4RJ4A

Egfr kinase (t790m/l858r) with inhibitor compound 6
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
322
structure length
299
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKEATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYEDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of Selective and Noncovalent Diaminopyrimidine-Based Inhibitors of Epidermal Growth Factor Receptor Containing the T790M Resistance Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 91
structure length 299
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rj4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rj4A01
4P7EA 2PVMA 4EOMA 4AF3A 3VS3A 4DGNA 3DBFA 4NTTA 4XP3A 3EFLA 2B53A 3WARA 4RJ7A 3TKIA 1Q62A 3FSFA 3QLGA 4QPSA 4IFGA 4D4RA 4MF1A 4FL3A 5EFQA 1YXTA 2F49A 2BDFA 3H4JA 4IANA 3LJ1A 2CLXA 4JRNA 1FVRA 2B7AA 2F9GA 2ZV2A 4O1OA 1FMOE 3BX5A 3QQUA 4APPA 1OL5A 4MYGA 5CZHA 4BZOA 5JGBA 3Q4CA 1RJBA 3NYXA 1R78A 1TQIA 5IF1A 4DTAA 4U41A 1GY3A 5FLFA 3L9MA 3FQEA 3GCQA 4GSBA 4M12A 3C4WA 2A19B 4GVAA 3NGAA 3E8DA 2PZ5A 3D7ZA 1PXNA 2Y0AA 3E8EA 3AD6A 5T6KA 4N57A 3LFSA 4AA0A 2F2UA 3ITZA 3ORTA 3C1XA 3AG9A 5IUGA 4KB8A 5EG3A 4GYGA 4HNIA 3UDBA 4FKIA 3OCTA 1H26A 1VEBA 4BDKA 3H0ZA 1Q8WA 4BKYA 2GNHA 5KMKA 1UNGA 2WMUA 3VVHA 2XIXA 3DZQA 1UKIA 4L7SA 4BGGA 4BWPA 5F94A 2UW7A 2YA9A 2XIRA 1AQ1A 3NCZA 4C4IA 3C4FA 4PPBA 2UV2A 3ZS5A 2W1CA 3VN9A 4CRSA 2W1IA 2Y8OA 2CGUA 3ANRA 3I60A 4L9IA 4APCA 4DG3E 5HTCA 4ZTQA 4Y46A 3QC4A 5A14A 4FEQA 4BI1A 2DQ7X 4FV4A 4E20A 3FQSA 3ENMA 5HESA 5CASA 4FT3A 4U0IA 1U59A 3FXXA 2QR7A 1CKJA 4F9AA 3PXKA 4RJ4A 4F08A 5BVNA 5HCZA 2NO3A 2SRCA 3GFWA 3KKVA 4HZRA 5G1XA 1FGKA 3DBEA 3IG7A 3Q9XA 3Q4ZA 4FZ7A 4FTCA 4DAWA 5CF4A 3DV3A 1PMVA 5IEVA 1U54B 4LGDA 4P2KA 4C2VA 4JQ7A 4AW2A 4BC6A 2EU9A 4G3DA 5A9UA 5BYYA 3LM5A 4PWNA 2V7OA 1KOBA 3OBJA 1NY3A 4O0UA 5HCYA 4PRJA 5DH3A 3VUDA 2QOFA 3GI3A 3MV5A 4HCUA 4L42A 1ZMUA 3O51A 5E8XA 3FWQA 4AACA 4R7HA 1YHSA 2ITVA 3O23A 4GL9A 3TNHA 4A9YA 4QMOA 4ERKA 2QU6A 4IDTA 4MD9E 4FV0A 4JG6A 4CV9A 4TPTA 2WQBA 2XNNA 3WIGA 3LMGA 4EKKA 2X2LA 2YM4A 4UXLA 4YJNA 3TNPC 2VWXA 3S4QA 4MNEA 4D9TA 4KNBA 3ZBXA 5A46A 4F7SA 2XUUA 1O6YA 3PTGA 5D7AA 3EB0A 2WPAA 1OL1A 3ZCLA 4RQVA 3K5VA 4DEAA 4I0SA 1LEWA 5JQ5A 4USDA 3DNDA 5H2UA 2G9XA 5IEYA 1XBAA 3LAUA 3LFQA 5JQ8A 4D2TA 1BYGA 4F99A 4C37A 2W05A 3TTJA 1PKGA 4RRVA 5KNJA 4CGAA 1Q8YA 4AZWA 1UNHA 2B55A 5FG8A 3GT8A 3OROA 3DTCA 4QP1A 3UC3A 2VTLA 2C0IA 3LOKA 3GCPA 4C4JA 3OD6X 4DFUA 3HRBA 1BMKA 4HVSA 2FH9A 3ZC5A 4K11A 1OI9A 3GQIA 2R5TA 4U79A 1J91A 2J0LA 3TKUA 3WE4A 3MA6A 4W8DA 3MY0A 3VQUA 4ZTSA 2WGJA 2Y9QA 3SOCA 4D0WA 2C6DA 4FKWA 5AUXA 1YDRE 3T8OA 4X2FA 4EH7A 3VBWA 5AWMA 4XG6A 4UWBA 3HX4A 3E3BX 2P2IA 4FKOA 1YHWA 1UV5A 3BEGA 4IZYA 3OW4A 3BEAA 1WBTA 5KZ0A 3RPSA 3NW5A 3R63A 1FBNA 2C6IA 4I4EA 4OTRA 3EZRA 4W8EA 3CC6A 2H34A 3OTUA 4RX9A 2PUUA 2BFYA 3PVUA 4C0TA 5E8ZA 4O7RA 4QO9A 4HNFA 4YHFA 1OVEA 5KO1A 5C8MA 3A7HA 2GQRA 2Z7LA 3R22A 4XV9A 4F7NA 5KBRA 2CN8A 4WG4A 3P1AA 5GNKA 4FT7A 1Q97A 4OR5A 2W4KA 4NH1A 1YXVA 5L2SA 4XV1A 3BKBA 3PXYA 4B8MA 5J79A 3CKWA 1WBVA 3I6UA 4LL0A 5KZIA 5D12A 3LFEA 3UBDA 3KREA 3Q6WA 3PG1A 2R3MA 3OTVA 4FI1A 1OKVA 4QMVA 3RI1A 4BL1A 4DH8A 5HICA 1YHVA 2E9OA 2OH0E 4EKLA 4E6CA 2GNJA 3RCJA 1OPJA 3FI4A 4LYNA 3BHTA 3L8PA 4CD0A 3FPMA 1JNKA 4WBBB 4DEGA 4IEBA 2O3PA 5KUPA 4AGUA 3FMDA 3HLLA 4I5PA 4M68A 1XQZA 3DKOA 3EN4A 5CLPA 5LJJA 2YZLA 5IQDA 3NUAA 5J9YA 2NP8A 3EQCA 1M7QA 5M53A 3GC0A 4ANOA 2R3HA 5EDQA 1HOWA 5B2KA 1Y8GA 4FNXA 3TIYA 3COKA 1KE8A 3QAME 3VS1A 3HDMA 3ACKA 5FUTA 4WHZA 4YJRA 4IAAA 3TDWA 3IW6A 2OXYA 1FPUA 3V8TA 3HECA 4EH5A 4JX7A 4YZNA 1ZY4A 4MD7E 4PP7A 4EBVA 4FVRA 3KEXA 4IZ5A 4Q9ZA 5LXMA 3BYOA 4M67A 3IOPA 3OS3A 4FNWA 4U44A 2QO9A 3DLSA 3ENHA 5CALA 4RX5A 3TI1A 1JOWB 4BCJA 3A8WA 4J97A 4GFMA 1DI8A 5FP6A 3SV0A 5KX8A 4BDCA 3F3VA 4FNZA 4IWDA 5EW9A 1IRKA 3M2WA 4QNAA 2J0KA 3E88A 3E92A 4JDJA 3HEGA 4YR8A 3SC1A 3PPZA 4FV3A 1UA2A 4JG8A 5A3XA 5CEPA 1ZWSA 3FLSA 2B9FA 4W4WA 2PY3A 2JC6A 5HVJA 3MYGA 3UPXA 4FV7A 4IW0A 3FLQA 4Y72A 4AZTA 5JRQA 4PMMA 3FXZA 3G5DA 4TW9A 5IDNA 4IACA 5EOLA 2UZEA 2BROA 2VO0A 1M52A 4I4FA 5K4IA 1JKTA 2XA4A 3FKOA 4TYGA 5BVDA 4QQCA 3QQFA 3VS7A 3EN7A 2QI8A 2BZHB 2XK3A 3VULA 2BCJA 2XRWA 5C03A 4BDFA 5HBHA 3TV7A 3A7IA 3EQRA 4OW8A 4U3YA 1Q8TA 3MH0A 1ZXEA 5AP5A 3RJCA 3QD2B 4I5HA 3UNZA 1BKXA 3FI2A 5TF9A 3SKCA 4QYFA 3P9JA 4FVPA 5FD2A 4IX5A 4C3FA 2HCKA 4I22A 2B9HA 5KBQA 3L8SA 4O0XA 5ETAA 3SW7A 4WSYA 3PE2A 4KIQA 2XK8A 3F6XA 5FEEA 4CZTA 1U5RA 2OXDA 4QOXA 5K5XA 2YDIA 3AGMA 3DZOA 4ACGA 4DA5A 4O81A 1J1BA 3IS5A 5K0KA 4LFIA 4XOZA 3SLSA 1FINA 1JPAA 3PFQA 5DI1A 4ACCA 3BHVA 2HZ0A 2CHLA 3QX4A 1V0PA 4OT5A 3SG9A 4K6ZA 2BKKA 3UTOA 5CAPA 3O71A 2W4OA 3MVLA 3Q52A 4CMTA 4O0YA 3G2FA 2C6TA 3JY0A 2G1TA 4FUYA 4QP9A 3EYGA 5ANEA 3T3VA 3TZ9A 2WTCA 5D1JA 2JKMA 2QOQA 1W83A 2Z60A 2OIBA 4XG8A 2YEXA 5CT7A 1PKDA 4ZOGA 3KN6A 3V6RA 1IG1A 2BAJA 5CX9A 5H8EA 4L00A 3TJDA 3UMXA 1G8SA 3PSBA 4F65A 2H6DA 5LCKA 3DA6A 2PWLA 2XBJA 3G6GA 4I3ZA 4U7ZA 5DEYA 2UVZA 3OT3A 3MGYA 2HW7A 3TWJA 2VRXA 2FVDA 5CAQA 3FY0A 4NTSA 1Y6AA 4YP8A 4P5ZA 4ZXTA 5HIDA 5TE0A 3OEZA 3ROYA 3ZRLA 3F82A 4ANNA 3L9NA 3D9VA 4Y5QA 2R3GA 3WYXA 3R8UA 4JQEA 3I4BA 3CXWA 4MWHA 4QMPA 3R6XA 4B0GA 1PF8A 4CFXA 4RQKA 1R0EA 4W4XA 2UW3A 1R0PA 1H28A 1DI9A 2X2MA 4RT7A 5C26A 4FV6A 4FKSA 3R83A 4H3BA 2XNBA 5DN3A 1FVVA 2NRYA 3JXWA 1YDSE 4OTWA 5EKNA 3PVBA 3ZRKA 5FTGA 4LOPA 2IVVA 3MIAA 4FSNA 4GJ2A 2VD5A 4EHZA 5AV4A 2BRBA 3P7AA 2Z7SA 4KKHA 4CVAA 1TVOA 4G34A 4NKAA 3U4WA 3GU8A 4MHAA 5EI6A 2OXXA 4DTBA 4HJOA 4AW1A 2B54A 2UZTA 2VWUA 2WMBA 4ONAA 2Y4PA 3S1HA 4DFBA 4FG9A 1UU9A 2VTRA 3G0FA 3R9HA 2W99B 2YISA 3FUPA 5FEQA 4FV5A 4XG7A 5GINE 4CFUA 3ODZX 3ORMA 5G6VA 3V5LA 4Z9LA 4ITIA 3ZZWA 2XIKA 4KAOA 3I5NA 4J8MA 3R8PA 2G01A 2X8DA 4G3GA 4K0YA 5E91A 4A4XA 4BRXA 1VYZA 4YURA 2NNWB 4RIYA 4GH2A 2NRUA 5M06A 3BHUA 1M17A 3FBVA 3T3UA 3VS4A 4ID7A 2I0EA 3VJOA 4EK8A 2WO6A 2RF9A 2IN6A 3BU3A 3KN5A 5CSHA 3L8XA 4NFMA 4IFCA 3K3IA 4OTPA 3L8VA 4GRBA 4JIAA 3CEKA 3PA4A 4KIKA 4B4LA 4AZFA 3FZRA 3TKHA 2ZYBA 5CAVA 3FY2A 5CY3A 2YABA 2A4LA 3QKMA 3HUCA 3PJ3A 1UU7A 5AM6A 4R5YA 2ZDTA 2QOOA 3BCEA 2P0CA 3IK3A 3R9OA 4AE6A 4O82A 4EK4A 3AMBA 3GCVA 4RVKA 5IA2A 5JFXA 2XM9A 3ORLA 3DQWA 4U3ZA 4ACDA 3W32A 3TM0A 3GNIB 3Q5ZA 2OSCA 4HOKA 4C61A 4R1YA 4XH6A 5CEKA 5GIOE 4JS8A 4F9YA 4YJOA 3W8LA 3QC9A 3DS6A 4MBIA 2PVLA 2ITZA 3NRMA 4LMUA 2WB8A 2GQSA 2UZUE 4YHJA 2PHKA 2PVYA 3ZTXA 3A4PA 3FZOA 4GW8A 1YWVA 4EH8A 3H9OA 5HBJA 3V51A 1XH5A 5AUUA 3PRIA 4FTTA 4XMOA 2WMVA 3WILA 4M69A 4QYYA 4QMQA 2C30A 4BDBA 1ZRZA 2E9NA 4WNOA 4ALWA 4BN1A 5LWMA 2VGPA 5M44A 2XM8A 3PXFA 3P78A 1Y57A 5CQUA 1UNLA 3WZEA 3NCGA 4DCAA 5AA8A 3VUTA 3P0MA 4D1XA 5AEPA 2OJ9A 3PDTA 3CS9A 2QG5A 3R7GA 4IXPA 2ITYA 2EWAA 4XS2A 4OTDA 3WZJA 1OIRA 3G51A 3KF4A 2QOBA 4LUDA 5T68A 4NW6A 2J0MB 4FKUA 4JDKA 4KA3A 4MQ2A 2GMXA 4RA4A 2XNMA 1WBSA 4MWIA 3ZMMA 4EOQA 3R9DA 3SG8A 3UG1A 2CLQA 2ITUA 3F3TA 3ORKA 2PK9A 1Q99A 3POZA 5JT2A 3OBGA 1H08A 3TDVA 4QTCA 1U46A 3ERKA 3TXOA 4QP2A 5GZAA 3EN9A 2W1GA 3V01A 2YIYA 2C0OA 4X3FA 2V22A 3GEQA 4CTCA 2GHGA 5E90A 4FKLA 2W1FA 3QCXA 4JR3A 3QUEA 5C8KA 1KV2A 2VWIA 5ETIA 2OFUA 2QURA 2VTPA 3BV2A 4DF3A 3NYOA 4G6LA 3QHRA 2J7TA 2ITQA 4EH9A 3R28A 1PMNA 5CVGA 4L67A 5ANDA 1FOTA 3BYMA 4E3CA 2WKMA 1O6KA 5IMEA 2HENA 4RX7A 2RFDA 3B2WA 3D5VA 1JAMA 3ZDUA 3ZSIA 3DXNA 4AT5A 4DFXE 3NUNA 1YXXA 3QHWA 4RPVA 3HMOA 4EHVA 4BF2A 2WMAA 4FTUA 4G2FA 4EHEA 3UOKA 3Q60A 2QO7A 4WD5A 4M66A 2WQNA 3UYSA 4A9TA 3HNGA 5HO6A 2RL5A 3DXQA 5IA3A 1Q8UA 3QTXA 3MH1A 4WG5A 2Q83A 2HY0A 1ZYCA 2B9JA 3KRRA 2V62A 4HPUE 3RGFA 1GNGA 4AZVA 5IU2A 3H3CA 3QQHA 3QQGA 4Q2AA 4X21A 4DT9A 3O96A 3ZSGA 4GYIA 4RWKA 5L6OA 4XOYA 1LUFA 1QCFA 4H36A 5CSWA 4ZTNA 2W06A 1FMKA 3TJCA 4F1MA 4M14A 3S2PA 3DKGA 3ZEWA 4ENXA 2VO3A 2XCKA 3ORNA 4FTAA 4YUQA 5EK7A 4FIJA 5HE1A 3FL4A 2CKOA 1ZARA 3MDYA 3Q9YA 4EH4A 5AP7A 3HMMA 1W8CA 4GU6A 5IUIA 3JS2A 2HYYA 4H1MA 4J95A 4O7NA 2ONLA 2XIYA 4MXYA 2ZB1A 4NCTA 3RNYA 2ZDUA 3I5ZA 4BCNA 4Y95A 5AR8A 1JKLA 5EHLA 1HCKA 2GHLA 2Y7JA 3PJ2A 3R02A 4U9AA 5KMIA 4EUUA 1JVPP 4FVQA 3DAEA 3LCSA 4UWCA 5BMSA 3UPZA 2WNTA 4FZFB 3DY7A 5EKOA 1H1WA 2C5VA 5BPYA 1UWHA 3C5IA 2XJ0A 1PXMA 4DFNA 2C68A 2QC6A 3B2TA 4JBPA 2OH4A 4G3FA 5DR6A 4TXCA 5ANJA 3UIMA 4DEHA 4HVIA 1Q4LA 4IZAA 4Q5EA 1M7NA 2OZAA 2NPQA 3EOCA 4YHTA 4MTAA 4XHKB 3LCOA 2XYUA 3KL8A 4TYEA 5CSVA 1PMUA 1NA7A 2UUEA 3OCSA 1S9IA 3QZGA 4NSTA 3W33A 3ZONA 5J5SA 1OKZA 4PTGA 4L53A 3EIDA 1PXOA 4UMTA 4BIEA 4CSVA 2I0YA 5JFVA 1PJKA 3U6IA 2OK1A 5IISA 2YM7A 3FYJX 2BDJA 2J4ZA 3Q9ZA 2C5XA 1CSNA 4MK0A 1Z57A 2B52A 4FTLA 3W16A 4KSQA 5DOSA 3Q32A 2ZV9A 4RC4A 3PY1A 3KCKA 4L45A 2LAVA 4G16A 3QD4A 2Z02A 3RZFA 4ASDA 3G9NA 3ZUVA 4QMZA 4XV2A 3FKNA 3TV4A 4YJQA 2X81A 2IW8A 1H8FA 4FTOA 2WU6A 5AV3A 4FV9A 2JITA 3PP0A 1KSWA 4NYEA 3ALOA 4ZY4A 3HUBA 4ZTHA 2KULA 4DEDA 4R7IA 1R39A 2O5KA 1OITA 3R8MA 1MRUA 4HCVA 4UMUA 4IC7A 4E26A 3F2RA 5JZNA 3RM7A 4KBAA 3D94A 4C3PA 1V1KA 2BPMA 3S95A 3CD8A 3NYVA 4KIOA 4FOCA 1PHKA 1YWNA 2HWOA 5DWRA 5FEDA 4YJSA 1NW1A 2JBPA 3ZH8A 3RAIA 3JVSA 3M11A 4M8TA 5LVNA 4BTFA 2ZM1A 5HG9A 4UN0C 3D5UA 4O7SA 4S30A 3PPKA 2HAKA 5JGDA 2GQGA 3G90X 3GCSA 4AWIA 3HMPA 4PL3A 1ZAOA 5DNRA 5IZFA 3WF7A 3JYAA 3QYWA 4O7ZA 1DM2A 4MCVA 3TT0A 2C3JA 2VTMA 2YERA 5CEIA 1JQHA 3MPMA 3HRFA 4RFZA 4WIHA 4QMUA 3KXMA 4NT4A 3HKOA 2P4IA 4AGDA 2PVJA 1YXUA 5CU0A 3F5PA 3CY3A 3TTIA 5BMMA 1ZYLA 2VTTA 4DTKA 4PP9A 4G1WA 1ZOEA 2XJ2A 3CPCA 4N6YA 5E8VA 2O65A 5BYLA 1E9HA 1KE9A 4L68A 2R3IA 4YJPA 4YLLA 4E4NA 3SX9A 2GTMA 4O7TA 2YITA 5AADA 5B2MA 2FA2A 2XKEA 4L8MA 2WTVA 2RFSA 3IDCA 5FTOA 4EOKA 4TN6A 4FSRA 5FDPA 4DEIA 2OJGA 3DK7A 2YIRA 4WKQA 2OF2A 3RP9A 5GZ8A 5IH4A 5L2WA 4BKJA 2W5AA 4TYIA 2WMSA 3FMLA 5DPVA 4BDAA 3FE3A 4I23A 2VWYA 4I93A 3NZ0A 4W9XA 2OO8X 3DB6A 4UEUA 3FMMA 1GZNA 5EI2A 2A27A 3FYKX 4MF0A 2XNPA 3VHKA 4E7WA 2F4JA 4XG4A 3RZBA 1J7UA 3A61A 3Q4UA 4W9WA 3NIZA 4I0TA 3QYZA 2GFSA 4IWOA 2JDVA 5C1QB 4NK9A 5J5TA 3HZTA 1OIUA 2CCIA 2XKCA 3KXGA 3NNWA 5CI7A 3U51A 4AFEA 4AZSA 4EC9A 2X4ZA 4I21A 4EOPA 2O0UA 3MVHA 4O0VA 1J3HA 3EN5A 1V0OA 3RK9A 3BGQA 1P14A 4C4FA 1QMZA 4BICA 1DS5A 4IX4A 4UV0A 3UQGA 1Z9XA 2FSOX 1WBWA 4GMYA 3W10A 3C0HA 2ZJWA 2QKWB 2JBOA 5IMXA 2YAAA 3GQLA 4BCKA 5M4IA 3E8CA 4QRCA 3SXFA 2XK6A 4D5KA 2V0DA 4E6AA 4LM5A 1Z5MA 3HP2A 3QTIA 3FZTA 4QMWA 5CENA 1GZOA 3C7QA 4FKQA 4H1JA 5IDPA 5HIEA 2CKPA 2X7OA 3FV8A 4BTKA 5HVKA 5J1WA 4AX8A 5HORA 5EI8A 1KE6A 3BQCA 1ZY5A 1YVJA 3MWUA 4FG7A 5DMZA 5CS6A 2O63A 5AA9A 4F09A 5EYKA 3UGCA 2H8HA 4RLKA 4M15A 1ZZ2A 4V05A 4UY9A 1O9UA 3A4OX 4BDHA 3H9RA 3JUHA 3QRIA 4MXAA 2VWZA 3TL8A 4IVAA 4CKIA 4EI4A 3DB8A 4K8AA 3NEWA 4I0RA 4BDGA 3GFEA 3VQHA 3P4KA 1QL6A 2QG7A 2JAVA 3SHEA 3PXRA 1JWHA 3AC2A 1SVHA 3OWJA 4AUAA 3GUBA 5ACBC 3DJ6A 3ZEPA 4D4SA 5KMJA 2OKRA 2BR1A 3U6HA 3O7LB 3QRUA 3IDBA 2XBAA 3LXLA 3TG1A 5ICPA 5LVOA 2HWPA 3EN6A 4FIEA 1REKA 3GGFA 4RIXB 3QCYA 4XBRA 2EUFB 5TT7A 4G3EA 5KMOA 2A2AA 4GKIA 4HYHA 2XKFA 4HVGA 3KK9A 3ORIA 2UW8A 2XMYA 2YIWA 3EQPA 4TWNA 3HV7A 3HA8A 4JG7A 3ZM4A 5KHXA 4AA4A 1M2PA 4PDYA 3ZO3A 2IVSA 2YLFA 4IBMA 3HV6A 4OTGA 4PY1A 2PVRA 3F69A 3KA0A 5AIRA 4PQNA 2UVXA 1H07A 3EKKA 3T9IA 1L3RE 3FAAA 2WHBA 4QMYA 4XP2A 2BAQA 3JR1A 3EJ1A 4ZSLA 1R3CA 4C4GA 4KIPA 4H39A 4YC3A 3WI6A 5A4TA 3Q96A 3RAWA 4YO6A 2QQ7A 4USFA 2J50A 3DBDA 2IZSA 4DG0E 5EM5A 1J7LA 1PY5A 4S32A 4CKJA 2UZNA 4AA5A 4C3RA 4EQMA 4KUJA 4DH1A 1F0QA 4NM7A 4C7TA 3QTWA 2IW6A 2RGPA 1SM2A 2CN5A 2VV9A 2Y6MA 4I6FA 4LOOA 5F1ZA 4YZDA 3ZFMA 3WF5A 3FDNA 3HDNA 2G2IA 4QNYA 4BCQA 2VTNA 2YCFA 4FSWA 4BWXA 4CFFA 4B8LA 4EJNA 1PW2A 5A6NA 4G31A 2HZ4A 4R6VA 3RKBA 1U54A 3GU6A 4A07A 2VWWA 5KMLA 3TZ7A 5CEMA 4BR3A 3AMYA 3W2RA 1A06A 3A8XA 3ZOSA 2HIWA 2QHNA 2WMQA 2UZOA 4FOBA 1Q5KA 3NVMB 2R0IA 1XBBA 4KIKB 3WF8A 4M97A 3ID6C 5DYJA 5AIKA 4I92A 5DT0A 4BWKA 3SGCA 1WBNA 2CCHA 3LIJA 4OGRA 4EC8A 1Y6BA 2OZAB 4MVFA 5HNGA 1REJA 4OTQA 1E1XA 3HA6A 5H3QA 3NAYA 4YJTA 5HO8A 2CJMA 1CKPA 2XK4A 4M13A 4O7LA 4IJ9A 1H01A 4BCHA 4WUNA 4CZUA 5B7VA 4FTMA 3BIZA 1E1VA 1G5SA 3LFCA 2CKQA 4WOVA 4EBWA 5H8GA 4TYHA 4R78A 3NNUA 3PJ8A 3DNEA 5KHWA 2BRHA 3UQCA 3MB7A 2ITOA 4O6EA 4M0YA 4BIBA 4ZAUA 4BI0A 3VNTA 5AJQA 3Q2MA 1B38A 4UYNA 5IKWA 3ULZA 2REIA 2C47A 1WVXA 3EL7A 4L43A 4OAUC 2R3RA 3KRLA 1K2PA 3VF9A 4JXFA 1BI7A 3F5UA 2QHMA 1OB3A 4UMRA 1XH6A 3UJGA 4CFWA 3FI3A 4CYIA 4RWIA 3GCUA 5DHJA 3UC4A 3AD5A 3PIZA 2C3KA 5L8KA 5ANOA 3RMFA 3PXQA 4D2WA 4N0SA 5L4QA 4QTBA 4IADA 4DH3A 5JEBA 3GU5A 4HYIA 4OTFA 2GDOA 1KUTA 4TL0A 4C59A 3N9XA 1W82A 3O8PA 2VTSA 4EK3A 4BCOA 4F4PA 4L3LA 2VWVA 2XYNA 3CKXA 2WTIA 3D0EA 4UB7A 5EW3A 3TEIA 2ETMA 3F3UA 2DUVA 3T9TA 2PZIA 4YTHA 1SMHA 4BDDA 1KE7A 3FMEA 4U8ZA 4ALUA 3EQGA 5EM8A 3GC8A 4DC2A 4YZ9A 5LVPA 3C4XA 4WRGA 3NDMA 4BHNA 3QGYA 4JAIA 3R0TA 4GG5A 4FKVA 3MESA 4ZTLA 5CXZA 5L8LA 4L52A 5AAEA 3Q2JA 3MW1A 4D2PA 2C1BA 3ANQA 2BRNA 5E8SA 4TNDA 2QOCA 5BVEA 3ZSHA 4CZYB 3BGZA 3NUPA 4FT5A 2PZPA 4MNEB 2FSLX 1PXKA 2AUHA 2PZYA 2QU5A 5DGZA 5DT3A 3CLYA 5I9XA 3PIYA 4ITJA 4AOJA 2WTKC 1PXLA 3RWPA 2WEVA 5BVFA 5DEWA 3QRTA 4DLIA 3S00A 4C36A 2VTAA 4Z16A 3P23A 1MQBA 4YO4A 4FSMA 5IH6A 5I4NA 3VO3A 3DDQA 4S2ZA 4RFYA 2C4GA 3HAMA 4DN5A 4RIWB 1KV1A 4EYJA 4LRKA 3R73A 3RNIA 5J7BA 4MAOA 3FQHA 4JDIA 2HOGA 5EQYA 3QZHA 5DT4A 3OFMA 4FEUA 4O21A 2GPHA 4IAIA 2WELA 4FK6A 4RX8A 3RK7A 1M14A 3HL7A 3QTSA 1U5QA 4U97A 5LOHA 3Q53A 5E92A 3ZLWA 3MVMA 4E1ZA 4I6QA 2WIHA 4XBUA 1RW8A 2E9PA 2JDSA 3CPBA 3FL5A 3EFKA 3R71A 4MKCA 3JY9A 2PZRA 4G3CA 2BRGA 5IQGA 1UWJA 2WXVA 4AT3A 4CFVA 2GCDA 3PJ1A 3Q5IA 5HZNA 4F70A 2H9VA 4H3QA 5CXHA 1M2QA 2YIQA 3LJ2A 4ASXA 2C69A 5HE2A 4R3RA 2I0VA 4D5HA 1ZZLA 4LGGA 3BU6A 3VRZA 4I24A 4ITHA 4C02A 3AQVA 3IW8A 1DAYA 2BKZA 4ZK5A 4FSZA 4CT1A 3IGOA 5FDXA 4U43A 3I81A 2RFNA 5DR2A 5HD4A 4IAZA 4H3PA 1YI4A 5I9YA 2KTYA 3PE1A 4M3QA 4FKGA 3SXRA 3R01A 4AZEA 4YZMA 5ANKA 5EH0A 1QPEA 1ZYDA 3LW0A 4U45A 4BCFA 4C58A 4OLIA 1YOLA 4X0MA 2BZJA 2JLDA 5HG5A 3LMIA 4IVCA 2ZOQA 1CTPE 4DLJA 4D9UA 2GS6A 3SOAA 2EVAA 3LCKA 3QUDA 2GU8A 5FM3A 4DYMA 2RG5A 3GU4A 4ANBA 3QTUA 4B9DA 1WZYA 3QZIA 4QTAA 1WBOA 5AR2A 3BWFA 2C6LA 4AGWA 3DPKA 5EOBA 4YMJA 4IH8A 1WBPA 4YTIA 1G3NA 1P4FA 1O6LA 3EQHA 3O0GA 4PTEA 1OPKA 1Y8YA 3KXZA 3ZRMA 2PMLX 4DGLC 5DIAA 2RIOA 1PRYA 3H10A 2QKRA 2WZJA 2E2BA 3IO7A 2XNOA 4FTKA 2XIZA 3ALNA 4GT5A 3UG2A 5HG8A 1YI3A 3E7VA 2YJSA 4CCUA 3KB7A 3BBWA 4WNKA 1LPUA 5FRIA 5LARA 3QKLA 2CKEA 2WU7A 3LFFA 4RIYB 3PWDA 3PYYA 4MBLA 4YBKA 4MEDA 3NUUA 3HV5A 5LMKC 3NYNA 2C0TA 2W1HA 3QALE 3VS0A 5BYZA 5H8BA 5AFVA 4V0GA 3PXZA 1Q3WA 4OT6A 4R5SA 3DT1A 2R3LA 3LPBA 4I6HA 5CU4A 4XLIA 5ANIA 4O27B 2CMWA 2XEYA 3RPYA 3ULIA 2YCRA 3O50A 4F7LA 2IZTA 2PMOX 4EUTA 4YZCA 3D7TB 2ACXA 5JFSA 2HK5A 4GVJA 3LFDA 4E4MA 2V55A 4OTIA 2ZAZA 4IB0A 3ZZEA 4EOIA 5J8IA 2B0QA 2Q0NA 1PXJA 2OI4X 5CU3A 2BTSA 3UNKA 4GIHA 5H9BA 5A54A 1T45A 3G0EA 4FC0A 4BHZA 5IQAA 3AXWA 5EHOA 3Q6UA 4GKHA 3V5WA 4ZS0A 3TCPA 2W17A 3R2BA 2R3JA 4ENYA 4O7YA 1IA8A 3E7OA 4ZLOA 4FSQA 3UO5A 1GIIA 4KSPA 2I6LA 5EYCA 5HBEA 2Z8CA 4D4YA 4LG4A 4P4CA 4LL5A 4CQEA 3FHIA 3KULA 5ITAA 5M08A 3RCDA 3O7LD 4G9CA 2F2CB 5AMNA 5A4QA 2PMIA 4FKJA 4RWLA 4BGQA 3C13A 4LV5A 2C3LA 2JKOA 3G33A 2R3QA 3QRJA 4KINA 3GVUA 3BU5A 5FXRA 2OJFE 3LMHA 1GZ8A 4ZSEA 4FKRA 3TUBA 2BALA 4C2WA 5JH6A 3OY3A 1VZOA 3COIA 3MFRA 2WTDA 5CI6A 4JAJA 4O0WA 4FF8A 2JFLA 4K18A 5IA4A 2WFYA 3F9NA 5CU2A 2LGCA 1P4OA 2YM6A 2YM8A 5DFPA 3LQ3A 4ZMFA 3QKKA 1XO2B 4AN9A 1WFCA 3IONA 3R1YA 2ETRA 4MX9A 4IVDA 1J1CA 4J7BA 5CT0A 1ZMWA 4S34A 4IMYA 4F63A 1YQJA 3BE9A 3R7EA 5ANGA 3UIXA 3P08A 5JZJA 1K9AA 4B99A 2O2UA 5E8UA 3I7CA 4XG2A 5TR6A 3CGFA 3N51A 3P7BA 3EFWA 5I9UA 4G6NA 1UU3A 4IAFA 4TWOA 4JLCA 4UMQA 3PWYA 5AP6A 5HX6A 4O22A 4KS8A 5EDRA 3U54A 2YFXA 4O91A 4IIRA 2XJ1A 4KKGA 3VS6A 4J1RA 4BZNA 3OEFX 4JX3A 5BQ0A 3MH3A 4BFMA 3AC8A 3ZUUA 4O84A 2YM3A 1W98A 2JD5A 4X6RA 4TRLA 2QONA 4KRDA 3PPJA 3F7WA 1GOLA 2ITTA 2JIIA 4KWPA 3R1QA 3IDPA 3G15A 1FGIA 3UP7A 5AR5A 4Z3VA 3TACA 3RAKA 3MIYA 3UVRA 3NUYA 5L8JA 2PTKA 5M56A 3MBLA 1SZMA 3W18A 1OL6A 5CAOA 1H00A 2GSFA 5EHYA 3E3PA 3H30A 5CYIA 3DGKA 3R7VA 4O2ZA 2C5OA 5I3RA 2VTQA 4NWMA 3LE6A 2C6MA 4FTIA 4NIFB 4LUEA 2YJRA 4WBOA 5IQIA 3Q3BA 4GK4A 2Y4IB 4FT0A 3U87A 3N4TA 1PXIA 2UZVA 3HYHA 1KE5A 2J6MA 3EQIA 3MH2A 3FI8A 2ITXA 5IQHA 3MFSA 4C4HA 5K9IA 4FSTA 2VN9A 2JIVA 4GCJA 3QTZA 4CEGA 2UZWE 3MFTA 2YM5A 2I0HA 2FSMX 1OKWA 3CQEA 3C4ZA 3KC3A 4QMMA 1G8AA 5HI2A 1IAHA 2YDKA 4QP6A 3N4VA 2Z7QA 4NM5A 3GOKA 5GJDA 2RKUA 3UOJA 3VBVA 1X8BA 2OGVA 4L6QA 4E93A 1JKKA 1H24A 4EWQA 3DCVA 3LJ0A 3QFVA 3BE2A 1H1PA 1YRPA 3PZEA 3AT3A 3NWWA 3CSVA 3R9RA 1TQMA 3DLZA 5IA1A 3A99A 5HOAA 5EM7A 4AN3A 4RG0A 4MQ1A 4WT6A 5GIPE 1S9JA 4ZZMA 3ETAA 2QVSE 1GZKA 3BYVA 4D55A 5L2TA 1I44A 3OMVA 4PDSA 3K2LA 4QP8A 1H1QA 5M4FA 3VUKA 5LMKA 4PNIA 2VX1A 3UO4A 4L44A 3DFCB 1BL7A 5AP4A 2QCSA 3B8QA 4QQJA 4OBQA 5IG1A 2CNQA 4U42A 1NVQA 4DFZE 1OBDA 2P3GX 1Q24A 3SW4A 2C1AA 3R2YA 2BHHA 5BVOA 5AAGA 3KVXA 3GB2A 2XCHA 1ZYSA 2R0UA 3BBTB 5HQ0A 5FXQA 4AW0A 2J51A 4XV3A 5HGIA 4YNEA 3NMUF 4S33A 3ORPA 4RBLA 4RC2A 4IC8A 2BIYA 2J0IA 4Z55A 3OWKA 3FLZA 4I5MA 3DU8A 5CVFA 1ZYJA 4RSSA 3VW6A 4F1OA 1H25A 3U8WA 4MXOA 5D7VA 2DWBA 3P7CA 1PYXA 3UYTA 4X3FB 2CGWA 4EOOA 5J7HA 3MA3A 3EYHA 4O7WA 4MXZA 3E64A 4XJ0A 3ZFXA 3DKFA 4XG9A 2BZIB 2UW4A 2BRMA 2Z2WA 4YLKA 4FEWA 2R3OA 4B6LA 4UZHA 3CR0A 3CJFA 2ITNA 3MN3A 3QTQA 2FO0A 4X2KA 3HRCA 4FGRA 1OZ1A 3RPOA 2X0GA 1PYEA 2W0JA 4NJDA 2PVKA 4KABA 4XRLA 3SXSA 4WNPA 2ZM4A 5HKMA 3LXKA 4RZVA 4EK5A 2J0JA 3PVGA 3UIBA 3RPVA 4ZTMA 3ZXTA 4TT7A 5FP5A 1H0VA 4F0IA 3FHRA 2OW3A 4FZAB 5ETCA 2IZUA 2VWBA 3MY5A 3NSZA 3PSDA 4DGMA 4DE4A 2W1ZA 4ZJIA 4BYJA 3JPVA 4TWCA 4M69B 5CEQA 4HVDA 3UZTA 3SVVA 1P5EA 1L8TA 4IM0A 3CTHA 2XKDA 3M42A 4G17A 5B0XA 4BY9E 1OUKA 5BUIA 5EM6A 5KMNA 2QO2A 5GZ9A 4K33A 1H27A 4TZRA 2CSNA 3ZBFA 5C4LA 1U4DA 3ZU7A 5IQEA 4RLLA 4C62A 4YBJA 1SNXA 3W2SA 4DT8A 3LVPA 3TUCA 2WOUA 2X8EA 5BUJA 4FYNA 3BYUA 4UX9A 1PMEA 2GS7A 5LQFA 5E1EA 3P5KA 4R3PA 4IJPA 5AUTA 4X3FC 4CFMA 5AUWA 3MY1A 5J87A 4F6WA 3GOPA 1YW2A 4QD6A 5IH5A 1MUOA 4FTNA 2IPXA 5IQCA 4IDVA 1XJDA 4H58A 4NUSA 3OXIA 3UVQA 4X3JA 1GAGA 4FZ6A 2ITWA 4IB3A 2A1AB 2OJJA 3QCQA 2IVTA 4HZSA 5AV0A 4ZY5A 2P55A 2R7IA 4IM2A 3OG7A 1OPLA 2ZMCA 3GENA 3AGLA 4Y73A 1JKSA 3QTRA 3AOXA 4Y85A 4F0GA 4D1ZA 1STCE 4FTJA 2R2PA 2UW6A 1OKYA 4M84A 4F9WA 3OY1A 5AP0A 3OZ6A 4CMOA 2WMWA 1H0WA 3R8LA 4ANMA 5HNIX 5CSPA 3ZO1A 5LMBA 3BELA 3F66A 3DKCA 4DGOA 4FE2A 3CTJA 4LMNA 4WUAA 2YWPA 4CG8A 4FIFA 3QXPA 2JDRA 3EFJA 3MB6A 4N6ZA 5GJGA 4IX3A 5AV1A 5HU9A 5DLSA 3CBLA 3IKAA 1SYKA 4GK3A 4XX9A 4F9CA 3VBTA 1H1SA 3I0QA 3OCGA 4YZBA 4HGLA 4C34A 4E5BA 3MPAA 5C27A 5EDPA 3R7UA 4HYSA 5DA3A 3NUXA 3QL8A 2IWIA 5E1SA 4QMTA 4FNYA 4DGGA 4S31A 4WO5A 4FTQA 2I1MA 3OOMA 3DK6A 4QP4A 3CE3A 3F3WA 4AFJA 4XG3A 1QPJA 3TV6A 4AP7A 2AYPA 4GUBA 1IAJA 3C0GA 3IOKA 2EXEA 2X8IA 3FKLA 4NZWB 2PU8A 3VUMA 1V0BA 1IA9A 1GIJA 4YGAA 5ETFA 4RGJA 1IEPA 4YSJA 3QWKA 4R1VA 3V3VA 3V5QA 3KXHA 2VX3A 4QMLA 4RVTA 3OF0A 5AR4A 1T46A 3VS5A 2ZM3A 4BCIA 5F20A 4A9UA 3WF6A 2HXQA 3PIXA 3W55A 4EZ5A 2W96B 3PVWA 4V01A 4AQCA 2JIUA 4E73A 4I41A 4GK2A 4RJ6A 4N70A 1WMKA 3DXPA 4FSUA 3VBXA 2X7FA 1DAWA 3ZFYA 4DEEA 3E8NA 3F2NA 4PL5A 4RJ3A 5D11A 1RDQE 4LV8A 3S0OA 4BI2A 3UVPA 1CKIA 2WAJA 3SDJA 4E8AA 4O7VA 4FODA 5HX8A 2BDWA 3FC2A 2QD9A 4TY1A 2IW9A 4TNBA 5TO8A 2CGXA 5HLWA 4FSYA 5DRBA 3CY2A 3VWAA 4YNOA 2R7BA 5K0XA 4QTEA 4C38A 3F7ZA 3U55A 2X6EA 2JDOA 2ZB0A 3VC4A 3DDPA 3KRXA 5HU3A 4RVMA 4PDOA 3AD4A 3PA5A 3U9NA 2UW5A 2GFCA 4F1TA 5LCJA 2WIPA 4FKTA 2VTJA 5EQEA 2YACA 3EZVA 4QYEA 2X7GA 4NEUA 4UZDA 4CV8A 1YWRA 4K9YA 4EH3A 1ND4A 4F6SA 2PSQA 3NAXA 3ZO4A 4MXCA 2XK7A 3ZLXA 4ZLYA 4NKSA 2VTOA 5HLNA 3V8WA 3IECA 3Q04A 4BYIA 5BX0A 4Y8DA 5HIBA 3IPHA 5L2IA 2BHEA 5D10A 4QMXA 3BRBA 3VS2A 3PLAE 2WOTA 1OIQA 4RMZA 4AE9A 4DCEA 5K5NA 2VNWA 4FUXA 1UKHA 4JBVA 4LQMA 4LGHA 2OICA 3V5TA 3RHKA 5FBNC 3PG3A 2JFMA 3WZKA 4R77A 2OIDA 2VTIA 5L6WL 2X2KA 5DR9A 4ZEGA 5CAUA 2CDZA 3A60A 3LXPA 2PVFA 2O8YA 3B8RA 2WQMA 1HCLA 3PY3A 3WZDA 4AGCA 4HCTA 4Z7HA 4YC6A 4YTFA 4YPDA 2FYSA 5J95A 5E8YA 2VO6A 4KD1A 3LCDA 3LFAA 4TWPA 3A7GA 3ELJA 1A9UA 2RFEA 4I1ZA 2V7AA 4F6UA 3VJNA 3OUKA 4C8BA 5FTQA 3OW3A 4HW7A 4EONA 4FMQA 4QMSA 4EQUA 1KWPA 5J1VA 4ZTRA 5I0BA 4BCMA 4GFGA 4FZDB 5T3QA 4ACHA 5JK3A 3TUDA 2UVYA 2F57A 4LRJA 4YPSA 4HGSA 1RQQA 3THBA 3UMWA 1XWSA 3WYYA 4CCBA 2J90A 3RINA 3ZC6A 4AS0A 5IPJA 3FMKA 2Z7RA 5HTIA 3VBYA 2ITPA 4ZJJA 3ZO2A 2I7QA 3ROCA 4HPTE 3EHAA 4KRCA 3MPTA 4FIIA 3WE8A 4PPAA 1WCCA 4GU9A 2XEZA 3NVKI 4DH7A 4FTRA 4O96A 5I3OA 3QQJA 3OXZA 4EWHA 4RVLA 3K3JA 4BTMA 4UXQA 2BTRA 5F95A 3VW8A 1EH4A 3F61A 4EL9A 4I20A 4NCTC 3R30A 2YLEA 4A4LA 1VR2A 5LMAA 3PLSA 4D2VA 2PUIA 3FZSA 5CZIA 4U40A 5A4EA 5AR7A 4IB1A 1OL2A 4J53A 3F5XA 5DBXA 4X2JA 4JQ8A 1M2RA 4JL9A 2C5YA 2JEDA 3F3ZA 3BLRA 3Q4TA 4IM3A 4RIWA 3UOHA 1NVSA 4XLVA 5KMMA 3MJ2A 5L6PA 4ASEA 4O0TA 3EWHA 4G5PA 3A62A 4P5QA 3IW7A 4WNMA 4XYFA 4FYOA 3BLQA 1MQ4A 4MBJA 4RJ5A 3ZYAA 3BWJA 2W1EA 3HVCA 5J9LA 1ZOHA 2QODA 3F2AA 3DBCA 5HEZA 1Q3DA 2WQEA 3NW6A 3BYSA 3POOA 2GTNA 2IVUA 3FZ1A 4ARKA 3MTFA 4KS7A 4DFLA 5FM2A 1KOAA 4AOIA 4PDPA 4W4YA 2W4JA 3ACJA 5LVLA 2PE1A 1MP8A 4HYUA 4MD8E 4MH7A 4CTBA 3C51A 3KFAA 4EEVA 3HAVA 2J9MA 2EXMA 2W5HA 1LEZA 4LOQA 3UNJA 4DFYA 2QLUA 3HMNA 3BV3A 2OFVA 4O0RA 4JRVA 4WG3A 4ASZA 2PVNA 2AC3A 2XK9A 4XRJA 4DHFA 1OUYA 3NNVA 2BILB 4JJRA 2YDJA 5I5ZA 1OL7A 3KXNA 2OU7A 3FSKA 3QCSA 4PF4A 4FV8A 4D0XA 5B2LA 3CJGA 4L01A 2F7EE 3MVJA 5FQDC 3GP0A 4GT4A 3FEGA 3ATTA 3U9CA 4O86A 2YN8A 4JT3A 5C8NA 2PUNA 5C9CA 3IW5A 4L3JA 3R00A 2WMRA 2QLQA 1BUHA 3LFNA 4PNKA 1W84A 2P2HA 2FUMA 2QOKA 4JIKA 4DEBA 3DK3A 3V04A 5JGAA 1YXSA 2X9EA 2C6KA 5JFWA 3ZM9A 1Q61A 3SAYA 4CMUA 1CMKE 5AV2A 2XNGA 3C9WA 4D1SA 5CANA 1WVYA 1IR3A 5CNOA 4U80A 3RAHA 3VUHA 4IX6A 4U6RA 2R4BA 3I6WA 2V5QA 3QA8A 3QQKA 4X7QA 2ETKA 1TQPA 1F5QA 5F4NA 5HCXA 3W1FA 4D4VA 2R64A 4BDIA 2ERKA 4USEA 1JLUE 2QOIA 3R7YA 4QYHA 3RHXA 2ERZE 5JMSA 5HE0A 5IA0A 5GJFA 4ERWA 3BI6A 3OP5A 3JVRA 1TKIA 4NM3A 3ZLYA 2PUPA 4GJ3A 2EXCX 4CFNA 4PV0A 4I6BA 3VIDA 4QMNA 3TN8A 2OZOA 3LHJA 2FGIA 4IQ6A 4PX6A 4CG9A 5C4KA 4W4VA 3IW4A 2W9ZB 3KVWA 5CF5A 3TNIA 4BDJA 4FA2A 4NIFA 3NR9A 1SVGA 4R7BA 4ZLZA 1W7HA 5CU6A 3RPRA 4XNEA 1GIHA 5AAFA 2JKKA 4EHGA 5CQWA 4ZZNA 4GV1A 2PE2A 3I0OA 2UZDA 3EKNA 3II5A 3HGKA 4FGBA 2XZSA 3FMHA 2XVDA 4EK6A 1JBPE 4C57A 4FEXA 2WTWA 5DG5A 4K1BA 5DVRA 3OC1A 4QT1A 1I09A 3LFBA 4DINA 1CM8A 2F7XE 3WF9A 3W2OA 4CYJA 1BLXA 3LCTA 4WA9A 3UQFA 2YCQA 4GS6A 5M4CA 1F3MC 3EQFA 5HD7A 1NT2A 5HHWA 4BKZA 2BUJA 4QYGA 3SRVB 4BGHA 3PA3A 4ANLA 2HZIA 3F5GA 2C6EA 2C6OA 1LP4A 4M0ZA 3KXXA 5DRDA 3I1AA 4R3CA 4C33A 2HW6A 4MXXA 5IQFA 2BZKB 2HY81 3O8UA 4BZDA 3BLHA 4CNHA 1B39A 3W2QA 3D83A 2VO7A 4FL2A 5D9HA 4V04A 2CNVA 3LM0A 3EMGA 1Q8ZA 3TZMA 5J9ZA 4ZSGA 3LQ5A 3D2KA 3D4QA 3OOGA 4BCPA 3CQWA 3KY2A 3UZRA 4GT3A 2GNIA 4Z7GA 5IQBA 5TKDA 1UVRA 2F7ZE 3I7BA 4I94A 4Y5HA 4G5JA 3NIEA 4A9RA 5HLPA 4ORKA 3GXLA 3R7IA 2PYWA 5IEXA 2VAGA 1R1WA 3VUGA 3KQ7A 4XUFA 5AP3A 2UZBA 3L9PA 3QQLA 5KE0A 3V8SA 5M07A 3HV4A 4JOAA 4AW5A 3DJ5A 3LLTA 5AR3A 5M4UA 3NPCA 3CIKA 4NL0A 1URWA 4ZJVA 5KKRC 2W7XA 3MTLA 2VUWA 5E4HA 5EYDA 2XS0A 3QWJA 3ORZA 3EH9A 4F64A 1XR1A 3P86A 3RM6A 2GNGA 3A7JA 3LQ8A 4O2PA 3GBZA 3V5PA 4IWQA 3OVVA 4FR4A 4QP3A 4OTHA 3UO6A 3KMUA 3O8TA 3IGGA 2OF4A 5CEOA 1B6CB 3CGOA 4ZS4A 2W5BA 2GNFA 3KGAA 5LWNA 1NXKA 4EOJA 2YIXA 4OUCA 4ZZOA 4BB4A 3K5UA 4D58A 2PE0A 2YHVA 3QF9A 4PMTA 2GS2A 3MSSA 2R3PA 1YKRA 3C50A 1YI6A 1FQ1B 4BBMA 4QTDA 1JSTA 4E4XA 4J98A 5I9VA 4ZIMA 1P2AA 4RFMA 4EH6A 4QQ5A 3G9LX 3TNQB 3V6SA 3VAPA 3PRFA 4HGTA 1XHAA 2JKQA 3QXOA 4FX3A 2YAKA 4F9BA 5AUZA 3NUSA 3PZHA 1GJOA 2VZ6A 2UZLA 3REPA 4AXAA 5CF6A 5AP1A 3RK5A 4BCGA 3EQBA 3CP9A 4E5WA 3C4CA 1RE8A 2B4SB 3QA0A 3L1SA 3D7TA 2VTHA 1FVTA 3FJQE 3NW7A 3LXNA 4F7JA 4QP7A 4UALA 5HVYA 1BL6A 4QPMA 3IQ7A 3KRJA 2XRUA 3DAJA 3R9NA 3WIKA 3LLAA 4QQTA 4X6QC 3ZLSA 4V0GB 5HO7A 5M09A 4HGEA 2E9VA 4C4EA 2BAKA 2J2IB 4CRLA 4OAVB 2G2HA 2WMXA 4DITA 4RIXA 4A7CA 5L3AA 4O83A 4GEOA 1OGUA 3OWPA 2AC5A 3OT8A 3ATSA 4D2RA 5AUYA 2P33A 3FLNC 5BNJA 2WTJA 3W2PA 1Y91A 4NJ3A 2GNLA 5DE2A 2ZV8A 5BVKA 4ZSJA 2UW0A 2W1DA 4NFNA 1NVRA 4YLJA 4WSQA 3F88A 3C5UA 4F0FA 4EORA 4CKRA 3P79A 5AUVA 4JVGA 3DTWA 4FG8A 2QR8A 3VRYA 3O2MA 2OBJA 3E62A 4K2RA 3RTPA 2C3IB 4ACMA 1ZMVA 4BIDA 5A6OA 3S3IA 3QBNA 1ZOGA 5E8WA 3OUNB 4ZY6A 3O17A 3W8QA 4NU1A 1XH8A 2JDTA 2XB7A 4LRMA 5K4JA 1H4LA 4MNFA 4DBNA 4FL1A 3DFAA 3R1SA 3BHYA 5ACKA 4DG2E 1OM1A 3HV3A 4O1PA 3R7OA 4A4OA 4O6LA 4IE9A 2O64A 4R8QA 3UE4A 2RSVA 1MRVA 5HG7A 5TOZA 5BUEA 4BVUA 4ZSAA 4AOTA 2RG6A 3NX8A 3VUIA 1Q41A 2XNEA 3KMMA 4KBKA 1QPDA 3AC1A 3DAKA 4KBCA 2X39A 3M1SA 5E9EA 2YZAA 3C0IA 4BBFA 2G2FA 3QLFA 4J8NA 5GHVA 1YDTE 1MRYA 2A0CX 3ZXZA 4CLJA 3PJCA 3A7FA 2QNJA 4PMPA 2VGOA 3KULB 5CF8A 3W2CA 5M55A 1AD5A 1BI8A 3PY0A 4TYJA 4IAKA 4DH5A 2CNUA 5EQPA 1ATPE 5F9EA 1OIYA 4JI9A 3AC3A 2JAMA 4RC3A 2R3FA 3GU7A 4L7FA 1BX6A 2OG8A 3R21A 4UWYA 4BBEA 2IO6A 4UYAA 5JSMA 1OECA 2EB3A 3EQDA 3KCFA 4RZWA 3R8ZA 3HMIA 2OLCA 3G6HA 4H05A 3KF7A 5E7RA 2G15A 4FKPA 1SVEA 4FT9A 3UODA 4BTJA 4J52A 2DYLA 4ALVA 2BVAA 1XH4A 3QD0A 3KU2A 4FBXA 3TZ8A 3CD3A 1A48A 2ZMDA 3QU0A 4JR7A 5E8TA 5HNBA 4EOLA 3U6JA 5FWKK 4FEVA 3RWQA 3PUPA 1WAKA 4O0SA 2BMCA 2HZNA 4P90A 3BGPA 1K3AA 3NLBA 3UP2A 5HTBA 4PTCA 4CXAA 4EJ7A 4EZ3A 4GIIA 5AM7A 2OJIA 2Q0BA 4YU2A 4XEYA 4UMPA 4FICA 4EQCA 3QUPA 3U4UA 3N4UA 3UIUA 4RIOA 2C5NA 4TTHB 3NS9A 3QX2A 4FV2A 3D2IA 5CNNA 5IA5A 4E6QA 4IB5A 1XKKA 3KK8A 4TYHB 5FXSA 2XH5A 3FPQA 4YSMA 4ZMEA 2VNYA 2XF0A 3AT4A 5I9WA 4IHPA 5M57A 5KKRB 3D5WA 3SQQA 4U81A 3FC1X 5LVMA 4EYMA 4DBXA 3HP5A 3GC9A 3QD3A 3FMJA 1J7IA 2VX0A 4IVBA 3KRWA 5L2QA 4YC8A 4QPAA 4Q5HA 3QZFA 3ET7A 4E4LA 1XH7A 2UW9A 3UOLA 4AAAA 3FLWA 3WZUA 4D2SA 5EYMA 5FGKA 1YOJA 4AU8A 4JBQA 4KKEA 4YJVA 5D41A 3NNXA 4FIHA 4OBOA 4CQGA 4RWJA 3LZBA 3H0YA 4N4SA 4XP0A 3SD0A 2H96A 1LR4A 3AT2A 3E63A 4PPCA 3FXWA 4XCUA 4EOSA 3FMNA 4YTCA 4GFOA 4D28A 5FBOA 4IZ7A 3MFUA 3VBQA 2PULA 5HE3A 3BHHA 3OXTA 4PUZA 4RA5A 2PVHA 3MI9A 1URCA 2R9SA 5CTPA 5JN2A 3OCBA 5AX3A 2QOHA 4NM0A 1ERKA 1AGWA 1PXPA 2WQOA 2Y4IC 2WD1A 3PSCA 4FK3A 5CSXA 3SA0A 2HXLA 3H9FA 3GC7A 5EW8A 3OHTA 3D15A 5AX9A 3ZDIA 2W9FB 2IZRA 3MS9A 4ZP5A 3RVGA 2R3KA 3WBLA 4CLIA 5M51A 1WVWA 2OIQA 5JRSA 4J96A 4AN2A 3AMAA 3K54A 4L46A 4M7IA 3UZPA 3CTQA 4BDEA 2DS1A 3RALA 2ESMA 2FSTX 3DQXA 1XBCA 1H1RA 4I5CA 4CT2A 2BFXA 4AT4A 2JGZA 3BZ3A 4IWPA 2IJMA 5JKGA 2HELA 4A06A 2R3NA 4J71A 4LI5A 2GHMA 2PL0A 5A4CA 5CVHA 5I9ZA 2X6DA 2WMTA 3E87A 3COMA 5KCVA 3A2CA 3R1NA 4TKSA 3OWLA 3R8VA 3E5AA 2CGVA 3KMWA 2PPQA 4OBPA 4G6OA 1W0XC 2VU3A 3DBQA 5CWZA 5IUHA 2X1NA 4JBOA 4PMSA 2J5FA 5C01A 1SNUA 1VYWA 2ONLC 4AG8A 4IAYA 3BPRA 1QPCA 3E93A 4L3PA 2J5EA 2YCSA 4O38A 3VF8A 3D14A 4Q9SA 2IG7A 3BQRA 4EH2A 2FB8A 3TNWA 4X2GA 3COHA 5BVWA 4ANQA 3LKMA 3FZPA 4EZ7A 4NW5A 2ZVAA 3MJ1A 4YJUA 4ANSA 2B1PA 4G9RA 4UBAA 3PP1A 1XH9A 2PMNX 3DOGA 3R04A 2QOLA 4Y83A 3RBWA 2OWBA 5AP2A 3VHEA 4FIGA 4RJ8A 3V5JA 4B7TA 1OMWA 4X2NA 1CDKA 3AC4A 3ZUTA 3D5XA 2YWVA 1JSVA 3Q9WA 2BIKB 2I40A 4JNWA 2X9FA 2EB2A 3QGWA 1YOMA 3WOWA 3ORXA 2CPKE 1UU8A 4J99A 1IASA 3I79A 1APME 2ZV7A 2X4FA 4FV1A 4GG7A 3EL8A 3DJ7A 3QRKA 4II5A 4GUEA 2Y6OA 3L9LA 4K77A 4U5JA 3CQUA 1OBGA 3C4EA 1JSUA 3TIZA 2WEIA 5K3YA 3AC5A 1ZLTA 3FLYA 3SRVA 4E6DA 1VJYA 4WRSA 4E5AX 3ZHPC 4HVHA 3ODYX 4A9SA 2WTKB 5A4LA 4JDHA 2B9IA 4PL4A 2E9UA 2XP2A 4C35A 3CCNA
chains in the Genus database with same CATH superfamily
4P7EA 2PVMA 4EOMA 4AF3A 3VS3A 4DGNA 3DBFA 4NTTA 4XP3A 3EFLA 2B53A 3WARA 4RJ7A 3TKIA 1Q62A 3FSFA 3QLGA 4QPSA 4IFGA 4D4RA 4MF1A 4FL3A 5EFQA 1YXTA 2F49A 2BDFA 1G8KA 3H4JA 4IANA 3LJ1A 2CLXA 4JRNA 1FVRA 2B7AA 2F9GA 2ZV2A 4O1OA 1FMOE 3BX5A 3QQUA 4APPA 1OL5A 4MYGA 5CZHA 4BZOA 5JGBA 3Q4CA 1RJBA 3NYXA 1R78A 1TQIA 5IF1A 4DTAA 4U41A 1GY3A 5FLFA 3L9MA 3FQEA 3GCQA 4GSBA 4M12A 3C4WA 2A19B 4GVAA 3NGAA 3E8DA 2PZ5A 3D7ZA 1PXNA 2Y0AA 3E8EA 3AD6A 5T6KA 4N57A 3LFSA 4AA0A 2F2UA 3ITZA 3ORTA 1XMMA 3C1XA 3AG9A 5IUGA 4KB8A 5EG3A 4GYGA 4HNIA 3UDBA 4FKIA 3OCTA 1H26A 1VEBA 4BDKA 3H0ZA 1Q8WA 4BKYA 2GNHA 5KMKA 1UNGA 2WMUA 3VVHA 2XIXA 3DZQA 1UKIA 4L7SA 4BGGA 4BWPA 5F94A 2UW7A 2YA9A 2XIRA 1AQ1A 3NCZA 4C4IA 3C4FA 4PPBA 2UV2A 3ZS5A 2W1CA 3VN9A 4CRSA 2W1IA 2Y8OA 2CGUA 3ANRA 3I60A 4L9IA 4APCA 4DG3E 5HTCA 4ZTQA 4Y46A 3QC4A 5A14A 4FEQA 4BI1A 2DQ7X 4FV4A 4E20A 3FQSA 3ENMA 5HESA 5CASA 4FT3A 4U0IA 1U59A 3FXXA 2QR7A 1CKJA 4F9AA 3PXKA 4RJ4A 4F08A 5BVNA 5HCZA 2NO3A 2SRCA 3GFWA 3KKVA 4HZRA 5G1XA 1FGKA 3DBEA 3IG7A 3Q9XA 3Q4ZA 4FZ7A 4FTCA 4DAWA 5CF4A 3DV3A 1PMVA 5IEVA 1U54B 4LGDA 4P2KA 4C2VA 4JQ7A 4AW2A 4BC6A 2EU9A 4G3DA 5A9UA 5BYYA 3LM5A 4PWNA 2V7OA 1KOBA 3OBJA 1NY3A 4O0UA 5HCYA 4PRJA 5DH3A 3VUDA 2QOFA 3GI3A 3MV5A 4HCUA 4L42A 1ZMUA 3O51A 5E8XA 3FWQA 4AACA 4R7HA 1YHSA 2ITVA 3O23A 4GL9A 3TNHA 4A9YA 4QMOA 4ERKA 2QU6A 4IDTA 4MD9E 4FV0A 4JG6A 4CV9A 4TPTA 2WQBA 2XNNA 3WIGA 3LMGA 4EKKA 2X2LA 2YM4A 4UXLA 4YJNA 3TNPC 2VWXA 3S4QA 4MNEA 4D9TA 4KNBA 3ZBXA 5A46A 4F7SA 2XUUA 1O6YA 3PTGA 5D7AA 3EB0A 2WPAA 1OL1A 3ZCLA 4RQVA 3K5VA 4DEAA 4I0SA 1LEWA 5JQ5A 4USDA 3DNDA 5H2UA 2G9XA 5IEYA 1XBAA 3LAUA 3LFQA 5JQ8A 4D2TA 1BYGA 4F99A 4C37A 2W05A 3TTJA 1PKGA 4RRVA 5KNJA 4CGAA 1Q8YA 4AZWA 1UNHA 2B55A 5FG8A 3GT8A 3OROA 3DTCA 4QP1A 3UC3A 2VTLA 2C0IA 3LOKA 2X0OA 3GCPA 3OD6X 4C4JA 3HRBA 4DFUA 1BMKA 4HVSA 2FH9A 3ZC5A 4K11A 1OI9A 3GQIA 2R5TA 4U79A 1J91A 2J0LA 3TKUA 3WE4A 3MA6A 4W8DA 3MY0A 3VQUA 4ZTSA 2WGJA 2Y9QA 3SOCA 4D0WA 2C6DA 4FKWA 5AUXA 1YDRE 3T8OA 4X2FA 4EH7A 3VBWA 5AWMA 4XG6A 3P5JC 4UWBA 3HX4A 3E3BX 2P2IA 4FKOA 1YHWA 1UV5A 3BEGA 4IZYA 3OW4A 3BEAA 1WBTA 5KZ0A 3RPSA 3NW5A 3R63A 1FBNA 2C6IA 4I4EA 4OTRA 3EZRA 4W8EA 3CC6A 2H34A 3OTUA 4RX9A 2PUUA 2BFYA 3PVUA 4C0TA 5E8ZA 4O7RA 4QO9A 4HNFA 4YHFA 4O4BB 1OVEA 5KO1A 5C8MA 3A7HA 2GQRA 2Z7LA 3R22A 4XV9A 4F7NA 5KBRA 2CN8A 4WG4A 3P1AA 5GNKA 4FT7A 1Q97A 4OR5A 2W4KA 4NH1A 1YXVA 5L2SA 4XV1A 3BKBA 3PXYA 4B8MA 5J79A 2IF8A 3CKWA 1WBVA 3I6UA 4LL0A 5KZIA 5D12A 3LFEA 3UBDA 3KREA 3Q6WA 3PG1A 2R3MA 3OTVA 4FI1A 1OKVA 4QMVA 3RI1A 4BL1A 4DH8A 5HICA 1YHVA 2E9OA 2OH0E 4EKLA 4E6CA 2GNJA 3RCJA 1OPJA 3FI4A 4LYNA 3BHTA 3L8PA 4CD0A 3FPMA 1JNKA 4WBBB 4DEGA 4IEBA 2O3PA 5KUPA 4AGUA 3FMDA 3HLLA 4I5PA 4M68A 1XQZA 3DKOA 3EN4A 5CLPA 5LJJA 2YZLA 5IQDA 3NUAA 5J9YA 2NP8A 3EQCA 1M7QA 5M53A 3GC0A 4ANOA 2R3HA 5EDQA 1HOWA 5B2KA 1Y8GA 4FNXA 3TIYA 3COKA 1KE8A 3QAME 3VS1A 3HDMA 3ACKA 5FUTA 4WHZA 4YJRA 4IAAA 3TDWA 3IW6A 2OXYA 1FPUA 3V8TA 3HECA 4EH5A 4JX7A 4YZNA 1ZY4A 4MD7E 4PP7A 4EBVA 4FVRA 3KEXA 4IZ5A 4Q9ZA 5LXMA 3BYOA 4M67A 3IOPA 3OS3A 4FNWA 4U44A 2QO9A 3DLSA 3ENHA 5CALA 4RX5A 3TI1A 1JOWB 4BCJA 3A8WA 4J97A 4GFMA 1DI8A 5FP6A 3SV0A 5KX8A 4BDCA 3F3VA 4FNZA 4IWDA 5EW9A 1IRKA 3M2WA 4QNAA 2J0KA 3E88A 3E92A 4JDJA 3HEGA 4YR8A 3SC1A 3PPZA 4FV3A 1UA2A 4JG8A 5A3XA 5CEPA 1ZWSA 3FLSA 2B9FA 4W4WA 2PY3A 2JC6A 5HVJA 3MYGA 3UPXA 4FV7A 4IW0A 3FLQA 4Y72A 4AZTA 5JRQA 4PMMA 3FXZA 3G5DA 4TW9A 5IDNA 4IACA 5EOLA 2UZEA 2BROA 2VO0A 1M52A 4I4FA 5K4IA 1JKTA 2XA4A 3FKOA 4TYGA 5BVDA 4QQCA 3QQFA 3VS7A 3EN7A 2QI8A 2BZHB 2XK3A 3VULA 2BCJA 2XRWA 5C03A 4BDFA 5HBHA 3TV7A 3A7IA 3EQRA 4OW8A 4U3YA 1Q8TA 3MH0A 1ZXEA 5AP5A 3RJCA 3QD2B 4I5HA 3UNZA 1BKXA 3FI2A 5TF9A 3SKCA 4QYFA 3P9JA 4FVPA 5FD2A 4IX5A 4C3FA 2HCKA 4I22A 2B9HA 5KBQA 3L8SA 4O0XA 5ETAA 3SW7A 4WSYA 3PE2A 4KIQA 2XK8A 3F6XA 5FEEA 4CZTA 1U5RA 2OXDA 4QOXA 5K5XA 2YDIA 3AGMA 3DZOA 4ACGA 4DA5A 4O81A 1J1BA 3IS5A 5K0KA 4LFIA 4XOZA 3SLSA 1FINA 1JPAA 3PFQA 5DI1A 4ACCA 3BHVA 2HZ0A 2CHLA 3QX4A 1V0PA 4OT5A 3SG9A 4K6ZA 2BKKA 3UTOA 5CAPA 3O71A 2W4OA 3MVLA 3Q52A 4CMTA 4O0YA 3G2FA 2C6TA 3JY0A 2G1TA 4FUYA 4QP9A 3EYGA 5ANEA 3T3VA 3TZ9A 4AQKA 2WTCA 5D1JA 2JKMA 2QOQA 1W83A 2Z60A 2OIBA 4XG8A 2YEXA 5CT7A 1PKDA 4ZOGA 3KN6A 3V6RA 1IG1A 2BAJA 5CX9A 5H8EA 4L00A 3TJDA 3UMXA 1G8SA 3PSBA 4F65A 2H6DA 5LCKA 3DA6A 2PWLA 2XBJA 3G6GA 4I3ZA 4U7ZA 5DEYA 2UVZA 3OT3A 3MGYA 2HW7A 3TWJA 2VRXA 2FVDA 5CAQA 3FY0A 4NTSA 1Y6AA 4YP8A 4P5ZA 4ZXTA 5HIDA 5TE0A 3OEZA 3ROYA 3ZRLA 3F82A 4ANNA 3L9NA 3D9VA 4Y5QA 2R3GA 3WYXA 3R8UA 4JQEA 3I4BA 3CXWA 4MWHA 4QMPA 3R6XA 4B0GA 1PF8A 4CFXA 4RQKA 1R0EA 4W4XA 2UW3A 1R0PA 1H28A 1DI9A 2X2MA 4RT7A 5C26A 4FV6A 4FKSA 3W0QA 3R83A 4H3BA 2XNBA 5DN3A 1FVVA 2NRYA 3JXWA 1YDSE 4OTWA 5EKNA 3PVBA 3ZRKA 5FTGA 4LOPA 2IVVA 3MIAA 4FSNA 4GJ2A 2VD5A 4EHZA 5AV4A 2BRBA 3P7AA 2Z7SA 4KKHA 4CVAA 1TVOA 4G34A 4NKAA 3U4WA 3GU8A 4MHAA 5EI6A 2OXXA 4DTBA 4HJOA 4AW1A 2B54A 2UZTA 2VWUA 2WMBA 4ONAA 2Y4PA 3S1HA 2XAMA 4FG9A 4DFBA 1UU9A 2VTRA 3G0FA 3R9HA 2W99B 2YISA 3FUPA 3TMOA 5FEQA 4FV5A 4XG7A 5GINE 4CFUA 3ODZX 3ORMA 5G6VA 3V5LA 4Z9LA 4ITIA 3ZZWA 2XIKA 4KAOA 3I5NA 4J8MA 3R8PA 2G01A 2X8DA 4G3GA 4K0YA 5E91A 4A4XA 4BRXA 1VYZA 4YURA 2NNWB 4RIYA 4GH2A 2NRUA 5M06A 3BHUA 1M17A 3FBVA 3T3UA 3VS4A 4ID7A 2I0EA 3VJOA 4EK8A 2WO6A 2RF9A 2IN6A 3BU3A 3KN5A 5CSHA 3L8XA 4NFMA 4IFCA 3K3IA 4OTPA 3L8VA 4GRBA 4AXEA 4JIAA 3CEKA 3PA4A 4KIKA 4B4LA 4AZFA 3FZRA 3TKHA 2ZYBA 5CAVA 3FY2A 5CY3A 2YABA 2A4LA 3QKMA 3HUCA 3PJ3A 1UU7A 5AM6A 4R5YA 2ZDTA 2QOOA 3BCEA 2P0CA 3IK3A 3R9OA 4AE6A 4O82A 4EK4A 3AMBA 3GCVA 4RVKA 5IA2A 5JFXA 2XM9A 3ORLA 3DQWA 4U3ZA 4ACDA 3W32A 3TM0A 3GNIB 3Q5ZA 2OSCA 4HOKA 4C61A 4R1YA 4XH6A 5CEKA 5GIOE 4JS8A 4F9YA 4YJOA 3W8LA 3QC9A 3DS6A 4MBIA 2PVLA 2ITZA 3NRMA 4LMUA 2WB8A 2GQSA 2UZUE 4YHJA 2PHKA 2PVYA 3ZTXA 3A4PA 3FZOA 4GW8A 1YWVA 4EH8A 3H9OA 5HBJA 3V51A 1XH5A 5AUUA 3PRIA 4FTTA 4XMOA 2WMVA 3WILA 4M69A 4QYYA 4QMQA 2C30A 4BDBA 1ZRZA 2E9NA 4WNOA 4ALWA 4BN1A 5LWMA 2VGPA 5M44A 2XM8A 3PXFA 3P78A 1Y57A 5CQUA 1UNLA 3WZEA 3NCGA 4DCAA 5AA8A 3VUTA 3P0MA 4D1XA 5AEPA 2OJ9A 3PDTA 3CS9A 2QG5A 3R7GA 4IXPA 2ITYA 2EWAA 4XS2A 4OTDA 3WZJA 1OIRA 3G51A 3KF4A 2QOBA 4LUDA 5T68A 4NW6A 2J0MB 4FKUA 4JDKA 4KA3A 4MQ2A 2GMXA 4RA4A 2XNMA 1WBSA 4MWIA 3ZMMA 4EOQA 3R9DA 3SG8A 3UG1A 2CLQA 2ITUA 3F3TA 3ORKA 2PK9A 1Q99A 3POZA 5JT2A 3OBGA 1H08A 3TDVA 4QTCA 1U46A 3ERKA 3TXOA 4QP2A 5GZAA 3EN9A 2W1GA 3V01A 2YIYA 2C0OA 4X3FA 2V22A 3GEQA 4CTCA 2GHGA 5E90A 4FKLA 2W1FA 3QCXA 4JR3A 3QUEA 5C8KA 1KV2A 2VWIA 5ETIA 2OFUA 2QURA 2VTPA 3BV2A 4DF3A 3NYOA 4G6LA 3QHRA 2J7TA 2ITQA 4EH9A 3R28A 1PMNA 5CVGA 4L67A 5ANDA 1FOTA 3BYMA 4E3CA 2WKMA 1O6KA 5IMEA 2HENA 4RX7A 2RFDA 3B2WA 3D5VA 1JAMA 3ZDUA 3ZSIA 3DXNA 4AT5A 4DFXE 3NUNA 1YXXA 3QHWA 4RPVA 3HMOA 4EHVA 2X0PA 2WMAA 4FTUA 4BF2A 4G2FA 3PUFC 4EHEA 3UOKA 3Q60A 2QO7A 4WD5A 4M66A 2WQNA 3UYSA 4A9TA 3HNGA 5HO6A 2RL5A 3DXQA 5IA3A 1Q8UA 3QTXA 3MH1A 4WG5A 2Q83A 2HY0A 1ZYCA 2B9JA 3KRRA 2V62A 4HPUE 3RGFA 1GNGA 4AZVA 5IU2A 3H3CA 3QQHA 3QQGA 4Q2AA 4X21A 4DT9A 3O96A 3ZSGA 4GYIA 4RWKA 5L6OA 4XOYA 1LUFA 1QCFA 4H36A 5CSWA 4ZTNA 2W06A 1FMKA 3TJCA 4F1MA 4M14A 3S2PA 3DKGA 3ZEWA 4ENXA 2VO3A 2XCKA 3ORNA 4FTAA 4YUQA 5EK7A 4FIJA 5HE1A 3FL4A 2CKOA 1ZARA 3MDYA 3Q9YA 4EH4A 5AP7A 3HMMA 1W8CA 4GU6A 5IUIA 3JS2A 2HYYA 4H1MA 4J95A 4O7NA 2ONLA 2XIYA 4MXYA 2ZB1A 4NCTA 3RNYA 2ZDUA 3I5ZA 4BCNA 4Y95A 5AR8A 1JKLA 5EHLA 1HCKA 2GHLA 2Y7JA 3PJ2A 3R02A 4U9AA 5KMIA 4EUUA 1JVPP 4FVQA 3DAEA 4JMQA 3LCSA 4UWCA 5BMSA 3UPZA 2WNTA 4FZFB 3DY7A 5EKOA 1H1WA 2C5VA 5BPYA 1UWHA 3C5IA 2XJ0A 1PXMA 4DFNA 2C68A 2QC6A 3B2TA 4JBPA 2OH4A 4G3FA 5DR6A 4TXCA 5ANJA 3UIMA 4DEHA 4HVIA 3UDTA 1Q4LA 4IZAA 4Q5EA 1M7NA 4DHZA 2OZAA 2NPQA 3EOCA 4YHTA 4MTAA 4XHKB 3LCOA 2XYUA 3KL8A 4TYEA 5CSVA 1PMUA 1NA7A 2UUEA 3OCSA 1S9IA 3QZGA 4NSTA 3W33A 3ZONA 5J5SA 1OKZA 4PTGA 4L53A 3EIDA 1PXOA 4UMTA 4BIEA 4CSVA 2I0YA 5JFVA 1PJKA 3U6IA 2OK1A 5IISA 2YM7A 3FYJX 2BDJA 2J4ZA 3Q9ZA 2C5XA 1CSNA 4MK0A 1Z57A 2B52A 4FTLA 3W16A 4KSQA 5DOSA 3Q32A 2ZV9A 4RC4A 3PY1A 3KCKA 4L45A 2LAVA 4G16A 3QD4A 2Z02A 3RZFA 4ASDA 3G9NA 3ZUVA 4QMZA 4XV2A 3FKNA 3TV4A 4YJQA 2X81A 2IW8A 1H8FA 4FTOA 2WU6A 5AV3A 4FV9A 2JITA 3PP0A 1KSWA 4NYEA 3ALOA 4ZY4A 3HUBA 4ZTHA 2KULA 4DEDA 4R7IA 1R39A 2O5KA 1OITA 3R8MA 1MRUA 4HCVA 4UMUA 4IC7A 4E26A 3F2RA 5JZNA 3RM7A 4KBAA 3D94A 4C3PA 3BL9A 1V1KA 2BPMA 3S95A 3CD8A 3NYVA 4KIOA 4FOCA 1PHKA 1YWNA 2HWOA 5DWRA 5FEDA 4YJSA 1NW1A 4DHJA 2JBPA 3ZH8A 3RAIA 3JVSA 3M11A 4M8TA 5LVNA 4BTFA 2ZM1A 5HG9A 4UN0C 3D5UA 4O7SA 4S30A 3PPKA 2HAKA 5JGDA 2GQGA 3G90X 3GCSA 4AWIA 3HMPA 4PL3A 1ZAOA 5DNRA 5IZFA 3WF7A 3JYAA 3QYWA 4O7ZA 1DM2A 4MCVA 3TT0A 2C3JA 2VTMA 2YERA 5CEIA 1JQHA 3MPMA 3HRFA 4RFZA 4WIHA 4QMUA 2XANA 3KXMA 4NT4A 3HKOA 2P4IA 4AGDA 2PVJA 1YXUA 5CU0A 2A98A 3F5PA 3CY3A 3TTIA 2XAOA 5BMMA 1ZYLA 2VTTA 4DTKA 4PP9A 4G1WA 1ZOEA 2XJ2A 3CPCA 4N6YA 5E8VA 2O65A 5BYLA 1E9HA 1KE9A 4L68A 2R3IA 4YJPA 4YLLA 4E4NA 3SX9A 2GTMA 4O7TA 2YITA 5AADA 5B2MA 2FA2A 2XKEA 4L8MA 2WTVA 2RFSA 3IDCA 5FTOA 4EOKA 4TN6A 4FSRA 5FDPA 4DEIA 2OJGA 3DK7A 2YIRA 4WKQA 2OF2A 3RP9A 5GZ8A 5IH4A 5L2WA 4QDEA 4BKJA 2W5AA 4TYIA 2WMSA 3FMLA 5DPVA 4BDAA 3FE3A 4I23A 2VWYA 4I93A 3NZ0A 4W9XA 2OO8X 3DB6A 4UEUA 3FMMA 1GZNA 5EI2A 2A27A 3FYKX 4MF0A 2XNPA 3VHKA 4E7WA 2F4JA 4XG4A 3RZBA 1J7UA 3A61A 3Q4UA 4W9WA 3NIZA 4I0TA 3QYZA 2GFSA 4IWOA 2JDVA 5C1QB 4NK9A 5J5TA 3HZTA 1OIUA 2CCIA 2XKCA 3KXGA 3NNWA 5CI7A 3U51A 4AFEA 4AZSA 4EC9A 2X4ZA 4I21A 4EOPA 2O0UA 3MVHA 4O0VA 1J3HA 3EN5A 1V0OA 3RK9A 3BGQA 1P14A 1W2DA 4C4FA 1QMZA 4BICA 1DS5A 4IX4A 4UV0A 3UQGA 1Z9XA 2FSOX 1WBWA 4GMYA 3W10A 3C0HA 2ZJWA 2QKWB 2JBOA 5IMXA 2YAAA 3GQLA 4BCKA 5M4IA 3E8CA 4QRCA 3SXFA 2XK6A 4D5KA 2V0DA 4E6AA 4LM5A 1Z5MA 3HP2A 3QTIA 3FZTA 4QMWA 5CENA 1GZOA 3C7QA 4FKQA 4H1JA 5IDPA 5HIEA 2CKPA 2X7OA 3FV8A 4BTKA 5HVKA 5J1WA 4AX8A 5HORA 5EI8A 1KE6A 3BQCA 1ZY5A 1YVJA 3MWUA 4FG7A 5DMZA 5CS6A 2O63A 5AA9A 4F09A 5EYKA 3UGCA 2H8HA 4RLKA 4M15A 1ZZ2A 4V05A 4UY9A 1O9UA 3A4OX 4BDHA 3H9RA 3JUHA 3QRIA 4MXAA 2VWZA 3TL8A 4IVAA 4CKIA 4EI4A 3DB8A 4K8AA 3NEWA 4I0RA 4BDGA 3GFEA 3VQHA 3P4KA 1QL6A 2QG7A 2JAVA 3SHEA 3PXRA 1JWHA 3AC2A 4AXDA 1SVHA 3OWJA 4AUAA 3GUBA 5ACBC 3DJ6A 3ZEPA 4D4SA 5KMJA 2OKRA 2BR1A 3U6HA 3O7LB 3QRUA 3IDBA 2XBAA 3LXLA 3TG1A 5ICPA 5LVOA 2HWPA 3EN6A 4FIEA 1REKA 3GGFA 4RIXB 3QCYA 4XBRA 2EUFB 5TT7A 4G3EA 5KMOA 2A2AA 4GKIA 4HYHA 2XKFA 4HVGA 3KK9A 3ORIA 2UW8A 2XMYA 2YIWA 3EQPA 4TWNA 3HV7A 3HA8A 4JG7A 3ZM4A 5KHXA 4AA4A 1M2PA 4PDYA 3ZO3A 2IVSA 2YLFA 4IBMA 3HV6A 4OTGA 4PY1A 2PVRA 3F69A 3KA0A 5AIRA 4PQNA 2UVXA 1H07A 3EKKA 3T9IA 1L3RE 3FAAA 2WHBA 4QMYA 4XP2A 2BAQA 3JR1A 4BJJA 3EJ1A 4ZSLA 1R3CA 4C4GA 4KIPA 4H39A 4YC3A 3WI6A 5A4TA 3Q96A 3RAWA 4YO6A 2QQ7A 4USFA 2J50A 3DBDA 2IZSA 4DG0E 5EM5A 1J7LA 1PY5A 4S32A 4CKJA 2UZNA 4AA5A 4C3RA 4EQMA 4KUJA 4DH1A 1F0QA 4NM7A 4C7TA 3QTWA 2IW6A 2RGPA 1SM2A 2CN5A 2VV9A 2Y6MA 4I6FA 4LOOA 5F1ZA 4YZDA 3ZFMA 3WF5A 3FDNA 3HDNA 2G2IA 4QNYA 4BCQA 2VTNA 2YCFA 4FSWA 4BWXA 4CFFA 4B8LA 4EJNA 1PW2A 5A6NA 4G31A 2HZ4A 4R6VA 3RKBA 1U54A 3GU6A 4A07A 2VWWA 5KMLA 3TZ7A 5CEMA 4BR3A 3AMYA 3W2RA 1A06A 3A8XA 3ZOSA 2HIWA 2QHNA 2WMQA 2UZOA 4FOBA 1Q5KA 3NVMB 2R0IA 1XBBA 4KIKB 3WF8A 4M97A 3ID6C 5DYJA 5AIKA 4I92A 5DT0A 4BWKA 3SGCA 1WBNA 2CCHA 3LIJA 4OGRA 4EC8A 1Y6BA 2OZAB 4MVFA 5HNGA 1REJA 4OTQA 1E1XA 3HA6A 5H3QA 3NAYA 4YJTA 5HO8A 2CJMA 1CKPA 2XK4A 4M13A 4O7LA 4IJ9A 1H01A 4BCHA 4WUNA 4CZUA 5B7VA 4FTMA 3BIZA 1E1VA 1G5SA 3LFCA 2CKQA 4WOVA 4EBWA 5H8GA 3AKJA 4TYHA 4R78A 3NNUA 3PJ8A 3DNEA 5KHWA 2BRHA 3UQCA 3MB7A 2ITOA 4O6EA 4M0YA 4BIBA 4ZAUA 4BI0A 3VNTA 5AJQA 3Q2MA 1B38A 4UYNA 5IKWA 3ULZA 2REIA 2C47A 1WVXA 3EL7A 4L43A 4OAUC 2R3RA 3KRLA 1K2PA 3VF9A 4AXCA 4JXFA 1BI7A 3F5UA 2QHMA 1OB3A 4UMRA 1XH6A 3UJGA 4CFWA 3FI3A 4CYIA 4RWIA 3GCUA 5DHJA 3UC4A 3AD5A 3PIZA 2C3KA 5L8KA 5ANOA 3RMFA 3PXQA 4D2WA 4N0SA 5L4QA 4QTBA 4IADA 4DH3A 5JEBA 3GU5A 4HYIA 4OTFA 2GDOA 5BV3A 1KUTA 4TL0A 4C59A 3N9XA 1W82A 3O8PA 2VTSA 4EK3A 4BCOA 4F4PA 4L3LA 2VWVA 2XYNA 3CKXA 2WTIA 3D0EA 4UB7A 5EW3A 3TEIA 2ETMA 3F3UA 2DUVA 3T9TA 2PZIA 4YTHA 1SMHA 4BDDA 1KE7A 3FMEA 4U8ZA 4ALUA 3EQGA 5EM8A 3GC8A 4DC2A 4YZ9A 5LVPA 3C4XA 4WRGA 3NDMA 4BHNA 3QGYA 4LV7A 4AAYA 4JAIA 3R0TA 4GG5A 4FKVA 3MESA 4ZTLA 5CXZA 5L8LA 4L52A 5AAEA 3Q2JA 3MW1A 4D2PA 2C1BA 3ANQA 2BRNA 5E8SA 4TNDA 2QOCA 5BVEA 3ZSHA 4CZYB 3BGZA 3NUPA 4FT5A 2PZPA 4MNEB 2FSLX 1PXKA 2AUHA 2PZYA 2QU5A 5DGZA 5DT3A 3CLYA 5I9XA 3PIYA 4ITJA 4AOJA 2WTKC 1PXLA 3RWPA 2WEVA 5BVFA 5DEWA 3QRTA 4DLIA 3S00A 4C36A 2VTAA 4Z16A 3P23A 1MQBA 4YO4A 4FSMA 5IH6A 5I4NA 3VO3A 3DDQA 4S2ZA 4RFYA 2C4GA 3HAMA 4DN5A 4RIWB 1KV1A 4EYJA 4LRKA 3R73A 3RNIA 5J7BA 4MAOA 3FQHA 4JDIA 2HOGA 5EQYA 3QZHA 5DT4A 3OFMA 3AKKA 4FEUA 4O21A 2GPHA 4IAIA 2WELA 4FK6A 4RX8A 3RK7A 1M14A 3HL7A 3QTSA 1U5QA 4U97A 5LOHA 3Q53A 5E92A 3ZLWA 3MVMA 4E1ZA 4I6QA 2WIHA 4XBUA 1RW8A 2E9PA 2JDSA 3CPBA 3FL5A 3EFKA 3R71A 4MKCA 3JY9A 2PZRA 4G3CA 2BRGA 5IQGA 1UWJA 2WXVA 4AT3A 4CFVA 2GCDA 3PJ1A 3Q5IA 5HZNA 3VONA 4F70A 2H9VA 4H3QA 5CXHA 1M2QA 2YIQA 3LJ2A 4ASXA 2C69A 5HE2A 4R3RA 2I0VA 4D5HA 1ZZLA 4LGGA 3BU6A 3VRZA 4I24A 4ITHA 4C02A 3AQVA 3IW8A 1DAYA 2BKZA 4ZK5A 4FSZA 4CT1A 3IGOA 5FDXA 4U43A 3I81A 2RFNA 5DR2A 5HD4A 4IAZA 4H3PA 1YI4A 5I9YA 2KTYA 3PE1A 4M3QA 4FKGA 3SXRA 3R01A 4AZEA 4YZMA 5ANKA 5EH0A 1QPEA 1ZYDA 3LW0A 4U45A 4BCFA 4C58A 3O5AA 4OLIA 1YOLA 4X0MA 2BZJA 2JLDA 5HG5A 3LMIA 4IVCA 2ZOQA 1CTPE 4DLJA 4D9UA 2GS6A 3SOAA 2EVAA 3LCKA 3QUDA 2GU8A 5FM3A 4DYMA 2RG5A 3GU4A 4ANBA 3QTUA 4B9DA 1WZYA 3QZIA 4QTAA 1WBOA 5AR2A 3BWFA 2C6LA 3W0PA 4AGWA 3DPKA 5EOBA 4YMJA 4IH8A 1WBPA 4YTIA 1G3NA 1P4FA 1O6LA 3EQHA 3O0GA 4PTEA 3PFYA 1OPKA 1Y8YA 3KXZA 3ZRMA 2PMLX 4DGLC 5DIAA 2RIOA 1PRYA 3H10A 2QKRA 2WZJA 2E2BA 3IO7A 2XNOA 4FTKA 2XIZA 3ALNA 4GT5A 3UG2A 5HG8A 3W0OA 1YI3A 3E7VA 2YJSA 4CCUA 3KB7A 3BBWA 4WNKA 1LPUA 5FRIA 5LARA <