 1NGPL 4YHYB 2BZDA 1KB5B 3OF6D 3GMPB 1L9NA 1MF2L 5GZNC 3GSRA 3VFMA 3UJTL 3BPCB 2WWMC 3WEXA 5MEOB 1BIHA 1P4BL 1IL1B 1I4FA 3K8LA 1CFNB 1EEZB 3KPOB 1I1AA 4NBZB 3QCTL 5KOVC 1UQSA 4I5BA 1F6AB 1ZTXL 5D5MB 2D7TH 5IV2B 5DYOB 2ZPKH 4NUGL 3BHBB 3W0WE 1JGVH 4ODSL 1N8ZB 3UJIH 3EOTL 1U92B 3HC4H 2DBLH 5HYSA 5JA9A 2VDNL 1SEBA 4A2MA 3QRGH 3MLSL 4XBGB 4NM8H 3L7EA 3PF2A 3S7GA 1RZ8B 1JZ7A 4W4OC 5BVJA 2HTLC 4M7KH 1HEZA 2ICES 1IQWH 5C71A 2YN5A 1ZHBB 5T3XE 5EZJB 4R4FL 1AR2A 5ADPH 3BH9A 2GCYA 1BVLA 2BK8A 5F9WC 1W0VA 3SOBH 1ZHLB 4K9EC 4LLYA 4NQEB 1FV1A 4FP8H 2BMKA 3L95B 5EU6B 1OTTC 3C09B 4JO1H 4LSSH 4D0BB 4EBQL 1C16A 3WJJC 1P6FA 1RURH 2CDEA 4U1IB 5L2KA 3MQIA 5FHBH 3SDXA 5J56B 5E70A 5E99H 2UYLB 1KPUB 2B0SH 1T0NA 5C9JA 5CD5D 1P7QB 2NW2B 4ELME 4NRXA 2JE8A 5T1LA 5KG9A 3D25B 3INUH 4O2CA 5D5ME 1G7IA 1OSZA 4I8DA 1FVEA 1LNUA 1NL0L 1UZ6F 4Z7WB 3TO2A 3DETD 3MREB 3EO0A 1MRCL 2VOTA 1RZJH 2A9ML 4N1EA 3OR7B 3ZSSA 2VZ1A 1J0YA 3U36A 1CD1B 2APTA 5JXEA 1G7JA 3DYOA 1NGYA 5DMJB 1CGTA 2YPKA 1Q9LB 4U1NB 5EU3B 1FO0H 2X9YA 2YPVH 2JIXA 1U3HC 3CH8A 5D1ZA 5I76A 4E42B 4HG4J 4PRNA 1FSKB 5E8PA 4PRPE 4OD2B 3JVGA 5GGTL 3AROA 3RVTC 4YHIB 4WCYH 3SBWC 1U8NA 4WEMB 1TNNA 1IC4H 3MRRB 2P7TA 2I07B 3TJEH 3LMJH 5D2NB 3KPQA 3P77A 4KROB 1CT8B 1NFDB 3TBVB 3DXAE 4G42B 2HN7A 2G9HB 5EZIL 5K9OB 5MENB 4FMFA 3I2CH 2P5WD 4A6YH 3IETA 2PXYA 2VE6B 1KBGL 3RNQA 2DICA 3CMGA 1U8IA 4U6HB 3IDMB 3ZZ1A 3PDOA 4GRLB 1DFBH 2NTSP 1UEYA 4KV5E 1EO5A 4Q0XH 3W2DL 5F1KC 5IF0B 4YHOH 3U0PB 4P9HC 4PG9B 1EFXB 1WJ3A 3EFFA 3MRFB 3V52L 2XPGA 4ZYKA 4UINL 1MWAA 5DRWA 2FIKB 2N7AA 1BP3B 1MPAH 4OZFH 4U6XB 4M5ZL 3ZSTA 2Z35A 3KR3H 4W4NA 5CSGA 1OLZA 1OAUH 4MNGB 3WHE0 1UADC 2HT2C 5BV7B 4JY5L 4QRUB 2L0DA 4L8SC 1TDQA 3MLXL 2BJML 4PTTA 1E0OB 1OP9A 2XKNA 4QXGH 4XTRD 5CIPA 3QNYA 3GHEH 1DBBH 1GGYA 1K6QL 2YD3A 1F11A 4NKDB 4KK5D 4PJ9A 3OGCA 4LF3B 4WJ5B 1A1NB 3G6AA 2FGZA 2I24N 1P7KB 4RIRA 4RAUA 2R39A 2UY6A 3CVHA 3FRPG 1CYGA 3ESVF 5FA4A 7FABL 3GI9L 5DJ2B 3PJSA 3EO1B 1NFDE 3MBEC 4FFYH 5KOMC 4UT9H 5IM7B 2YC1A 3C6SB 3FOLB 4OFYA 3KPSA 2H3NA 5MENE 1Y0LB 1UKTA 1AXIB 5TGBA 3MRMB 1R5WA 5C2BH 2VABB 3UJTH 2QSVA 4NC1C 3GSXB 3T3PE 3BKYL 3QWRA 4JFFB 1QRNB 5JR1L 3QCTH 5CSZA 3B83A 3GSNB 4K23L 5F9OL 1KULA 2DLFL 5I1JH 1CXIA 1JPFA 1REIA 1YYLL 1AR1D 1AGEB 4NUGH 2Z8WC 4LKCA 2Q8BL 1KFAL 4IDJL 3MO1B 2BVQA 3ULUD 4W6YB 2IANB 4IJ3C 4NFBA 3PIQA 2O5ZL 3EOTH 3UAJD 1UB6A 2H1PH 2HTKD 5D7JA 4PGEA 5GRVL 3NPZB 5GRJL 4XP5H 3MLSH 3TZVD 2AXGB 4MNGE 3KPMB 2NY0D 1YEHL 3LV3B 1T6WA 1A7QH 1UWEL 3OHXA 3IFLL 2X4NA 4M7ZC 5DMGC 1IKFL 1X5XA 2X4SB 4R4FH 4HKBA 1A6TA 5DRZB 5D2LB 3GSUB 1NBYB 4HDIB 4WUUB 3QA3B 1VFAB 4FQXD 4AT6A 3HTLX 4K8RL 3FB8A 1SYVA 1KTKE 4HV8B 1LD9B 2GSGB 4RX4A 5EA0H 4XPAH 3KLHD 2RBLA 1ZVSB 5DI8B 3RY4A 3KS0J 1YEGL 3TBTA 2FATL 3TJHC 1PEZA 4M9OA 4J8RB 4WHYG 1X5FA 5JO5B 1LO5A 3UTPE 3NFPA 3C6LA 5F97E 1NANI 3T65A 3EYUL 4TNVF 3MJ9L 4JFFE 4MHHG 2EDKA 3BH8A 3H6JA 3WKNA 2NLJA 3BPOB 2GJZB 3WLWD 3BP5B 1FNEB 3JWNC 1J1PL 2EICA 2HJLA 1MRCH 1IAKA 4YDKL 4MD4A 2A9MH 3SDAD 4JO4L 1P9MC 3CVIH 2IANE 5F1OB 5C0IA 3BEWA 4XCEA 2DWEB 5CGMA 4HUXB 4TTDD 2Z93B 5DJ6B 3E6FB 4JFDE 4Z5RA 1Q94A 2P8LB 3VGDA 3KLSA 2ZNXA 5A3ID 5T3ZE 5KSUA 4YDVB 3RVXC 3LKOA 2C1PB 5J89A 2WIIA 1MCIA 5D93B 4YJZL 4P2YA 2JK5B 4HWZA 3HE6B 1CGSL 4OD3L 1BZQK 1T21B 5E00A 4GBXC 2KH2B 5TF1H 4ZSOA 4JFOB 1RV6X 4K7PL 2MHAB 4CKVX 3ULUH 5CMAA 5DT1L 1BHGA 3GJFK 3UPRB 1CE1L 1TVDA 2ID5A 3MC0A 3FT3B 4EOWL 3RWGB 4RSVA 5I2IA 1KIPA 5CZXC 5TE6H 4G6KH 5KSAA 1YMHA 4PGCB 2Y36H 4GG6F 4KI5D 1D5IH 3BE1H 1F6FB 4WY7L 4TSBL 4PV9A 5SV4A 5HDBF 3T2NH 1H3WM 1VERA 2VDLL 2Z31A 3CCHA 4L8DB 4UINH 1T3FB 1B3JA 3RU8H 3VXUA 4JPIB 4CADA 5DO2C 5GRVK 1JNLH 4NHUA 2VDPL 3EOYG 2MCG1 2H26A 3MLWH 3QNZA 3TCLA 2H2SD 5E0QA 3W5NA 5E8OA 3VFWB 4AK1A 1U8QA 4KRLB 1D5ZB 4K9EL 3V6FA 3CDYA 1FL3B 4EI5C 4XWGL 4B7LA 3BW9A 3MLXH 2BJMH 2BSTA 2HFTA 2NY2B 1FFPA 3P4NB 4OV6F 3RDTA 1K6QH 4XPFL 2BOCA 3RGVD 4Z7UF 3DRTB 2QQKL 4QXTB 1MELA 4LVOB 2P44B 4QF1A 3C09C 5ACMA 3CLFL 7FABH 5IBUB 1EHLL 1PKQE 3L3JA 4XP9H 1H8SA 2XQYK 4G8IA 5AEAA 4ZG1A 3WNOA 2IPUK 3GJFH 3QDGB 2Q76B 5IVXB 2HFFA 3KYOB 1N7ML 2Y72A 2GK0B 2KKQA 3NCEB 4KMLB 1JPTH 1RUPL 5IMLA 1DVFB 4WU5B 3C08L 2BVEA 5DC4B 3BKYH 4X6CB 4MDJA 2CMRL 2V7HB 4K23H 5F9OH 1PYWB 4WNQB 3EFDL 1WWCA 5INCB 1YYLH 2CIKA 5IFAH 2VSDA 2NY3B 3DURA 2Q8BH 2B1AL 1NFKA 1KFAH 4QEGA 4PR5A 1H0DA 2YHGA 2VDQH 3NABH 2O5ZH 4GXVH 2VLRD 3RVUD 4Q6IB 4JVPA 3O8XB 2AP2A 3BKJL 3MR9B 4JVWA 3WBDA 3DUHA 3H0TB 1R3JB 1YEHH 5ICZA 3VDCA 2GUOA 4QWWC 1NCTA 2IH3A 3IFLH 4KVNL 5DQ9A 2MQ0A 3QISA 3VDBA 3LY6A 4PP1D 1GHFL 4XNMB 5D2NC 1IKFH 4QY8B 2V2XB 4KROC 5KS9F 1AO7D 2WANA 5C0DB 4I0PC 4K8RH 1U95A 1V3MA 4M93B 3VFMB 3WEXB 4IMKC 4PRHD 5J6HA 1RY7B 1YEGH 2FATH 3X14A 3BD3A 4DCQA 4DGYL 1L7IH 5GSRA 4GRLC 4PBVC 1INQA 3UJJL 4NKIH 2AKRA 2NY1B 2HVKA 4TNWK 3S3PA 3TF7C 1T1ZB 5IHBA 2IAMB 2NXZB 1EDQA 4X6CE 1IEBA 3QHTC 1HINL 1GAFH 4HZAA 1IGML 2DLTA 4PLOB 5HYSB 2V9RA 4U1SB 1SEBB 4YDKH 3QUKA 1ZLSH 3TBWB 1JI2A 3BP4A 3ZDZF 4JO4H 4G6AC 1PG7L 1SY6H 4LARL 4N8VG 5D7KD 3TC9A 4AY0A 3QG6A 1ZK9A 5BV7C 5ACZA 15C8L 5BVJB 2Q86A 1JWSA 1OGAD 1A2YA 4QTHA 1LO3L 3H3BC 1WTLA 2BVTA 5K9QG 4N1CA 4LSTH 1VACA 3WKML 1JHTB 4HWBA 1BVLB 1JPSH 2VXVL 4HPYH 2A73B 3MV7D 1W0VB 4LLYB 4N68A 3LN5A 5IMMA 3W9EA 2BMKB 1CGSH 4OD3H 3THMH 5H2BA 2BHZA 1C16B 5GQBA 3FQNA 4L1HA 4QRRD 1XGPA 2CDEB 3QAZB 5L2KB 5KSBF 4HIIB 1DCLA 1HI6A 5KVDL 4GRWH 4U6YA 2JB5H 4LKXA 3O9WC 3MRJA 4NQXA 1T0NB 5C9JB 3MV9A 3C60D 1W2KT 3L5XL 1IAIL