4RIRB

Structural analysis of the unmutated ancestor of the hiv-1 envelope v2 region antibody ch58 isolated from an rv144 hiv-1 vaccine efficacy trial vaccinee and associated with decreased transmission risk
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the unmutated ancestor of the HIV-1 envelope V2 region antibody CH58 isolated from an RV144 vaccine efficacy trial vaccinee.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CH58-UA Fab heavy chain
total genus 42
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rirB01
4OCYL 5EU4B 4K71C 2PTUA 3KJ4C 5E8OA 5C09E 3UPRB 2IAMC 4X6CE 3VXNB 3W9DB 5EWIH 3WHE0 1OSPH 2A6JB 1YN7B 4G6MH 1C1EH 5D7JC 5C8JB 3VGEA 2EIDA 2W9DH 3MBXL 1P1ZA 1F3JA 3MRJB 5I15H 4MNQB 5MENE 1UM4L 4ZO7A 2AEIT 4WY7H 4TSAL 3QIBC 3S34H 4PRBA 4N9GA 2LABA 4Z6AT 5F1IB 1G0YR 2H26A 3TIEA 4JRXD 3QUZA 5HVHB 4RWYL 3B9EA 4LP4A 1MHEB 1WT5A 1ZSDB 1TQBC 4LCUA 1AI1H 2ICEA 4U0QB 3ECBB 4S0SD 2GFBB 3LRSB 1P7HL 4R90L 4FFYL 3LH2L 1JPFA 1FFPB 3MV9E 1P7KB 4C57C 3L3IA 4GH7B 3Q6GH 3TNNB 3QQ4A 3TCLA 1HHJB 1KXVC 1ZEAL 3UTTB 2IH1A 3U6RA 1W0VA 1XAUA 1P7QD 2LTQC 4Q9QH 4OD3L 3SKUD 2EH7H 3L3HA 2CPCA 3U7YH 4OF0A 43C9A 3D48R 3NPZB 3CLEL 4JFOB 5EUOE 3KS0H 5CSGA 5HJ3A 1X3DA 4L4JA 4WEUD 2IH3A 5H8DA 1L7TL 3HR5A 4H1LG 4F7PB 1N5AB 4Z8FH 3IJHA 2FBJH 3CDYA 5DC4B 5GQBA 4RMSA 2EDNA 4NWUL 1FO0L 1R3HA 1UVQA 4IRSB 3AVEA 4HULB 5HY9B 2GAZB 3ULVF 2DQJL 2WBJC 3HZMA 5H35B 4AMKH 4FZEH 3GDBA 4G3YH 1EZVX 5E6IB 4GRMA 1HHKA 4JFXA 4NYLA 3K8LA 1KJVA 4HV8A 4XVSL 3JSSA 1S3KH 1UXSB 3RQ3A 1QQDB 2WQ8A 3IFOA 3BE1L 2DMKA 2VZSA 4Q7DA 1RUKL 2XRAL 3SGDH 4BKLA 3OGOE 1Y0LB 2A9ML 2F19L 1Z9LA 2AEPL 1FGNL 1FH5H 2BOBB 3K1KC 3REVB 4G9FB 5T1MB 3S36L 3KXFE 1I7TA 4I0KA 4BK4A 4HKXB 2CKBB 3IDNB 5E6YA 2WUCL 4HFWB 2AJXH 4HZLA 1FZMB 3S5LA 3VWKC 4JR9L 4ODUB 5CEZD 3U83A 4CVXA 2OK0H 3L95B 3OWEA 3A6CH 2GTZB 4K07A 2XA8L 1KCVH 4WCYH 3BRGC 2O61B 4O5LL 2HG5B 2QQNL 3RVUD 5I8CB 1QEWB 4WNQA 3B9VA 3NMEA 4C56E 3R4DA 5DRNA 1C08A 4P59H 5F9OH 1WBXA 4NJAH 1OP5H 5IR1A 4BUHA 4GW4A 2NW3B 2Z8WC 3F7YB 4OCYH 5DJYA 2AV7A 4XXCA 3H0TA 4GMSL 1UXWB 3UJTL 4JKWA 3GSRA 4QGYA 5DJYB 2CK2A 4ORGB 1JWSA 1U8NB 1RQ5A 4YR6B 2W60B 5KVEL 1YYMH 1OWWA 3HE6D 3HI5H 2NPLX 3QCVL 8FABB 4MXWH 4E0RA 3BIKA 3BPOB 3HC3H 1IL1B 4LCCC 4NZTL 1WC7B 1YNTB 1RURL 2ZCHL 5GGTA 1P4IH 4OGAC 2IFGA 4PGBB 3TYFA 2ZSVB 5GS2H 4S10A 1YUHA 2FSEB 4D8PA 2VDRH 2Q7YB 3LKPA 3QDGA 4FQ2H 1FGVL 4LVHB 4LSPH 1A14H 2KPNA 4XPBH 4OT1L 1EGJA 4DOHB 1LEGB 1CQKA 2PO6B 3TVMB 2WWKO 2H9GA 5KG9A 2R0LL 4PJ9B 4NPYB 5KSBE 3SN6N 1V05A 3LPWA 4PJAB 3QCUH 1UB5A 1FO0B 5IMMA 1LWRA 1KV3A 5FIEA 4QRSB 2BNRB 3LEVH 2E7BA 4C56D 1OM3H 4IDJL 5E6IA 4YDIH 3DXAD 3FO0L 5L2JB 3TN0D 1OP9A 2H6PB 3OPZH 1T1WB 1YNTA 4RFEA 3BVNA 3GSVB 4U33A 3TBYA 5E2UH 1A7QH 1UEMA 3VDCA 2UWEA 1T1YB 5MI0B 1JTTA 3EW3B 4XBEL 2LU4A 3ZKQD 1W0WA 4KPHH 2UWEB 2A9NH 1V3LA 4MMZC 4LLDA 3EOTH 3EJZC 1FSKB 4I18A 3TIDB 4R2GD 4XNYL 3CU1A 5ILTL 3NIDE 3NA4A 2F8XC 3FQTB 4LSQH 3ROOA 3OHXA 3EOAB 5D1QA 4OIIH 1QHOA 1YNLL 2JF1A 5TH2A 1I3RB 4G6JH 4HJ0D 1T0NA 5DQ9A 3PL6D 4JJ5A 4XXDB 2M8XA 1J11A 3BGAA 2AJUH 2C3WA 3LD8C 3RVWD 1LK3L 2OZ4L 3GM0A 3V7AG 5D71L 4PJXE 2R0WL 3QHFH 4E41D 3HC3L 1D7FA 1DN2A 2GFBA 1B4JH 3LRSA 3O3AA 4U3XA 5CBAA 1N5YL 2IMMA 3B2VH 5CFHA 3JV5A 4M5ZH 4JFEE 3QUMH 2ZCHH 3GSWB 1CVRA 2R4SL 1F13A 2DTMH 4QHNB 3SJVB 1JYVA 1NL0H 4ZPVB 4LLQB 1I8MA 5SWSB 4BFIB 2H32H 3SHSA 5JO5B 1OWRM 3ZTJG 1URLA 5I19L 5FYLH 2DBLH 4PJ7F 4JRYD 4XPBL 4K23H 2ARWA 4A6YL 1U93A 1MI5A 3BRDA 5CAYB 5I6XB 1FVDB 1TPXB 3FQNA 4XMPL 4UILL 3L5WA 2F8OA 3GMMA 3G6JE 2FZ3A 4YHMH 2Q86B 4OZHF 3L3GA 3VXMD 5H37H 2X4SB 4MLIA 1U9KA 2V6HA 3BDYL 4Z7OF 4RMWA 4OUOA 1CTOA 2J8HA 5FB8A 4X6DA 1YPZE 1IAKA 5DHVA 2AJ3B 1MCPH 3VI3F 9CGTA 3FAWA 4JDZA 1N2RB 3STLB 3SDYH 4H88H 3P9MA 2XTJD 3WLWC 1OF2A 1H3XA 3NFPB 3NIFE 4Z7NF 4GAGH 1CDYA 1F02I 2FL5A 1OB1A 1FG2A 1YEKL 4OFIA 1A9EB 3L3JA 5DJDB 4ZFGH 2AKRA 4H5SB 1KYOJ 2YN5A 4X7DC 2AJZA 1CDBA 3CNKA 5EU3A 1T22A 1EJOH 4PS4H 1HINL 2PUQT 1ZHLA 2ADGB 2EKSB 4L1DA 4WTWA 5DJ6A 3QZWA 5EU3B 1F4YL 2VDOL 1ZEAH 1OCWL 3LQMA 1E4WL 4E41E 5T5FL 4LBEB 5FGRA 1JK8B 4NKIH 1KLUA 2J6EA 2HJKB 3DO7B 1VDGA 2ITDB 3MRNB 3GSNA 1H0DA 2CD0A 2DQIL 4G7VL 2DLEA 32C2A 1CD9B 1ZAGA 3MRFA 4RA0C 3KYMA 1MFNA 4TQEL 4MQXC 3QI9A 5GIRB 4NGHH 2Z31C 5MEOA 1KSRA 4PJXA 3M8OH 5CILH 4NWUH 3ORJA 2VDLH 4O2EB 4U05A 2H1PH 4OZGA 4NYLB 3QUML 2Q8AH 4NQXB 4NQED 3VCLA 2BVOB 1NUDA 3MYJA 5GZOC 1I85A 3FQNB 1SYSA 4EUPG 2X9WA 1IAIH 4KRNA 4XPAH 1SJHA 1LMKA 1BJ1H 1QP1A 4TPRH 5SX4I 2ZCKL 4Y16A 3VJ6B 4XVJL 3OAZH 2ID5A 3CFJB 5A2LH 1X5KA 4LSUH 2APWA 1CFBA 4U1KA 1S7QB 4RISL 1JYNA 4WI9A 2E9IA 1JGDA 1RUAH 2YSSB 4QXUL 2HT4D 3KPRD 4PJAF 1NAML 5JNYB 2C1PB 4MJ4A 4X8JB 1WC7A 2W0LA 1BFOA 3OAUH 4EN3B 1HN1A 3WO3B 3MA9L 4TOYL 4HIJA 1QFHA 4YEFA 4GRLD 1ZWIB 3NIFF 5FCSH 1P69B 4FP8H 5DC9B 5HHPB 3NCCB 3ZDYF 5D7LD 3GFUA 4BZ2L 1HILA 4G8GB 1ORSB 4DK3A 1ZVHA 3WLBB 5BZWB 5L7XH 3VFVA 3HLAA 1JWUB 4HWZB 1NUFA 3SDXB 3RI5K 3WV0A 4HIEA 1HKLL 4KMQA 2AK1L 2F53E 5K33A 3WHXB 4OV6F 1KJVB 4RGNE 3SEPA 4ZO8A 5GS0C 3RX7A 1R5IB 3GUTA 4CVZA 1IKFL 1JN6A 1NH6A 4YX2L 4W6YB 2GAZA 4OM0L 2YD4A 1QSVA 5DK2A 4JY4B 3CX5K 4DKFH 1WUNT 3L6FA 3RJQB 2HG5A 5T33L 4X6BB 3EYSH 3N1MC 4RFEB 4U6HB 2ARJB 5ID0B 1UJ3B 1A7NL 1VPOH 3LHPH 2GJ6D 3MGTB 4PUBL 1JPST 3QH3B 1K6QH 3I2CL 3QIWB 4APQD 1ZANL 3REWA 4P9ML 2PYED 1IGFH 1BZQK 3QQNA 2P5WB 5EUOF 1WWAX 4F9PC 1R3IH 1M7IB 3ARVA 2VE6B 3EYUH 4CJ0A 3KLAA 1ZS8B 4RAUA 4FQ2L 5TH2B 4C56B 2CR6A 4N90E 4IM8A 3V9FA 3MRDA 3FCTB 4PB9L 3S3JA 3GI9H 2F54B 1DEDA 4OZFA 1BZ7B 2EDHA 3IB4A 3OXSA 4KDWA 1H3GA 4X7EC 2Q3AA 5ALCH 3QIWD 4APQB 2IF7A 2NY2B 5C0RL 1OTTC 4TUOB 3VG9C 1G9NH 5J1AB 4DKAA 2A6KB 2XZAL 3BHBA 3QB7C 5JDJA 1PKQB 4FTVD 4XVTH 1MFEH 2VN4A 4R2GB 5CEXB 4RCAA 1P7KA 1NEZG 3WMSA 5IVXE 3B5TA 3MSPA 5E8NB 4X80H 1AFVH 1YPZF 4XCEA 4U3HA 1U8LB 3I75B 3DX9B 1P9MC 3SQOL 2UZXB 3AMLA 5CUSH 1IC7L 1VFMA 3RAJH 4A6YA 1FFRA 3MLXL 3PWJB 4EIGB 3MLSH 2ZWLT 3QA3A 5I1CH 1Z2KA 3HZYB 5D72H 5FGBC 3VH8A 3TBWB 4N0UE 5DHVH 4CNIA 4YX2H 3X17A 5D70L 4JM2D 1MCLA 1JF5A 3V0VA 1NKOA 3O9WC 4UV4L 1TLKA 2B5IC 3IDIB 3H7BB 4OGYL 2EECA 5I8OL 3MNWB 2YEZA 3BT2L 3QNZB 4LCUB 3RVTD 1S7WB 1CDCA 5FYJE 2HVKA 3HB3C 4NZUL 2P24B 1HYSC 2C1OA 3QNZA 3X11A 3HTLX 2AAVA 1LK3H 5CIPA 2YK1L 4RGNC 2NY5L 2UUDK 3TH2T 1A6WH 3I9GL 3WS6C 4M7KL 1X9QA 5GPRA 5E08L 3GBNH 3QXWA 1NDGB 3G5YB 2JCCA 2HRLA 4QXTA 5EU5A 5IFAH 4AM0B 1FC2D 3C09C 5D70H 1KJ2B 3DVFA 3S96A 5GGTL 4NN5C 3ZKXB 2YPLE 3TWCL 3GJFA 1EHNA 2A38A 2E3VA 3O3UN 4KXZI 4KRPD 4XP9L 1FL6A 2P5EE 4JCLA 4FQCL 1RUMH 5D7KD 1TITA 2EDOA 1VKXA 1AQKH 4G9DB 2V5YA 2IPKA 3TZVC 5GIRA 1BD2D 1LE5A 1HXMB 4LHUD 4XAKE 5F7HA 3HZMB 1E27B 2FJHA 4OJFL 1FLTX 15C8L 1HI6A 4YHYB 4XNMB 5IG7B 2MJWA 5KSAD 4MVBC 3HUJB 3IRZA 3MCKB 4XC3H 4JG1L 4LLVA 1GOFA 4RDQG 5HPOA 3ILPB 1OPGH 3FMGL 4J2XA 2R15A 4FQHB 3LRHA 4RFOH 4KUZL 3PQYA 3BJLA 1KT2A 1WEJH 1A6VH 2EDTA 3K2UL 4U1NB 3D69B 3UTPE 5I1EL 3EOBA 1U8JA 4MS8D 1HQ4B 1NC4D 5DURD 1YEFH 4KZEH 1IGTA 4OJFH 5D93B 2WLYA 4X6CB 4WW2C 4M7JH 3G08A 2P5EB 3ULVL 4HX1A 1F4WH 1WZLA 5AD0B 5KVFL 1AJ7L 1T20A 5KJRL 3MGOA 2VXUL 1RHFA 1DQJB 3EO0B 1BZ9A 4PJ8B 4QHKI 4BA8A 1PGRB 1DBJL 2EDDA 5E1AA 1YQ2A 2EE3A 5CIPH 4XPFL 3T1FB 4PJ5E 4TTDD 5I71B 4KPHL 5L2KB 2A77H 4JO3H 1N8ZB 1BFVH 4MXQC 5D7KE 2WK2A 4ZSOA 2ICWA 2DL9A 4OV5B 4L4TE 4XVUC 4KMTH 3GMPA 2NY4C 4FXKB 4YHPB 4HWEL 5EIIA 3QPQC 4RQQA 3HHRB 1ZT1A 3J7HA 3OKEB 1A0QH 4DQOH 2V2XB 5T3ZD 2YMXH 5E5MA 2GTWA 4X4XA 1UWXH 1KB5H 3F7PC 4XCNB 3VFTB 1CICB 4BSVB 3KYAA 4WHTA 2E7HA 1FORH 2YBRA 5CSZA 2QL1A 4G8EB 3LKNB 1RZKL 4HIJB 1NBYA 2GJJA 2ZZUT 5I2IB 1QBMH 3AREC 5CP3A 1CD1B 5JW3H 1C16B 4R4BB 3INUL 1EIBA 4YGAB 2Y06H 5TF1H 1D5ZB 3RIAF 5FA4A 5HDBF 5INCB 4LK4A 5B39A 2IBGA 4KJQC 5LGJB 4XCYA 2XWTB 1RJYB 2D0FA 1CE6B 4JO2H 2CIKA 4FZEL 4Q74A 1T03H 4C54A 4KUCD 4RSVA 2XZCL 1PKQE 1AP2B 4U6YB 3EFFB 4OZFH 3IXAA 1MCOL 4D94A 1GOHA 4LIQE 3STZA 5JW3L 1JNNH 4YHLH 3D3VB 4D0BA 1LE5B 3LQAH 5DD0L 2DM4A 3RY6A 5LCVL 1W72L 3IFPB 4X8XA 3QHZL 5HYSG 4G9DA 3QIBB 4O2EA 3TH4T 2EZ0C 1N7ML 2WIIA 3TT1L 4Z7NE 2J6EL 3MRPA 3P9LB 3WNLA 1J88A 2V5TA 2Z92A 4L4TD 3ARFB 2OR9H 3IETA 5HYQB 1GC1C 1O7VA 5B8CB 5JHLH 4CN1A 1CFTB 2BVPB 4ZXBB 4M6MH 4OM1H 4HD9A 3KJ4B 3VD4A 1KPUB 3O6FA 1AP2A 3UBXA 2QR0B 1MUJA 3L5XH 4NDMA 5K9QG 1I1AC 3WKML 3Q0HA 4MB4A 2AXGB 1ZKAA 1A0QL 4DQOL 2FR4A 4Q6IA 4BM7A 1MFDH 4J1UB 4UQ3A 2VERN 1BP3B 1NJ9B 4HUVB 5EU7C 5C0JA 2ENSA 4NKIL 2MQCA 2PYFA 1KG0A 3BGFC 2VDML 4JGUA 3BH9A 4M6ML 4OM1L 5MERA 4P2QD 5CLTA 4NM8L 2WANA 5DFTA 2AXHA 1AI1L 3SKMB 1ZVYA 4FXGB 2E9JA 5CZVH 3KPRE 1I8KA 1Q9WA 2GSGB 4WTZG 5ILTH 1OAKH 3QDAA 1DUZA 4M8VA 2B5IB 3DX6B 5GS0H 3IXTA 3E2HB 5CINL 3SJVE 2GSGA 1U8LA 2Z8RA 3QEGH 5DD1H 2Q8AL 5B3NA 2IADA 2XPGB 4IBLT 5DRZB 3F7YA 5F6HJ 3U7YL 2ICWB 3O2WH 3ZDYE 3RWIA 3V4VH 3VXUE 3QIUB 3SE3A 2A74A 1WK0A 4O51B 3S6CA 1VCAA 3VFTA 3QRGH 3MUJA 2F53D 3RAJL 5EUKA 4DW2H 4EVNB 2C26A 5DC0A 5EO9B 3U9PL 2BCKA 5F6HI 4MNGA 3FT3A 3IFLL 3MLTA 1AO7B 3TH3T 2YEZB 2OP4L 1DUYA 2JLLA 1ORQB 5DMIL 4G80B 3CDCA 3VXPA 3RZWA 1CGSL 3MUHL 3S4SB 2G60L 3MJ9A 4HKJA 5IK3B 5GISL 3B8SA 3DYOA 1U2HA 4PJCA 1IQWH 3QQ3A 3NFSL 3HE7B 4NRYA 5CS7A 1LO4H 5D7IF 2NYYD 3QA3B 4KVCH 5E1AB 1ITCA 1U8OB 1D5BB 1RU9L 2EIZA 2NTSP 2DWDA 4TVPE 2HFTA 4Y5XC 1A7PL 1R5VB 1K8IB 4Y4HD 3U9PH 1WICA 3IF1A 4OZGF 4XBPB 3ZT5A 2FO1A 3L3DB 3BZ4B 4NKDB 2Y6SC 3JWDC 3KPQA 4X4ZA 4LU5L 3RTQC 3FHQA 4YHPA 2P5EA 1BIHA 3ZYOA 1WZ1H 5FEBA 2MNUA 1JPTL 3D0VB 3M17B 3LN5B 1ZVSB 4K55A 2HVJB 5D1ZC 5C7XH 1OTUC 1J1PH 1ZGLA 4TN9A 2DI9A 4OIIL 4WFGD 3F7RA 5DXWA 3BVNB 3GSVA 1HXYB 4QHUA 1VENA 4Z7VB 5JPMA 4JANB 2X6MA 2JCCE 4DCQA 1J87A 4G6JL 5T5NG 1Q94B 2EDJA 2NY3C 4M8QB 1T4KB 4ZPTB 2EDBA 4NZRH 5HGDB 3KLHD 3EO1B 3V0AC 1MCIA 4FABL 4PJ9D 5JIIA 3K0WA 4CL7A 1M71A 4IOFC 4X6FA 1GZQB 3ARGC 1D5ZA 3B9DA 3UPCA 2YUZA 1E0OB 3QNXA 4JFZL 3Q6FA 1BIIA 3QDGD 4M5ZL 4MQXD 4XNQA 2DM7A 4HLZG 5GRWA 1J1PL 2WAHA 5DJAB 5E8EA 5CGMA 4U6XA 3ZSTA 5F89A 4WO4A 4E9LA 2EDWA 3CLFH 3O4OB 4IRJC 3IGAB 4Y1AE 4ZODA 3MV7D 3X11B 4PRAA 2WMPA 5HGHA 3U2SA 4OZIF 4MA1C 3DX8B 4MA1B 3V7AE 3RBSA 1XEDA 2BNUB 3UYRL 4KTYA 2QTEA 5SWSE 1HXMA 3LEYL 3ILQC 4I18C 2ZCKH 4FQIH 1N6QH 3O2DA 3BKML 1VA9A 4ZFOL 5AAWA 2PTVA 2NY0D 5ACZB 1I3UA 3MNVA 3D3VD 3MR9B 1JPGB 1CN4A 4NC0B 3BYYA 5D1QD 3T0BA 3QHFL 5E5UB 1MHPL 1AIFB 2D7NA 3L7EA 4KK5D 4GKOA 4L3EE 4X4YA 2QKIA 1DSFL 2NW2B 1AIFA 1EZVY 2J8UA 3ULSA 2A6KA 5C92A 1G7QA 1T3FB 35C8H 2BSRA 2D7QA 2R2BA 3UO1H 4CVXB 4LLUB 1FNEA 5DO2C 5MEPB 3HG1E 1HOCA 2EO9A 4NZUH 1F90L 5JTWA 5E8NA 4G43A 5I1JH 4P9HL 1I7ZB 2J8UE 3O6FB 4XX1E 4UILH 4RZCA 2FATH 2DYPA 4NNXB 2VITA 2QHRL 2YC1A 5IFAL 2EIEA 2HJFB 4PJEE 2DDQL 2V2TA 5KS9E 4QHLA 4PREB 4LDOB 2UY7A 3MRRB 5H2BA 5BS0D 1EBPA 2OTPA 1TVHB 5L8LB 4PJGE 3PNWB 5CJ5A 3VXRB 1N4XH 2AJXL 1A22B 5JHDA 1JMZA 1BJ8A 4L4TB 5GGSY 4WI8A 4WWKD 3AB0B 1TZHB 1T66D 5KN5A 2FATL 5LCVH 1BBDH 4U1IB 1FHGA 1P53A 1L0QA 3O9WA 4PJEF 1QR1B 5FF6B 4JO1H 4QXTB 3QDHA 3TT1H 5F9OL 3OKLA 2NTFB 5LGKA 2H2PC 3MV8A 5HHVL 3A6BH 4JZJA 5FYLL 1KIUA 1T22B 3T3PF 1DCLA 1IC5H 1JIBA 3WFHA 4GBXD 5CD3B 4K8RH 4UBDD 4XMLL 3I6GB 4RAUB 4EVNA 1MWAA 2DQFB 3RVVC 5TQ2L 5I2IA 1EO7A 3HG1D 5J3HC 4NJ9L 4EN3D 2XYCA 4ZS6C 5C0FB 2P5WA 3D0VA 5EU6A 2XWJA 3ARWA 4P5TD 1Z9SA 1ETZA 3O8XA 4YEEA 5DLMH 4H0IA 1RZIA 2GJ6A 4X9IA 3NIGF 4Z77B 2UZIL 4JJHA 1P4LA 3LKRB 1P4IL 2JKXA 2VISB 4GLRH 4Q97A 4XNZB 1A6UL 5ERWA 2EC9T 3WLBA 1CR9H 3Q1SH 1SJXA 5IBTL 2H41A 3EZ8A 4ODTH 1ACYH 4PRBB 5EU6E 2Y36H 5MHSE 1LNUB 2EXYC 1PX4A 5CEYA 4IRZH 4GS7C 2PXYC 2H32B 2QHRH 2IPUK 4GRWE 5C09B 1K8DB 1IGFL 3HUJF 4TULH 4GAJL 4M1GL 4OCSL 2WBJA 4TNVF 4ELMA 3H9SD 1S7QA 4RIRB 2BCKB 4Z95L 5TE4L 1LO0H 2F54A 4M7ZC 3OAZK 3ESUF 5DSCA 5EOQH 5C08B 3C08H 3RWGA 3V6ZA 2XN9D 3FQWB 3MTRA 2B1AL 4NHUA 3U46A 3IDMB 1QLEL 3ARPA 3WN5B 5KZCB 4ETQA 1RUKH 3MFFB 3VG0L 4KI1A 4YHIB 1I9JL 4LVOC 4URTB 4LKCB 3ULUH 1FGNH 1XF4B 4AZ8A 5J8OA 2W9EH 4ZFOB 3CZJA 5EIVA 2BY3A 3JTTB 4HH9A 4UMGA 3EOBB 1OAZL 1WTGT 5C0DB 1I3VA 4MSWA 2Q7YA 1Q0YH 1HHHB 2XZAH 1Y6MR 3PDOA 1NBZB 4P5TB 3FFCD 4ALAH 4WUKL 5DJ0B 5C6PB 1J8HB 1PY4A 4Z7WB 1KLGA 4MCZB 3BD3A 2ATPA 1XR9B 3TO2B 1MIEL 1Q72H 2Z0BA 4N0UB 1ADQA 3EBAA 4V2CB 5A40E 4N0YH 2MQ0A 2NY2D 3BIKB 3NFPA 3TF7C 3ULVC 2E6QA 5T1KB 3TBYB 3QXDB 3FRPA 2Z8SA 4TUOA 2MOVA 4HWBA 3DV4A 1AHWB 3WXWH 1OT1A 3K46A 1IAKB 3NZ8A 1YEHH 4D9RE 4GMSH 1OW0C 4MZ3A 4HIEB 1A1NA 4MNQD 3IDJB 3GM8A 1MJUH 3SO3C 5DEGB 5GHWH 5INCA 4Q9RL 1IEBA 5EOTB 4HBQA 1IBGH 3WNMA 1SEBA 3DUSB 4LEXL 1LEGA 2HT3D 2BVPA 1FNGA 4YK4B 1RPQA 3FO1A 1ZTXH 4OQTH 3V4PL 5IV2B 2XKUA 3ARDB 4OFVA 3MRMA 2VLKD 3MJ8A 4OD2A 5T3XH 3GMRA 4R90H 4IMKA 4ELMF 1QFWM 3QZWB 4PIRF 2C1PA 2NZIA 3GSXA 4XAWL 2JELL 3F6IA 2DL2A 3MNWA 4KKBD 2PO6D 5EOCL 3TVMD 4WFHD 5IB2B 5IBUB 5F7KC 2B1AH 3QXVA 4X80L 4LQFL 5D7SL 1S9YA 5A2JH 4OCWH 4OQTL 3V4PH 3U7WH 4EUPB 1X44A 5E2JA 1MNUH 5BOZG 5B8CC 1GAFH 4ODVH 1L7TH 4F3FB 3S35L 3K1DA 3RKDD 4D0DA 3Q5TA 4D9QE 1P4BH 5TPWL 4ONGL 1A7OH 1INQB 1E28A 4PJDA 3BKCL 4GRLA 3OQ3B 3QEGL 4ALAL 4J4PA 4H25B 3TNMA 4UT6H 3VXRD 1LP9B 4GG6B 3FQXA 1T04A 2LTQB 1S9KC 1WQVT 4OLUH 2DM2A 4LHUB 2YPVH 2X1XR 4KJPD 2D3VA 3H42H 3RL2A 1G9NL 4OCMC 4JQVC 4ZNCD 1I4FB 1TCRA 3TJHC 3GSWA 4P5KB 4ONGH 3MODL 3PQYB 4TVSa 4HDIA 4YQXL 4S2SB 4P4KC 4PRID 2NY1B 2NTFA 3KHOA 1Z0MA 1GZPA 4ZS7L 3EYOA 4RFNB 3ZSSA 3L5IA 1MLCA 4JFDA 1NBVL 1KCLA 5IMKB 4NPYA 1IAIL 4XPAL 2VE6A 4NRZA 2OXGA 4LSDA 4BK5A 5IF0A 4G9FD 1FFNA 4AENA 2R69L 1MEXL 3PHOB 1Q8MA 4ONHA 3T1FA 3S98A 1DBAL 2EZ0D 4WW1A 3V5HB 2P8MB 3BD5A 1IM9D 2LFGA 3FZUD 3DMMB 2ICCA 1DANU 2XY2A 1EMTL 1N64H 5DD3H 1UWXK 3O0RL 5FOBA 3RWJA 5D2LF 4LSUL 1RIUL 3AU1B 3KPRA 4Z7VF 5FB8B 1RIVL 1T20B 3SGJC 4N8CH 1UB5B 1AXIB 4JFEA 4HK0B 4BQBA 4Y2OA 3ARTA 5H35A 1U0QA 5ECJE 4LF3A 3ZL4L 5KAQG 4LPYA 2PCPB 4PP2B 3D5OF 3OV6A 2GEEA 1TQBB 3TA3D 1EHXA 2QADB 3G5YA 2ORBH 2N7BA 2O5YL 1F8TH 3CXHJ 2F5BH 3I9GH 1HQRA 2FB4H 5DJ6B 4V1DE 2VAAA 4P3CL 3VFOA 1I1AB 5BRZA 1AE6L 5D5MB 1FPTH 5JIKA 3A6OA 3V0WH 4JZOA 4GUPB 2VXTH 5KVGH 5E2TL 3DHJA 4FQJL 4CN4A 2OS7A 3KPOB 3MRMB 3P11L 4ENED 4R97B 1J1XH 4GO6B 5E9DE 3RU8H 1CICD 3PGFL 4Q9CA 3HC0B 3MYZA 3VFRA 2D7OA 1IGIH 1F3RB 2WQRA 4Y5XA 5IVZB 4M43H 4DEPB 4GW1A 2PR4H 5CJQL 2AGJH 3S35X 5GS0L 2WNGA 2ZUQC 4FOMA 4QNPF 2KKQA 3RWCB 3TM6A 5BVPH 1RVFH 2I07A 4WY7L 3S96B 4I4WB 4OCRL 1JZ6A 5GGSA 4Y16B 2IPUG 3F12B 1TIUA 4TUKH 1V3MA 1NDGA 3IAPA 2ATPB 1KLGB 4MCZA 1CDUA 1XH3B 1S7UB 3LN9A 4S1QL 4RNRA 4HK0A 1H8OA 1MREL 3MJ7A 2P24A 1KCSL 2SEBA 5ID1B 1U92B 1EAPB 1GPOH 5IBLC 3VXRA 3H2WA 3UCRA 5CBEB 4JHAL 2JCCF 5DFVC 5GISH 3OGCB 4L8BA 4Y4HC 3BXNB 5A3ID 4WV1B 4L8CB 4OZHA 3KR3H 2CGRL 2E7MA 2RQ8A 3RTQD 3OF6D 5IJVA 5GSRB 4IMKC 4JZOB 3HR5B 5TQ0H 1J86A 3EDKA 5FM5O 2CXKA 4ONFH 3MRQB 4JPKL 4I2XA 3H3PH 3ZKMC 5GGQL 4DKEH 5EG6C 1DP0A 1X5FA 4JAMA 5F1KC 3PL6B 4LMQI 4G9FA 2BK8A 5IB3A 1K2DB 3RZCC 2R29L 3DXAA 4JFQA 1KBGL 5I75B 3D39E 5HD8D 4JFDD 3VI4F 4C58B 1J05B 4IOFD 4NWTH 4P99A 5L2JA 1QVOA 3RBGA 4OLZH 4PBVC 4LAQL 1JP5A 3MROA 4X6DB 1PW3A 1RZGA 2IFFL 4PY8J 1Q9KB 4JGMA 4Z77A 5SWZE 5IJVB 1V7NL 4ZFGL 3UTTA 1U3ZA 4G8IA 4JRWA 4N5UA 2BFVH 3NCMA 4DAGL 1CGVA 3GBNL 3VMOA 1M7IA 2H9GB 4NQCB 1NC2A 1U6AH 4JLRA 5J4MA 2DYPB 4HC1A 3GIZH 1CGSH 4FQXD 3CPLB 5D9SB 4M00A 4OD1H 5HI5D 1ND0B 1MCPL 2WV3A 4PLJD 5GS1A 3T2NH 1GGBH 2NY6B 2CDGB 3ARFC 4EQ2A 5E99H 5I1IH 3X14B 2OI9B 3GSXB 3QJFB 1OD7A 1NCDH 1T6WA 1FNSL 4EKXA 3VWJC 1NCWH 5L88H 4HKXA 2DWEA 4GXVH 4HPYL 5CBAB 3VXNA 4IS6A 1Q1JH 5GZNC 3ME0A 3QQ4B 4NCDA 4NC1E 2XQYK 4PJBA 4X98B 5DS8B 1YMHA 3T0XA 4K3GA 3ARRA 3RDTC 4FTVB 4BJLA 1FQ9C 2OQJB 3DV6B 4NOFA 4HG4K 5EBGA 1M6OA 3FO2A 5FKPA 4F58H 5D1QB 3FOLA 3GI8L 4GAFB 4PGDB 3BKJL 5I66B 2AQ3A 5IB1A 2FECI 3MOBH 5I1KH 2XKSA 2BHYA 3KYMB 4PJGF 3S9DB 1LDPL 1KG0B 4U49A 4X9HA 1XGPB 1EVUA 4NO0D 4HS8H 4MNGE 4M61A 4M6NH 5F96L 5SWZD 4JM2A 3GMLB 2F9BT 1MPAH 3BFOA 1G7JA 4HHAA 2NNAA 3MBED 4DZ8B 3UP1A 2FEEL 3P9WB 4ZFFA 5KJRH 4PJ7A 4S1RH 3P30L 4Q9BA 2HH0L 3OKLB 5KSUB 1GC1H 1IEAB 1MREH 1YY9D 3ZDZE 2Y7QA 3AXLA 3QG7L 4HK3N 1HH9A 5IB5B 2R0LH 1OOAA 4XTRD 1BIIB 3GK8H 1LP9A 4GG6A 4JRYB 1XZ0B 2APXA 1EPFA 4OZIA 4JHAH 3QCUL 3PWPA 5DJXA 3NABL 1NFIB 1RZFH 5HHOA 5F9WC 5ADPL 4KROD 1CLYL 3D18B 3PWVA 4ODHL 2W91A 4NNYB 3T4AA 4KRPB 4RNRB 4OLXH 4HF5L 4F2MB 4L9DA 2XFXB 1V7ML 2VLKE 1NGQL 3I6KB 2WP3T 5T3XE 1PQZB 5D7JA 3V6BR 1VEOA 3AUVA 2AK1H 4GLRI 5IHLB 3U4EB 3WIFA 1ZHNA 2WP3O 1ZE3C 2VDQL 3TO4B 2NXYD 1G7PA 4P3WA 3CH1A 5HPMA 4C4KO 3C6LD 3GBML 2ADGA 2EKSA 4ODXB 5ERWB 5E7FA 2DIAA 4CN6A 4ZFZB 2WBJD 3MCG1 4JO2L 4MSWB 1G6RH 3IYLW 1KB9J 2ERJB 1UENA 3PV6A 1P9MA 4HUWB 4BUGA 4AEHH 2CXGA 1IT9H 5FK9A 3F7QA 5M95B 2AEQL 3NZHL 5FECB 2ZNWA 4HUMB 5DJAA 3HCVB 1BFTA 1WITA 4ERSH 2D31A 4BSVA 1CG9A 3EDFA 1TZGH 1DQQB 4L9LB 5I0ZA 3B9KC 1DUYB 1DQMH 1VADA 3KLDA 2P42B 3UJTH 3GMNB 3LV3B 3T3PE 5ICYB 1G7LA 4NZDA 2FH6A 2JELH 3FAXA 2D4FA 3FOMB 4UT7L 3OR7A 1FVDA 3PXHA 4LLDB 3MLYL 5D2NC 1OAYH 3PP4H 2P5ED 4EDXA 4DVBB 4P4RA 2NY4B 3HZKB 1QSFA 1RZ8B 5IW1B 1S9WA 4HCRL 4JQIH 4GXVL 5JHDE 5JQ6L 1BQUA 1BD2E 3TJEL 1FRGL 2X4UB 2YHGA 3MOAH 4R7DB 3BDYH 4JPIB 4QO1A 5E8PB 5J6HB 4XBPA 2X4UA 2E5EA 2VXQL 3QUZD 4OCXH 4UAOB 1FO0A 5IMMB 1BREA 5I1AA 4WI7A 4XP5H 5J11B 4R26L 5B3JE 3D39A 3VXME 2V7NA 5MI0C 3O6LL 5A43C 3BH9B 3HE7A 5JORA 4ZUUB 3BE1H 5I73C 4UNTA 1NGZA 2ICES 1XGUB 3W0WE 4K3HA 4RAVB 5DQJA 3UTPD 1NCBL 1FL3B 2WZPD 4W6XB 3FFDB 5I8KL 1FCCA 2OTUA 2OL3H 4Z8FL 1SM3L 3KNBA 1HOCB 1EO8L 1F6FB 5BZDA 2NLJB 4PLOB 1F58L 4Q58C 2HKFL 4YHOL 3SGEH 5CD5D 2VDOH 1FL5A 1JPSL 4PJ5A 5I17A 3L3HB 4Y4KA 4U1HB 1FN4B 4R2GC 2GJZB 1KCUH 3MREA 2XICA 4PJFE 2AK4A 5HSFA 4X4YB 4JN1H 4H0HB 1WZKA 3HRZA 2H6PA 5F6IC 5F88A 3AREB 4LLWB 1BM3L 5CJOH 1CXLA 3BQUB 3T0WA 3VMNA 3PL6C 4K3JH 4PJDF 2H1PL 2AJYH 3PIQA 2B2XH 1NQBA 4PLNC 1OGTB 5HHOE 1HH6A 4L1HA 1MSPA 1CFSB 1U8PB 1XIWC 4GAJH 5IM7B 1WCBB 1D5BA 4HPOH 2EDXA 3S8WA 3RX8A 4XT1C 1KJ3L 2GT9B 1ZHNB 4PV9B 4PJ9A 1Y6KR 1N8ZA 1WBXB 4EUPA 5EU5B 2O93L 2VITB 3MFFA 2XQBH 4PB0H 4PJIA 4I48B 3MCLH 1MCWM 4WU7A 1NMCC 2DLHA 2XA8H 4KKBC 4G42A 3G5VB 3FT2B 3WFEL 2FR4B 3RDTB 4RIRA 1AE6H 1MWAH 1QBAA 3VXSE 3KPMB 2EDEA 5M94B 2IAND 3DX7B 5LKNA 5AAMA 1VFBB 5D5MF 3J8F7 2NW2A 4WO4B 1UZ6E 1BQLL 1TTUA 1UCTA 1XGRA 3L1OH 1UA6H 2P49B 5FYJU 4R7NB 3UAJD 3R8QA 5C0ND 1CFSA 5IM7A 4O2CA 3MLPA 3WFEH 5I1EH 5HVHC 1YN6A 3W2DL 3MXVL 1PBYA 2PR4L 5ISZB 1BQHB 4FMKA 3NZ8B 4CU7A 1F58H 4KJWD 1CDGA 4PRPB 1TJHL 3B43A 3MOQA 5IWLA 1DVFD 1NC4B 2M26A 4DGYL 3RRQA 1RFDL 1NMBH 2W0KA 4D2NA 4M1DL 3RL1B 4P4KD 4P46C 2EYTA 2PYEE 5T1LB 1SEQL 4OQ1A 2F53A 5HHMD 4LSTH 3EYFB 4ZUVA 1QLEH 1S9XA 3VGBA 3LHPL 4PUBH 4I77H 5KVMC 2H2SD 4ESKA 1M6OB 1BLNB 5L9DL 4PJCE 1KFAH 4PJFA 4DGYH 3EJJX 5FDYA 1DN0B 5FF6A 3SE8L 2YD9A 5BV7L 2ZUQB 2FIKA 1ZLWK 2GJ6E 5GRZA 4RGOL 1IAII 1YNLH 2WUBL 2CUIA 1Y0LA 4BKLB 3VXSD 2XQBL 2HTKD 3S88H 2VXSL 3TPUA 3T0EE 4X6FB 1ZHKA 5HTSA 4X4XB 2A6DB 3SE3C 3QXAB 4PB9H 4HKZB 4Z7UF 4PG9B 1A02N 4FS0A 5J89A 3H3KA 5C0EB 1TZIB 1U3HC 4JPKH 2X10A 1B6UA 4OKDA 5F72S 4PLKD 3RGVD 4PGZA 3H7BA 4Y2DC 1YYLL 4MYWB 4WU7B 2VC2L 2ZKHL 2DMCA 2M1KA 4XNMA 3M45A 5CGYC 1XFPA 2HMIC 3BP5A 4BH8A 5DD5L 1KBGH 4HUKB 4OLWL 2YD2A 4PRDB 1LEKA 1H8NA 4YPGA 1Q9LA 2L0DA 2WBKA 4KXZH 2GSIA 5LVEA 4LQ1A 1U91A 4QNPE 4OZGE 5DRXA 2G2RA 5HI4D 4L9LC 1RZGB 3C2AH 2VISA 1EK3A 2UYLB 1NAMH 2FD6L 5GGUB 1GIGH 3QEQE 5EZLA 5FYKD 2Z31D 5C0IB 1ZT7B 1YMMA 1HHIB 3ES6A 4FQJH 5F89B 2DBJA 4PJGA 2HFGH 4PGEA 1VFBA 5AZ2L 4EBQL 1T2XA 2XQYG 4ZS7H 3PGFH 1ZMYA 5GS0D 3KPSD 1UWEH 5DVMA 2VUYA 5L7XL 2XKNB 4YK4C 4Q6IB 3GHEL 3K8KA 5F93C 4L8SA 1CFNB 3WDJA 5GSVB 5J12C 3UTZB 1JGLH 5EO9A 3CK0L 3B5HA 5J12B 2MCG1 3GSQB 2GSIB 1T0MA 2XTLA 3FFDA 4Q0XL 4DN3H 5T1LA 4ZUTB 2W92A 3FFCA 5L2KA 5IG7A 2NY1D 1S7SB 4HUNB 1PQZA 5J11C 5DTFB 3O3BA 2EC8A 5C0GA 2YA2A 3BISA 3VGHA 4DKFL 1NC4A 4BQCA 4JHWL 4KZDL 2EE2A 4XMKL 2C5DC 2X70A 4M62H 3RUGA 3V52L 2IG2H 1A4KB 1G9NC 1UJTA 3CCHA 4NCC2 4R7DA 1BBJA 2GI7A 3IF1B 3QNYB 2NY5C 1Q0XL 4XWOD 3M8OL 4FXGA 3SKOA 5CZVL 3GB7A 1KTLB 4TUJB 2JK5A 3ULVE 3HS0A 5J1AA 5C3TA 4F9LA 2JIXB 2I07B 2PXYA 4L3AA 2X4PB 2GW5A 2LE9A 1QFUH 3MLUH 1OTTD 5FYKE 1KACB 3B2UC 1ORQA 4G43B 4NQVA 1S9VB 1A6UH 2ZUVA 2YD1A 3LAFA 4YAQB 3AY4C 5FHBL 1IGML 2H8PA 4NUJB 2OSLA 2V7HB 5HVGB 5J56B 4EI6B 4X99B 2RIKA 3IU4H 5M7QA 4JY5H 3NACH 1XIWB 3MV7E 2APFA 2HTLD 4LKXA 4PY8I 4QGTA 2ZG3A 1A7OL 3AAZA 3NTCH 1BHGA 4LIQH 4ODWB 5FK9B 3KPOA 3MGAA 4XP6L 4EN3A 5EZLB 2BY0A 3MRPB 3GO1L 3P9LA 2WIIB 5D1XC 4IRSC 3LMJH 5JNYA 2P8LA 3QUYA 4GQ9H 5EC1A 4J3WA 1QA9B 4Z7WF 5E94B 1Z5LA 1CLYH 4GBXB 5DRXB 2PW2B 1N59B 1U8OA 4PJBB 2X41A 4K23L 1B4RA 4U7MA 3N50A 3PF2A 5D72L 3DGGB 3BUYA 3RY4A 5DMKB 2I25N 1S5HA 1WSST 2MFNA 4O9HH 5I16A 1SHMA 3RWCA 4U1HA 4BSWA 5ANMB 3DBXA 3DTXA 5T3ZH 5ITFA 1B6DA 4NFCA 3MYJB 2W1NA 4NO5A 3VWJD 2VZ3A 4LLAA 4LGPB 2QQKL 1OGAB 4LRIA 3P2TA 3F7VB 1GYAA 1EAJA 2FHFA 4UI2A 4NQTA 5JXED 1U8KA 3FT2A 3D2UB 3ARBC 1EXUA 5IOPB 2A6DA 3HNSL 1INEL 5DFWH 3CX2A 5F9WB 4RFNC 2R23B 4HBCH 4I3SL 1TPXC 1DLFL 1UWGH 1WV7T 5AWNL 2X4QB 2O5ZL 1RZKH 1JF1B 4HJGB 4G8IB 3QDJB 4L3EA 2VDKH 1EV2E 4FG6D 4OSUH 1MHCB 3H9ZA 3P0VH 3QCTH 4YHNB 4X7TB 1TCMA 1FIGL 4J8RB 1GH7A 4QKXB 3QIWA 3DIFB 3A6BL 2VAAB 3VFOB 3BQUA 3CH1B 1U95A 5BS0E 2CMRL 5A1AA 3P77A 1NGWB 1GL4B 4X6BA 3GSUB 5C0BE 4G6ML 3EGSA 5AWNH 4QTHB 1OAYL 3PP4L 1MFBL 5C70A 4IHOB 4MA3B 4MD5A 2A9NL 1LDPH 5BXFA 2VDKL 1K3ZA 1YECL 4Y4KB 3OSKA 2QQQA 3UDWA 3F5WB 4OB5H 4MB5A 5FFLA 4PFEA 1A3LL 1IGYA 4JVUA 1IFHL 2DQUH 5F96H 1FRGH 5HGBA 3V4UH 4MS8C 2YPLA 4C59B 1KTDB 2X7LA 5B39B 1P84K 2AQ2A 2EDLA 4XMKH 3WJLC 5TJWK 3S5LG 3KS0J 3KWWB 3BKMH 3T2NL 4QCIA 3ULUD 3OGCA 4L8BB 3O4LD 1SY6L 4KZEL 1F6LL 4OKVB 5T1KD 4ONFL 4O9HL 2FBJL 3PGDA 1KXTB 4ZAKC 2Z31B 1QFPA 5DJZA 4HDIB 5IOPA 1AGFA 4OCRH 5C08D 1L7IH 1I1YB 2Z35A 1P5VA 5IB4B 5L6YH 2CK0H 1W8OA 4YIQB 1XF2A 2VTFA 3O45B 5JXAL 2VO5A 4X0KA 5E70A 5L2KD 3AGVA 2V9RA 3IDIA 4NO5B 3MFGB 3K74B 1FBIL 4WUUA 4F80A 4YDKL 4OLZL 1WLHA 4W68A 2R8SH 3O4LB 4C83A 5TFSH 1JNLH 2GKIA 4HUXA 4PRHA 2VC2H 1ONQB 3PWJA 3TT3H 1QUNA 1JWMB 5L6YL 3VXOA 3FOLB 3ROOB 2X40A 1FJ1A 2A6IA 2OQJA 5SX5H 3GHBH 1FFOB 2BVQA 3E8UL 2OM5A 4K71B 1KJ2A 2FEDD 4UDUA 4FA8A 3WIHA 5BRZD 3WNOA 2YRLA 3SJVD 2PYFB 2HT2C 3I6KA 4W81A 2A0LD 1S78C 2FGWL 1A7NH 2K3TA 1U58A 5TF1L 4PS4L 3VFNA 4YDLC 4ZFFB 3MRHB 3JBG7 3IDNA 1G7PB 3C5ZB 3KJ6L 2GUOA 3DPBA 1GGTA 4LLVB 4NWTL 3MV7B 2B20A 4MJIE 1RHHA 5C2UB 2V9TA 3GZKA 1XGUA 1E4KC 3FFCE 5E0QA 3ALXA 1HH9B 4ONOA 4YHIA 1A8JH 2VAJA 5LQBL 2OK0L 4LPXA 3VCLB 1IEBB 1IEAA 5EOTA 3QFJE 3V6FB 4R0LC 3SDCC 4CMMB 1YEFL 1R24B 2Q7NA 1XGQA 3KPNB 1GCFA 4G7YH 5D96B 1H15B 1IGYB 4OZIB 4NJ9H 2E7LA 3QCTL 4U6HA 1RURH 1WAAE 1MFCL 2ARJQ 5BXFB 4MAYA 2IG2L 1QSZA 5A2IH 1EHLH 3PJSB 1KEGL 3BGFB 3QFJA 1TENA 5ALBL 4M1DH 1K2DA 3BZFA 4B41A 4IOIB 4I5BA 5AZEH 3K2UH 3BZEA 5SWSA 1PLGH 4BFIA 1YYML 2YWYA 2EYRA 5FUZL 4P5KA 1MF2H 4N8VG 5I1DA 5D7IB 4FABH 3OZ9L 1TMCB 3VFWB 1UXWA 3CFCH 4HJ0C 1BF8A 1A9EA 4TVPL 5DJDA 2CKBH 1D5IH 4X7TA 2QQLL 4M7JL 4QRRE 4XPGH 5E00A 3VXMA 3MLWH 1UC6A 3GK8L 5F3HB 2R2HB 1U8IA 1II4E 1DQML 5ICXA 1FVEA 4YHKL 5IWLC 1DQDL 1HDMB 4LDEB 4EQ3A 4PGEB 4WW2F 1WWCA 3SE4A 4W4OC 3THMH 1W72B 2P8PA 1KB5L 1F4AA 3N85L 3DETC 5DQ9B 3TBWA 3AS0A 4RX4A 4WHDA 1CICA 3SQBA 4NFBA 4MJID 4K3EL 4XPFH 5C0AB 3QJFA 4OIBA 5L8KB 5CKAA 2DF3A 2OJEA 1QBLH 1C5DB 1BVKA 5DA4A 3R06B 2Y06L 5IMOA 3KPLA 3QIUD 4Z7UB 3BW9A 1TNNA 5DI8A 1MPAL 2XG4A 4KRLB 4S1DD 1KB9K 3E6FA 1D6VL 1F3DJ 3TV3L 2B39A 4R0LA 5HDQH 3SDCA 4ZYKA 4PB0L 1S7TA 2DTSA 5F7WC 3TA3A 3HE7C 4NKOA 4NN6C 3QUXC 1IKNC 5FGCB 5KBNC 2XG5A 2E27L 4KTEL 5IW6A 1JWUA 4HWZA 1BZ7A 5HHOB 1SYVB 3RWEA 5ICZB 4KKLC 4LCYA 4NP4L 1CXEA 1TZGL 3UC0H 3VA2C 1J05A 4YDJB 1QKZH 1LO5A 2M2DA 5C6WH 5FO9B 4TRPH 5FECA 1MAMH 1CXFA 3HNTH 1DSFH 2G75B 4JQVA 3HPLA 4U1MB 3QG6B 5ALBH 5IJKA 2Y6SD 3B6SB 3O3DB 5T5NF 4PJFB 4GJTB 4PTTA 3KYNA 3D25A 5F7FA 4IIQC 3ZKND 1NGXB 3BP7A 2J88H 1MF2L 4Z7QE 3MGTA 5D1ZD 2GIYA 1JGVL 1ZTXL 3ILPA 4MAUH 4Y16C 5J57B 4GKSB 1FNAA 3S35H 4JM4L 5DQDH 5I9QC 4W70A 3REVA 4CJ1A 2ZUSA 4TRPL 4RMTA 4O02L 2VLJE 4LARL 3MRGB 1R3JA 3U48A 1JUFA 5LAXA 5C9KA 2B0SL 3A67H 2WWMC 5I66A 2FDBP 1YEDA 4R26H 4Y19E 3M07A 4NBZB 1ERNA 4K7PY 1JGUL 3I50L 5D1ZB 1MI5E 3B6SA 3EYVA 5C3LD 4HCRA 4JM4H 5DQDL 1IFHH 4J3UA 1FYHB 5I18H 1Z3GL 2F54D 4WV1A 4L8CA 4N9GB 2A77L 3CAFA 1AGEA 1T7ZA 4ZUTA 3VD9A 5HBBA 4QOKA 5ISZE 1JE6A 5JA8B 4UT7H 3UZVB 4PJ7B 5IKCB 1MJ7L 4MD4B 2G5RA 4G6FB 4I9WE 2ENYA 3VXQA 2UUDH 3W5MA 4Z5RB 3BO8B 1QBBA 2UVEA 1IE5A 1K4CB 2QJDA 3L3JB 3B3IA 1GGUA 4UNVA 3G5VA 1CK0L 3F62A 1N64L 4EOWL 3OJMB 2AK4E 1REIA 4JFYA 3WFZA 4OFYD 1GGCH 4QRTA 3PABA 4PP2A 4CNIB 3BW9B 2VXQH 1LEIB 3KR3L 4DZBA 4WTXA 3WFCL 1NCNA 2X4TB 3V6OC 3NCEB 4PJHE 4HPOL 5EU6D 1CL7I 4Z7QF 1RUPL 2G2RB 1RU9H 1NLDH 5J1TC 2EDQA 3JZ7A 1KGCE 1G0DA 4QYOB 3T8XB 4MA8H 1YEGL 3DSFL 3DECA 1VB9A 4P23D 4KFZC 5DVKA 4Y8AA 5ABDE 1QRND 3MREB 2OP4H 1BFOB 4CVWA 1KFAL 3QWRD 4M93C 4N0UA 4GKSA 4QHMB 4F7EB 3HAEG 1ADQL 4YC2B 3CVHB 1RY7B 1CZ8H 2VLKB 4RFOL 1UJ3C 5MHSD 1RZFL 4P4KB 3QAZC 2BNRA 5ADPH 4JE4B 4U1GB 2R2CA 4PTTB 3JV6B 3LN4A 3QO0B 4UTBL 2HKHL 4RA3A 1CL7L 4TNWK 1NGZB 3TCLB 3TYGH 3C5SB 3CMGA 4OFPA 4POZC 5F3BB 3QNXB 2DLFL 1UB6A 3UC0L 4HQQH 3WIHL 3GRWH 1KJ3H 4KK5C 4HGWB 5IQ7H 4ZAKA 4HAGA 2VXUH 5E8PA 1EAPA 4J6RH 2D03L 2V2WA 2DKUA 1MCBA 3W0WB 1JUFB 1RI8A 3O4LE 3L3GB 5GRVK 3G5ZA 5F7MC 5D4QA 1HCVA 3MRRA 4QHMA 5EUKB 2H26B 4NQSA 1EO5A 1XGTA 3UROR 1X5GA 2VDNL 2AEQH 5F7LB 3VFSA 2XNAB 1RJLA 1XF1A 4DK6A 1AD9B 3EDEA 4HWNA 3NPSC 4GAGL 4G7YL 5ELIA 4LCIL 4MCYB 1SVCP 3I85A 1N59A 3ZE1F 3K4ZA 3FOMA 4KHTH 1EJOL 1IGJA 1Z5LB 3MLUL 4PY7A 1HYRC 43C9B 4J8RA 3WO4C 1AGDA 1OSZA 4LPVA 2IMNA 1I9IL 1UKQA 3BAEL 3CFKB 3ZE0E 4M6OL 1RJZB 3DSFH 5SV3A 1A6ZA 1A4JA 3HE6A 5ICXB 5F8RC 1D5IL 4U2ZA 3TNMB 4MA7L 2EH8H 2P43B 3OBAA 4YFDB 5C6TH 3ET9F 2BHZA 2ZSVA 2X4RA 3VFNB 2HJLA 1S7VA 2QSVA 4L5FL 4ODUA 4OBSA 3P4MA 2DJ4A 3K80A 4JFFE 2BC4A 4LAQH 4WEBH 4ZOAA 1WFUA 2JJTA 4YDKH 3MV8D 3E6FB 3VFPA 1CFTA 1JZ4A 4KI5E 2DD8L 3MLSL 4N68A 2DQCH 4X9FA 3RX5A 3X3GH 3ARBD 1MFAH 2CDFB 3BMWA 1IC4H 4ORZC 4DJMA 5JOPD 4YE4L 4JFFA 1QSEA 2GCYA 4MX7B 3H0TB 4EN3C 4ELME 2Z31A 3QDJE 3QIBA 3VFGH 1E6JH 3ARDA 2V5SA 3VU2A 5E8OB 4BQ6A 3IT8D 4PREA 5GRUL 5GRJH 1I9JH 4XXDA 1A6TA 3P73B 4AEFA 4Y7MA 4QXGH 1K3IA 3O41A 4XHJD 2F19H 2GTZA 1UACH 5I0DA 3IVKB 1MCSA 2IAMA 4UV7L 1Q0YL 3KGRA 1CE6A 1BMGA 1U8QB 3FO9A 4WI5A 5ANME 3ZTJH 4XNXL 2OJZH 1M7DB 4BH7A 1BQSA 4YHNA 1RK1A 5HYIA 1BQHG 4JZNA 4M62L 1WWBX 4OGYH 5I8OH 1D6EB 2VQTA 2BOBA 2Z4QB 3WUWG 5IEKB 1R3KA 1QFWH 2P7TA 1MEXH 3WIIH 5JR1L 4J23A 1KLFA 4TSCL 3MLRH 2BXYA 1NGPL 3D1MC 3P40A 4M7LT 4I0PB 4QRRD 2HKHH 4B53A 3W0WA 1OLLA 4N0RA 2VYRE 2ZG2A 3ARBA 2VDPH 1EFXB 3BP6B 4NT6A 5EH1A 3NFNA 2DQGL 5J06A 4U6VH 3FMGH 1G9EA 4G3YL 4JRXE 1AKJB 4Y1AB 1KN2L 4YPGB 3QJHA 4XNUL 4C83B 2BERA 1D5MB 1QO3A 4KAQH 1AR1C 2R23A 5GGRB 2BSED 3RY5A 4LASH 1JGUH 4LHJB 1TXKA 3HI5L 1IC1A 2FSEA 4D8PB 4DN3L 2PO6C 2XZQH 3TVMC 4TTGA 4XCYB 2VR4A 5DT1L 4NHCH 5C0EA 2RAMA 5BO1L 5E9DD 5DJ2B 5F9AC 1M7XA 2Z35B 2CK0L 3HI1B 1DVFA 4HC1L 5DJCA 5C07D 4WI3A 1MCHA 3MO1B 3E3QC 2Q87A 5B38G 3IDXH 1PFCA 4ZOCA 5FYLD 1B0GB 4V1DD 4U3CA 3WFBH 1T7WA 4TPRL 3S37X 1CLZL 1HWGB 4LKXB 4NQEE 3SY0A 4KI5C 4QCIB 1JHKH 1QRNA 4WCYL 3TBSA 1TZHA 5I74B 3VG0H 2XZQL 4LPWA 4M4PA 1GRWA 3DJ9A 1DUZB 3JUYA 2OL3L 2HT3C 2P8LB 3QUYB 3CX5J 2AV7B 1UM6H 5IFHH 2HRPL 4FQHA 4I8DA 4HV8B 1YEDB 1WWWX 3TGXA 3MLXH 2EH8L 1MY7A 3VXUA 4U1GC 4OZHE 4QTIH 2JB6B 2DDQH 4FP8L 2OL3A 1WFTA 2FO4B 1VSCA 3EHBC 5DUBB 1NLBL 2VL5B 3GSUA 3IJSB 1HKFA 1AQDA 3I6GA 1XR9A 3SDAC 1DQLH 1KIPB 3FHAA 5I19H 1YZZA 3L95A 3QBTB 5ETUB 3BUTA 1ZK9A 1H15A 1HKLH 1NFIA 1WGOA 5IFHL 3PP3H 4MD4A 3CCHB 2AJYL 3JUZA 3MV9A 1I7RA 2ESVE 2BSRB 5KTEH 1SQ2N 4D9LL 4YHML 3RIFF 5GSRA 3P0VL 4PJHB 4NNPL 4XBGA 3AM8C 5DTFA 2O26U 4K8RC 4Y4HA 5EA0H 3BN9C 3SO5A 3VFGL 2BMKA 2HLFC 3JTSB 2XACC 4Y19D 1IBGL 2LVEA 1JZ3A 2BNRD 3MV7A 3PWNA 1A14L 4Y5YB 1MCOH 3B4NA 1CGYA 1S9VA 5HHMB 4Y4FD 5GGRY 3EUUA 4O2FA 4OLYL 3EO1A 4K8RL 4K7PH 4NHCL 4YWGH 4JFDE 5IW6B 4Y4KD 4NSKA 1CDJA 5TFSL 1PG7H 3INUH 5E9DA 3KPTA 3JVGC 5ISZD 5AYQA 1K8DA 3LS5H 4PJ7E 1KIQA 2FJGA 5HY9A 1IL1A 3V6OA 15C8H 4QTHA 4KVNL 3VE0B 3WFBL 5DJ8B 3SGJA 5F7NC 4YJZL 5SX5K 2F15A 4OLEA 1MJ8L 1C5DA 5E94A 4Y4FB 1MELA 4J4PD 4P3CH 1FJ1B 3X12B 3D25B 3W2DH 5DRWB 3C5JB 2V17L 3MNVB 4N90D 2BXZA 4TQEH 3U6RB 3NPSB 3VI4E 4MXWL 4ZFOA 3QRFM 5JQ6H 4WGWB 3Q6GL 1INDL 3QQ3B 3P11H 4U6XB 3MRBB 2ADIB 1U6AL 2VLMD 2DLTA 3WL9B 3OMZA 1JZ8A 2ZCLL 3MO1A 1I8IB 5HYJA 4Y5VA 5J6GB 4LCYB 4U6VL 3QDME 2ICEB 2YD5A 1JCKA 1U8KB 2YXMA 2H8PB 4R4NC 1KGCD 5HGHB 1S7WA 3N1FC 1FZOB 3TA3C 3S37L 4XCCL 5D9SA 3WNKA 3TBVB 3C60D 4XH2B 1UQSB 2NXZC 4Q2ZA 5D2LB 4JANA 2PXYB 4XPHH 5DQJB 2E6JA 3C5ZD 1A5FH 3BUYB 1QFWI 3W5NA 1CGWA 5JORB 5E2WL 5BV7H 4JEGB 3PJSA 1S7XB 5DF0A 2FWOB 5E8DL 5ADOH 1HSAB 1Q9KA 1LO2H 1YEEL 1MCCA 4XC1H 1VFUA 4MD0B 4YGVB 5GGVY 1AO7D 1JV5B 4HS3B 1CICC 2RCSH 4CMMA 2OXHA 1U3HB 5HHME 1J12A 3BRFA 3DXAB 4JFQB 4UZGA 1YEGH 1RAMA 2CKBL 3FB5A 1MAML 1KOAA 3BEWA 1A3RL 1JRHI 2ZSWB 5IK3A 4UIMA 2AABH 2Y72A 4NUGL 3O3EB 4HWBH 3LV3A 1O7SA 4QRQA 1A9BA 5EO1A 4J12A 4LSQL 2NCMA 4QRRA 1IC5L 1BX2A 3QSKB 2GITB 2WM0A 4OTXH 5DDHB 1H3PH 2DQTH 1AKJD 5C9JA 4GKNA 2FX9H 4Y5VB 4UTBH 5J6GA 3OKKA 4S11A 2IH1B 4BFGA 3QDJA 4UNUA 5BVJA 1P84J 5FHAH 4I0PD 3HZVB 4QRUA 1DLHB 2VH5L 4IRJD 2R29H 3CSYB 3LD8B 2R0WH 4X7SH 1S5IL 3LSOA 1D9KD 5SWQB 2ZCLH 4P2RB 5DMIH 3PQYE 5CMAA 4CRPA 2P47B 2X89A 4XAKD 1W2KT 4TSAH 2D7TH 3CU7A 1JI1A 3O6FD 3RY6C 2ARJA 5ID0A 1V8HA 3UZQA 1KIPA 1G7IA 2C7UB 1UA6L 2R2EB 4NQUA 5D7IE 4OCLC 3VXTB 4CW1B 4WFED 6FABL 2MKWA 4AM0A 1LEKB 4AEIL 2CJUL 5GJTL 1A5FL 1QO3B 2AXFB 4MQ7A 4QXWA 2VDPL 4P49A 5B4MC 1IKFH 3QEQD 3TBVA 2FYYA 3QEHA 3OXRA 2PW2A 1HH6B 2APTA 4MNQA 2O5XL 3RZCD 2EDRA 5K9KA 2GK0B 1G9ML 3DVNB 5BZWA 4ACPA 4FFWD 5C71A 4BQ9A 3UBXB 4N5EC 5E2VH 5EUOA 4XZUB 4EI5A 2IAMD 4PJIB 5GRYA 5KSAA 4WI2A 3C2SA 1S7RA 3O8XD 4ZQKB 5JOPE 5CSZB 3LPFA 3RPIB 4OLUL 5FOJA 5HYEA 1VEMA 3IS1X 4B7IA 1BD2A 5DO2D 2Q76A 1CLCA 3PV6B 1MCJA 3DROA 3DX7A 5EZJB 2GITA 1S8DB 3B9KA 4JRXB 5MEQA 3VFUB 3DO3A 2B4CH 4P23C 2VABA 5TDNA 2VQUA 5CEXA 1Q94A 4M8QA 3U4EA 3L3KB 3PQYD 4KMLB 3O4LA 4KK6C 2BRRL 1R3LA 5TDPB 3V8OA 3CVIH 2YD6A 3BSZH 3QJHB 3QRGL 4V1DA 4YBQD 3QUYC 3HPJB 5I17B 1JTOA 1GPOL 4XPGL 3C8KB 4X0KB 1OL0A 3DXAE 1QD0A 4PRPA 4RGMC 1FAIH 3P77B 5BZDB 1PAMA 2ZKHH 4RRPG 2AXGA 2IGFL 3MGOB 3QNYA 1SBBA 2QADC 3DMMD 4AIOA 5IVXA 7FABL 3RWJB 2R0ZL 4AL8H 1CXKA 2VZOA 2A83B 2VZUA 3MACL 4XTRC 3RVXC 3JWNC 5EC2B 1C1EL 1X5AA 1KPRB 3JXAA 1XGRB 1XF4A 5CJBA 3KWWA 5C9JB 3EYOB 2BSSA 4PJEB 2YKLL 4RAHA 2CQVA 1MRDH 1I8MB 4JVPA 1I7UB 2MHAB 1MIMH 1UYWL 4QY8B 1J8KA 1U8QA 2P1YA 3NABH 2VMFA 2PNDA 1PVHA 2BNQE 4JM2C 3B9AA 5J9PB 1U8MA 3EO9H 3V52H 2ADJB 3HMWH 3HB3D 1JZ2A 5D93C 1FDLH 4O51A 3FQXB 3T8XA 5ESAA 1GGIH 2DOCA 3M17A 3BKYH 4H25A 3NN8A 3HI6L 2H3NA 1Q1JL 1TTGA 3IDYB 1IAOB 1CFVH 3L5XL 2G5BA 3ALWA 5J13B 1FIGH 1RJYA 2D0HA 4NQDA 1J18A 5HDBE 1WIOA 4JRYE 4LCWE 3D0LA 1W0YT 1HSAA 2FWOA 3TO4A 3V95A 2CLRA 4JB9H 1QHPA 1T7YA 4IIQA 5FA3A 1F5WA 3VWKD 3NGBC 3MQIA 4P5MB 4KROC 4OGZA 5FO7A 5CEZL 3MOBL 4HLZH 4LLQA 4LSPL 2NY7H 1E4XL 4U1NA 1VFAB 5E4EB 3D2UA 1I1FB 1LILA 2YSSA 2J8OA 2BJML 3PWVB 4MNGB 5DT1H 5BO1H 1OARL 1PEZA 5CINH 1QSED 1EDQA 3P4NA 4AMKL 2UVFA 2DN7A 4JZJB 4UIMB 3V8CA 4GG8B 3HN3A 2BDNH 5GJSH 5FGBA 4ZUUA 3EYUL 3C5SA 1L6XA 3VWJA 1BAFH 1CE1L 4OAWA 1LD9A 3QPXL 5DEGA 1OGTA 1NC2D 4FFZH 2BP3A 5HI3C 4KKCC 4YGVA 4MX7A 3BPCB 1FSKC 4PPTA 1G0XA 3NOIA 4BZ1L 1A21A 4OCSH 3SE9L 3TWCH 3VD5A 2YA1A 3SDXE 5AYUH 5KZCD 1OGAE 5IHUH 3EJZD 3VFSB 2R9HC 2I9LA 2GY7B 1CDIA 4JAMB 4F2MA 1HEZA 3ZDXE 3OG4B 5EZIH 5I30H 5F1NA 4GFTB 4LVNC 5C1MB 1CFVL 3TZVA 5EBWB 2I60L 1BVZA 3IVKA 4UV7H 1DEEA 1WCQA 1EO8H 1BECA 1M05A 3JTTA 4LOUC 1NANI 4TULL 4FTVA 3TPKA 1WJ3A 3HPLB 2YS4A 1RZJH 2MMXA 3JV0A 4QLRA 5F7DA 3WL9A 3B8YA 5MP6L 2J3SA 1FYTA 1XCQA 2NX5A 3LS4H 3D87B 1CFQA 2MPAH 3QAZB 1MLBB 1XF3B 2APBA 3MACH 1MIEH 1Q72L 2BNQB 1IT9L 5ICZA 1XGYL 4RBPH 5F9JA 3TN0C 1BBJB 3VXSA 5J6HA 4AEEA 5E99L 4YFEA 2DD8H 1UEYA 1I85C 1PZ5A 4YWGL 4F15C 3QXTA 5GS1B 3NA9L 5BV7C 1IC4L 2NY6D 2CRMA 5DVNA 3MJ9H 3QP3A 2VDQH 3QULB 2ZOKA 3VRIA 1QOKA 4NRXA 2EDFA 5KOVC 1IZJA 1AGEB 3QUKB 3VE0A 2E9BA 1XCTA 3HNTL 4IS6B 1D5MA 1AY1L 1F42A 2X5PA 4LF3B 4WU5A 4NN5B 3ZKXC 3VXUB 3V6OE 2XFXA 2OLDA 4OQTA 4ORGA 3U82B 4HIIA 4YC2C 3DURA 1K6QL 1P4LB 3LKRA 3WNNA 1FE8H 2DJSA 4U0RC 3DV6A 1OAXL 3ULUF 1IZKA 1AXSB 5HDLA 3SE4C 4X4ME 3WD5H 1IAMA 1CGXA 2DQUL 3PABB 4E42A 3MRBA 4LPUA 1FFNB 2CUHA 3ZTNH 2C3GA 2YBRB 1KEGH 1B0GA 3GSNB 3QI9D 5BVJB 3CGTA 4L29B 3TJHD 2DWEB 5GXBB 2H45A 4YDVA 1NEZA 2V2XA 2RHEA 1O0VA 2FH8A 1G6VK 2I24N 2EEDA 2NNAB 4PD4K 2HRPH 3I50H 3KYNB 1JHLL 3ARYA 4HCRH 3W81A 1MFAL 1T5WB 4KKAD 3WKMH 3O9WB 1IGCH 1HXYA 1VERA 4ZTPL 1Z3GH 1ZLUH 3G6JB 4OIAA 1FH5L 1X6NA 4XI5D 2HFEB 3PL6A 2PW1A 4KH2A 4OCXL 5FO8A 1OQOA 1E6JL 1IQDB 1NCCL 3OB0H 1C5BL 3RNQB 1DQLL 2AERT 1CS6A 4EZMA 1BJ1J 4QEGA 3OB0K 4ODHH 1T5XB 2NYYC 5FOBB 4HWUA 3LQAC 4I0PA 1YJDH 3BN9D 5GRVL 3KLAB 1OAQH 3MRFB 3ZT7A 1GHFH 1E4KA 4OZHB 2R1XA 5FGSA 4I3GA 4LU5H 1PD6A 5DEFA 4HKBA 4BZ1H 1GZPB 1FP5A 1T21A 4Z7UA 3MXWH 4Y2DD 3S4SA 5E6ID 1RULL 4UT6L 2KH2B 3MRHA 5GGVL 1ZHLB 3V79C 2N56A 5CJ8A 1FNEB 3R0MA 3U4BH 1AGBB 3SDAA 4BZ2H 1IRAY 1PG7X 3L5JA 4JO4H 3S97C 1VACB 4Z76A 3HFMH 1CFQB 1RZJC 3WD5L 1A7RL 2QKIB 5I1LA 3F12A 1IVLA 2OBGA 1A6ZB 3H9YA 1LO5B 3F58H 4KY1L 4NQCA 4J4PC 3MRCB 3QDMA 5JDSB 3FKUS 1JPFB 1PDKA 3PP3K 5FUOH 3K8MA 2BY2A 4JQXC 1U8PA 2DQGH 1RZJL 4Y2DB 2C3VB 1EEZA 4X8JA 3S7GA 1U92A 2W07A 5FM5M 3DARA 1F3DH 5HVWA 4DN4L 2NMSA 3N9GH 3VRLF 2VOTA 4O2CB 3FTGA 3HI6H 1LEIA 2BY1A 2YPLD 5K59E 3W9EA 3U36B 1RZ7H 3ZYZA 5E2TH 4HSQA 1SYSB 2UWEF 3IKCA 2AW2A 3UTQB 1WFOA 4PJ5B 3C60C 4S1SH 4Z5RA 4YIQA 1NKRA 4XAWH 1FZMA 3WIIL 1DZBA 1KIRA 3BWAB 3O3AB 4ODSH 3FB6B 3H3BC 5DEFB 1TETH 4MDJA 5HI4C 3QG6A 4LSVL 2A9MH 2LV4A 1PYWA 1RUQL 4M3JA 4LKCA 1UCBH 4P46A 4Y1AA 2V7NB 1FPTL 3MV11 5DMGC 4ZXBD 2G60H 2AJ3A 2WWKT 3LKPB 1TJHH 3QDGB 4HXBL 1MCNA 1F6AA 12E8L 3EDDA 1AD0B 4K9EH 1MJ7H 5I1DB 3KXFA 1LK2A 1T4KA 4ZPTA 3DRQB 4K94H 4FFVC 4XVJH 2Q86A 4GRWF 3UJIH 4LLMA 2Y4SA 1G7HA 5C09A 3BDBA 2Y07H 4O58H 4JDTL 2DQHL 1RUQH 4U1LB 3EKCA 4JY4A 2HVJA 2AJUL 1LNUA 1EUUA 1FLRH 2Y5TA 3BN3B 4I4WA 2BNQD 5INDB 3CVHL 1QZ1A 4WTZA 3ULUE 4FRWA 4Z18A 3L3DA 3FO9B 2YPKA 2IGFH 4L4VD 4PJ5D 4G6AD 2MCPH 3PGCB 2ITCA 1HSBA 5CP7A 2Y25A 4NRYB 4O58L 1A6TB 4FQXC 3V4VL 1SMOA 2DBLL 3DRTA 4PGCA 3U0TB 4PLJC 4PRNB 2D7PA 4YUEL 3RVTC 1MLCB 3PWUA 4JFDB 5T3ZE 1AXSA 1WBYA 3PE9A 5JO5A 1SYVA 3T2PA 5CZKA 5FGCE 2GTWB 1K4CA 2ILLA 3MJ7B 2EEBA 3N1QC 4GQ9L 3I3DA 4XRCB 3TIEB 5BRZB 4OGXH 4G8FB 3OR6B 1ODAA 3GMMB 3E3QE 3P4OB 4UB0H 1MCEA 2X4NA 2WUCH 1LGVA 4OF3A 3W11D 2A1WH 1QLFB 1TETL 4IOIA 3TN0B 2GK2A 3D85A 2YWZA 4AEIH 4YUEH 4LSRH 8FABA 1N0XL 2OR8A 3K7UA 3MLVH 5EC2A 4KRPC 3OKYA 4MDIB 3ZYIA 4KGLA 1QSFD 4P9MH 1BVKB 4GBXA 3EZJB 5GGQH 2FB4L 5J13C 1RMFH 3CFDA 4HEPG 3DX6A 4NO0A 2AEWA 1C7SA 3GRWL 2C4FT 3C6LA 2HWZH 4OUUA 3U0PB 1MH5B 4XC3L 1I8LA 4YZFF 4H26B 2YRPA 4LARH 2XIDA 1JL8A 3L3OB 1XZ0A 2P8PB 3WS6A 3O9WD 4A6YH 3PHOA 3HNVH 4MA3A 5IF0B 3GRWA 4WFFD 3N9GL 1UH3A 1VACA 3MBEC 5EULV 1KXQE 3AY4A 4LVEA 4XP4L 5C0RH 4Q0XH 1KIRB 3BO8A 4J7RA 4KDTC 1DBKL 1ZA3B 4KK6D 3Q5YA 3FQRA 3BKCH 5DEZA 3WUWB 5BRZE 2VLRA 4NQEB 2B4CL 2N7AA 1T21B 2DLIA 2BSSB 2X4PA 5I9QB 4JHWH 2FL5B 4KZDH 1B90A 4YHYC 3UDWC 3O2VH 4TUKL 2FBOJ 2AS5M 2KQNA 1CCZA 2QADD 2VDRL 1F00I 4PJBF 5KSAB 1YECH 3V7MA 1DFBL 4LL9A 1VGKB 1PEWA 1A1NB 1KCSH 4ZUSA 4YR6A 1GGYA 3RWEB 4EI5C 1NAKL 1PJ9A 4RISH 3MODH 4P2RE 3X3FH 3RNQA 5IBUG 4FG6C 4DKDC 3C8KA 2NQCA 2AQ1A 4HWEH 2EKJA 4NN6B 3STZB 2Z93B 3BT2H 1JI2A 4MJIB 2BZDA 4JKMA 5E7BA 3BEVA 5FDWB 3IDMA 4WUKH 5E2VL 5I8CA 3BP4B 5KSVA 3VXTA 5KSUA 3C5ZA 3RP1A 4LFHD 3GI9L 3O11A 1CF8L 5I1KL 3KYKL 4Z7UE 3C2AL 4LCWA 1ZLSH 3P3YA 4OFDA 4LLUA 1NEZB 3OZ9H 1FNLA 3HR6A 2UZYB 1VFOA 3HMXA 3LZFL 3UTQA 4HQQL 4HS8L 5LG1A 5CJXA 4HMDA 4G5ZH 3HZVA 1FNGB 5C0IA 5GHWL 5I1LB 3N85H 4A2MA 1NGQH 4X99A 1T2QL 5K9QI 5E5MB 3DSNA 1JVKA 3WE6B 2BSTA 1OAUH 3CZFA 4RMVA 2CSPA 4LMQE 4QRRB 4QRQB 4TTDC 4NO2B 1A3RH 2IBBA 1GXEA 4N0FB 4XB7A 1EA9C 1K85A 2FX8L 5DRNB 3QPQD 1JTPA 4G7VH 2B1HL 5J0BA 2OR7A 3KPLB 5ITBH 4NQCD 1NUNB 2C4FU 2WSKA 4YBLB 1XF2B 4OFKA 1JV5A 3JWOL 2BJMH 4OLYH 2NY5H 4HZLB 3S5LB 4JZJC 2B4CC 5AG8A 5IVNA 4OGAD 4PJAA 3BPOC 3G08B 2VWEC 3O3DA 1MHCA 3OJDB 4WW1B 3V5HA 5KSBF 1XF5B 5HI3D 1X5XA 4F9PA 3W39B 1FFPA 2ITCB 2CRYA 3FFCB 4ODSL 2D7MA 4JFPA 2ZUUA 3WS3A 2NR6D 3QO0A 4J3OC 3AS2A 1F97A 2YZ1A 4OT1H 4FQCH 4UDTB 5A16A 3I2CH 1J5OL 2JJUA 1ZLSL 3DGCR 3DV4B 3GSNH 4KU1A 4F33B 1KJMB 3TIDA 4F8QA 3WKNA 4PG2C 3DUHA 2QLVB 4KJPC 1UKSA 2OI9C 5ITFB 4JY5L 3BPNB 4JQXA 5BS0A 1G7HB 1CLZH 4M3KB 4E42B 3IJHB 1YDPA 3IJYA 4PJDE 1H5BA 1AXTL 3BOVA 4K7PX 4NO2A 3TFKD 5DK0A 4LHQB 4F37K 3MNZB 3P4LA 4W4NA 3IS0X 5IEHB 5CGTA 4JDVB 5SWZB 2V5RA 4UTAH 4FQ1H 5HHXH 3CFCL 5SWSD 4K7FB 4IJ3C 4R3SB 3DETD 1UACL 2Y36L 4X6DE 3UPAA 1EFQA 2R0KL 4QTIL 1C7TA 4QOKD 3NCJL 3CXDH 1B2WL 4F57H 1QEWA 1JFQH 4Q9RH 3VWKB 3MR9A 3VXMB 4LDLB 1CWVA 4J3TA 2DIBA 5K9KB 4XP5L 4R4FL 3GHEH 1FBIH 4XP9H 4WUUE 3KAAA 5D5MA 3FL7A 3QWOA 1JNNL 4YHLL 1JNJA 4HKZA 3Q3GB 2QBWA 3V0VB 4XB8A 2CKBA 1B4JL 2X1WL 5IVXF 2H32A 1MCDA 2R0KH 1NAMA 4I5BB 1NFDB 5HHQA 1A7RH 1B0WA 5KVDH 3FO1B 1UG9A 3TESA 5C0CD 4P59L 1L0YA 3TV3H 1UADC 4M02A 1IARB 4K7FA 1VESA 4X9GA 3QEUA 2MSPA 4ZTOH 5IMOB 4KKLD 3EYVB 3D6GA 3X12A 4AIZB 4ENEC 5FKAA 2DI7A 1OPGL 1GGBL 2FGZA 2J12B 2VQ1A 4Y5YC 1J0JA 5C8JA 4MAYD 4LPTA 3TZVB 5F9JB 2NW3A 4CMHB 4OFYA 3V6FA 1VGKA 1HZHH 1FORL 5HHNB 4AQ1B 1W72A 2R39A 5JUEL 1MFBH 2X1QA 4WO4D 4ONHB 3D9AL 4PR5B 2JB6A 4OB5L 5IROA 3T3MF 4P2QA 2L7UA 4J1UA 4UQ3B 5BJTA 4GUPA 1ZGLM 1CU4H 1I7ZA 4HJJH 1TJIH 6CGTA 5C0BB 3S3PA 3VRLE 3V4UL 5JW5B 3ARGD 4YHZH 1KELL 3RTQA 2ORBL 3RWHB 3MRDB 5DVLA 1OT2A 2PTTB 5FUCC 2BNRE 1XMWA 1QR4A 4WHCA 3QPXH 4Y4HB 3BZFB 2HTKC 3L9RA 2Q6WB 2QSCH 3LVEA 2JK5B 5JW4R 1KPRA 2VZ1A 4DGVH 2JJWA 4X5XB 4IIQB 2YUXA 4WUUD 2ED9A 3GKWL 4X6EB 1GZQA 5IHZB 1FFOA 2BVQB 4X7FC 5DJCB 3UYRH 1NMBL 3WIHH 4GRLB 3BZ4A 3ARDD 3ARGB 1LE9A 2BOCA 3UZEA 1GJIA 1KJ2H 4MB3A 3KPRB 3AU1A 1MHEA 1ZSDA 4W6WB 4QF1A 2X4SA 5I1GL 3MJ6A 2EYTB 3FB7A 3PUCA 2P46B 4FXKA 3QYCA 3VRJB 2NY7L 1W8NA 2E7CA 3L5WB 3L6FB 5I73B 4OLVL 4V1DB 5D2NA 1A7QL 2VUOA 5DR5H 5ESAB 4DGVL 4WI6A 1T1ZB 4CAGA 3LN5A 4GS7B 1ZLVK 4WUUB 5GGTH 2QQLH 2GUOB 3I3EA 4LRNL 3SBWC 3UBXG 4S2SA 3DLQR 1PSKL 3D0LB 4AG4H 5IESH 3FT3B 1RULH 2Y1VA 5K9OA 1I9RH 4LCCA 1I4FA 1TCRB 3VFVB 5I1GH 1LO4L 1RUML 1ORSA 1G7QB 1T3FA 2EH7L 2EIZB 5BCAA 4Z78B 1ETZB 3UO1L 2A74B 3PHSA 4P5MA 4GW5A 2GHWB 5IV2A 3BAEH 4M6OH 3VW3L 5CEZE 4LAJH 5HHXL 1A1OB 1DN0A 3V5KB 3GIVA 5DFVD 5F3HA 4IEFB 5JLZA 5KTEL 2PTTA 3RWDB 1NGYA 2CLVA 1JGDB 3ZO0A 3AM8A 2XT1B 2FHCA 3WCYA 3IDGB 1S9XB 4NC2B 1A9BB 5I75C 2YPKB 1KPVB 4DN4H 2NY1C 2DAVA 3T65B 3NCYP 3EDJA 2NY0B 5HGGS 5DMKA 1S9YB 2NY0C 1DBMH 1FNFA 5D7JB 3RHWF 3VGFA 1F45A 4U1IA 3S4SG 2GT9A 4UQ2B 4XXCC 3QO1B 5IP4A 4GOSA 4JFFD 4NQXA 2WIMA 5BMFL 1MRDL 5D1QC 1J8HA 5BV7B 3PDGA 2E7LC 3BPCA 1JNHA 5F97E 5H94A 3MV8E 3DIFA 4KDTA 2AXJA 4MD0A 3FN0L 1X6LA 4ZTOL 3PGDB 3RDTD 4POZD 4X6EA 4NN7C 2B0SH 5FUCE 5EWIL 4HH9B 2DWDB 4OD3H 1R3KB 2P7TB 1T89C 3MLYH 5H2BB 1DDHA 4YBLC 3VWJB 4CDGC 2CIIB 3A6CL 4D9RD 1ED3B 2EO1A 4HUVA 1U8HB 1UM4H 1I8LC 2BVEA 4MGXA 3IDJA 1BX2B 1G7LB 5DSCB 4NM4H 3QIBD 3Q48A 3T04D 2ZUXA 5CKGA 1J10A 4JGJA 12E8H 1SY6A 2XV6B 2CGRH 5HI5C 5LGJA 4WWKB 3BESR 1OP5K 2FYYB 4QHUB 4YFLF 4YXKL 1EEUA 5DUBA 5I74C 5JXEA 2OL3B 5D6DC 1X5IA 2I9LB 1G84A 2DQIH 4UDUB 3R8BB 1S7RB 3L3OA 3W9EB 1LO3H 3VH8B 4FFYH 5GZND 4XCCH 3VD7A 1MRFH 4LLYB 1NDMB 4M43L 4I77L 3BPNC 1S8DA 4R9HA 5DK0B 2IANB 2G5BB 4OI8A 3WFCH 3V5KA 1ZT4A 3S36H 3O2DL 4OAWB 3NN8B 3SGDI 2X4QA 1AGCB 2WUBH 4UUJA 4KAQL 4QRUB 5L8JB 1T2JA 3TZVD 4LNRB 3LEXA 3G6AA 1DBJH 3V5DA 1T0MB 4PBXA 5I1JL 5DZLA 1V7NH 5JXEC 2WINA 5IMLA 3DVNA 1U41A 3T08A 1J8HE 3MA7A 5FA4B 1MVFA 4PG9A 4M6NL 1QG3A 1AGFB 3QXAA 1FVCB 3CMOH 4UV4H 4CDHA 4P5TC 1DE4A 5AYUL 1NFKA 4DFIA 4HWBL 3HRPA 1G6RA 4C55A 1CD8A 1HSBB 2LAGB 4XCNA 2ZOLB 3ARFA 5HYQA 1N3NA 3DVGB 3SGKC 3QUXB 5GS3A 4JDTH 3QCVH 4YE4H 4GKZA 4NQDB 3CJJA 1QQDA 4I3RL 2DICA 4WVRA 4AK1A 4FQPA 1Q9WB 2EXYD 1YNKH 5HPMB 3O6KH 1UJ3A 5C09D 4G9FE 1Y6NR 1MCQA 3K4AA 3NH7L 1JBJA 5EPMB 3IJSA 3TO4C 3EOYG 2FX7L 2AK4B 1X4ZA 1J0ZA 4DVBA 4DWHA 2VR5A 2IANE 3ZE2E 1WIPA 4GXUM 4EXKA 2X1PA 4EI6A 4U6YA 1R5IA 3K4DA 3FB7B 3GUTB 3HG1A 3HKFA 3UJJL 2QQNH 1MRFL 4JREC 2EXWD 3GJEB 2IFFH 3CK0H 3HAEB 4IMLB 5C0BA 5AD0A 4XVUD 5KW9H 4KQ3L 2BSTB 4AIZA 5JPNB 3O41B 2DMBA 4M1CD 1JF6A 3JTSA 5ENWA 1H9VA 5DS8A 1RFDH 1S7XA 4JB9L 3BXNA 4NNPH 3GMOA 1HHJA 3I3BA 3Q2CA 3C60B 3O2WL 3L9RB 1BWMA 4G8EA 5EN2A 5KANG 2VXVH 1J8HD 3MRKB 1I9IH 1DQTA 3HE6C 4HS3A 4LSTL 5EUOB 5DD6A 3C5JA 1PY9A 2FECL 5CJQH 4ZFZA 3UEZA 3PWPD 2NY2C 5IKCA 1A3LH 3ARZA 3ISWA 2HN7A 1MCWW 4LRIC 2VL5A 2OCFD 1XGPA 1GGCL 1T7XA 4OF6A 4RMUA 1CGUA 3CIQA 4UAOC 4E0RB 4WENB 1LQSR 2OX5A 2AP2A 4HMCA 3MMEA 4KRMB 5F6IB 3T65A 5EOQL 2CMRH 1A6AB 2IPKB 5TDNB 3NFNB 5DA0B 1FZOA 4L8SC 1S7VB 1CF8H 4L8SB 2C3VA 2NY4D 1A47A 4QXUH 5JQHC 1IC7H 4IRJA