4RISL

Structural analysis of the unmutated ancestor of the hiv-1 envelope v2 region antibody ch58 isolated from an rv144 hiv-1 vaccine efficacy trial vaccinee and associated with decreased transmission risk
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Structural analysis of the unmutated ancestor of the HIV-1 envelope V2 region antibody CH58 isolated from an RV144 vaccine efficacy trial vaccinee.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2014-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4risL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4risL01
5LCVH 3TNMA 2BJMH 5D1QA 3GJEA 2WP3T 1U58B 1T3FB 1X7QA 2YZ1A 2E5EA 3NOIA 4LQFL 2N4IA 3MLVH 3RFZC 4OI9A 4F2MA 5FF6B 4PJ9D 4NQSA 3NCJH 2FBOJ 2ZOLA 3SDXF 5AWNH 2ADGA 4MCYA 4OF5A 4WU7A 5T3ZE 3DSFL 5K59F 3MRJA 2OMNA 4EZMA 2IFFL 1YNTA 2YEZB 4R4ND 5INDB 3C5SA 3LKRA 2VDNL 4S1DC 1ORSB 1B0WA 4XNZB 2NZIA 5EN2A 5MEQA 3WSQH 1QFUL 3T77A 1LO4H 1NBQA 1HXYB 1KBGH 2IJ0C 4HUVA 4G80B 5EU6B 1OSPL 2NNAB 5C09B 4EI5A 5DFVD 4ZFOA 4JG1L 5BOZG 2ESVE 1MCIA 5BZWA 3AVEA 1B2WH 1HN1A 2UY7A 1TTFA 4CU6A 4HBCL 1P6AB 2EH8L 1M71A 3A6CH 5B8CB 4A6YL 2IG2L 3IKKA 5CJXC 2B2XH 3QAZB 1U3HB 2ZUUA 4H0HB 3OZ9L 4GRLB 5DD1H 1K6QH 4J8RA 3KPPB 1BIHA 2VXTH 2WWKO 3I02B 1S5IH 1MHPL 4N90E 4GJTB 2D03H 4B50A 1SJHB 3ULVF 4LPVA 5SV3A 2ADJB 4PY7B 3RPIB 5BXFA 4OLZH 1GGTA 1QRNA 1EZVX 4PRNA 1CL7I 5GGRB 3VXUB 2BY0A 7FABH 3ULVH 1KN4H 3RWJA 2EDDA 5HVHB 5HGDB 2VZUA 4OV5B 3R06B 4K7PX 2O5YH 4YAQB 2DN7A 1QZ1A 1FVCA 5GGRY 1ITCA 4WEMB 5DSCA 3WS3B 4YZFF 3RTQB 5T33H 4CL7A 4KV5F 5EA0H 2BCKB 2FGZA 3SKMA 1ZHKA 1XGUB 4HIHA 3SHSA 1ZAGA 3ARDB 2Y6SD 5F7EL 4GAJH 2VWEC 1CTOA 3RNQA 4M7JH 5I1IL 1NJ9B 1H3VA 1T22B 5TPWH 4X6FB 4WDIA 5K9OA 1WWWX 3MCKA 3DX6A 4WI2A 1R3KA 3SDCD 3K1KC 3MRIA 4Z95H 3L3HB 4NNYA 2XXCB 2PR4L 4AENA 1S7UB 3O11B 4P4RB 4XVJL 5HY9A 1BPVA 1AE6H 1PVHA 2QQLH 1EHAA 2VIRA 4PRHD 4LSQL 4JLRB 1GGYA 1T66D 5IQ9B 3QIWA 1K4DA 2NY0C 5F96L 3ILPB 3S34L 3FQUA 1Y0LB 3MZTA 4QXUL 4GBXA 4QHMB 3ME0A 3HUJF 4PJGB 4MGXA 3P73A 3S36X 4G42B 4RX4D 1HHGA 3RU8L 3SDAB 4MZ3A 2HWZL 4Y5XA 1R3HB 1DBJL 3MV8A 1WBYB 2R23B 1A7OH 2D31A 1BECA 1MUJB 1JUFB 5BS0A 1RZFL 1DQML 5E2VL 4TSAL 1FDLL 3QQNA 4EBQL 2AJSH 1FGVL 3SDDC 5HHQA 1WFUA 3U0TB 3FT3B 4KKBD 4RGMC 1FZOB 3QCTL 4QRRE 3FT4A 4GKSA 2CXKA 1HQ4B 4E0RB 3MX0A 3C5ZD 4CMHB 3EYQC 1DTUA 1RK1A 2YMXL 1S7VB 5E95B 4RAUB 5HI4D 4TQEH 2F54A 3G04A 4W68A 3D1MC 2NQCA 3C5JA 3C6SA 2WIMA 4X9HA 5AZEH 5D6DC 2E8YA 4WW2A 2D9CA 4XH2A 5F9OL 5DJCB 2G60H 5D7IB 3BKYL 4LRIC 4P9MH 4LVOC 1DQQB 4U6XA 5KOVC 5C3TA 5E2UH 1NGQH 3K0WA 3KYOB 2UY6A 4OFDA 4M6ML 1S9YB 4JDTH 1OD9A 4PJAE 3IDJB 1MCRA 3MGOA 4NQCE 1NAKL 1FO0H 3DUUB 1F8TH 4PRPD 3U7YL 5ACZA 4CMMB 3L3OA 3ETBF 4Z7UB 2FIKB 2GJ6D 3SO3B 3N0PB 1Q0XL 3WE6A 4OZGF 3D9AL 4IBLT 4KZDH 4MS8C 5T1KD 3X17A 3IU3A 5IEKB 3OKDB 2OP4H 3BP5B 4JPVH 6FABL 1DFBL 3QXDB 5DK0B 1BIIB 5C6TL 4PTUB 1OTUC 3HNSL 3IDNA 2D4DA 4XXCA 1MCJA 3QCUL 3OB0K 3HMWL 5LGHL 3QEGH 3W0WD 4GRMA 3CDCA 3KPLA 2GK2A 4NWUH 1U93B 5I8KL 3KPSA 4L5FL 1KLFA 1JWMB 2Z91A 3S37H 4XPHL 1M7DB 3KJ4B 3VCLA 4G6ML 1P69B 5M95B 3HC0A 1D5ZB 4JFEE 2IQAB 1FVDB 1IGTB 2OJZH 3EZJB 4W70A 5HHXH 3K46A 2JF1A 3OXRB 3VFTB 4X4MA 5CIPH 5GGVY 2E27H 1WJ3A 1GAFL 5IJVA 2R56L 1DBAH 3TBYB 3F7RA 3O2VL 2R0ZL 3TNNB 5FGCE 3QUYB 5C0CE 3HRPA 3O4OC 2XPGB 4KUCD 2OR8A 3EJZD 1KJ2B 2MJWA 3QEHB 3RDTD 1NKOA 2JELL 1KUMA 12E8L 5IKCA 1JPGA 2X1XR 1CK0L 5GXBB 5SWQA 5GZOC 5IVZB 1GIGL 4LPYA 3PWNB 4YUEH 2IADA 3TZVB 1I1RA 1M6OB 1Z9MA 4GT7A 4UUJA 4ZTPL 3MGTB 4ODVH 1QR4A 4CUCA 4PJ5B 2AEQL 4ZAKC 4JFEA 4MX7B 4GSDL 2P7TB 3MOAL 1NEZA 3WUWA 1WIPA 3TNMB 1RZ7L 4KTEH 1NCUA 4M9OA 1N0XH 5D1QB 3GJEB 1RV6X 4Z76A 3RAJH 1A6AA 4PJ8D 1L7IH 2FEEI 3OAYH 1X7QB 3MODL 4K7PY 4D0BA 4F2MB 1FNSH 2BJML 5EBMA 4NQSB 5D7JD 1KTRL 3P0YL 3GBMH 1H8NA 2ZOLB 1EAPA 1RPQA 1CXHA 2ADGB 4MCYB 4YDJA 4WU7B 1P4LA 5EG6C 1ZT4A 3GSUA 3UZVB 3MRJB 4TVPE 1YNTB 4DUVA 3K3QA 2FL5A 3C5SB 3LKRB 5AWNL 5E5MA 1JNNL 5EN2B 5MEQB 1JHLL 3T77B 2YD8A 4JRYE 2P8LA 3RIFF 1OAXL 4ZNEA 5BV7B 4HUVB 3GI9H 3NPZB 4EI5B 4H5SA 1CLYH 2HFGH 5KS9E 2FLRT 4ZFOB 4XP1L 3WSQL 4FQLH 1LO4L 5BZWB 5JHDD 1Q0YH 3UPCA 4KY1L 3GNMH 2L7UA 1IC5H 1M71B 4PJIA 5T1DH 2DKSA 5EZOH 1X6LA 5I15L 3V0WL 5DLML 1CDGA 2DM3A 4I48A 1V7ML 5I8OH 4J8RB 5BO1L 2FO4A 4TTDC 3SDXE 3WS6A 3VI4F 8CGTA 4YK4B 1ZT7B 3MV9E 5BXFB 1K6QL 2NY4B 2WQ8A 1A6ZA 4EDXA 1QRNB 4PRNB 1MF2L 2VLME 5CLTA 3RP1A 4UTAH 4WUKL 4EOWL 3VXPA 3HAEG 2LVEA 3RWJB 1GXEA 4OIBA 4IRSA 1KCSH 5AZ2H 4OLZL 4GFTB 1FVCB 4F7PA 1GZPA 5DSCB 5I1GL 1KN4L 2HTLC 2VDOH 3LPFA 1B88A 5D8JH 4LCYA 3SKMB 5EUKA 1ZHKB 2O5YL 2DYPD 4HIHB 1PW3A 3KPRE 3HC4H 3RNQB 3B9AA 4WDIB 5FM5O 2VTFA 5K9OB 2HRLA 4KUZH 1BVLA 3MCKB 3DX6B 3VWKC 4EXPX 1F4HA 1R3KB 4AT6A 2AJXL 5GJTH 3F7YA 3MRIB 4NNYB 1IAKA 3QCVL 2V7HA 4D9LH 4YFDB 4AENB 3LPGA 3QR2A 3HZYA 3NFNA 5HY9B 3ULVE 4FMFA 5CSBA 2VMFA 3FQTB 1BLNA 2VIRB 5DD0L 1NBVL 3HMXA 1S7RA 5DA4A 5K93A 1LE9A 3QIWB 5F1KC 2IQ9L 3FQUB 2AEPH 4GBXB 4V2CB 4XNUH 1XEDA 3P73B 4YZFE 1HHGB 2OXGA 4KV5E 1A6PA 1V3KA 3ARGC 3DVNA 4MA3A 2PO6A 4Y5XB 3SBWA 5IW6B 1YC7A 5E4IA 3MV8B 1OQOA 3JSSA 1KEML 5TQ0L 2D31B 3C2AL 1KXVC 2PUQT 2H2PD 5BS0B 1KC5L 5F72S 1PG7X 5T1LA 4Z7VA 3QPQC 5HHQB 1Y6KR 3U82B 5I1KH 1GGBL 1N7MH 3EYFA 3FT4B 1A7OL 4GKSB 3JV0A 4H0GA 1UFUA 3RQ3A 2L7JA 5F1IA 3NCBB 3HKFA 1RK1B 3GIZH 4NHUA 4G8GE 3FAXA 1KJ3H 2F54B 1CXKA 3G04B 4FP8H 3C5JB 2OSLA 3NH7H 1RZJC 2F5BH 3C6SB 4JO3H 4CNIA 1IILE 4WW2B 1ITBB 3NPSC 4JM2D 2HRPL 5FGSA 1I7RA 3VFNA 3WHXA 4XH2B 4TQEL 3AMLA 2R2HA 4NUJA 1DUYA 5EORL 4U6XB 25C8L 4X6DA 5JW4Q 5AZEL 2IAMD 1DDHA 3NZHH 3OX8A 3HUJE 3HI6H 5JQHC 2X4QA 5FYKU 2FHBA 1HYSC 1G9EA 5HPOA 5EZJA 4RGND 4R26H 3K81A 3MGOB 2NYYC 4P9ML 3A6BL 4MVBD 2I60H 5CD3A 1UB5A 3MLYH 5E2UL 5ACZB 3L3OB 1YY9D 5GSVA 4XI5D 3S98A 2AK1L 5D93B 1J0KA 3PQYD 1FO0L 3WE6B 1F8TL 4JFFD 1MCQA 3WNPA 3CSBA 1T21A 3MRNA 3OR7A 2OZ4L 5KAQF 3IU3B 4I77H 4NQEA 1JGUL 3QDMA 3VI3F 2YSSA 4NQDD 4R7DA 4ACPA 1C08A 5IR1B 3N9GH 5LQBH 3IDNB 3LQAC 2Y06H 4GRMB 3KPLB 2OP4L 1BP3B 4JPVL 3P30L 3ZDYF 3WKNA 3KPSB 3FZUD 1LQSR 2Z91B 1A7PH 4L9LC 1AGBA 3PP3K 3VW3H 5JZ7C 3IDUA 3RY6A 1RZJL 3QEGL 3SJVD 3VCLB 5A3IC 4NWUL 1K9TA 3Q5OA 3HC0B 4CVZA 1A21A 1QBML 4NO3A 3S37L 1T1XA 2EEBA 3KPOA 3UTSA 2N56A 3QDHA 1N4XH 5IJVB 1L6XA 4BUGA 15C8L 5DMGD 2OJZL 5HHXL 2F8XC 4O2CA 2XI9A 4U6HA 1QKZH 2Y9RT 2Y4SA 2R2BA 4M48H 5TDOA 5KSBA 1A2YA 1D5IH 2E27L 5ILTH 5TJWK 1DBAL 1SHMA 1ZA6A 4OZGE 1U8HA 1D9KC 2GFBA 5J1TC 2A73A 1JPGB 5SWQB 1JNJA 3MRFA 1PKOA 1YYMH 1OARL 4NN6B 3WNOA 3HLAB 4UUJB 1T20A 5IM7A 1LO0H 1P7HL 2FYYA 5LXGH 2YZ8A 1LEKA 4JFEB 1S9XA 3WDIA 4R6UA 3JTTA 3LQAL 1NEZB 4WY7H 4XVUD 4YUEL 3WUWB 2E3VA 1QPPA 3SE4A 1YEHL 5GGVH 3S9DB 4Z76B 1A6AB 1NBYA 3MV7D 5IHBA 5DI8A 4WIQA 3TN0A 4PJDF 1TITA 1IAOA 4D0BB 1JNLH 4M7LT 4AK1A 4WGWB 3KWWA 5I1JL 4KTEL 5EBMB 4PJHA 1EAPB 4ORZC 1CXLA 3PWPA 4YDJB 3E1F1 3OR6A 2XXMB 1P4LB 4Z18A 3B2VH 1JYVA 2VZVA 3MLSH 2YXMA 1ZT4B 2VERN 3GSUB 3MBED 2VXQL 3NIDE 4OT1L 4ELMF 1VPOL 4OTXH 5DC9B 4DTGL 5FYKH 2FL5B 3C87A 3THML 5E5MB 2FEDD 4X7FC 4XNZC 4MJIE 1JVKA 4PYGA 1U2HA 3LN4A 3KJ6L 5DT1H 2P8LB 4JO2H 4MAYD 4AIZA 4QXWA 4F9PA 1CGSH 3VXRD 4H5SB 1IKNA 5L6YH 3KS0H 4YE4H 5E2TH 3H9ZA 4NSKA 2EEDA 4NDMA 3GI9L 3A67L 5JQ6L 4K7PH 1AO7A 1CYGA 4XMPL 1JF5A 4RDQF 4PJIB 4MA8L 4NPYA 5IT2H 4HWNA 5B8CC 2AV1A 1UM6H 1Q0YL 4YC2B 5D71L 3QDAA 1F97A 5IBTH 1U3HC 3GNML 1RFDH 3LKPA 4I48B 4GRLC 1J11A 3RIAF 5T1DL 3HTLX 2L0DA 3AGVA 5C0IA 4MSWA 2KQNA 2FO4B 4PB9H 3VXSD 4KKAC 1FN4A 1KULA 4MJIA 2N7BA 3NGBB 3LSOA 3ISWA 1U36A 2VXVL 5M94B 3BH9A 1A6ZB 4EDXB 1EPFA 4YHKH 1BM3L 1CFQA 4FFYH 3VXPB 3WXWH 3B6SA 2DI9A 4ZPTA 3MLWH 1IC4L 1RJZA 5C0ND 4F57H 2YUZA 5HVHC 1ACZA 4QRPA 5T3XH 3GMPA 4ZSOA 4F7PB 4QRQA 1GZPB 4QNPE 5TFSL 4UTAL 1A5FL 3RTQC 1IT9L 4LCYB 2OL3A 4MYWB 1DQLL 5EUKB 1KCSL 5F44A 4ZOBA 1UJ3A 4ZXBA 1FYHB 5GRWA 3ARDC 2V2WA 4JKPH 4ODHH 1EO8H 2VDOL 4MNQE 3WV0A 3S36H 1KCKA 3MLUH 4Y4KD 3IRZA 1T03H 1INQA 4W6YB 1BVLB 4KJWD 4WHCA 1TCMA 1L4IA 1G7QA 3ARBA 4FNLH 4AT6B 1J1OH 5HI5D 3V8OA 5GGQL 1JTTA 3F7YB 1IAKB 2KQMA 2V7HB 3F58L 5ECJE 3VI4E 3HZYB 3NFNB 1D6VH 4G3YH 3ZKND 5EWIH 3MA9H 5EB9A 5C07D 1BLNB 3QQ4A 5DJ8A 3MUY1 1S7RB 4M9PA 1LE9B 4GG6A 1H8SA 1R6VA 2F53A 4F37F 3NCYP 4F33A 3RX8A 4N0CD 4L8BA 1IGYA 3O2DL 3S88H 3SDAC 3VFGH 3DVNB 4MA3B 2PO6B 2EDXA 4XBEL 3MRKA 2RHEA 2OTWA 5T1LB 2A77H 3EFDH 4Z7VB 2RGSA 1JGVL 4HUKB 4MMZC 2D7MA 4AL8L 3EYFB 2BVOA 3QIBD 3WLWD 4MHHI 1DVFC 1PYWA 5F3HA 4OLYL 5F1IB 2X9WA 5CZXC 2GIYA 3FT2A 1BJ1H 3HG1A 4U1KA 2ZJSH 4M43H 4NHUB 5I1KL 1N7ML 4V1DE 3CFJA 2J8UF 3RRQA 4ZFZA 4J4PA 2OSLB 1KFAH 3H9SD 4KMLB 4CNIB 3U9PH 5JUEH 1I7RB 3VFNB 5EU7E 3WHXB 3FCTA 5DVOA 1KJ3L 1DBMH 5BRZA 2R2HB 5IVXF 3HAEA 4LHUB 3CSGA 5IBLC 1U8JA 3FQXA 1DUYB 3PNWA 4NUJB 1KPVA 2F5BL 4X6DB 1MWAH 4AEHH 1DDHB 3OX8B 4L4TA 1AJ7H 2X4QB 4S1SH 2FNBA 3IGAA 3PXJA 5EZJB 3T3PF 3ZHKA 4GAFB 4ZUUA 1FFNA 3L3IA 1JRHI 2YPVH 1MELA 1UB5B 5SWZA 3ROLA 5CD3B 1WAAA 2PXYD 3HI6L 4U3CA 2Q1EA 5GSVB 3P4NA 3SO3C 4R26L 5F7HA 2C1OA 1SJXA 3BEWA 2I60L 5FKPA 3LEVL 2OYPA 3QPXH 5ENWA 1T21B 3MRNB 5JHLH 3OR7B 5IW3A 4YJZL 2FZ3A 1VKXA 2QKIA 1UB6A 4NQEB 5F6IB 3QDMB 1I8MA 2YSSB 4R7DB 1L6ZA 4AG4H 3FFCA 5LGJA 3H7BA 4L3AA 1QSEE 5J6GA 3CK0L 1S7XA 1TENA 2C3WA 2XTJD 3HC3H 4K8RH 1RIVH 1G9MH 5CKAA 1GRWA 1AGBB 3KJ4C 3MNZA 4G7VH 2DMBA 3VG9C 5FO9A 4WWKD 4D94A 2D7PA 4CVZB 4NO3B 1A7PL 1T1XB 1IQWL 3WIHA 3KPOB 3L6FA 4XP5H 3VW3L 4OLEA 3UTSB 4D8PA 4R7NA 3KPNA 4HCRA 2IGFH 1V8HA 3DYOA 3VH8G 5I30L 1WEJH 1OLLA 2H2SD 4O2CB 3U4EA 4U6HB 4FFVC 3QUYC 2R2BB 5TDOB 5KSBB 1A2YB 4S2SA 3RKDC 3ZSTA 4QRTA 1ZA6B 4HQQH 4XNXH 4QOKE 2GFBB 1QSEA 3DNKA 1T0PB 3FN0H 4OD1L 1FH5H 2A73B 3SOBL 6CGTA 3O9WD 2VDRL 4M48L 3MRFB 1D5IL 3MOBH 5I73B 3VI3E 3AAZA 1AGDB 3TZVC 1T20B 4G7YH 5IM7B 4ZYKA 4YFLI 4G9FD 2C7UA 2FYYB 3GSVA 1XIWA 1LEKB 2YPLA 2CH8A 1S9XB 3BMVA 4UINH 4NCC2 1YYML 2IH3B 4OM1H 4OLVL 3ZDYE 4HC1H 3JTTB 1LEGA 4M62L 1G7IB 3RBGA 5GRVK 4OLUL 5D1QC 4DQOH 1NBYB 4E41A 4L1HA 5DI8B 3TN0B 5LXGL 4K23L 1PQZA 5F1NA 1IAOB 4DN3H 2HJKA 1O0VA 5E99H 3ULSA 1MJUH 3KWWB 2C4FT 4PJHB 3ZSSA 4X7DC 4LPUA 5GGVL 3C09B 2IBBA 3PWPB 5F6HI 3OR6B 4LLAA 3ULUD 4OZGB 3VG0H 2R2EA 1RZ8A 5EZIH 3B83A 1A3RH 1RU9H 3BEVA 3MBXH 4JFYA 5DMIH 3TV3L 3QXTA 2G75A 3OKLA 3VWJA 5FKAA 2K1MA 2G5BA 3LN4B 2UYLA 1J9CT 4OTXL 4AIZB 3WO3B 4YR6A 3ZKSD 5BV7C 1KJ2L 2BSSA 1X6NA 5F70A 4EI5C 2BSTA 5SX4H 3JVGA 3RZWA 1PEWA 1DE4A 4NSKB 4P57B 5JW5A 5K33A 1EX0A 4ALAH 4NDMB 2C9AA 1AO7B 4XWGL 5MENA 3EYUH 1T2QH 4ODSL 5L6YL 4NPYB 2AV1B 1J12A 3LKPB 2OBGA 4PJDE 1RJYA 4WFED 4HFWA 5F9JA 1YN6A 5C0IB 1CGVA 2IANA 4MSWB 2O26U 3EOBA 3SCMC 1FN4B 5FYKE 4MJIB 3G08A 4UV4H 1XT5A 4RQQA 3C6LC 3LSOB 4YK4C 4ETYA 3BH9B 2NY4C 4QRSA 4ELME 4KJPD 5H2BA 3ET9F 3RWGA 1CFQB 1F3DH 3BDYH 4ZPTB 1RJZB 2RJMA 5DZOA 2BXYA 4OF8A 1CN4A 3FOLA 3OJMB 4QRPB 1DBKL 5HDLA 5CJQH 3GMPB 1AI1H 4QRQB 3DUSA 3WXWL 1RAMA 2X7LA 5LJYH 4GUPA 3MLWL 3Q6GH 2OL3B 5BV7L 2GTWA 1UWGH 4FQJL 1UJ3B 1WZMA 4ZXBB 2VDLL 1BQUA 5JMOC 1FGNH 2V2WB 4YX2H 5HHOE 3INUL 1ZEAH 2XT1B 4NKIH 4LCIH 4P4KD 1INQB 1NC2D 4JKPL 1G7QB 3ARBB 4ODHL 3IFNH 5AYQA 3MLUL 1PG7H 3TIDA 3OHXA 3QWQB 4TTGA 1T03L 1OLZA 4HUUA 4CDHA 2CO7B 2ICCA 3KNBA 4JQVA 2ZCHH 4XCFL 3QFJE 5MERA 3ARUA 2J2ZA 3QQ4B 1EVUA 5DJ8B 3RVVC 3N06B 4GG6B 3QIWC 5T3XE 1YA5A 5DD5L 1S7SA 5EWIL 4MJ5A 3D85D 1GPOL 4GBXC 3RGVA 4F33B 1Q9WA 4L8BB 1IGYB 5HHOA 2A6JA 1TETL 4R4FH 4NBYB 5T5FH 5BVJA 2BNQE 3MOQA 3J8F7 4J3VA 4Y5XC 4JANA 3MRKB 3BGFB 1J86A 1MHCA 5FDYA 1TQBB 4AY0A 1HINH 2OTWB 3R8QA 5AYUH 1NCWH 4DGVH 4X8JA 1H3XA 4Q9RL 3OKKA 4C4KO 2Z4QA 2BVOB 3H9HA 8FABA 5KZCB 2E9IA 1RZKC 5DXWA 3WO4C 1AQDA 5D96C 1PYWB 5F3HB 4GXVH 3FT2B 1ZA3A 4BM7A 1BFSA 3HG1B 1TJGH 4U1KB 4KI1A 1FNEA 1NANI 5CP3H 1IGCL 4ZFZB 3S3PA 1NMAL 5GS0C 2VQUA 1CFVL 2XQYG 4PRBA 3GHBH 4UT9H 4WW2C 3QQ3A 3FB8A 1FYTD 2P1YA 3FCTB 5BRZB 3HAEB 2VC2H 4S1DD 1O5DT 1U8JB 3FQXB 3PNWB 1KFAL 1KPVB 1YEGH 3ARSA 1UA6H 3N1GC 3PHSA 5DGQA 3OJDA 4L4TB 1BFVH 1QD0A 2XKUA 3IGAB 3WL9A 3MRGA 1FFNB 1TCRA 3L3IB 3ROLB 3O4LE 5SWZB 1AJ7L 3QEQD 4WI4A 3P4NB 2M2DA 2HLFC 3GKZA 4LCWA 4ZTOL 5D93C 5D4QA 2C1OB 3BEWB 4ISVA 2YPVL 5FKPB 4F7MA 4MB4A 1G1CA 5ENWB 1VKXB 2FZ3B 5JNYA 2QKIB 5TF0A 1W0YT 1EJOH 1UB6B 1I8MB 4I9WD 4M1GL 3ZDZF 2YHGA 4KKLC 4NRYA 3FFCB 2C3HA 1CGTA 5LGJB 3H7BB 3QPXL 4XXCC 1RZKL 3U7AA 4RA0C 3DGGA 3SGDI 4IIQA 1TTGA 5JHLL 5J6GB 2J8UE 4FXKA 1S7XB 4EIZC 3U36A 2IBZX 5E1HB 4NYLA 4AG4L 2KL6A 5FYJL 3MNZB 4QKXB 2X05A 5GS0L 2AJ3A 2FJFA 4EDWL 1MQKL 1DLFL 5IVXE 4P2QA 1H3PL 3HC3L 4WHYG 1RIVL 4AIXA 4FABH 5IB1A 1RUQH 4XCYA 1G9ML 3L6FB 4NIKB 4D8PB 4Y7MA 4R7NB 3KPNB 1FIEA 4G7VL 3T3PE 1WCBA 3IAPA 3IETA 3U4EB 1S7QA 1YMMD 1XGRB 2X4PA 4G6KH 4S2SB 2IGFL 2XN9D 3IFOA 4QRTB 4PJBA 3LPWA 4PUBH 4JRXD 2R29H 4JFDD 1QSEB 4LGSB 4XCCL 2W9DH 4YXHH 3AAZB 5L2KE 1IM9A 4XNXL 3R1GH 4NN6C 1UM4H 4JM4H 4ZYKB 3P9WB 5IBUG 1RHHA 5FV2A 2C7UB 2YA2A 3GSVB 1XIWB 2AJZA 2CK2A 2YPLB 4MNGE 3QUKA 2X1OA 1LEGB 4UZGA 4F7EA 4G7YL 1BJ8A 2DQIH 5E9DA 2IWGA 4YDVA 5FHAH 4E41B 2Z8SA 4OUOA 4UINL 5IB4A 4DGIH 4OCYH 1PQZB 5F1NB 2A74A 2LV4A 2NX5D 5JXAL 2HJKB 4FQCH 3ULSB 2FGWH 3MPCA 1CD0A 2EIEA 4DQOL 2WIIA 2A9MH 3OAZH 3BZ4B 3T0BA 2IPUG 2A6KA 4I2XE 1BREA 1P6FA 1U8NA 4XNYH 4YQXL 1TZGH 1RZ8B 2R2EB 4DN3L 4FTVA 2CRYA 3PJSA 1MJUL 4Z5RB 2ENSA 1EHNA 3BEVB 4JFYB 1I3GH 1FORL 2G75B 5JIIA 1PEZA 3OKLB 3QDGA 1FFOA 4RZCA 4H25A 4NP4L 4YHIA 3O6KL 3VWJB 3VG0L 5E6IA 5FKAB 2G5BB 1BQSA 2UYLB 3VFOA 4JGMA 4M5YH 1A3RL 4YR6B 3MBXL 3SDDD 5DMIL 2BSSB 5KVEL 3KGRA 2AABL 4TUKH 2BSTB 1ZGLA 2QQNL 3EIFA 1DE4B 5D5MA 5DHVH 5JW5B 3EYQD 3P11H 4LLQA 2X4TA 5DQJA 4MXVF 4XPGH 5MENB 4Y88A 1NAMA 1YPZA 5DRXA 3TPUA 4GRWB 4HAGA 1BEYL 3VFPA 4NZUH 4RFEA 5HHVH 4YC2C 3MRMA 3RVXC 1ZSDA 2GT9A 3FQNA 5GS2H 4DFHA 1T89A 2LE9A 4L4VD 3EYUL 1RJYB 4HFWB 5F9JB 1YN6B 3CVIL 4X80H 5SWSD 2IANB 4UOJA 2E7HA 3EOBB 4G8FA 3ALWA 3VH8A 3G08B 4RQQB 3NGBC 1QSFE 4C58B 4QRSB 5H2BB 5DRWA 3RWGB 3BN9C 4P9HH 2NY3B 2Y36L 4YWGL 5FYLD 2VE6A 2QHLA 3LHPL 3GM0A 4PD4K 4OKVA 4OQTA 4P2RA 4OKDA 4IRSC 3FB7A 3FOLB 1MFDH 3LZFL 3DUSB 1DP0A 1YN7A 4MS8D 2X7LB 4GUPB 3MREA 4RWYH 1OGAA 1WT5A 2J4WH 3UTTA 2DQCH 1OTUD 5L8LB 2VLRA 2VR5A 5KVMC 2ORBH 1U0QA 4ZQKA 4U33A 3Q6GL 1CICA 4N0RA 2I9TA 1VGEH 4U0RB 4M7KL 3ZDXF 1FGNL 2QHRH 4NC1E 4YX2L 1AKJD 3BVNA 2B8OT 3TIDB 3OHXB 2QBWA 4LCIL 1JPSH 2C26A 4HUUB 3KNBB 4HF5L 5MERB 1PG7L 2PTTA 2MPAH 3RHWK 1S7SB 4FQXA 5HYQA 3FTGA 4MJ5B 2XQYK 3RGVB 1XGYH 1I9EA 4ETQA 1Q9WB 1L9MA 5HHOB 3RJDA 2A6JB 2YKLL 3TH4T 4Y1AE 5HXMA 3MUHL 3NTCH 5GZOD 1Q1JH 4PJFF 2XKSA 4X0KA 2PO6C 4JANB 3SBWC 1DEEA 5GSRA 3ROOA 1MHCB 2Q7YA 2DIJA 3RUGF 4BQ6A 4D3CL 2FX7L 3O6LL 3GO1H 5KTEH 4ZAKD 4WO4A 1T2JA 1WWCA 1E6OH 2Y72A 1J1PL 4U1MA 4X8JB 3OKKB 5MI0B 2Z4QB 3H9HB 8FABB 3DXAD 1W8OA 3CZJA 1AQDB 3BZEA 5EBGA 1CT8A 1ZA3B 5F7KC 2EDJA 1FNEB 1TJHL 4FQIL 2DKMA 1MREL 3OG4B 4PRBB 2UWEF 3QQ3B 1TJGL 2W9EH 5FA4A 2ZG1A 4C56D 3IU4H 3HMXL 3SGKA 1B4JL 5J13B 3OJDB 4IOSD 4PJCA 3UTQA 5CZVH 3BKCH 1C12A 3MRGB 4JO1H 1HH9A 2NY5H 1YEGL 1TCRB 1UA6L 2Y5TA 1A14H 5IEHA 1UEYA 2IMNA 3LKQA 1C5BH 4FXGA 2H26B 1OVZA 4IDLA 5GZNC 4LCWB 4F7MB 4ISVB 5L8JB 2E6PA 4XB7A 3ES6A 5JNYB 2FJGA 1ZK9A 3QUZA 5F6IC 3HFMH 2FLBT 1J05A 1RUPH 5F9AC 4NRYB 5EZLA 2E8ZA 4BH8A 3DGGB 4IIQB 1IC1A 3DX8A 4TTDD 3P77A 4FXKB 5EOCJ 1EJOL 3U36B 4Z8FH 5JXEA 1KB5A 4M4PA 4NYLB 5C0AA 3T2OA 4QWWC 2FD6H 5B4MC 3S35X 1CF8L 3O3DA 4TVSa 2DQUH 2HFEA 2AJ3B 2FJFB 3EOTL 1QLEL 4P2QB 1I75A 5IB1B 4OGAC 1XCTA 4XCYB 4HJJL 2VOTA 1MI5E 3BP7A 5FV1L 2OTPA 1WCBB 2HTLD 3O6MH 1HHKA 4PRID 4ONOA 1RUQL 3IETB 1HH6A 3MYZA 1S7QB 2EDYA 3LV3A 1G1YA 2CUMA 2X4PB 2ZUTA 3ZL4H 3ZTNH 2IPUK 3IFOB 4HPYH 1PSKH 4PJBB 3VXME 3RWIA 3ZT5A 5C0BE 4P3WA 1EBAA 5E8OB 1G6RA 4X9FA 3VD7A 2EDFA 3MXWH 5GHWL 1CDHA 4UNUA 5CINL 3NCYS 3VWKD 4Q74A 4KXZH 4UI2A 3V4UH 1IM9B 3ZDZE 5EDXA 5I73C 1WSST 4I0PA 3ARRA 5CILH 1RHHB 5DWUL 4K7FA 2VLKD 3QUKB 1MJ8H 2YUVA 4LAQH 1YNLL 4KKCC 1YEJL 2WWMC 4F7EB 1UM4L 3SE4C 1X3DA 1U8LA 1OP5H 5E9DB 5CBEB 4NO0D 5IB4B 3TN0C 2A74B 1MRFH 1X4ZA 1BFTA 2DQIL 4UNVA 2WIIB 5FHAL 2A6KB 4DGIL 1U8NB 1LGVA 4FTVB 3MRHA 4FQCL 3PJSB 3ARGD 4POZC 3RWEA 2A9ML 5L2KB 3QDGB 4RZCB 1FFOB 4YHIB 4H25B 5E6IB 2YC1A 1TZGL 2OI9B 3VFOB 3QPQD 3L3JA 3OPZH 1T80A 1FL6A 4F9PC 3CFCL 3LEXA 4UBDC 1ZGLB 1IKNC 3VGBA 5MP6H 5DMYA 3P9LA 4PBXA 3IKCA 1FSKB 3JWDC 4LLQB 5C9KA 2X4TB 5DQJB 5BMFH 4MAUL 5CS7A 4F8QA 1NAMB 1YPZB 5DRXB 2HJFA 3TPUB 3VFPB 3P11L 3F5WA 3CUPA 3FB6A 3MRMB 5E5RB 4K94C 1ZSDB 4J3UA 4P0DA 2GT9B 4DGYL 1EK3A 4G6FD 2O5ZH 9CGTA 4WI8A 5ICXA 3L3KA 5HHVL 2CMRH 1GC1H 4G8FB 5DJAA 1HYSD 2FIRT 4TPRH 3VH8B 2ICWI 4HKJA 3QUXA 2DTML 1IE5A 2NYYD 5C08A 5AG8A 2GSGA 3JV6A 3DHMA 5DRWB 3AMKA 2LU7A 5TGBA 2VE6B 3VXTA 1NEUA 2X5PA 4OKVB 4P2RB 4C83A 3GK8H 4YEEA 4EVNA 4U1JA 3FB7B 3LIZL 3BJ91 1YN7B 1OHQA 1YY8A 1FBIL 4KRPB 3GSNA 5T5NF 3MREB 4G6JH 4XPBH 1OGAB 4FZ8L 2GY7B 5EU3A 1YEDA 5F6HJ 3WNKA 5SX5K 4OCWH 4QYOA 1MFDL 1UJ3C 4ZXBC 1MCBA 3UTTB 2VLRB 3DO7A 1NCTA 4Y19D 4ZQKB 4MXVE 3JWDL 2I9TB 2YN5A 2J4WL 1ZLUK 2DQCL 4L8DA 3CFBA 5JZ7D 2WUBL 3BVNB 3ARBC 5A3ID 2EKJA 2VLJE 1QSFB 4U1SA 4K94L 4LSSH 4XGZA 2JCCA 5HVFB 4J6RH 3EYSH 1ZANL 3NABH 3T4AA 4I5BA 4EJ1C 2X89D 3K2MC 5INCA 3BRDA 4MDJA 2J3SA 4M1CC 4UTBH 2PTTB 4Y2DA 1K2DA 5CKGA 1KCUH 2PYEA 4D9QD 4RFOL 3W2DH 4FQXB 4JHAL 5HYQB 3O3EA 3FTGB 2VDQL 3ELAT 1YYLL 2E7LA 5I17A 2BNRE 4Z7WF 2ZCLH 1D9KD 4X7EC 4ETQB 2H45A 1J8HD 4NOBA 4RMRA 3L1OL 4PGEA 4XP9H 4X0KB 2Q8AL 1DBBH 1W72A 2Z8WC 3LD8B 1DEEB 5GSRB 1XGYL 3ROOB 3V5DA 3BGFC 2FECI 2AJYL 2Z31A 4NN7C 2Q7YB 2OL3L 2N7AA 1TQBC 3NTCL 5F7LB 1WGOA 5JOEA 4WO4B 4WFGE 4OZIF 2DI7A 5DTFB 5JW4N 4U1MB 3MO1A 1F45A 4M6OH 3ZDXE 3SE3A 5DZNA 3LOWA 1WUNT 3UJTH 3BZEB 5KTEL 2P5EA 1MCWW 1Z9LA 2R4RH 1CT8B 2ICES 1E6OL 4Q9QH 3WCYA 3F62A 3IDXH 5K9JH 3FAWA 1CXEA 1KACB 4J4PC 1N5YL 4XPTH 4PS4H 1EA9C 3CLFH 5FA4B 3P4LA 5ELIA 3HPJA 3ZTJG 3UJJH 3RZCA 4PJCB 5DRZA 2E7CA 4HUMB 3UTQB 5D72L 3C2SA 1C12B 5EU6D 4PJEA 2EZ0C 3E3QE 5C09D 1HH9B 1MY5A 4PJFE 3I85A 2Y5TB 4JY6A 5IEHB 3RA7L 3LKQB 3O3BA 2Q8BH 4JDZA 1MRDH 4FXGB 5CZVL 2IFGA 3T0AA 3RUGE 4JO1L 3RVTC 4K3HA 1F4WH 4GW1A 2AKRA 1QBBA 3OF6A 1A14L 1KIUA 1OGTA 5BJTA 3ES6B 2FJGB 4IOIA 4J23A 1U3HD 3QUZB 3SKUD 2XQBL 4S0TD 3EO9H 3N1FC 1J05B 4GRLD 5EZLB 4BH8B 2E7MA 4UT7H 2KUTA 3DX8B 5D7LA 5F21B 4Z9KB 1LO5B 3P77B 4JDVA 4KKAD 4Y5VA 1KB5B 5C0AB 3V5HA 2UWEE 3GKWL 3JV4A 1ADQA 4PV9A 3O3DB 5CFHA 3SQOL 3W11C 2Z92A 2HFEB 2VAJA 2VNCA 1IJ9A 3CX5J 5C6WH 3PDGA 1NUNB 3OKEA 3U7WH 4OZFB 3VXUD 4Z8FL 1R24A 4PLNC 1JNHA 1MCWM 1RI8A 1XCTB 3UJIH 3ZLQC 1GGCH 3OKMA 2DQUL 1VHPA 2XFXA 3BP7B 1N5AA 2UVEA 4X6BA 1HHKB 1SVZA 3RTQD 3Q6FA 1HH6B 4MJ6A 3UPAA 3LV3B 5BW7A 5ADOH 3ARDD 1RIUL 3RWIB 2BDNH 5I1CH 1G6RB 4UV7H 5DDHA 5GRZA 3TT1L 3ZL4L 5GGSA 4G5ZL 4HPYL 2GAZA 1PSKL 4H1LG 5J0BA 4I0PB 4Q0XL 4I4WA 2LU4A 5JW3H 1NMBH 4K7FB 1XIWC 3MLZL 1E4XH 3WLBA 4LSUH 3KDMA 5CILL 3MLXH 5C3LD 1CWVA 3DJ9A 1U8LB 3K8KA 5FUOL 3GHEL 4PRHE 2BY2A 3D69A 4JM2F 4U7SA 3W9EA 1BOGA 3V7MA 2GSIA 3JUYA 2M8XA 4XVTH 5IQ7L 3TO2A 1CQYA 3TM6A 4HPOH 4NJ9L 5ICZA 3WIHL 4M61A 3MRHB 2DJUA 3SDAD 1ZTXL 1K3ZA 2W60A 3RWEB 2B20A 1KN2H 3VWJC 2YC1B 4OI8A 3MYJA 2BVPA 5DZLA 1AD9A 3L3JB 4OFVA 1FL6B 3LQMA 2VZSA 2V9TA 3P9LB 2D2OA 3JVGC 3IKCB 1DVFD 3D39D 3L3GA 2H6PA 1FLTX 1HSAA 5CZXD 5I19H 1R5WA 3OPZL 4NM8H 1NKRA 5DF0A 2HJFB 5MP6L 2C5DC 4APQC 1NLDL 4LBEA 3F5WB 3FB6B 3CUPB 5D70H 4TNWK 4CW1B 2WUCH 3PABA 4NFCA 5ICXB 5IBLD 2CLRA 5F9WB 4DUWA 3DHJA 4YDIL 2NXYB 4CJ1A 2WBJA 5DJAB 3KPQA 1DJSA 4HKJB 1U41A 3QUXB 2O5ZL 4RBPK 1EEYA 1OTTC 3T0EA 4P5MA 5C08B 4KK5C 2CKBA 3JV6B 2HKHH 1RUAH 4PRPE 2C1PA 2NY3C 5TGBB 3VXTB 1S8DA 5HDQH 4CU8A 4Y5YA 2R4SH 4C83B 3HE7A 4LDOB 2GJ6E 5DURB 4FQ2H 4EVNB 3JBG7 4U1JB 4Y4HA 1T7WA 3C5ZA 1YY8B 1KENH 3GSNB 1I8IA 3W82A 3H3PL 3GK8L 5ACLA 5EU3B 5E94B 1YEDB 4HZLA 5DJYA 1L7TL 5IBUB 2Z8VC 1P4BL 4QYOB 1M7IA 1KTDA 5TQ2H 3SE9H 4XPBL 2F74A 43C9A 1P9MA 2CSPA 3W0WE 1MRCH 1KIQA 3AM8A 2FJHA 4OCWL 4L8DB 1C7SA 1KIPA 3O8XA 1QFWM 3D3VA 4J12A 7CGTA 4U1SB 3IFPA 3HE6A 4XGZB 2VH5H 2JCCB 4H8WC 5C0DA 1YQ2A 2DQGH 1QQDA 1TNNA 3T4AB 4I5BB 4DKAA 2RIKA 2NY6D 5FO7A 4JQVC 1EHLL 5D7SH 5INCB 3T2PA 2DLGA 4XVSL 4MDJB 1B6DA 4XPAH 4XC3L 4Y2DB 5FUCC 3EYSL 4FFVD 3QUYD 3NABL 1K2DB 3QWOA 2PYEB 3TYGH 5C0RH 1AY1H 3RKDD 3O3EB 1KIRA 5I17B 2IEPA 3RGVC 4JFOA 2PW2A 1KCUL 2Q6WA 1WZLA 4PGEB 1SY6H 1W72B 4PJ7A 3TZVD 3X3FL 3V5DB 2Z31B 1F02I 3LS5H 4PJ5D 2X9XA 3MRPA 4Z0BH 4XAKD 2BERA 1KB9J 3ZZ1A 3MO1B 3EO0A 3SPVA 3BRFA 5D1QD 2DQHH 1ACYL 2P5EB 4YHZL 4NZTH 3BYTA 1KCVH 1KG0A 4PJXA 4M6OL 3BIKA 1A4KA 4H8WL 5BQ7A 4E5XA 4OM0H 5HHMB 3BT2H 1G7LA 3IDXL 3F8UB 3HPJB 3P0GB 2GJZA 1SEBA 3RZCB 5DQDH 5J13C 4I1NB 4LEXH 5DRZB 4Z7WE 3BPCA 4X6CF 1UJTA 5EC1A 4YDKH 3U0WL 4PJEB 4N0FA 4EI5D 2FBJH 5DR5L 5J11C 1EUTA 4JY6B 4EUPG 1QR1A 1CCZA 3O3BB 3MC0A 4WI7A 4JDZB 1CR9H 5JHDE 3UYRL 4GW1B 5GRVL 2AKRB 1HIML 4OZIE 2MFNA 5FECA 1OGTB 1RIHH 5BJTB 2Q8BL 4X4XA 1FVEA 2HP4A 4HJGA 4IOIB 3RL1A 1F4WL 5J89A 2BRRH 1WC7A 1GHFL 3GGWA 4NZJA 5L2JA 1HKFA 1AR1C 5D7LB 4IIQC 4JDVB 3SCMD 3EO9L 4Z7OF 3BO8A 3C6LD 3V5HB 3JV4B 1HI6A 1CE6A 2NY4D 4O9HH 2Z92B 1QRND 2X1QA 3LRSA 4F15C 2OXHA 3OKEB 4DKDC 1XR9A 1R24B 1JNHB 1I85A 5GRXG 1CDBA 3HI5L 1OAUH 2XFXB 3MUZ1 2HG5A 1Z9OA 1N5AB 4PGBA 4X6BB 4HK3J 1A7QL 5FAAA 3Q6FB 4MJ6B 4HH9A 1GGCL 1UXWA 4LP4A 4OD3H 2M26A 2AQ1A 3QRFM 2CGRH 3O6FA 4X7SH 3MJ7A 5J6HA 4UILL 1SM3H 5DDHB 1FG9C 4HGMA 1UQSA 5GGSB 3BN3B 1F4YH 2GAZB 4OZHA 3GJFH 2X4SA 4I4WB 2M1KA 3RL2A 3MJ8A 3WFEH 4XMKH 1XFPA 4P23A 3PV7A 4OF7A 3WLBB 3KDMB 1U2CA 2NTSP 3DSNA 2PF6A 1F58H 3RVVD 2CRZA 2Z35A 4F9LC 3D69B 1JPFA 32C2A 3QIWD 3ORJA 1J10A 2K3TA 1BOGB 1N64H 2VXSL 4GBXD 3TO2B 1Z5LA 3X11B 1A7RL 1ES0A 1BQHG 4U1GB 4NUGL 5ICZB 4M61B 3TT3H 3M8OL 4LQ1A 4X9BA 3C08H 4MHHG 4XVTL 1QBLH 3P4OA 4UAOB 3L5XH 2W60B 5EOCH 4DVRH 3MV8D 2JLLA 3MYJB 5E6IC 5BS0D 2OI9C 2DQJL 2BVPB 1AD9B 4YNYA 3SGEH 3VRIA 1SEQH 1TVDA 1KN2L 1BBJA 2ZPKH 4DKFL 3D87B 1M4KA 1MCOH 3L3GB 2H6PB 1JZ5A 1FSKC 1HSAB 2VZTA 1VFAA 1R5WB 1K5NA 1C8PA 3VFMA 1YEKL 2YRPA 4RFNB 2ATKA 5FYJD 4FMKA 1VADA 2F54D 2R0WL 5GS0D 3CD4A 4GS7B 4LBEB 4N8CH 5I19L 4NM8L 5L8KB 1QYGH 2J6EA 3V7AG 1UWXK 2CDGA 3LN9A 1T89C 3T4YA 4UQ3B 3PABB 3QXUA 4GKNA 1J5OL 2CLRB 2CR3A 1EFQA 2LTQB 2WBJB 3KPQB 3UZQA 2WUCL 3DVFA 1EEYB 3BWAA 3BMWA 4JREB 4P5MB 3T0EB 2CKBB 4PFEA 4RGNE 1HILA 1RUMH 4LNVA 5J06A 1X5FA 1QA9A 4J1UA 1URLA 2C1PB 1WBXA 1S8DB 2HLFD 4Y5YB 4RCAA 3HE7B 4YDLB 4Y4HB 5EOQH 3C5ZB 4AIOA 1RUAL 2APFA 5HGHA 2GITA 3PQYE 4OCXH 4JFFE 2CDFA 4H1LA 4KTDH 2R4SL 2YD7A 4HZLB 4HKBB 5DJYB 4BSJA 1WT5C 4KKLD 1M7IB 4NQDE 3OWEA 4JN1H 2NZ9C 3DBXA 4D2NA 1KENL 1KTDB 4S1RH 2F74B 43C9B 1CICC 1LO2H 1EAJA 2HFTA 1WV7T 4MQTB 2DQDH 1KIQB 3KPSD 2FJHB 5SX4I 4PBWD 1NAML 2WAHA 1KIPB 2OX5A 3DO3A 3O8XB 3OKYA 4ODUA 3D3VB 1V05A 4WUUD 3IFPB 1NH6A 1WVZA 3HE6B 3SJVE 4A2LA 1MVUA 5C0DB 1UCBH 1CVSC 3RI5K 1MRCL 4CRPA 4O00A 1KYOJ 1QQDB 4S0SD 1A3LH 5FO7B 4DEPB 5DJDA 1MPAH 5TE7L 3ULUF 2DQGL 3X3GL 2IPTH 3QWOB 1QLRA 1DANT 2DQEL 1MCFA 4FQXC 1KIRB 4OZ4A 3ULUH 2ZUYA 5IV2A 4XPAL 4WENB 2AK4A 3O2WH 4JFOB 2YK1H 4J3OC 2PW2B 2Q6WB 4ZFGH 4Y16A 1AY1L 1MLBA 1RMFH 4YFLF 2BFVH 3BPOB 3ALXA 3NFSH 2ICWJ 5DK3A 5HYJA 3LD8C 2QSCH 4PP1C 3BD4A 1HNGA 1F4XL 2PN5A 4Z78A 4YXLH 3SJVA 5IB3A 1V5JA 4WO4C 1JWSA 4HWBH 1RUKH 1F3RB 2APBA 1TZHA 2D7QA 1QNZL 3EO0B 3SPVB 3LS5L 1IVLA 1KTKE 2B0SL 2YN3A 4WV1A 3MV7E 1RK0A 4PJXB 1NCDH 2UZIH 3BIKB 4NQVA 1A4KB 3WXVH 1AC6A 1IZJA 4AJ0A 2XZQL 5BQ7B 2XKNA 4E5XB 1GOGA 3M17A 4NZTL 4XAWL 1G7LB 4NJAL 4HWUA 4PG9A 1JI2A 1KV3A 3SKNA 2GJZB 1SEBB 3GB7A 1LK2A 3SGKC 1CIDA 3AS1A 3BT2L 1WICA 2DIAA 5EC1B 3HRZA 4N0FB 1JPTH 4U6VH 1FP5A 3DARA 3VXRE 2YR3A 4AEIH 1QR1B 5D2NE 1T5XA 3S35L 1NCAH 3DOSA 4YDKL 3UBXG 5J12B 1CZ8H 2EXYC 3QUMB 4O51A 5DS8A 5J7CC 4JO4L 4Y1AD 3FO0H 5FECB 3GRWA 4A2MA 4X4XB 5CLWA 1FVEB 4HJGB 3RVXD 1CR9L 3RL1B 4KQ3L 3QUZC 3I3EA 5TE4L 4RRPG 1WC7B 5L2JB 3GGWB 2GY5A 1LP9A 4NWTL 3VD4A 3TH3T 4YBHA 3VXSE 4CKVX 1OL0A 1R3IL 5L9DH 5JXEC 4XXDA 3BO8B 2VUOA 2ZSVA 1HI6B 1CE6B 1H3GA 3FFDA 3LRSB 3BN9D 3ZHDA 3DSFH 3I6LD 4WJ5A 1XR9B 2VL4A 4IRJC 5FF6A 5I71B 2AEIT 4IRSD 3UAJC 3MJ9A 5FHBL 4X6CE 2HG5B 4GQ9L 3VA2C 4OZIB 3IDGA 4PGBB 1QFUH 3BIBX 1I3VA 4HH9B 4I3SL 1UXWB 1LEIA 1I7UB 1YUHA 1OSPH 2AV7A 2DL2A 3BPNB 3O6FB 3QIUA 5KANI 1S3KL 2XZAL 3GFUA 1A6UL 4JJ5A 3MJ7B 2A2QT 5J6HB 4HFUH 1G7HA 4OD3L 4HBCH 1KSRA 1UQSB 2EH8H 3ARZA 1NQBA 4A6YH 1K85A 4OZHB 1TPXC 2IG2H 2X4SB 4X7SL 2DBLH 3AB0B 1I1AA 4NO5A 4I0PC 1NGXA 5ESAA 3RL2B 3FRUA 4LPWA 3MJ8B 1NLBL 2W38A 5B3NA 3OZ9H 4P23B 1V3MA 1F4YL 3QHFL 3QYCA 1MHPH 5JLZA 1E6JL 4G9DA 4LPXA 4NNXA 5C07E 1KB5L 5FGRA 2Z35B 1JPFB 32C2B 4OFPA 4XWOC 4PRAA 1NCBH 5DVNA 1KCRL 1G0XA 1Z5LB 1PY4A 2ZUQB 1ES0B 2KDGA 2P43B 4F7CA 1UT9A 3V6OE 1N64L 3DETC 4GAGL 4EUPA 5CEXA 3P4OB 2PO6D 4KHXH 3VDBA 5L2KA 1MQ8A 1ZS8A 5ID0A 4JGJA 1MJJA 1NC4D 3BQUA 5T1LD 3CXHJ 4YNYB 3VRIB 5F7EH 1ZHBA 4AZ8A 4DVRL 1BBJB 1WZ1L 5FUZL 5I1IH 1HQRA 3SE8L 5MHSD 1VFAB 2D0GA 5KW9L 1K5NB 4KK8C 5KJRL 1SEQL 4XT1C 3VFMB 2P5WA 2ATKB 1A3QA 4WI3A 1NANH 1VADB 2ZPKL 2F8OA 1MCOL 2ZZUT 3V52H 5J8OA 5I9QC 1BVZA 3KVQA 2PR4H 1KLUA 2EDHA 3H9SE 1U8QA 2CDGB 1RSFA 4LSDA 4X7TA 3T4YB 1YEIL 4GKNB 1HZHL 5F9WC 1ZLWK 2NXYC 1QYGL 1S7UA 4M93B 5F96H 3S34H 3JV5A 5DJ0A 3ARYA 3DMMA 3QUXC 2P46B 4QXUH 4HH8A 4LDLB 3TBWA 1C16A 1HILB 5GGTA 1DN2A 1V3JA 1QA9B 1BD2D 3LMJL 4J1UB 1CD1A 3UZEA 3N50A 1WBXB 3RU8H 1U8KA 2HWZH 3N1MC 1AQKL 5GZND 1M7XA 3IT8D 1DBJH 2F15A 5HGHB 2GITB 1RZIA 5FCUH 4KJYA 2CDFB 4MCZA 5IFHH 5KVFL 4RGOH 4H1LB 1FDLH 1PKQE 4EBQH 4MQSB 1FGVH 4NQED 3QDMD 3F7VA 4GG8A 5EOQL 3QCTH 3DBXB 1JUFA 3G6JF 5IB2A 4KTDL 3NZ8A 3MNVA 3MZGB 3B8YA 4JVUA 3KXFA 1ZWIA 1U42A 2XTJE 1E28A 4QWWD 5B4MD 4ODUB 4JN1L 2OS7A 1D5BA 2VDKL 4S1RL 3ZE2F 3V8CA 1MVUB 2C3GA 2DQDL 4OGAD 3U48A 1E0OB 5F9OH 1IEAA 1BQHA 3UTSD 3W81A 1YEEL 3M07A 3BKYH 3QNYA 5DJDB 1JFQL 1NGYA 2FX9H 3TGXA 3U0PA 5CHNA 3KLDA 2NMSA 1QLRB 4WTZG 1A3LL 3WD5H 1NAKH 3PWVA 4IJ3C 4TNVK 1MPAL 1NCCH 4OZ4B 1ED3A 1K8IA 1ERNA 3JTSA 5IV2B 4WEBL 2E7LC 4XP6L 1I1CA 2AK4B 4BZYA 3FL7A 2LABA 2A0LC 3W5NA 2JJUA 4Y16B 3WN5A 1MLBB 1Q0XH 5K9KA 5JO5A 3TJEH 3D9AH 1JZ4A 2CUHA 4OGZA 2Q3AA 5HYJB 3OAUL 3O2WL 3GSNL 2YK1L 2Z31C 4NGHL 4Z78B 4ZFGL 3SJVB 1DFBH 4G9FE 6FABH 5IB3B 1JWSB 3HNSH 2Q76A 1KJVA 1CS6A 2WWMD 3QCUH 1N6QL 3HMWH 1TZHB 5LGHH 4LGPB 3SE3C 5I8KH 4FG6C 4OLWH 4BQBA 4YXLL 4L5FH 3TN0D 4XPHH 4WV1B 1AFVH 1RK0B 4Z7QF 3QI9C 4NQVB 4HS6A 4KI5C 4OFIA 1KELL 3PWPD 5EUOA 2XKNB 3M17B 2K7QA 3VGFA 5HJ3A 3ULUE 1NCDL 1A7NL 2UZIL 4POZD 3WXVL 1IEBA 4PG9B 2R56H 3L7FA 3GB7B 1LK2B 2QTEA 3O2VH 5E4EB 3HNVL 5E8EA 3RZCC 3L9RA 3QDJA 1P4IL 3RVUC 4Q9BA 2OR7A 3HRZB 4FS0A 2EXWC 4OSUH 5FYLH 4UBDD 4U4BA 3VRJA 12E8H 1ZGLP 1MCNA 3QRGL 5CWSA 1T5XB 3VU2A 1MIML 5B38G 1GIGH 4O51B 1W72L 1AO7D 5DS8B 4U6VL 2ZUVA 1DQDL 1VFUA 3DVIA 4AEIL 3EDJA 4KGJA 4DOHE 1NCAL 3MRBA 4N0YL 3ESUF 4GSDH 5EBLB 3MOAH 5ISZA 5JTWA 1RZ7H 1OPGL 3FO0L 4ZUSA 1HEZA 4LCCA 3PIQA 4F80A 4XBGA 4WFEE 1LP9B 1Q72H 4AEFA 4W4OA 5D2LF 2YUXA 4Y5VC 4XXDB 1ODAA 2WW8A 2ZSVB 3P0YH 4HEME 3FFDB 4N5EC 4EXKA 2FX8L 2CXGA 5HDOA 1YC8A 4WJ5B 4JJHA 5L9DL 1H3WM 1BJMA 1JN6A 5IMKA 4LLVA 2NPLX 3QXAA 4L3CA 2E9WA 3BDBA 3I3DA 3NCMA 3IYLW 1JNNH 4QRPD 4KROB 3TYFA 2DMKA 3IDGB 5F9DC 1JHLH 3Q2CA 1OAXH 3OGCA 4XHJC 5L7XL 1WISA 3WFDH 4HK3N 3GMQA 4N9OB 2AV7B 1FNGA 1YUHB 4HSQA 5DRNA 5ESVA 1LEIB 5BW7C 4ZXBD 2YRLA 3QQ9C 4XP1H 2JJWA 3QIUB 4JJ5B 1G7HB 4KY1H 2AEWA 5J3HC 4X9IA 5AEAA 4JN2A 1UEMA 5D6CA 2R69L 3ARBD 1N8ZA 4R2GC 4NO5B 1I1AB 4XC1L 3V0WH 5I15H 4HFUL 1NGXB 1FG2A 5DLMH 3FRUB 5ESAB 5A43C 1WBZA 1OP3H 1V7MH 1JF1A 1REIA 3GSOA 5C0GA 1WIOA 4JE4B 1IM3A 5BO1H 3TBVA 2DBLL 2MHAA 3QP3A 1N6UA 4Q6YA 5JLZB 4Q97A 4G9DB 4NNXB 1J0ZA 4M1CD 3IJSA 4R97B 3PG2A 1ADQL 4PRAB 3TA3A 1MF2H 1VFMA 5E7BA 2F53D 4WUKH 3DIFA 4OFKA 4EOWH 1AGCA 5C2BL 4EQ3A 5LWYH 2P8MA 1ZT7A 4F7CB 2DM2A 1NCBL 1CXFA 4EUPB 5CEXB 4U1NA 4YLQT 4UAOC 5I1GH 1UENA 1ETZA 2BHZA 1YEFL 1ZS8B 3UBXA 5ID0B 4LHUG 2ESVA 1MJJB 3BQUB 3DROA 4G6AC 2XY2A 1U8IA 3MA7B 1BJ1J 4EIGB 4B7IA 1FC2D 1MNUL 1ZHBB 5JOPD 1KGCD 4KHXL 2W1NA 5C6PB 3B43A 1EMTH 5KZCD 1HQRB 4RRPA 4XCNA 4JRWA 4WNQA 1VFOA 4PRDA 4IHOA 5F3BA 4ZNCD 1F2XK 3VD9A 3HG1D 2P5WB 4KAQL 4RFNC 5DA0B 2AJXH 2EDRA 4JFHD 4J4PD 1D6EA 3QCVH 4GS7C 5FEBA 3ZYOA 3UDWA 5CD5C 1KLUB 3D85A 4KXZI 4KVNL 1JGDA 5DHXB 4CN4A 1U8QB 1IL1A 4DKEL 5BRZD 4X7TB 2H32H 1FYTE 3V52L 5DD0H 3C8DA 3I3BA 1P5VA 1NBVH 2ED8A 3N1PC 4Z77B 3E0GA 4L4TD 3NA9L 2LTQC 2WBJC 1XF5A 2IQ9H 5DJ0B 4HXAL 4JKMA 3DMMB 5E1AA 1NGZA 3ZYJA 3LCYA 3FQTA 2EZ0D 1JZ8A 3EDFA 3TBWB 1A1NA 1C16B 1VENA 1MAKA 3T0EC 2ARWA 3O3AA 1HWGB 5E24E 5SWZD 4JPWH 4QY8A 4I18A 1CD1B 5DFTA 1U8KB 2FH8A 2OCFD 4Y5YC 3RVTD 3HE7C 3QEQE 1G84A 1UACH 4YDLC 4Y4HC 3C5ZC 1KEMH 5TQ0H 3I2CL 3C2AH 1HE7A 1RZIB 4LPTA 4RMSA 4KJYB 1KC5H 4MCZB 4EKXA 3F7VB 5IW6A 4GG8B 4ZS7L 1GGBH 4I9WE 4ZD3L 3FFCD 1E4WL 5FCUL 5IB2B 3HZMA 5IFHL 4RGOL 1CGUA 3NZ8B 2ARJA 3MNVB 4GXUN 1FFRA 3KXFB 5TF1L 1P9MC 1ZWIB 5TH2A 4KDTA 1E28B 1F2QA 3AM8C 5I1HH 1T83A 2B5IB 1Z0MA 3O8XC 3W11D 1D5BB 3OKNA 3HE6C 3FRPG 2HRPH 3GSWB 1CDJA 2V17L 5BVPH 1I7ZA 1IEAB 4KQ4L 1BQHB 3TJHC 5EORH 4U05A 5LG1A 3QNYB 25C8H 4DEPC 4O4YL 1NGYB 4D9RD 1SMOA 1EGJH 1PX4A 4JQIL 3U0PB 5CHNB 4OCNC 4P2YA 3PWUA 3PWVB 3U4AA 2BZDA 1YMME 1NPUA 2CKBL 3A6BH 1ED3B 4FQ1L 1K8IB 4OCRL 4U1LA 3ARFA 3JTSB 2XN9E 2FX9L 4LPCA 2VWEE 3VXOA 4JRXE 4WFFD 2AK1H 4JFDE 3WN5B 2W65A 2YXFA 3WD5L 5K9KB 5JO5B 2Q7NA 4ZO6A 1NCCL 3BE1L 2AI0L 2W59A 3BPOC 4QRRA 3MRDA 1TQCC 2HFFA 2UV3A 2OZ4H 4BFGA 2HVKA 1IMHC 3G6JE 1JGUH 5AD0A 1QFWH 4LFHG 3Q5TA 1XIWD 1LE5A 2YPLD 3TJEL 2Q76B 1KJVB 1NUGA 5JA8B 5IVNA 2HT2C 3TWCL 2JJSA 3P30H 4M8QA 4X4YA 1Z0NA 3ZE2E 5IR1A 4DAGL 1K4CA 2V9RA 1RZJH 2NX5E 4WHDA 4E9LA 4HS6B 1YMMA 3CMOL 4OLWL 5EUOB 1QBMH 3T3MF 1BZ9A 3F6LA 1AFVL 1CFSA 1KB9K 2X4RA 5HJ3B 5JPNA 4PJAA 5HI3C 2A9NL 3WMSA 1IEBB 4NQCA 2XICA 15C8H 3L7FB 3VWJD 5E8EB 3L9RB 3QDJB 4YGVA 4ZS6C 4U0QB 5DUBA 4HLZH 1FAIL 4G9FB 3VRJB 3S8WA 5CWSB 1MOEA 4OD2A 5J12C 1OARH 4OSUL 5FYLL 5MEND 1C5CH 5KSAA 1J7VR 3WFBH 4APQD 3S3JA 1A1OA 1VEOA 4PY8J 4UMGA 3MRBB 3JWNC 3ABZA 3LQAH 5ISZB 3HLAA 2AQ2A 1SQ2N 1YEHH 1HEZB 4LCCB 4JY4B 4ZUSB 3REVA 3PIQB 4L4VE 4Z7QE 4XBGB 1JI1A 2IAND 3BGMA 1F3DJ 5LKNA 5SWSE 3UROR 1U8MA 1EZVY 1WTLA 5I1JH 1YQVL 1GSMA 5D1XA 1OTTD 1IAMA 4KK5D 1INEL 3RY5A 1Q72L 4WTZA 4CADA 4XBPA 2XZCL 3AS2A 1ZLVH 3SDDA 3WJLA 2NY3D 2VXQH 1EV2E 5IMKB 1JN6B 4OT1H 5FYLE 5C0CA 1VPOH 5HPMA 4DTGH 4LLVB 5I71C 1I85C 3QXAB 4L3CB 2D7OA 3THMH 1F13A 3GI8L 3TYFB 1NFDF 1OCWL 3WUZA 2VKXA 3KJ6H 1TFHA 3OGCB 1PJ9A 4BZ1L 3CVHA 3GMQB 5DRNB 5ESVB 1FNGB 2W91A 1HHIA 1I4FA 3BPNC 2EDEA 3O6FC 4L4VA 4ENEC 3WFDL 3T0XA 3A67H 5JQ6H 4XMPH 4LRIA 5DMKA 4JN2B 5D6CB 4MA8H 1X5JA 1Z3GL 5ALBL 3K4ZA 1N8ZB 5D71H 1CLZL 3AB0C 1FG2B 1HSBB 5E8DL 2H1PL 3NMEA 1WZKA 4HT1H 3ZE0F 1WBZB 5D2LE 3GSOB 1JF1B 3AC0A 4P23C 5C0GB 3TFKC 1IM3B 4N8VG 3MLPA 3TBVB 1N59A 2MHAB 4KK6C 4LHJB 3QHZH 1HHJA 4MQXD 3IJSB 4YBLB 1VEPA 4N8PA 2VXVH 3MGAA 3TA3B 5FIEA 1LVEA 1BM3H 3DIFB 2YD2A 1AGCB 3RGVD 3T2NH 1IC4H 4JRYA 2P8MB 2ZUQC 5K59E 2EYRA 4JHWL 3T0DA 1H5BA 3Q3GA 4U1NB 4O02H 5TFSH 5KS9A 1X5AA 1ETZB 3UBXB 5B38A 1A5FH 3L5HA 1IT9H 5LWYL 3WBDA 2ESVB 3PGCA 3DROB 1DQLH 3AREA 1MEXL 1U8IB 4MB5A 1JGLL 5IUSA 3UO1L 1J8KA 4C57C 4XCNB 1UXSA 3CXDH 3UCRA 3DXAE 3SDYL 4WNQB 2ILLA 2VO5A 4PRDB 2MMXA 4IHOB 5F3BB 2C4FU 3BSZL 1EMTL 4MA7L 4XB8A 2O61A 5GGQH 4ONFL 2CPCA 4KRNA 3SDXA 1D6EB 3F58H 1OM3L 4M4RA 3D85B 2XG5A 2XWTA 4N0UE 1JGDB 5IW1A 1IL1B 3MV9A 3T65A 3BAEL 2PNDA 2B7DT 1E4XI 4C56E 4ZUWA 5GRUL 2R15A 1XF5B 5E1AB 1NGZB 4H20L 2H2PC 1A1NB 5F7UA 5E08L 3O3AB 1J0IA 5I74B 4QY8B 4I18B 3O2DH 2IBGA 1CGWA 3QG7L 2V6HA 4P46D 4S11A 3BW9A 4LCWD 4XBEH 1MAJA 3KPRA 1N3NA 1KXTB 1WLHA 1I9JH 1Z6JT 4JPWL 1U8PA 5D7KD 3TEUA 1JGVH 2FO1A 3U83A 1UACL 4AL8H 4WI6A 4W6XB 1AR1D 1FYTB 3HZMB 4J7RA 1KTLA 2ARJB 3EDDA 4OLYH 2Y23A 3KLSA 3GIVB 5TH2B 5H37H 1HHHA 3OB8A 3PHQA 4UNTA 3RWHA 2OQJA 1D3CA 3OKNB 3B9VA 4FQPA 1HKLH 4NKOA 4P2QD 1JP5A 1JMZA 2NY7L 4LSPL 3CU1A 5I1HL 3G6AA 4R90L 2GJJA 1I7ZB 1UCTA 3T08A 3U2SA 4YHYB 2ATPA 4WHTA 4YPGA 3CFKA 4PJGF 4LP5A 43CAA 2ZUSA 4KZEL 5BVPL 4PRIE 2J88H 3EW3B 3PWUB 4LHUA 2XTLA 3BDXA 4U1LB 3ARFB 1B0RA 1EGJL 1HCVA 4MXQC 3VXOB 4ZMAT 1UH3A 3BP4A 4B7LA 3QSKB 2W65B 4Y16C 3B5GA 1CLOL 3LEVH 1A6VL 3MRDB 4QRRB 2HFFB 1IM9D 3OGOE 4XMLH 3UTOA 5KAQG 5IHUL 1GGIL 4QHLA 4RSVA 3DI2B 2HVKB 5AD0B 3IJHB 1LE5B 4G8GA 5DO2C 2VLKE 5FOBA 3EHBC 1TJIH 4ODBD 2OJEA 3CK0H 4QHUA 2D3VA 5E9DD 1QFWL 5CGMA 4M8QB 4X4YB 4OCSH 1CG9A 3OKOA 4WV1C 1R5IA 1K4CB 4M7LL 4TSCH 4QRUA 2APVA 1YMMB 3OAYK 5D7IF 5CEYA 4HMEA 1OAKL 3HUJA 2QADB 3SKJL 1BZ9B 1CFSB 1IQWH 2X4RB 4ZO8A 5JPNB 4PJAB 1MCPH 2YA1A 3MLTA 4FTVD 2F58H 1FV1A 4NQCB 3MSPA 5I30H 5I2IA 3A0OA 4YHNA 4Z7UF 4YGVB 5E4EC 5E6ID 3GMLA 5DUBB 1A6WH 2WK2A 4QHKI 1T0MA 1R3JA 2DBJA 1UGNA 4OD1H 3SOBH 3AS0A 2VDRH 4OD2B 1UG9A 3RIFK 1XAUA 1ZVSA 5KSAB 1TVBA 2MCPL 1A1OB 3B2UC 4OLVH 2DRUA 1AGDA 4RAHA 4HGWB 4M62H 5DQ9A 3FRPA 2CD0A 1KEGL 1C5CL 3DECA 3REVB 3WFBL 4AQOA 1P7KA 4OLUH 3FO1A 3BGMB 2GW5A 3PGFH 4U2ZA 4K23H 2IH3A 1U8MB 4WEUD 1FO0A 4QTHB 3T3ME 2J12B 1G7IA 5D1XB 3ZHLA 4HJ0C 5JA9A 3EYOA 3IXTA 4IOFC 4CADB 4XBPB 2G5RA 2ICEA 3SDDB 4XX1E 4JKWA 5FGCB 5C0CB 4P2RD 5HPMB 3TV3H 5J4MA 4GKOA 4Y0GA 5J57B 4OZGA 2W0LA 4KROC 4MQ7A 2V5SA 3CVHB 1OGAD 1KJ2H 5F89A 1T2XA 1HHIB 3UTTD 2NZ9D 1I4FB 2GHWB 5DFWH 3QIUC 4L4VB 1IFHL 4Y19E 1CICD 3ZKMC 5KVDL 1JZ3A 1GZQA 2FHCA 4XWGH 4RDQG 2H9GA 2PW1A 5DMKB 4ODSH 4JR9L 5JORA 4P57A 2XRAH 1I1AC 2BY1A 1T7YA 5CIPA 4HZAA 3HR5A 1A9EA 1UH2A 4AMKL 4Y4FA 1N59B 4X7CC 2CIKA 3QAZC 4HT1L 4BH7A 1JL8A 1HHJB 1L0XA 3VRLF 4EN3A 4JZNA 3KLHC 2I26N 2Y07L 4R97C 5JIKA 5CP7A 1M1SA 2DOCA 4FQXD 4D9QE 3C8KA 3RX7A 5CJOL 3QHZL 3UEZA 3ESVF 4JRYB 2WBKA 1NFDE 2AP2A 4ODTH 5KBNC 2EYRB 3MJ9L 1H5BB 3Q3GB 1J8HE 1DBKH 1OAYL 3CH8A 1FIGL 5KS9B 3T2NL 5B38B 4PP1D 3PGCB 1XF2A 5BV7H 3AREB 3BQUC 1AKJB 4FQJH 4DCQA 2ICWA 2O93L 4WO4D 5IMMA 1LNUA 2VDLH 4UQ2A 4O02L 3INUH 3F12A 1UXSB 2H41A 1L9NA 3ZE0E 2QJDA 3VGGA 4LGRB 1F4AA 2O61B 3FOMA 5I0DA 5FYJU 3CXDL 3SDXB 4C59B 3CXHK 1QFHA 2XWTB 1LDPL 5IW1B 3MV9B 4XCFH 1NGPL 2CKNA 2FSEA 3LY6A 1I8LA 3PV6A 3T65B 4KVCL 2WM0A 4ZUWB 2FR4A 1UYWL 5DD5H 4TOYL 3Q1SH 4BQ8A 3DMMC 4HIJA 1GPOH 5EU6E 4KHTL 5C09E 1FFPA 1C5DA 5C70A 1FRGH 1TETH 4N1HB 5DJ6A 2EXYD 1LDSA 3BW9B 4OCLC 1BF2A 3KPRB 1N3NB 4X83A 2QEJA 4MNQA 1U8PB 2Y25A 4JG0H 4GMTH 2C3VB 3QUZD 2XYCA 5I1EL 4M5ZL 2HT4C 4Q9RH 5EO1B 1I9JL 1X5LA 2DLFH 2VLLA 3EKCA 1L0YA 4N8VA 3SGEI 1KTLB 3RPKA 1Q9OA 5ETUA 3RY4A 3C60D 2CIIA 5JXED 5C0AD 1HHHB 3LRHA 3PHQB 4K9EH 1IGCH 3TF7C 2X41A 3RWHB 2OQJB 5F7FA 1NMAH 3FO2A 1JBJA 1CFVH 1MAMH 4NKOB 1VESA 4WI5A 4CMHC 1TZIA 2DQTH 4IRJD 3VXUE 5HGGS 3G6AB 3UAJD 4U1HA 3K7UA 1U3ZA 5DUPL 1GVIA 3TPKA 3U2SB 1HKLL 2ATPB 4WHTB 4YPGB 3CFKB 3DYMA 43CAB 4O2EA 1CDCA 1HK6A 3VFVA 1XF4A 5GGTL 1ONQA 2RQ8A 4NKQB 3U30B 2NLJA 2R0LL 4HWZA 5FM5M 1B0RB 3I9GL 4DUXA 4C55A 1N2RA 3BP4B 2J88L 1WK0A 4ZTOH 1BQLH 1JE6A 1NBZA 4HAFA 5DD3L 2Y7QA 4FFWC 4YHLL 3K2UL 4R3SA 1G7MA 5I1LA 3PUCA 5E2WL 4I0PD 4QHLB 4ERSL 4QTIL 2WINA 4M1GH 4G8GB 3FO9A 4V1DA 4LIQL 1RZKH 5FOBB 2OTUA 4XMLL 2OJEB 4QHUB 4WW2F 1CG9B 5C9JA 4XWOD 3OKOB 1XGTA 1LWRA 5FYJH 1X5HA 1R5IB 3UC0H 5ALCL 5GS0H 4QRUB 1SYSA 1TJIL 4R8WL 3OSKA 1MQKH 1DLFH 3FKUS 4EDWH 1H3PH 5CEYB 2DWDA 4P3CL 3HUJB 4OCSL 1P7QA 4PJGE 3MLTB 3DETD 4TSCL 1FV1B 2X4OA 2OK0H 5GJSL 1FLRH 3QBTB 1A47A 4YBQC 5I2IB 4LAJH 4LMQE 2CRMA 3VWKB 4YHNB 5FGBA 1MCPL 3GMLB 4OAWA 2F58L 1MVFA 3E6HA 1T0MB 5ADPL 1MLCA 1R3JB 3E2HB 4WFHD 3AUVA 1BFOA 5D1ZA 1A6WL 1XGRA 4XCCH 4XTRC 3D39E 3WIIL 4KK8D 1BAFH 3DYPA 4K3DH 2VQ1A 3EZ8A 1ZVSB 5HVWA 1EFXA 3QWRD 2QSTA 1TVBB 2CR6A 2W0FA 1TMCB 3P3YA 3U4BL 1HNFA 2HTKC 5DQ9B 1JRHL 3OQ3B 4AEEA 1P7KB 4LCCC 3FO1B 2JB5L 3K8LA 2NXYD 4W4OC 5D7IE 1FO0B 5JXAH 3G6DH 1EUUA 2PKDA 3KR3H 3QUXD 1VGKA 3EYOB 2Z93B 3IXTB 5C08D 1X5XA 3PGFL 4BSWA 1OAZL 2ICEB 3RIAK 4YQXH 2D7TL 3FHAA 3MR9A 4Z7UE 5F88A 1DVFA 1FORH 3D39A 4JVPA 3NN8A 1NDMA 2B1AH 3BZ4A 4NP4H 3O6KH 1T7VA 4QOKA 5KVGH 1RZGA 4MQ7B 4Z5RA 2WQRA 3TC9A 3V4PH 2AJUH 5F89B 3IFLH 5KVEH 1LK3L 2AABH 3LS4H 2QQNH 5A16A 5LAXA 4M6AA 3GBLA 3LQZA 1GZQB 3DRTA 2H9GB 2PW1B 5IIEA 1S7WA 1BEYH 5JORB 4NN5B 3BPLB 1ZGLM 5CIPB 1GH7A 3HR5B 2JJVA 1A9EB 2XOTA 3CVIH 4Y4FB 3H9YA 2XRAL 3G5XA 2CIKB 4XZUA 4JY5L 4BH7B 1T04A 1MFEL 4EN3B 4JZNB 3FONA 1IGFL 5CP7B 2PYED 4S1QH 1UKSA 4L1DA 3TA3C 3C8KB 2XIDA 3BKML 4YHML 2Y36H 4YWGH 3LHPH 1V3LA 2A0LD 4PGCA 3QFDA 3LZFH 2B39A 4K3JL 2NY2B 4L9LB 2Z31D 4BKLA 1MIEL 1N26A 4ODTL 1XF2B 4FFZL 4F37K 4DCQB 2ICWB 1K3IA 4PJ5E 5IMMB 3ZKXB 1LNUB 4UQ2B 4PLJC 2JB6A 4XAKE 2QQQA 1I3RA 4PJIF 3F12B 4FQHA 4FG6D 1I7TA 2ZSWA 4M7KH 3SQBA 1BWWA 2P5ED 4XPFH 3QI9D 4PJDA 4ZFOL 4LEOA 4KI5D 5C0FA 5E03A 4KJQC 3FOMB 2Z0BA 5ITBH 3UDWC 3VGAB 4QHNA 4HWEL 5DJ2A 4GOSA 2F19H 5HHMD 4R0LA 3VRLE 4HF5H 2FSEB 3PV6B 4K9EC 4ELMA 2I9LA 3S6CA 2QQKH 4UB0L 3RZCD 2ITDA 1V7NH 1G6VK 2FR4B 1MCCA 2RBLA 3BP6A 5CJ8A 3E8UL 4HIJB 4KFZC 2PETA 4CVXA 4U7MA 1FFPB 1C5DB 5I74C 2A6DA 2YKLH 4I18C 4OZFG 4JFQA 3OB0H 1VERA 5DJ6B 5I16A 3Q1SL 1BWMA 4UIMA 2VQTA 3OF6D 4MNQB 1FRGL 4D3CH 2FX7H 3O6LH 3V6FA 5LBSL 1IC7L 1J1PH 5I18L 4PTTA 1HXMB 1P1ZA 4NHCL 5IF0A 2VLLB 4JG0L 4GMTL 4N8VB 5D7LD 3V5KA 1Q9OB 3LKOA 5ETUB 5FCSH 2CIIB 5IHLB 2ZWLT 1J1XH 4KDTC 3ZE1F 1TJHH 2DLFL 2A6IA 1T83C 3QFJA 1QHPA 4N5ED 1FNLA 4FQIH 4U3HA 1MREH 3FO2B 4NCC1 1CD8A 1QRNE 1G9NC 1TZIB 3O0RL 5KANG 2VISA 4K9EL 4U1HB 1ZLSH 2HMIC 4JEGB 3HMXH 1B4JH 1MAML 2LAGB 4YHYC 1YJDC 1MFCL 2DQTL 3HA0A 3I50L 4O2EB 1A64A 4OBRA 4XHJD 3VE0A 2BNQA 3VFVB 3QQ9D 1XF4B 1ONQB 2NLJB 5DUMH 1U6AH 1WTGT 3ARFC 4HWZB 4OF6A 4L8CA 1N2RB 1QO3A 4Z7VF 4IS6A 2XNAA 1B3JA 4OJFL 5J3HD 1NBZB 1ZOXA 2Y7QB 3SCMA 4LVHB 4R3SB 4TUJA 1G7MB 4R2GD 5I1LB 3C6LA 5FB8A 2H26A 3A6OA 4ZDHA 1OAQH 1BQLL 2WINB 1G7JA 2IC2A 2A83A 4DK6A 1INDL 3FO9B 4V1DB 2OTUB 1T1WA 4TULH 5E56A 4X99A 5EC2A 2JJSC 1E4JA 5C9JB 1Y18A 1XGTB 4HD9A 2VL5A 2DLIA 4DJMA 1CF8H 1H3UA 1SYSB 3EOTH 3UP1A 1QLEH 1G9NL 4X6DF 2DWDB 1MFAL 2SEBA 4JB9H 1P7QB 4HJJH 2QADC 1FZMA 5DJXA 3UC0L 4L8SA 2X4OB 2UZXB 1YJDL 3O4LA 5C71A 3B9KA 2FWOA 2EC9U 3S96A 4G6AD 3MV8E 35C8L 1U95A 4M6NL 4OAWB 2R0KL 1HYRC 5BS0E 2OK0L 2ADIA 1FLRL 3E6HB 2MWCA 1MLCB 4B53A 2HKFL 1IKFH 1BFOB 5D1ZB 5GHWH 1JWUA 5CINH 3ZMRA 1GJIA 3TLRA 2VQ1B 3LDBB 5E8OA 3MXVL 3T0WA 1EFXB 5KSAC 5FYJE 2J8UA 4RMVA 3QEUA 2W0FB 2F54E 1FNHA 4KDVA 5DWUH 5CD5D 4PGJA 1BAFL 4U3XA 4K3DL 3OJ2C 1YNLH 1MWAA 1YEJH 5EIQA 4WCYL 5IVXA 1P84J 4G8IA 1OT2A 2AQ3A 2VB5A 1UC6A 2WBJD 4W4NA 5C0JB 1VGKB 5D1XC 5E70A 4WU5A 1FZKA 2BSED 5CBEA 4ZOAA 3T0ED 5ESQA 1W2KT 4BSWB 3VXNA 4X98A 2NY0D 4KRMB 2W07A 3WJLC 4LSVL 2VUYA 3MR9B 3HB3C 3G6DL 3KR3L 1AGFA 3BD3A 3HE7D 1MHHA 2VITA 4ESKA 5F88B 1DVFB 3D39B 5KSBF 4GLRH 3NN8B 1NDMB 4Y4HD 2JK5A 5SV4A 3IS1X 1AH1A 4QOKB 1RZGB 1MSPA 2HH0L 3T2QA 3CFCH 3U1SL 3ZT6A 2YD9A 4QLRA 2B1AL 2WMPA 5A16B 3PL6A 5LAXB 2YD4A 2DLEA 5KVGL 3EFFA 3LQZB 1PLGL 1FJ1A 3V4PL 2AJUL 3DRTB 3IFLL 4MAUH 4I0KA 4CGTA 3LS4L 4MNGA 5EIIA 1VB9A 5IMOA 3OJVC 3KPSE 3O8XD 1S7WB 5IIEB 4LSRH 3D3VD 3KAAA 3V79C 3HE6D 2EYTA 4QHKJ 4WUUE 2OR9L 1EEQA 2J1KA 4DGYH 4ORGA 2VDPH 3IXAA 3TJHD 1BF8A 4PJHF 3G5XB 3VMOA 4X4ME 4PB0H 4I2XA 4XZUB 1T04B 3FONB 4PLKC 1CDIA 2DTMH 1Q9LA 3SN6N 2MQ0A 1J0JA 4NQTA 4LHQB 5EH1A 3WS6C 3MUJA 4Q7DA 4PLOB 4QGTA 4PGCB 4S1QL 1BZ7A 3LIZH 1H5BC 3QFDB 4MA1B 1FBIH 1DZBA 4NRXA 4BKLB 4HC1A 2V2TA 3CVHL 4FZ8H 4DW2L 1FPTH 3AREC 2ADFL 2DLTA 3VG9B 5TE6L 4WUUA 5I8CA 2WLZA 2JB6B 1I3RB 2HT2D 3JWDH 1BX2A 4XP4L 4FQHB 4P49A 1I7TB 2NY6B 2ZSWB 2A1WL 5F7DA 3H0TA 2WUBH 4PJDB 3QNXA 4EQ2A 5A2JH 4LEOB 3NIDF 5L88L 3IAGC 5C0FB 2H3NA 4K94H 3QT2A 2COQA 2YD5A 2GUOA 5B39G 4XPFL 5GRJH 4QHNB 1ZANH 5DJ2B 4GW4A 4JPKH 4R0LB 5HI3D 1QSFA 3V4VL 4ELMB 2I9LB 4FOMA 5ITBL 2ITDB 3NACL 4ZS6D 2F19L 4TVPL 4RFOH 1UKTA 1AC0A 3BP6B 4JHAH 4M1DL 4MD4A 2VDQH 1YYLH 4ZNEE 4MJ2A 5IFAH 2QQKL 3G9VA 4CVXB 1V7NL 2A6DB 5C86A 4PIRF 1AXTL 3L1OH 4JFQB 4JCMA 5I16B 4LKCA 2Q8AH 5C8JA 4UIMB 1B9ZA 2XY1A 2AJYH 5IROA 1FL3A 2OL3H 3AROA 3UTPD 4KMTH 4PJIE 3PP3H 5LCVL 1NL0H 3V6FB 1T0NA 2EIZA 3O81A 4POYA 4PTTB 4AYFA 3D25A 1P1ZB 2IBZY 1RQ5A 3MLVL 5IF0B 3KG5A 2APXA 3V5KB 2HLAA 3LKOB 3NCJL 5DTFA 1Z9SA 1T1YA 2X2YA 2A6IB 3QFJB 3ULVC 5K9QI 4BFIA 1N5YH 4CDGC 2YOCA 1WIUA 4QNPF 5JW4R 1J1XL 3I6LE 4GG6F 2VISB 2P24A 4HMCA 1KBGL 5FOJA 2DS4A 4OIAA 5D72H 4Y1AA 3BUTA 4HEPG 5GQBA 1ZLSL 3VE0B 2BNQB 2R9HC 1B2WL 3O6FD 3U30C 3RA7H 4PD4J 4ENED 4L8CB 5C2UB 1QO3B 3A6CL 3CMGA 1CXIA 3PHOA 4IS6B 2XNAB 2B2XL 1D5XA 3SCMB 4D0DA 5DUML 1U6AL 4TUJB 4LDEB 3C6LB 4CAGA 5FB8B 2WBWB 4GW5A 5DD1L 5DD6A 4ZDHB 2VXTL 2JIXA 1EH9A 5E2JA 2XQBH 1G7JB 1S5IL 4P23D 4CJ0A 2A83B 3TFKD 2D03L 4P2OA 3OL2A 2X6MA 3ZE1E 3O41A 1T1WB 4KK6D 2V9QA 4X99B 4URTB 5EC2B 1OAQL 1IQDA 4OQ1A 1Y18B 3GKWH 2VL5B 3ULVL 3AFLA 7FABL 3MACH 2I5YH 1IAIM 3SQOH 4I0CC 4TULL 1QVOA 1LO5A 2RR3A 2EO1A 2SEBB 1FZMB 1YZZA 4FQQA 2GKIA 5DJXB 3HAEH 5T33L 3RY6C 4L8SB 5EA0L 3IDIA 3OAZK 4MDIA 5HSFA 3VGHA 4OZFA 3O4LB 4H88H 3B9KB 2FWOB 4JB9L 5C0EA 1UWEH 3DV4A 1WAAF 3S96B 3QULA 4GAJL 2DLHA 1U95B 4M7JL 4RNRA 4QEGA 2ADIB 3IDMA 1F00I 4Z7VE 5ANME 5TPWL 1RIUH 4BYHA 3KYKH 4MZ2A 3EJYC 3E2HC 1GYAA 1JWUB 5CP3A 3UPRA 3TT1H 5MHSE 4G5ZH 4Z95L 1RURH 1AIFA 3TVMA 4Q0XH 3L5JA 1K4DB