4RJ5A

Egfr kinase (t790m/l858r) with inhibitor compound 5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
323
structure length
296
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKETSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Discovery of Selective and Noncovalent Diaminopyrimidine-Based Inhibitors of Epidermal Growth Factor Receptor Containing the T790M Resistance Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 296
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rj5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rj5A01
2FO0A 4TXCA 3D83A 1W83A 4AGUA 5E8ZA 3UQGA 2BHHA 4C4JA 2Q0NA 3U4WA 3EN7A 4WBBB 3SLSA 2J9MA 2WIPA 1UV5A 2WQOA 3AT4A 3QC4A 1S9JA 4KD1A 5ETAA 2C6EA 1PJKA 4G17A 3R73A 2X9FA 4V05A 5EDQA 4RVTA 2R64A 5JQ8A 3VBXA 4AACA 4CG9A 3EQGA 4QYGA 3BU3A 2CN5A 2BPMA 3MFTA 2XK4A 3V8TA 4WD5A 1PXNA 2UZTA 3AMYA 3FQHA 4F9YA 4JQEA 3FV8A 3E7OA 3F2AA 4FI1A 3ATSA 3HV7A 1U59A 2PVJA 2YITA 4WG4A 3KB7A 4WSQA 4L9IA 3EQRA 4DG0E 1FPUA 4PMTA 4EK5A 1QPJA 1ZXEA 4ZY4A 3UC3A 5BVDA 2OJ9A 5EW9A 1KE7A 2IPXA 2RG6A 1F0QA 4PNIA 2W06A 5HE2A 3AC5A 3N4TA 4O7WA 3QFVA 1CSNA 3MGYA 3NW5A 3ZBFA 3FKLA 3PXRA 5L8JA 2WOUA 4Z3VA 2HENA 1FQ1B 2XKCA 3KY2A 5FM3A 2OW3A 4F9CA 5DI1A 4MNFA 3SOCA 2PE2A 4XOZA 3QQJA 4D0WA 4UMTA 1BUHA 3F7ZA 4BDDA 3H0ZA 4NCTC 4QMQA 5M07A 3F3TA 3RPYA 4E6DA 4GK2A 5AR8A 1PY5A 4QD6A 5J87A 3POOA 4JJRA 4F6WA 4NM0A 2VTLA 4JL9A 4DE4A 4GT4A 3ORIA 4LV8A 5A4LA 3BYUA 4L44A 4BDBA 1R1WA 4FYOA 3F82A 3OF0A 2QOKA 3ITZA 4I5CA 5HG7A 2CN8A 4BDKA 5I9WA 4YLJA 1U5RA 3IQ7A 2CGUA 2WTIA 5F20A 4DEBA 5GJGA 3C4FA 4YTIA 4RWKA 2CGXA 3WIGA 1OB3A 4BTFA 2NO3A 4RJ3A 4CRLA 2BALA 5BNJA 3ROCA 5HTIA 3ACJA 4FL3A 3UIXA 3KRXA 3LFNA 1BL7A 4LG4A 3GU5A 3QTSA 4QNAA 3RCDA 2WELA 2R4BA 2VGPA 4AXAA 4E5AX 3QC9A 5DYJA 4X6QC 1Q62A 4QTBA 2EUFB 3SX9A 4AW0A 2VWUA 5KZIA 3W33A 4WOVA 4JI9A 3RAWA 5EW8A 4BVUA 2QR7A 4TTHB 4EH6A 1OL7A 2X81A 1UWJA 5FXQA 1V0BA 4BCJA 5AFVA 4JQ7A 3RMFA 3IW8A 3LXNA 1APME 2NRUA 5J9YA 4JG8A 4D28A 3HV6A 3UIBA 1CMKE 4ACHA 3DB8A 1A06A 4HGLA 2C6DA 3QD2B 2J7TA 5AP4A 3V5LA 2V7AA 4C2VA 3TJCA 4MBJA 4RLKA 2C0OA 5A4QA 1P4FA 4TW9A 4DT8A 2OZAA 2RFEA 3VW8A 2XIRA 3I81A 5C8MA 3LXKA 3SDJA 4QQJA 2H96A 4F1TA 5CEMA 4OTRA 4W9XA 4OTWA 3S2PA 2R3JA 3DU8A 4I6QA 5KKRB 3W2CA 3GFEA 4G3FA 4CNHA 3L9PA 1R3CA 4FV9A 2HCKA 5B7VA 4I21A 1XH7A 4RIYA 3W8QA 4RC4A 5CYIA 3G51A 4I4EA 1YDTE 2WPAA 3UE4A 1Q61A 3LJ0A 3QTWA 1G3NA 4KA3A 1TQMA 4O1PA 4ZS0A 3F5XA 3DBQA 3PWYA 4IM0A 3SKCA 3OOGA 1FBNA 3VWAA 3MVLA 4RWIA 4QOXA 1FMOE 4BDIA 3MSSA 4DEGA 5M09A 5ETFA 4ANBA 4PTGA 5DGZA 1JSTA 4BZOA 5KMIA 2GS2A 4YP8A 1SMHA 4MEDA 3BYSA 3M2WA 2JFLA 3FY2A 2JKOA 4WG3A 4IJ9A 4FZDB 4ITIA 5HVJA 5BVWA 4A9YA 2C0TA 3EFJA 5M55A 4BWPA 3Q4ZA 4QMOA 5BUEA 5HEZA 2C3JA 1HCKA 4NKSA 5CZHA 5LMBA 3SGCA 3UO4A 3BEAA 3WE8A 3CCNA 1YXSA 2WQEA 4TL0A 4S31A 3QQGA 1OIUA 4OLIA 4EUUA 3UYSA 3BV3A 3ZZEA 4LFIA 1G8SA 3TV6A 2Z8CA 5L2IA 2CCIA 4UWYA 5BPYA 4DCEA 4EUTA 2PSQA 2FSLX 3MDYA 3P7CA 5E8XA 3TV4A 4F08A 2PUIA 4FE2A 4GU9A 4LOOA 4USEA 1YWNA 2XRUA 3IDPA 4NM5A 2JD5A 3R00A 4TWPA 1W8CA 5J7BA 4B7TA 2GMXA 4PUZA 5AMNA 3I6UA 2QD9A 1GZ8A 3DQWA 5A9UA 5J5TA 3D7TA 2C6MA 2JKKA 3COMA 1VR2A 2P55A 4WBOA 3BBTB 5GIPE 3I0OA 2YAAA 3ZMMA 4XLIA 3II5A 4EK3A 3V8SA 4FG7A 4YJOA 4A4OA 4AAAA 4LGDA 3WZJA 3OVVA 5AWMA 2WTVA 3QD3A 3P7BA 3VUIA 4D58A 2PYWA 5JFWA 2GFCA 2ZAZA 4JX3A 3PPZA 4B8MA 3OW4A 4CKIA 5CI6A 4PL5A 4FEUA 4U40A 3FDNA 4G6OA 4GKHA 3O71A 1KE9A 5AUXA 4FL2A 3QF9A 3L1SA 2CKPA 3RP9A 2R3IA 4F99A 5E8YA 2RIOA 2WFYA 4FNYA 4HGSA 3O8TA 3TZ9A 5M4UA 4FKPA 2G9XA 2J50A 3IW5A 3IW7A 2DQ7X 1WBOA 3ORMA 5FRIA 1OKVA 3U9CA 4BBFA 5JT2A 3QTQA 3QUEA 5DBXA 4RJ5A 4I22A 4NZWB 3RM6A 2C30A 2HZIA 2B9IA 3F5GA 4JIAA 4HGTA 1GOLA 4J8MA 5GIOE 1YW2A 4TYGA 3AOXA 4JRVA 3UOJA 3R1QA 3E92A 2UZOA 3W8LA 3IK3A 4LOPA 3V04A 3TXOA 2X4ZA 2XNGA 4UYAA 3ZC6A 4U9AA 3QX4A 5EYDA 5AUZA 5A4EA 4O7ZA 3CPBA 4MXYA 4HNFA 5DEYA 4E3CA 4ZMEA 4C4HA 4EH7A 4A4XA 2ITYA 4JBOA 3OW3A 5CT0A 1H26A 1WCCA 2VTQA 1JKSA 4ACCA 4KIKB 4Y46A 5FXSA 5FQDC 3HAMA 1LR4A 3DZOA 1BL6A 2FSMX 3FMKA 1XKKA 3NLBA 3QCYA 4EK4A 5EM6A 4DEEA 5IKWA 2A0CX 3KU2A 2EXMA 5L2QA 2Y8OA 4CVAA 5JSMA 3R8VA 3DTCA 2QO2A 2XCHA 4O96A 4RVLA 4E5WA 5CS6A 3RALA 4DH1A 2VTJA 2J5FA 3QZFA 2YABA 2JDSA 3EJ1A 3ORPA 3UDBA 2AYPA 5HBJA 4M13A 2YJSA 3CY3A 3E8CA 3RJCA 4IBMA 3QUPA 3MA6A 3IW4A 3NWWA 3ZSIA 4OAUC 3G0EA 2EXCX 3PJ2A 4GT3A 2GFSA 4EOKA 3DLSA 3OP5A 3HUCA 4Y85A 5EYMA 1KE8A 4ZLZA 5IQDA 2YIQA 1MRVA 3CD8A 4MAOA 3A7FA 3QYZA 5LVPA 5FDXA 2BTRA 2QU6A 2ONLC 4CV9A 3RWQA 2VWIA 4H1JA 4NTTA 5F4NA 3MW1A 3R28A 4FSYA 3WOWA 2VX0A 2XJ2A 3BX5A 3QGYA 5DN3A 3W2QA 3ZLXA 4PMPA 2QURA 4GS6A 4FSNA 4EC8A 2IO6A 4EOJA 2GHMA 3SXSA 3HMIA 2FSTX 4WHZA 4WG5A 4NIFA 4XBRA 3ZFYA 4ZTHA 4PL3A 4EHVA 5DE2A 1XH9A 4DGMA 3PE1A 1WAKA 2OU7A 2YCQA 3D9VA 3ZS5A 3FC1X 2R3NA 4FTUA 4J97A 1SNXA 1H00A 3E62A 2I0VA 3FLQA 2O8YA 1F5QA 1Q97A 3RTPA 5ANOA 3KK8A 2GNHA 1OUYA 2HIWA 2RG5A 1H1QA 3KVXA 2XM8A 3PWDA 3R8MA 2XNMA 1KUTA 3V5PA 2C3IB 2Q83A 3UYTA 4CCUA 3C50A 4JRNA 4KIOA 5EOBA 3VS5A 5HIEA 2JIVA 3BWJA 4WIHA 1PXKA 4DBXA 3FLSA 3PJCA 2GNFA 4QP4A 3HUBA 4MF1A 1PW2A 2P2HA 2YIRA 3O96A 4ZK5A 5JGBA 3I79A 4WUNA 3WF6A 5IMEA 3CY2A 1ZYSA 2X7FA 3HA8A 3QAME 2DS1A 4YZDA 2I0EA 2G2FA 2I6LA 3D0EA 1H1WA 2ZM3A 4J96A 4FIEA 2XK8A 5EG3A 4CT2A 4NFMA 3ZONA 1PHKA 4AZEA 5I9XA 3KULA 2CPKE 4XJ0A 4ZLOA 5C03A 4ASZA 3RNYA 4EH5A 5EK7A 4FX3A 4XP3A 4BL1A 4BKZA 1PKGA 1UU7A 1DAWA 1K9AA 2PZIA 5GZ9A 5ANJA 4J7BA 3NAXA 3AC3A 4HVHA 4DEHA 5HTCA 1O6LA 2G01A 2UZLA 1FGKA 3DKGA 4BYJA 5K4IA 1YXTA 5GHVA 3UPXA 2XK9A 5DOSA 2BKKA 4XH6A 1ZMWA 3PG1A 4BWXA 3HL7A 3LOKA 3PP1A 2HY81 1H1SA 4GEOA 3IDCA 1A9UA 4I6BA 1URWA 3TACA 5GINE 3TTJA 4HJOA 2IG7A 4FNXA 5TT7A 4QMMA 5D7AA 4N4SA 2X6EA 3NW7A 4C35A 1ZARA 3OWPA 4Z9LA 3VHEA 3A60A 2OSCA 3GP0A 3KN6A 5JFSA 3D7ZA 4TYIA 5HTBA 3UODA 3UG2A 5E8VA 3Q9YA 4FICA 4J98A 4EH2A 3CEKA 3L9LA 5TO8A 5F1ZA 3EL8A 3MV5A 2HY0A 4FT5A 1Q41A 4EH4A 5KX8A 3VUTA 4IZ7A 3QLGA 4ENYA 4K9YA 4ZSJA 2QO9A 4JS8A 4O84A 3EQBA 4RJ4A 2WEIA 4L00A 4FSUA 4MWHA 4NM7A 2BUJA 4IM2A 2RL5A 5EI8A 4BDHA 4F9BA 2H34A 2XKEA 4M0YA 5HU9A 3BBWA 4FUXA 3PPJA 3O23A 2ZDTA 4FKJA 4CFWA 3DAJA 2Y4IB 3BHYA 3FAAA 3NVMB 2W1IA 3MVJA 2UW0A 2EVAA 1OPLA 3DQXA 4HZSA 3UGCA 2WMUA 2BRGA 1W7HA 3LE6A 4EWHA 2IW8A 3CPCA 3NRMA 3OY3A 4NM3A 5JRQA 4WSYA 1PRYA 3OC1A 4XV9A 1JOWB 4TYEA 3PY1A 4C37A 4WA9A 1KV2A 3C4ZA 3QQKA 4HYIA 4C36A 1QCFA 3QRKA 3ZEWA 3FHIA 2XKFA 4CFVA 3JXWA 3VIDA 2YIYA 4C0TA 4LL5A 3DZQA 3ORKA 4BTMA 3G15A 4OR5A 3MVMA 3CJFA 2VTTA 2JGZA 4BCIA 1ZLTA 5HX8A 3C9WA 4U97A 2PZ5A 2WXVA 4IIRA 1MQBA 4AW2A 2WOTA 2GQSA 5J1VA 5L8LA 5E7RA 4FTQA 1JQHA 4ZOGA 4F0IA 2OF4A 3ULIA 4QP6A 5L6PA 1ZYJA 3CJGA 4YHFA 1PYXA 2ITWA 3LIJA 3U51A 2C3KA 3RI1A 3QD4A 4OTHA 3Q4TA 3NYOA 4NCTA 4R8QA 2O2UA 3L9MA 3QBNA 2E9OA 4FVQA 3ZM4A 3F3ZA 3FMMA 5EHOA 3OBGA 3CGOA 3KF4A 3KULB 1JLUE 5HD4A 3QHRA 2KULA 5I9YA 4RIWA 2Z7SA 3R63A 5H8EA 2DUVA 2V5QA 5AM6A 4C4EA 1YRPA 3EYGA 3F69A 4YGAA 4ZTRA 3JVRA 4FSZA 4BGGA 2XNOA 4DEAA 3KVWA 4M0ZA 1Z9XA 4W4VA 2VWBA 4QTEA 5EH0A 2YWPA 1JSUA 4XBUA 2VWVA 5BYLA 4QP1A 3SAYA 2C47A 1P4OA 5C4LA 3RZFA 3E8DA 4R7IA 3R7EA 3UVQA 3V01A 1OPKA 4P2KA 1WMKA 4BCMA 4G5JA 4YLLA 4I0RA 4GFGA 3UOHA 3R71A 2I1MA 1ZOGA 2RSVA 4FOCA 4GVJA 4GK3A 5HNBA 4EH8A 5JFVA 4XCUA 4Y72A 5IEVA 5C26A 2OIDA 2E2BA 3NUYA 1SVHA 4FKOA 2JIUA 2PVKA 1O6KA 2YDKA 4TNDA 3D5WA 2WTJA 3LHJA 4KBKA 2OK1A 4ONAA 4R1YA 2BRHA 2VWZA 3EQDA 4MNEA 4A7CA 4AW1A 4EOMA 2PZPA 3COHA 3DXQA 3MIYA 3ODYX 5HICA 4D2VA 5JMSA 3OOMA 3P0MA 4E5BA 4G2FA 3Q5ZA 1NW1A 1IASA 3DBDA 3OG7A 3BQRA 4GFMA 3NIZA 4BKJA 4WUAA 4DG2E 2QI8A 3IDBA 4IFGA 2C5OA 3KKVA 3QHWA 1WVXA 5AUYA 4FKLA 4KNBA 4YJVA 5HIBA 1UWHA 3NUXA 2CMWA 1PMEA 2R9SA 4XX9A 5E90A 1Y8GA 3EMGA 3QD0A 1WBPA 4JAJA 5B2LA 3KC3A 3P4KA 4M15A 5E4HA 2BZJA 4UY9A 4YPDA 3DK7A 5GZ8A 3T3VA 1ZRZA 2J0IA 1V1KA 3LZBA 4IC8A 3D5XA 5LWNA 4GMYA 2ZV9A 4BFMA 1WBVA 5D11A 2CNVA 3N4UA 5GNKA 2BAJA 5FBNC 2OJIA 3EHAA 3B2TA 1P14A 3C4XA 3A8XA 3MH0A 4JIKA 5AV1A 3PUPA 4AFJA 2RKUA 4OTQA 2UW5A 4K77A 2IN6A 4GYGA 2ITOA 3WZEA 4BCHA 5EM7A 1H8FA 2B1PA 5ANGA 3W32A 2FSOX 4FKSA 4UEUA 4YHJA 3EN9A 3LCKA 3EKKA 2YA9A 4QMUA 4V0GA 4H58A 1S9IA 3ZCLA 2Q0BA 4QMZA 5HGIA 4XP2A 3RINA 3TN8A 1T45A 4FKGA 4MHAA 4BDEA 4FT9A 2WQNA 3GOKA 4FIIA 3K3JA 4BHNA 4ACMA 3EQPA 3EN6A 3N51A 2GQRA 2JITA 4FV6A 3QZGA 4X3FC 3VUDA 3V3VA 4E6QA 3E7VA 5CAPA 2ITZA 3DV3A 5T3QA 1YOLA 2OH4A 4PNKA 5IQHA 3GUBA 2VO0A 3DPKA 3FI2A 4FK6A 4W4YA 3TG1A 3PSBA 1ZY4A 3ET7A 3ZO4A 3BWFA 5M06A 4DYMA 4FEWA 1Y6AA 1E1XA 4GSBA 4QMNA 3C51A 5CF8A 3WBLA 4DFNA 3OBJA 4EH3A 4TWOA 2C3LA 3EFLA 3FY0A 1WBSA 4RIXB 4RLLA 3F2RA 2C6LA 3GU7A 4IWDA 1H1RA 3EFKA 4I20A 4XYFA 2WMAA 4DGOA 2JDRA 3KGAA 4NKAA 4BN1A 4RA5A 5DRDA 4FBXA 4D55A 3HECA 1L8TA 2X8IA 5EFQA 2EXEA 3ANQA 4PWNA 3IOPA 4XMOA 1CM8A 3ZLYA 4GKIA 5K5NA 4BHZA 4MCVA 5L6OA 1KE5A 3WZDA 5M4FA 4ACGA 4O0TA 4QMVA 4ASEA 4F4PA 4BI1A 1MUOA 1O9UA 1WVWA 4FIHA 4GL9A 4H39A 3FBVA 4UMUA 3CTQA 4S2ZA 2CKOA 2OLCA 3D94A 4AZWA 2OO8X 4O1OA 4CZYB 4YJQA 5I3RA 5FUTA 2YEXA 3WZUA 3V5TA 3HEGA 4L3JA 3NNWA 5FBOA 4FTKA 1OBDA 4FIJA 4HCTA 4BTJA 4W8DA 2O0UA 1GNGA 4F9WA 1FVVA 3TUDA 3GENA 1QL6A 3PJ1A 3UZPA 2W1HA 3QCQA 4J99A 4U8ZA 3C0IA 1K3AA 3LFEA 4EONA 5M57A 3SXRA 2UZEA 2VTAA 4M14A 5E1EA 2Z7QA 4EOLA 1ZMUA 3P1AA 2R3OA 3RAHA 3Q60A 5AIRA 4QP2A 2H6DA 2ACXA 3DBEA 2F49A 3GFWA 5JKGA 3Q2JA 3L8SA 2LAVA 4JX7A 3MH3A 2WMWA 2XA4A 4UN0C 4FTRA 1OIYA 5G6VA 4CXAA 2W05A 4TNBA 4MXCA 1PYEA 3QQFA 4QQCA 2WTCA 2J90A 2WTKB 3JVSA 5H3QA 2YIXA 4RRVA 2XNBA 4AWIA 3MY0A 3O17A 4E20A 5I4NA 1PXIA 3OCTA 5L2WA 2Y9QA 5EI6A 3DDPA 3ZM9A 5KCVA 4JOAA 1P5EA 4K11A 4O22A 5LVOA 1MRUA 3GEQA 2P0CA 4JNWA 1NVRA 1TVOA 2ONLA 4V0GB 3DAKA 4PDSA 4D2TA 2R3MA 4U45A 3KF7A 4BZDA 4DGNA 5BQ0A 1BKXA 2VN9A 5F9EA 3U6JA 4CT1A 5IQGA 4KRDA 4CMTA 1YXUA 3KN5A 2YJRA 5HE1A 5ITAA 5HOAA 3A4OX 2E9NA 4FIGA 2R3HA 1BLXA 1J3HA 2GCDA 3WF8A 2XKDA 5HCYA 2ZMCA 3AT2A 1DI8A 2I0HA 5CX9A 3CC6A 3QTZA 5L3AA 2Z7LA 2ITTA 5D12A 3SW7A 4EZ5A 1W98A 2VTIA 3NCZA 3U4UA 2XIZA 3UNJA 5EDPA 5LQFA 4P90A 5DRBA 4HPUE 2E9PA 4JG6A 1IEPA 2W9FB 3IPHA 4LOQA 3VHKA 4CYJA 2ITQA 3QWJA 1XJDA 3QGWA 5FTOA 2J4ZA 5C8NA 2RFNA 3TUBA 3D14A 4K33A 4RC2A 3C5UA 4JVGA 4XG6A 3BGQA 4UBAA 4YHTA 1QPCA 4FSTA 3PZHA 3H4JA 4C4IA 2JDOA 3QRTA 4X7QA 4B6LA 5LOHA 2G2HA 4FMQA 2R2PA 4JAIA 4J53A 4X2GA 3ZO3A 3OD6X 3HV3A 4YBJA 5DVRA 4FOBA 3ORNA 3NYNA 3PIXA 5TR6A 3RKBA 3JYAA 5AR3A 1HOWA 4FKIA 2JEDA 4USFA 5FTGA 5A46A 4MWIA 3U87A 4EWQA 2QQ7A 4EZ3A 1RE8A 4YZMA 3MFUA 5IEYA 3NPCA 4RWLA 3A7JA 3O7LB 4XOYA 1GAGA 5DG5A 4I4FA 1G5SA 3NX8A 5HE3A 4KIPA 2YM7A 5HE0A 2BRBA 5KMOA 1GIHA 3QRJA 3R9OA 4KABA 1PXPA 4CTBA 3F3WA 3R2BA 2VTRA 4M68A 1ND4A 4XG2A 5AV3A 2OIBA 5J9ZA 2AC3A 3ZTXA 2DWBA 3FL5A 4JR3A 4G3EA 4EI4A 4QO9A 4ZP5A 1M2PA 5DA3A 2B55A 1JPAA 1QPDA 1NT2A 4ACDA 2RFSA 4LMUA 5EHLA 4TPTA 2QHNA 2GNGA 5CEKA 3ORTA 5CVHA 1YHWA 3FZRA 3P78A 4DGLC 4UZHA 3ZOSA 4G9CA 4KSPA 3KRJA 2WD1A 2W99B 4OT6A 3S4QA 4R7HA 4O91A 4C3FA 1UU8A 4BCGA 4RFYA 4BDFA 5A4TA 3ZU7A 1UVRA 2B54A 4DITA 2QO7A 5CSVA 4XEYA 3EH9A 3HV5A 5JZJA 2BVAA 2FB8A 4E4MA 1J7IA 3HNGA 3TDVA 5DR2A 4HGEA 5EQYA 5EHYA 1R0PA 3PSCA 3F88A 2X1NA 2GDOA 4Q2AA 4QTDA 1E9HA 4IVCA 5DLSA 3ULZA 4I0TA 1R39A 4FUYA 4YNEA 2CCHA 3VF9A 3Q2MA 2P33A 3WE4A 2P3GX 2QLUA 4DA5A 3TV7A 2EB3A 3QRUA 3BHVA 1ZZ2A 3COKA 3O8UA 4Y95A 5HCZA 4DC2A 4EHZA 4Q9ZA 2VAGA 3LMGA 5CVFA 4D4YA 2PMIA 2BDFA 1AD5A 2X39A 3RWPA 3KREA 3NUUA 4O83A 5K9IA 1M7QA 4O0YA 1YI6A 3BU5A 2A27A 5FGKA 4WRSA 3VQUA 3DJ6A 2UUEA 4IW0A 2VWXA 1OECA 1SM2A 3LXLA 2IZTA 4GUEA 4JT3A 1OZ1A 4QRCA 1FINA 2ITUA 1H28A 4ID7A 4I92A 2YCFA 2VTMA 4U43A 4R5YA 3H10A 3K2LA 4IJPA 1Q4LA 1ZOEA 3UZRA 2XP2A 3AD6A 5D9HA 3WYXA 3HMMA 3I5NA 4LI5A 4NWMA 3LFCA 5CI7A 2YZLA 5FP6A 4C38A 4YJRA 5AJQA 3QTXA 3R21A 4L3LA 5HBEA 3DK3A 3I60A 4BICA 5AA9A 3UQCA 1X8BA 3FZSA 5HHWA 4I5HA 1OITA 2W1ZA 4PPCA 2OG8A 5CAVA 4CMUA 3VRZA 5LVNA 4D4VA 3F3UA 3LFDA 3QUDA 1OI9A 5JQ5A 4GVAA 3I7CA 4LGHA 3VVHA 3G9NA 4G3GA 4BCNA 3EWHA 3NSZA 5L6WL 5IQEA 2OWBA 4YC6A 1ZZLA 1ATPE 2VTPA 4CSVA 3EB0A 3CKXA 3NZ0A 4IAYA 5BVOA 1XH6A 3UVRA 3SQQA 3GC7A 2UW4A 5HNGA 3SG9A 1DAYA 2YM8A 3L8PA 2PVMA 4KUJA 4E6CA 2UZNA 3G90X 2OZAB 4EKLA 3UO5A 2BROA 4J71A 3KA0A 3DKOA 2C69A 3TNPC 4RSSA 4MKCA 2AC5A 4LRJA 5FEDA 1B38A 4FTAA 3AQVA 1A48A 3TZ8A 4O6EA 4CD0A 4GG7A 5KO1A 2GU8A 4YBKA 2R3LA 5T68A 1KV1A 2XK6A 3AC8A 3K5VA 3NS9A 3T9TA 3QTUA 2OXXA 4QYEA 4RIYB 4QQTA 5J95A 3HV4A 4L46A 5IA0A 4Y5HA 4RGJA 5IH5A 3LLAA 3C7QA 2ZM1A 4BC6A 2Z60A 3GU6A 2ZB0A 1VYWA 4PX6A 3V5JA 3QLFA 4F7NA 3FMHA 4PMSA 5AP6A 5BUJA 2XH5A 3LCTA 2QODA 3FL4A 3UP2A 3QYWA 3POZA 3HMOA 5E92A 4BIEA 2VD5A 3PA3A 4FKWA 5HQ0A 2C1BA 4I94A 4W4XA 4LM5A 2O63A 3LFSA 4DEDA 3SVVA 3ZSHA 2Z7RA 3BHUA 2V0DA 5CAUA 3P86A 3FLWA 2FUMA 3MB7A 3VBQA 4V04A 2W1CA 3NAYA 3RZBA 2B9JA 4O7VA 2XNPA 3HZTA 3A7HA 3E64A 3FQEA 4FTNA 2YM3A 1OVEA 3VS4A 4S33A 5EKNA 3E3PA 3ZXTA 4FV8A 1IG1A 5CENA 2OXYA 3E5AA 5LXMA 3OWLA 1M17A 2AUHA 5KKRC 3C5IA 3CS9A 4PV0A 4G6LA 3MS9A 4G3CA 4IM3A 4HCVA 4EEVA 3ZO1A 4IVAA 4DHFA 5AR2A 2W4OA 3R9DA 4XG9A 3UVPA 2C0IA 4EORA 4QMYA 4EOIA 3CXWA 4GK4A 5EM5A 4A9RA 3R1SA 5BVNA 2XM9A 2RGPA 3A2CA 5LCKA 4KKGA 3D7TB 3WF5A 4RC3A 1DI9A 5FTQA 4O7LA 2PUNA 2UVXA 1JKLA 4Y5QA 5HX6A 2R0IA 4C61A 1IA8A 4OTPA 3UJGA 1IRKA 3ATTA 3TDWA 4CGAA 3FI3A 1W0XC 5CSWA 4TN6A 4RFMA 3M11A 1IR3A 2PL0A 4IWQA 2ERKA 2BHEA 5D10A 4RJ8A 2PULA 4B99A 3D5VA 5HLPA 5IQFA 3LMIA 3FJQE 5AV2A 3T8OA 3R8LA 3V8WA 2BKZA 4RQKA 3GC0A 5CEIA 4HVSA 4TWCA 4BZNA 2VTOA 4X2FA 3MIAA 2I7QA 2XBAA 2ZMDA 4AFEA 4ZLYA 4NL0A 4ASXA 2ZV2A 3KCFA 3EYHA 3RK5A 3FYKX 4DFXE 4GV1A 3BGPA 4PF4A 2G15A 4XP0A 2E9UA 1YWRA 4LQMA 3R7VA 3EQHA 2HZ0A 4AZSA 1YOMA 2OI4X 4X3FA 3H0YA 4IQ6A 5DIAA 3R6XA 4YZ9A 3GC9A 4UMPA 5LARA 4AQCA 3HKOA 3KXHA 4S32A 5HG8A 4A9SA 4F6UA 3WYYA 4NH1A 4EKKA 5AADA 4FTCA 5HVYA 1JVPP 4ANMA 5B2MA 3U9NA 4P5QA 1YWVA 2QOQA 3CQWA 3DBFA 4IC7A 3R9HA 2WMQA 2ETRA 4BTKA 2X8DA 4R3CA 5CF5A 5KBRA 3AXWA 5ACKA 2PWLA 3QA8A 2PPQA 2QHMA 4R3RA 3LPBA 3FQSA 5AA8A 3ID6C 4XRLA 4F7JA 2YACA 3FEGA 1GZOA 5HD7A 3ZSGA 3A7IA 3DGKA 3G0FA 5IH6A 3GNIB 4BGHA 4ALWA 5KMMA 4HVGA 4RZWA 3IONA 3ETAA 5L2TA 4AF3A 2VTNA 5KMLA 2J51A 4GJ3A 3DXNA 1H24A 4YJUA 4P7EA 1WBNA 4BCKA 5A14A 4AE9A 4PL4A 3VS0A 4HZRA 5LWMA 4FV5A 2X9EA 2EU9A 4IWOA 2FA2A 2QR8A 3C4CA 5M44A 4R7BA 5KHXA 3V51A 2F2CB 2C5YA 1KOBA 2OIQA 2R7BA 4IX6A 4FZ6A 4CEGA 4IAIA 4G9RA 1Q8YA 3C4WA 4MXAA 3A7GA 3GU4A 4E26A 3TCPA 2UVYA 3TT0A 5C01A 2OF2A 2RF9A 4QMTA 3QZHA 4AGCA 2YM6A 5AUUA 2UW8A 4QMSA 3VNTA 3FZOA 4XHKB 4I23A 2OBJA 3W2RA 2HYYA 3VS1A 4EOPA 3QKLA 5AV0A 2ITXA 4IAAA 4J1RA 1OKYA 2BIKB 3ZUUA 3GB2A 5IF1A 3PLAE 4O86A 3SOAA 5CQWA 3FI8A 3GXLA 4O7SA 3BGZA 5LVMA 5BYYA 3ODZX 3UNZA 1OGUA 4E8AA 3HX4A 4GJ2A 4CKJA 3W16A 2VU3A 4YMJA 5K3YA 3W2PA 4NIFB 3DA6A 5ANIA 4QP8A 3JPVA 4UV0A 2H8HA 3OEZA 4M67A 4MVFA 5M4IA 3DY7A 4L45A 2PVYA 4IDVA 4UWBA 4CV8A 3RHKA 4N70A 4RWJA 4QTCA 4FNZA 3AMBA 5IH4A 3V6SA 3BKBA 3NUNA 3WIKA 4EQUA 1JKKA 5KMJA 1LPUA 3Q96A 4U3YA 1BMKA 3MJ1A 4R6VA 5DHJA 2JKMA 4CLIA 2WTDA 1YHSA 3OEFX 4O0XA 2F9GA 5J7HA 3D15A 3VF8A 4N6ZA 2UZVA 3RK9A 5JGAA 4EOQA 3SG8A 4BIDA 2W1DA 2J0MB 4GG5A 1PXLA 4B8LA 2V22A 3FMEA 4AG8A 2PTKA 2YM4A 3NUSA 3T3UA 3AMAA 2YFXA 4EHEA 5M4CA 4ZY6A 3GGFA 3UMXA 4X3JA 3BIZA 1XQZA 5DT4A 1FOTA 1SVGA 3QCXA 4EK8A 2PK9A 4MQ2A 4GUBA 4NK9A 1YXXA 3H3CA 3PFQA 4YTFA 4IB3A 4ZZOA 4Z55A 3C13A 4PDPA 1Q8TA 3M1SA 3TUCA 1T46A 1QMZA 2YDJA 4U81A 5JRSA 1FGIA 4EBVA 2QCSA 1XHAA 3R83A 1OL5A 4BDCA 5IA2A 3VS2A 5AR5A 3ANRA 2IWIA 3QQHA 3O0GA 3KMWA 2SRCA 5L8KA 4GIHA 3O8PA 3LFFA 3LM5A 2QKRA 5BVKA 3OUNB 4M8TA 2BCJA 5IZFA 4O27B 4M69A 1DS5A 3ZLSA 4EYMA 3R7YA 4Q5HA 4UMQA 1TQIA 2WKMA 1B6CB 2UZBA 4WKQA 5DT0A 2PMLX 3CQEA 3KXMA 3QKKA 4ERKA 3ZDUA 4UXLA 3WILA 2XJ1A 1H4LA 3GQIA 4GU6A 4CTCA 3PJ3A 4EL9A 5IUIA 4D1SA 4E93A 5M53A 4EOSA 3FMJA 4IWPA 4V01A 4E1ZA 3RAKA 3WZKA 4F65A 2OJJA 2PMOX 3ZO2A 3KMUA 4M12A 5KHWA 2VO7A 4R77A 1K2PA 5C4KA 1TQPA 5FXRA 3K54A 2OICA 4WNMA 4RA4A 3EQFA 3TZ7A 4J8NA 5E8SA 3DNDA 5KMNA 2B9FA 2W4JA 4OTFA 4CFXA 2W17A 1O6YA 2C4GA 3W55A 4FK3A 3TI1A 2YLEA 2I40A 2ERZE 2YN8A 3DLZA 3F61A 4IAFA 5DT3A 3BV2A 4FV3A 4CKRA 3PA5A 4CCBA 3R8ZA 3DS6A 4H3QA 3ALNA 4MF0A 2GNLA 1Q8UA 4XS2A 4ALVA 3BLHA 4BIBA 4FSQA 4CZUA 1YI3A 2QU5A 4DAWA 2ZJWA 1OKZA 3CKWA 3ZFXA 2B53A 2X8EA 2BZKB 2VTHA 3NUPA 3OWJA 3S3IA 3GI3A 4DFLA 4KWPA 4XRJA 3RVGA 4CFNA 3FZTA 3KRLA 4F1OA 2G1TA 4NFNA 3OMVA 2XNEA 3BYOA 3TNHA 5C9CA 2PZRA 4WNOA 2A4LA 5AX9A 3VUMA 3RGFA 2VZ6A 4JG7A 4QPMA 4YJNA 2WQMA 4GT5A 5HIDA 2XUUA 2PE1A 5CXZA 3S1HA 4MXXA 1MQ4A 4X6RA 4AW5A 4U41A 1Z57A 2JKQA 3KXGA 4AA0A 3TM0A 5FD2A 4BI2A 1GIIA 3FMLA 1JSVA 3PPKA 2CLXA 4DH5A 3ELJA 2WMBA 3TEIA 3GCPA 2Z02A 4GIIA 4WO5A 1U46A 3R0TA 4BYIA 5KZ0A 2PY3A 5H8BA 4ERWA 4F9AA 1OIRA 3KCKA 4IAZA 4GFOA 3WARA 4NSTA 4DG3E 3CD3A 5AR4A 4Z16A 4FTOA 4JBPA 1H0VA 5KUPA 2BZIB 4RX7A 2ITPA 3F6XA 3GU8A 4MK0A 4CG8A 3HLLA 4FV7A 3U6HA 4CLJA 1BYGA 1YDSE 5CANA 1AQ1A 2FVDA 2PHKA 3I0QA 4RIWB 3SW4A 4DF3A 4U79A 1U54A 5BVFA 4U0IA 1SVEA 2Y4PA 2PVNA 4FR4A 5LMKC 2HWOA 1H27A 1STCE 2X2MA 3HRBA 4XG8A 2QOFA 3ZRKA 2BAKA 4QYYA 2GHGA 4XV2A 1Q99A 2GQGA 2KTYA 1YOJA 5AP3A 5GJDA 3DCVA 3PTGA 3TNWA 4NT4A 1ZY5A 3A61A 4M7IA 4NEUA 4QMXA 3TKIA 2YZAA 4F64A 5D7VA 2OJFE 4FKUA 4HPTE 3P7AA 5J5SA 1Q24A 3N4VA 4IVDA 3MA3A 1WVYA 4X21A 3OCGA 5CSPA 4IZAA 3R1NA 3ENMA 4E4LA 4FZ7A 2XBJA 3F5UA 2W1EA 3ORXA 1YXVA 4YZBA 4IMYA 3ZH8A 3DKFA 3TNQB 2OKRA 4AT4A 4FGBA 3PE2A 4NUSA 1R0EA 3FZPA 5CEPA 4CQGA 4LV5A 5CLPA 2UW3A 3FHRA 2YCRA 5CWZA 4ZSGA 1E1VA 3TIZA 1YQJA 3UTOA 5I5ZA 3COIA 4II5A 3EQCA 5IA1A 4ZJIA 5ACBC 4MNEB 4FZFB 5ANKA 2VGOA 2HK5A 5EYKA 2ESMA 4TRLA 3R7IA 4F7LA 3CQUA 4AGWA 2IVVA 2BDWA 4OT5A 2OJGA 2WAJA 3SC1A 4BBMA 3ZZWA 2OFUA 4ZY5A 2W1FA 3OY1A 4TZRA 5J9LA 4MBIA 3FE3A 2BRNA 1Z5MA 3E93A 3HGKA 2X2LA 5BMSA 2WGJA 4A07A 2C68A 3PXZA 1EH4A 5ICPA 1UNGA 2XMYA 1VEBA 4YJPA 4UX9A 1LEZA 4NTSA 3FXZA 1RQQA 3IOKA 2E9VA 3LM0A 4TY1A 1PF8A 3IKAA 4IEBA 5C1QB 2R3QA 4C2WA 4D9UA 5E9EA 5BUIA 5HLNA 2XF0A 4PDYA 5IQAA 3KMMA 2CGWA 1XBCA 2B4SB 2B52A 1F3MC 2XS0A 2JDTA 4MXZA 4DH8A 5AP2A 3UPZA 4YTHA 1XH8A 4RJ7A 2IZSA 4APCA 2UW9A 4O0VA 4QT1A 3LFBA 2UV2A 3V6RA 4IH8A 3BLRA 4O0SA 2X4FA 4YZNA 4FTIA 4PRJA 3RCJA 4O0RA 4ZZNA 3VS3A 2JIIA 3PXYA 5IQIA 3MYGA 4H1MA 3G9LX 1I44A 2ZVAA 1KOAA 2H9VA 3E8NA 1J1CA 3REPA 3NNUA 4YPSA 3V5QA 4KKHA 5IA4A 1U4DA 3OXTA 4RPVA 3PVWA 2JC6A 4L7FA 3Q6WA 3S0OA 3IGGA 4XG4A 4MTAA 2B0QA 1UU9A 1IA9A 4IB1A 2O64A 3AGLA 4Y83A 2OXDA 3PXQA 1JNKA 2QLQA 2V62A 4OTIA 3OTUA 3L8VA 2IVTA 4ANNA 5HO7A 3Q53A 2HXQA 4EYJA 5IA5A 3H9RA 4F0FA 5AAGA 1U5QA 1BI8A 2WTWA 4FT3A 5ETCA 1BX6A 1U54B 3OHTA 4X2NA 5JH6A 4O38A 1TKIA 2DYLA 1NVQA 2X2KA 1OPJA 2C5NA 4R78A 4AN2A 3LCDA 4FSRA 4O7YA 4M84A 3DNEA 5DR6A 2X0GA 5I9UA 4D1XA 4J52A 3QQLA 1MRYA 3KEXA 3LCOA 4JBQA 3MTLA 3ZUTA 4BBEA 2Y7JA 3HMPA 1YDRE 5K0XA 1CKPA 3G5DA 3VULA 2Y0AA 4XG7A 3O2MA 5IISA 3IS5A 2UZDA 4FV0A 4FODA 4D4SA 3NEWA 3PP0A 3PZEA 4FGRA 3Q5IA 4IVBA 3N9XA 4L8MA 5DPVA 4MD9E 3MY1A 4K6ZA 3R8PA 5DWRA 3FLYA 2QNJA 3A62A 5AUTA 2QOCA 3TL8A 2CDZA 3OWKA 5T6KA 2JAMA 1Q3WA 2VO3A 3O51A 5D41A 4FC0A 4IDTA 4D2WA 2JAVA 2ZV7A 3I1AA 3VC4A 2CLQA 5IMXA 3U6IA 5EW3A 4H3BA 4KSQA 4LYNA 5CY3A 2R3GA 4AOJA 5HNIX 4G34A 2Y6MA 4I93A 4YU2A 2GTMA 2ITVA 2R3KA 4BCOA 5CALA 5KNJA 5H8GA 1Y91A 4Y8DA 2GNJA 2YLFA 5B0XA 3KRWA 4OTGA 2PVLA 2C6KA 2VX1A 3R01A 3AGMA 4E4NA 4RIOA 2WU6A 4I3ZA 5BX0A 1MP8A 3C0GA 4L6QA 4DFUA 2EB2A 4IX5A 3ZBXA 3EQIA 3D4QA 4N57A 3PXFA 2PVRA 3BE9A 5C8KA 4FTMA 4FV1A 2R0UA 3FI4A 4CQEA 2IZUA 2QVSE 1VZOA 3KQ7A 1KSWA 2ITNA 2A2AA 1OMWA 2BRMA 2QKWB 2YDIA 4PMMA 3H30A 2GHLA 2WNTA 2ZYBA 2R3RA 5B2KA 1JKTA 2QOLA 3Q04A 4CRSA 2VTSA 3LCSA 5TF9A 3FYJX 3NGAA 1WBTA 2BMCA 3FKOA 2C1AA 4IACA 4U6RA 3R7UA 3FSKA 1ERKA 4XNEA 3C4EA 4FEXA 3SRVA 4FL1A 5AP7A 3ZC5A 1UNHA 3NCGA 5DMZA 2VX3A 4O0UA 3FXXA 4FVPA 4S30A 4OW8A 4IANA 4PP9A 2ZDUA 2PE0A 3IO7A 2WZJA 3MVHA 3BU6A 5F94A 1Q8WA 5JN2A 4GYIA 3P5KA 5CU2A 1GY3A 4DEIA 5IU2A 4KIKA 4X2KA 2BFYA 3GQLA 3DDQA 3CSVA 3C0HA 5CU4A 4L68A 2W1GA 2P4IA 3MPTA 3PLSA 3B8QA 3PXKA 4LRMA 1UA2A 3GC8A 3SHEA 3UG1A 3OCBA 4G1WA 4IXPA 5IDPA 4UWCA 4UYNA 4EQMA 1Y57A 4FT0A 4AZFA 4HVIA 3L8XA 4IADA 4K1BA 1XBAA 5AEPA 4ZXTA 5CAQA 4QQ5A 5M08A 3IECA 3FUPA 5F95A 3DOGA 4ZZMA 4R1VA 3OTVA 4ASDA 2REIA 5AP1A 4BI0A 4D1ZA 3HDNA 3S00A 3R1YA 4DFZE 4IHPA 4AOTA 2WMRA 2BIYA 4IZYA 4D2SA 4FYNA 5KE0A 4DCAA 1YI4A 3EN4A 4BDAA 3R30A 5I0BA 5LVLA 4OUCA 3VJNA 3F5PA 3ZYAA 4MXOA 1OL1A 3NDMA 3EZRA 2XYUA 2WTKC 3ZDIA 4MQ1A 4KBAA 4C8BA 4YURA 3Q6UA 4L52A 4ZIMA 5FWKK 3BEGA 1LP4A 2HZ4A 2A19B 3JR1A 4YC8A 3TKHA 4OTDA 3FMNA 2YERA 3OUKA 5CU0A 5JGDA 4NW5A 2X7OA 4AE6A 4BCQA 1CKIA 4F0GA 3AC2A 4ANQA 3KXZA 4CMOA 3NVKI 2ZB1A 5A6NA 1RJBA 3LAUA 4RQVA 5AP0A 5AR7A 5IDNA 3UBDA 5JFXA 3UO6A 3HYHA 4ANSA 5J1WA 2NP8A 3KXXA 4MD8E 2HOGA 3GVUA 3QXPA 2UZUE 3EL7A 4O21A 3UMWA 3H9OA 1ZOHA 4X2JA 4EJNA 3B2WA 4F1MA 2F2UA 4WNKA 2IW6A 3GCQA 1J91A 4DTAA 2JLDA 2JFMA 5HG5A 3NR9A 4HYHA 1J1BA 1YVJA 3VS6A 3MY5A 3NYXA 5A3XA 4DTKA 4HW7A 2BAQA 4I0SA 4ANOA 4B4LA 3A4PA 3G33A 3DAEA 3F7WA 4YO4A 3MWUA 3MTFA 3EN5A 4IX4A 5J79A 4BCPA 4LRKA 4YJTA 5CEOA 1NXKA 3CGFA 4FIFA 1PMUA 3ZLWA 5HG9A 4AUAA 1RW8A 2XJ0A 2PU8A 3DBCA 4Z7GA 1V0OA 4YNOA 3T9IA 1YKRA 3M42A 3UIUA 2ZOQA 4IZ5A 5E8UA 3PVBA 1B39A 3EIDA 3AD4A 3GCUA 3IW6A 3LJ1A 4FKTA 4N0SA 2RFDA 4ANLA 2QONA 4HNIA 4YSMA 3Q4UA 4XV1A 4YO6A 3DFAA 1GJOA 2F7ZE 3UC4A 3KXNA 1UKIA 2GTNA 1J7LA 3TWJA 2C5XA 5CAOA 5ANEA 1OBGA 5CNOA 5LMAA 2UW7A 3O50A 3SRVB 3VN9A 2YAKA 3PVUA 3LKMA 5K5XA 3W10A 3ZRLA 2PZYA 4Q5EA 2OH0E 3BZ3A 5I9ZA 3BRBA 3GBZA 4D2PA 1REKA 4D5HA 2PVFA 2J0JA 2V7OA 4APPA 5DR9A 4ZJVA 2HXLA 4D5KA 3UP7A 4W9WA 3A99A 1Q3DA 2WMTA 3HRCA 4XUFA 3VBVA 5FLFA 1LUFA 5EM8A 4JXFA 5LJJA 2ZV8A 3I7BA 3E3BX 4FSMA 4L53A 4M97A 4DLIA 2CGVA 4AP7A 4G6NA 1FVRA 4DT9A 4FNWA 3MBLA 3E87A 3QRIA 3MH1A 2CNUA 3OCSA 1VYZA 3LMHA 5JZNA 1CKJA 3LQ8A 3QTIA 4FVRA 4O6LA 4U42A 3RBWA 4O82A 3CIKA 3MFSA 3MFRA 3NIEA 3Q52A 4QYFA 3QQUA 4AZTA 4C62A 2PVHA 4HVDA 1PKDA 5KMKA 4WRGA 3NMUF 2Y6OA 4K8AA 4ORKA 4DH7A 2UZWE 2C6OA 4C59A 4FTJA 3CTJA 3PRFA 5IQBA 1JBPE 4RX8A 5LCJA 4MH7A 4D4RA 4MBLA 4FV2A 5CSXA 2XK3A 4IFCA 4BWKA 4DH3A 4JDJA 3NUAA 1H25A 5CTPA 4O7NA 4Z7HA 3PJ8A 3AT3A 4GH2A 4LUDA 4CFMA 4U44A 1XH4A 4ITJA 5EOLA 4F63A 1H07A 5I3OA 3MN3A 2EWAA 2GSFA 3QA0A 4G31A 2F4JA 4LUEA 2XZSA 4F70A 5JK3A 1M14A 5DFPA 2OFVA 2BDJA 4C33A 3W2OA 3L9NA 4KB8A 4C34A 1H0WA 4AT5A 3LQ5A 3MI9A 4KBCA 5E91A 3LLTA 3SA0A 3ACKA 4YSJA 3OT3A 3AG9A 5M51A 4AX8A 2IVUA 1UKHA 4OBQA 3NNVA 3ENHA 4K0YA 2UVZA 3GOPA 2R3FA 2BTSA 2WQBA 4YC3A 3VS7A 3CR0A 2QOIA 5LMKA 4QPSA 4RJ6A 4JLCA 3SD0A 3GT8A 1ZAOA 2CSNA 3SXFA 4FF8A 1ZYLA 3TJDA 4BCFA 3ORLA 3LW0A 3RAIA 1M7NA 1Y8YA 2WIHA 3C1XA 3OFMA 5ETIA 1CTPE 2O3PA 2WEVA 5BYZA 5C27A 2UW6A 3AC4A 1XH5A 1CDKA 2HAKA 4UMRA 4PY1A 3E63A 3PDTA 3F66A 3A8WA 3EFWA 2XK7A 2HW6A 3NYVA 4E4XA 3FLNC 3R22A 4C7TA 4JDKA 4B9DA 2IVSA 3LQ3A 5DNRA 3ZUVA 1VJYA 4KS8A 4L42A 5EKOA 1XO2B 3D5UA 4A9UA 2XB7A 2QG7A 3I5ZA 3BHTA 3R7GA 4L43A 4FA2A 2WB8A 3THBA 1GZNA 4ZMFA 5IQCA 3PIZA 1PXOA 3FSFA 1XWSA 5KBQA 3O7LD 2QG5A 4GW8A 1JAMA 1R78A 1GZKA 4L7SA 2VWWA 2BFXA 2J0KA 3I4BA 2XIYA 4FEQA 1I09A 3DJ7A 5FM2A 4LL0A 2XVDA 5CF4A 4RFZA 1NVSA 1M2RA 1J7UA 3R9RA 4DFBA 4YLKA 3VBYA 3DJ5A 1OL2A 2HWPA 3TZMA 3Q9ZA 5HKMA 4GCJA 3PVGA 4M66A 4ZTLA 2W4KA 2JDVA 3Q4CA 4QNYA 4F7SA 4ZS4A 4ENXA 4BR3A 3DXPA 4DTBA 3H9FA 4N6YA 4L3PA 3QWKA 3B8RA 3G2FA 5EQPA 2HELA 2PUPA 3BELA 4FTTA 4O2ZA 4FTLA 3VUKA 4AZVA 1OIQA 4JBVA 3AC1A 4QYHA 4U80A 4O7TA 1Q8ZA 2XRWA 2HZNA 3HP2A 4FSWA 5TOZA 3TKUA 4DLJA 5L2SA 5BVEA 2LGCA 3KL8A 4MX9A 4DFYA 1IAHA 1BI7A 3BE2A 1UU3A 4EBWA 4G16A 3UOKA 5TE0A 3RPVA 1GIJA 1YHVA 2XIXA 4B0GA 3ZXZA 3VW6A 3CE3A 3F3VA 3HMNA 2CKQA 2GNIA 4UZDA 4ZTMA 4I41A 4A9TA 4G3DA 5HLWA 3R04A 2B9HA 4RX9A 2X6DA 5EQEA 2VNWA 2XYNA 5I9VA 2W0JA 2GPHA 3KK9A 2ETKA 5HESA 3WF9A 1PXJA 4FT7A 3UOLA 4EHGA 2R5TA 3GCSA 4RBLA 4ZSEA 1W84A 5CASA 3BHHA 4I24A 1OL6A 2WU7A 3F9NA 3W2SA 1WZYA 4IB0A 4U3ZA 4EC9A 4EQCA 4QMPA 3CBLA 5K4JA 4TWNA 3ALOA 4K18A 2VUWA 2R3PA 4W8EA 1M52A 3CLYA 5CU6A 4ZJJA 4KINA 2F7XE 3RHXA 3G6HA 2W9ZB 3G6GA 4QMWA 3JUHA 4DINA 4AOIA 3E88A 5CT7A 3VJOA 2WMSA 5E8TA 4X3FB 4HOKA 2QOBA 3ROYA 1OM1A 3KRRA 4ALUA 4JR7A 3DTWA 4OBPA 4EK6A 5CXHA 4NJ3A 5AV4A 3QXOA 2J5EA 2J0LA 4CYIA 4E7WA 4RZVA 3OROA 4AGDA 2VWYA 4P5ZA 1G8AA 1URCA 3HRFA 2XEZA 5E8WA 5TKDA 5IA3A 4S34A 3Q3BA 5FDPA 5M56A 4KAOA 3KFAA 3PYYA 3EOCA 2YM5A 4R5SA 5GJFA 4EOOA 5A54A 1REJA 4RVKA 2PUUA 3AD5A 5AX3A 4O7RA 5DH3A 2HW7A 4IE9A 4F6SA 2C6IA 5H9BA 3TNIA 5AAEA 4HYSA 3DKCA 2BZHB 3HA6A 4QP3A 5HI2A 3VBWA 4PP7A 3PRIA 2W5HA 3BQCA 2BR1A 1H01A 2OGVA 4C4GA 3MH2A 3RNIA 2FYSA 1HCLA 3VBTA 2W7XA 3GCVA 4GRBA 5DEWA 4WT6A 1OUKA 1LEWA 4LMNA 4NW6A 3ORZA 3U55A 4XV3A 3FC2A 3LXPA 3Q9WA 3WF7A 4ZSAA 4AN3A 1RDQE 5FG8A 4C3PA 4IAKA 1QPEA 1XR1A 4FKQA 4RVMA 4C02A 5HO8A 3LVPA 3VQHA 5HVKA 3HAVA 3BI6A 2XEYA 3HDMA 4BDGA 1ZYDA 4U7ZA 4BRXA 4NYEA 4H36A 5K0KA 4TYHA 4ZAUA 5CEQA 2CJMA 3PA4A 3PY3A 4R3PA 1KWPA 4KS7A 1NY3A 3PY0A 4M3QA 3PIYA 4H3PA 4U5JA 3RPRA 4WNPA 3QU0A 3WI6A 4ARKA 3DT1A 2CKEA 4E73A 3R2YA 3VO3A 2FGIA 4TYJA 3EZVA 4RIXA 2CHLA 2VNYA 3FKNA 3FZ1A 2BILB 3V5WA 4C3RA 2GS6A 2FH9A 1AGWA 3R8UA 3OS3A 3DK6A 3ERKA 4HCUA 5HO6A 3R9NA 1XBBA 5AM7A 1PXMA 5HBHA 4AA4A 4O2PA 4LGGA 3RM7A 4JDHA 1FVTA 4EH9A 1V0PA 1M2QA 2F57A 4I1ZA 3BCEA 4BB4A 2YHVA 3TTIA 4C57A 4FEVA 4ZSLA 3BLQA 4MD7E 1FMKA 3CP9A 3JY0A 3SV0A 4EZ7A 3UNKA 3P79A 4I5MA 2VRXA 2V55A 3MB6A 4UB7A 4QMLA 1PMNA 5G1XA 2J2IB 2O65A 3OXIA 4IB5A 4TKSA 1SZMA 5CU3A 3JS2A 4A06A 5HU3A 2PMNX 4RX5A 3QL8A 4OAVB 5E1SA 5IUHA 4FKVA 4OBOA 1ZWSA 2P2IA 4FV4A 2J6MA 4KRCA 4AN9A 4BDJA 1NA7A 4FG9A 3RPOA 1IAJA 1Y6BA 4MYGA 3FLZA 2NNWB 4RG0A 5CNNA 2W5BA 4PDOA 3VUGA 4DN5A 4ITHA 4QP9A 4RT7A 4KIQA 4YZCA 3FMDA 3BYVA 3VRYA 3RK7A 2WMVA 4PPBA 3U8WA 1SYKA 5D1JA 3E8EA 5EDRA 3OXZA 2Y4IC 2ETMA 2QOHA 2JBPA 3P08A 4NU1A 3DFCB 5HZNA 3W18A 2GS7A 3CTHA 4QPAA 2WHBA 2C6TA 5AUWA 3ZFMA 4ZTQA 3ZHPC 4YTCA 1W82A 2XIKA 4QTAA 4L67A 1H1PA 2JBOA 4BF2A 4DBNA 3MJ2A 3I6WA 3LFQA 5AP5A 3FWQA 2XNNA 4CZTA 1SNUA 3FPQA 4CFFA 3Q32A 4F09A 5CF6A 2QC6A 4M69B 2WMXA 3QALE 2QOOA 4PTEA 2YISA 3UIMA 2R7IA 3OT8A 1WBWA 5IG1A 4JDIA 1Q5KA 5BMMA 5CSHA 5EI2A 3RPSA 4FZAB 4AU8A 3R02A 4RMZA 3PSDA 4C58A 3LFAA 3F2NA 2IW9A 3MPAA 5CQUA 3NNXA 3K3IA 4PTCA 3BYMA 4UALA 3QX2A 3R7OA 3PG3A 1OKWA 2VV9A 4JQ8A 3LJ2A 5AAFA 4X0MA 5AUVA 3IGOA 3Q9XA 4FKRA 3P23A 4G5PA 4ZEGA 2WO6A 4D2RA 3QTRA 4I6HA 4DGGA 2O5KA 5EYCA 2NRYA 4D0XA 5J8IA 5ANDA 1KE6A 4USDA 3ZEPA 3U54A 5IPJA 4PQNA 3W1FA 3D2IA 4XLVA 1JWHA 4TYHB 3TIYA 2W96B 4E6AA 5CZIA 5IEXA 4QP7A 4NJDA 4KKEA 4TT7A 4Y73A 4ZTSA 5H2UA 4OGRA 4CFUA 2VO6A 3HVCA 3OZ6A 2IZRA 3BPRA 4K2RA 4FG8A 5FEEA 4BKYA 2YCSA 3FXWA 4AA5A 4O81A 2C5VA 1ZMVA 2A1AB 4L01A 4O0WA 4PPAA 2IJMA 3D2KA 5GZAA 4EJ7A 3IG7A 3VAPA 3NW6A 3VUHA 5A6OA 3HP5A 2NPQA 3K5UA 1DM2A 5A4CA 4XG3A 2CNQA 2I0YA 2B7AA 4W4WA 4C4FA 3UZTA 3ZRMA 5FEQA 3FPMA 3QCSA 4P4CA 4H05A 3EKNA 1H08A 2F7EE 2X7GA 2YIWA 4BGQA 2Z2WA 4I5PA 2YWVA 3MPMA 4A4LA 4I6FA 4YR8A 1UNLA 3QKMA 3JY9A 2G2IA 5CVGA 4ZTNA 3MESA 5HORA 3P9JA 4HYUA 1ZYCA 1P2AA 4AT3A 2W5AA 4YUQA 3S95A 4BY9E 5L4QA 3DB6A 3QZIA 1WFCA 2ZM4A 4IX3A 4D9TA 4Q9SA 4YJSA 1PMVA 1L3RE 5HCXA 4UXQA 2OZOA 3UQFA 4J95A 5AIKA 5FP5A 5IUGA 4AS0A 2XCKA 5JEBA
chains in the Genus database with same CATH superfamily
2FO0A 4TXCA 3D83A 1W83A 4AGUA 5E8ZA 3UQGA 2BHHA 4C4JA 2Q0NA 3U4WA 3EN7A 4WBBB 3SLSA 2J9MA 2WIPA 1UV5A 2WQOA 3AT4A 3QC4A 1S9JA 4KD1A 3PUFC 5ETAA 2C6EA 1PJKA 4G17A 3R73A 2X9FA 4V05A 5EDQA 4RVTA 2R64A 5JQ8A 3VBXA 4AACA 4CG9A 3EQGA 4QYGA 3BU3A 2CN5A 2BPMA 3MFTA 2XK4A 3V8TA 4WD5A 1PXNA 2UZTA 3AMYA 3FQHA 4F9YA 4JQEA 3FV8A 3E7OA 3F2AA 4FI1A 3ATSA 4AXFA 3HV7A 1U59A 2PVJA 2YITA 4WG4A 3KB7A 4WSQA 4L9IA 3EQRA 4DG0E 1FPUA 4PMTA 4EK5A 1QPJA 1ZXEA 4ZY4A 3UC3A 5BVDA 2OJ9A 5EW9A 1KE7A 2IPXA 2RG6A 1F0QA 4PNIA 2W06A 5HE2A 3AC5A 3N4TA 4O7WA 3QFVA 1CSNA 3MGYA 3NW5A 1XMLA 3ZBFA 3FKLA 3PXRA 5L8JA 2WOUA 4Z3VA 2HENA 1FQ1B 2XKCA 3KY2A 5FM3A 2OW3A 4F9CA 5DI1A 4MNFA 3SOCA 2PE2A 4XOZA 3QQJA 4D0WA 4UMTA 1BUHA 3F7ZA 4BDDA 3H0ZA 4NCTC 4QMQA 5M07A 3F3TA 3RPYA 4E6DA 4Q9ZA 4GK2A 5AR8A 1PY5A 4QD6A 5J87A 3POOA 4JJRA 4F6WA 4NM0A 2VTLA 4JL9A 4DE4A 4GT4A 3ORIA 4LV8A 5A4LA 3BYUA 4L44A 4BDBA 1R1WA 4FYOA 3F82A 1OGYA 3OF0A 3TYKA 2QOKA 3ITZA 4I5CA 5HG7A 2CN8A 4BDKA 5I9WA 4YLJA 1U5RA 3IQ7A 2CGUA 2WTIA 5F20A 4DEBA 5GJGA 3C4FA 4YTIA 4RWKA 2CGXA 3WIGA 1OB3A 4BTFA 2NO3A 4RJ3A 4CRLA 2BALA 5BNJA 3ROCA 5HTIA 3ACJA 4FL3A 3UIXA 3KRXA 3LFNA 1BL7A 4LG4A 3GU5A 3QTSA 4QNAA 3RCDA 2WELA 2R4BA 2VGPA 4AXAA 4E5AX 3QC9A 5DYJA 4X6QC 1Q62A 4QTBA 2EUFB 3SX9A 4AW0A 2VWUA 5KZIA 3W33A 4WOVA 4JI9A 3RAWA 5EW8A 4BVUA 2QR7A 4TTHB 4EH6A 1OL7A 2X81A 1UWJA 5FXQA 1V0BA 4BCJA 4MUQA 4JQ7A 3RMFA 3IW8A 3LXNA 1APME 2NRUA 5J9YA 4JG8A 4D28A 3HV6A 3UIBA 1CMKE 4ACHA 3DB8A 1A06A 4HGLA 2C6DA 3QD2B 2J7TA 5AP4A 3V5LA 2V7AA 4C2VA 3TJCA 4MBJA 4RLKA 2C0OA 5A4QA 1P4FA 4TW9A 4DT8A 2OZAA 2RFEA 3VW8A 2XIRA 3I81A 5C8MA 3LXKA 3SDJA 4QQJA 2H96A 4F1TA 5CEMA 4OTRA 4W9XA 4OTWA 3S2PA 2R3JA 3DU8A 4I6QA 5KKRB 3W2CA 3GFEA 4G3FA 4CNHA 3L9PA 1R3CA 4FV9A 2XANA 2HCKA 5B7VA 4I21A 1XH7A 4RIYA 3W8QA 4RC4A 5CYIA 3G51A 4I4EA 1YDTE 2WPAA 3UE4A 1Q61A 3LJ0A 3QTWA 1G3NA 4KA3A 1TQMA 4O1PA 4ZS0A 3F5XA 3DBQA 3PWYA 4IM0A 3SKCA 3OOGA 1FBNA 3VWAA 3W0OA 3MVLA 4RWIA 4QOXA 1FMOE 4BDIA 3MSSA 4DEGA 5M09A 5ETFA 4ANBA 4PTGA 5DGZA 1JSTA 4BZOA 5KMIA 3AKLA 2GS2A 4YP8A 1SMHA 4MEDA 3BYSA 3M2WA 2JFLA 3FY2A 2JKOA 4WG3A 5AFVA 4IJ9A 4FZDB 4ITIA 5HVJA 5BVWA 4A9YA 2C0TA 3EFJA 5M55A 4BWPA 3Q4ZA 4QMOA 5BUEA 5HEZA 2C3JA 1HCKA 4NKSA 5CZHA 5LMBA 3SGCA 3UO4A 3BEAA 3WE8A 3CCNA 1YXSA 2WQEA 4TL0A 4S31A 3QQGA 1OIUA 4OLIA 4EUUA 3UYSA 3BV3A 3ZZEA 4LFIA 1G8SA 3TV6A 2Z8CA 5L2IA 2CCIA 4UWYA 4BJJA 5BPYA 4DCEA 4EUTA 2PSQA 2FSLX 3MDYA 3P7CA 5E8XA 3TV4A 4F08A 2PUIA 4FE2A 4GU9A 4LOOA 4USEA 1YWNA 2XRUA 3IDPA 4NM5A 2JD5A 3R00A 4TWPA 1W8CA 5J7BA 4B7TA 2GMXA 4PUZA 5AMNA 3I6UA 4DHZA 2QD9A 1GZ8A 3DQWA 5A9UA 5J5TA 3D7TA 2C6MA 2JKKA 3COMA 1VR2A 2P55A 4WBOA 3BBTB 5GIPE 3I0OA 2YAAA 3ZMMA 4XLIA 3II5A 4EK3A 3V8SA 4FG7A 4YJOA 4A4OA 4AAAA 4LGDA 3WZJA 3OVVA 5AWMA 2WTVA 3QD3A 3P7BA 3VUIA 4D58A 2PYWA 5JFWA 2GFCA 2ZAZA 4JX3A 3PPZA 4B8MA 3OW4A 4CKIA 5CI6A 4PL5A 4FEUA 4U40A 3FDNA 4G6OA 4GKHA 3O71A 1KE9A 5AUXA 4FL2A 3QF9A 3L1SA 2CKPA 3RP9A 2R3IA 4F99A 5E8YA 2RIOA 2WFYA 4FNYA 4HGSA 3O8TA 3TZ9A 5M4UA 4FKPA 2G9XA 2J50A 3IW5A 3IW7A 2DQ7X 1WBOA 3ORMA 5FRIA 1OKVA 3U9CA 4BBFA 5JT2A 3QTQA 3QUEA 5DBXA 4RJ5A 4I22A 4NZWB 3RM6A 2C30A 2HZIA 2B9IA 3F5GA 4JIAA 4HGTA 1GOLA 4J8MA 5GIOE 1YW2A 4TYGA 3AOXA 4JRVA 3UOJA 3R1QA 3E92A 2UZOA 3W8LA 3IK3A 4LOPA 3V04A 3TXOA 2X4ZA 2XNGA 4UYAA 3ZC6A 4U9AA 3QX4A 5EYDA 5AUZA 5A4EA 4O7ZA 3CPBA 4MXYA 4HNFA 5DEYA 4E3CA 4ZMEA 4C4HA 4EH7A 4A4XA 2ITYA 4JBOA 4JMQA 3OW3A 5CT0A 1H26A 1WCCA 2VTQA 1JKSA 4ACCA 4KIKB 4Y46A 5FXSA 5FQDC 3HAMA 1LR4A 3DZOA 1BL6A 2FSMX 3FMKA 1XKKA 3NLBA 3QCYA 4EK4A 5EM6A 4DEEA 5IKWA 2A0CX 3KU2A 2EXMA 5L2QA 2Y8OA 4CVAA 5JSMA 3R8VA 2AEGA 4QDEA 3DTCA 2QO2A 2XCHA 4O96A 3PFYA 4RVLA 4E5WA 5CS6A 3RALA 4DH1A 2VTJA 2J5FA 3QZFA 2YABA 2JDSA 3EJ1A 3ORPA 3UDBA 2AYPA 5HBJA 4M13A 2YJSA 3CY3A 3E8CA 3RJCA 4IBMA 3QUPA 2AQXA 3MA6A 3IW4A 3NWWA 3ZSIA 4OAUC 3G0EA 2EXCX 3PJ2A 4GT3A 2GFSA 4EOKA 5BV3A 3DLSA 3OP5A 3HUCA 4Y85A 5EYMA 1KE8A 4ZLZA 5IQDA 2X0OA 2YIQA 1MRVA 3CD8A 4MAOA 3A7FA 3QYZA 5LVPA 5FDXA 2BTRA 2QU6A 2ONLC 4CV9A 3RWQA 2VWIA 4H1JA 4NTTA 5F4NA 3MW1A 3R28A 4FSYA 3WOWA 2VX0A 2XJ2A 3BX5A 3QGYA 5DN3A 3W2QA 3ZLXA 4PMPA 2QURA 4GS6A 4FSNA 4EC8A 2IO6A 4EOJA 2GHMA 3SXSA 3HMIA 2FSTX 4WHZA 4WG5A 4NIFA 4XBRA 3ZFYA 4ZTHA 4PL3A 4EHVA 5DE2A 1XH9A 4DGMA 3PE1A 1WAKA 2OU7A 2YCQA 3D9VA 3ZS5A 3FC1X 2R3NA 4FTUA 4J97A 1SNXA 1H00A 3E62A 2I0VA 3FLQA 2O8YA 1F5QA 1Q97A 3RTPA 5ANOA 3KK8A 2GNHA 1OUYA 2HIWA 2RG5A 1H1QA 3KVXA 2XM8A 3PWDA 3R8MA 2XNMA 1KUTA 4AXEA 3V5PA 4DDGA 2C3IB 2Q83A 3UYTA 4CCUA 3C50A 4JRNA 4KIOA 5EOBA 3VS5A 5HIEA 2JIVA 3BWJA 4WIHA 1PXKA 4O4DA 4DBXA 3FLSA 3PJCA 2GNFA 4O4CA 4QP4A 3HUBA 4MF1A 1PW2A 2P2HA 2YIRA 3O96A 4ZK5A 5JGBA 3I79A 4WUNA 3WF6A 5IMEA 1ZYSA 2X7FA 3CY2A 3HA8A 3QAME 2DS1A 4YZDA 2I0EA 2G2FA 2I6LA 3D0EA 1H1WA 2ZM3A 4J96A 4FIEA 2XK8A 5EG3A 4CT2A 4NFMA 3ZONA 1PHKA 4AZEA 5I9XA 3KULA 3UDTA 2CPKE 4XJ0A 4ZLOA 5C03A 4ASZA 3RNYA 4EH5A 5EK7A 4FX3A 4XP3A 4BL1A 4BKZA 1PKGA 1UU7A 1DAWA 1K9AA 2PZIA 4LV7A 5GZ9A 5ANJA 4J7BA 3NAXA 3AC3A 4HVHA 4DEHA 5HTCA 1O6LA 2G01A 2UZLA 1FGKA 3DKGA 4BYJA 5K4IA 1YXTA 5GHVA 3UPXA 2XK9A 5DOSA 2BKKA 4XH6A 1ZMWA 3PG1A 4BWXA 3AKKA 3HL7A 3LOKA 3PP1A 3O5AA 2HY81 1H1SA 4GEOA 3IDCA 1A9UA 4I6BA 1URWA 3TACA 5GINE 3TTJA 4HJOA 2IG7A 4FNXA 5TT7A 4QMMA 5D7AA 4N4SA 2X6EA 3NW7A 4C35A 1ZARA 2XAOA 3OWPA 4Z9LA 3VHEA 3A60A 2OSCA 3GP0A 3KN6A 5JFSA 3D7ZA 4TYIA 5HTBA 3UODA 3UG2A 5E8VA 3Q9YA 4FICA 4J98A 4EH2A 3CEKA 3L9LA 5TO8A 5F1ZA 3EL8A 3MV5A 2HY0A 4FT5A 1Q41A 4EH4A 5KX8A 3VUTA 4IZ7A 3QLGA 4ENYA 4K9YA 4ZSJA 2QO9A 4JS8A 4O84A 3EQBA 4RJ4A 2WEIA 4L00A 4FSUA 4MWHA 4NM7A 2BUJA 4IM2A 2RL5A 5EI8A 4BDHA 4F9BA 2H34A 2XKEA 4M0YA 5HU9A 3BBWA 4FUXA 3PPJA 3O23A 2ZDTA 4FKJA 4CFWA 3DAJA 2Y4IB 3BHYA 3FAAA 3NVMB 2W1IA 3MVJA 2UW0A 2EVAA 1OPLA 3DQXA 4HZSA 3UGCA 2WMUA 2BRGA 1W7HA 3LE6A 4EWHA 2IW8A 3CPCA 3NRMA 3OY3A 4NM3A 5JRQA 4WSYA 1PRYA 3OC1A 4XV9A 1JOWB 4TYEA 3PY1A 4C37A 4WA9A 1KV2A 3C4ZA 3QQKA 4HYIA 4C36A 1QCFA 3QRKA 3ZEWA 3FHIA 2XKFA 4CFVA 3JXWA 3VIDA 2YIYA 4LDTA 4C0TA 4LL5A 3DZQA 3ORKA 4BTMA 3G15A 4OR5A 3MVMA 3CJFA 2VTTA 2JGZA 4BCIA 1ZLTA 5HX8A 3C9WA 4U97A 2PZ5A 4F78A 2WXVA 4IIRA 1MQBA 4AW2A 2WOTA 2GQSA 5J1VA 5L8LA 5E7RA 4FTQA 1JQHA 4ZOGA 4F0IA 2OF4A 3ULIA 4QP6A 5L6PA 1ZYJA 3CJGA 4YHFA 1PYXA 2ITWA 3LIJA 3U51A 2C3KA 3RI1A 3QD4A 4OTHA 3Q4TA 3NYOA 4NCTA 4R8QA 2O2UA 3L9MA 3QBNA 2E9OA 4FVQA 3ZM4A 3F3ZA 3FMMA 5EHOA 3OBGA 3CGOA 3KF4A 3KULB 1JLUE 5HD4A 3QHRA 2KULA 5I9YA 4RIWA 2Z7SA 3R63A 5H8EA 2DUVA 2V5QA 5AM6A 4C4EA 1YRPA 3EYGA 3F69A 4YGAA 4ZTRA 3JVRA 4FSZA 4BGGA 2XNOA 4DEAA 3KVWA 4M0ZA 1Z9XA 4W4VA 2VWBA 4QTEA 5EH0A 2YWPA 1JSUA 4XBUA 2VWVA 5BYLA 4QP1A 3SAYA 2C47A 1P4OA 5C4LA 3RZFA 3E8DA 4R7IA 3R7EA 3UVQA 3V01A 1OPKA 4P2KA 1WMKA 4BCMA 4G5JA 4YLLA 4I0RA 4GFGA 3UOHA 3R71A 2I1MA 1ZOGA 2RSVA 4FOCA 4GVJA 4GK3A 5HNBA 4EH8A 5JFVA 4XCUA 4Y72A 5IEVA 5C26A 2OIDA 2E2BA 2X0PA 1SVHA 3NUYA 4FKOA 2JIUA 3W0SA 2PVKA 1O6KA 2YDKA 4TNDA 3D5WA 2WTJA 3LHJA 4KBKA 2OK1A 4ONAA 4R1YA 2BRHA 2VWZA 3EQDA 4MNEA 4A7CA 4AW1A 4EOMA 2PZPA 3COHA 3DXQA 3MIYA 3ODYX 5HICA 4D2VA 5JMSA 3OOMA 3P0MA 4E5BA 4G2FA 3Q5ZA 1NW1A 1IASA 3DBDA 3OG7A 3BQRA 4GFMA 3NIZA 4BKJA 4WUAA 4DG2E 2QI8A 3IDBA 4IFGA 2C5OA 3KKVA 3QHWA 1WVXA 5AUYA 4FKLA 4KNBA 4YJVA 5HIBA 1UWHA 3NUXA 2CMWA 1PMEA 2R9SA 4XX9A 5E90A 1Y8GA 3EMGA 4I6LA 3QD0A 1WBPA 4JAJA 5B2LA 3KC3A 3P4KA 4M15A 5E4HA 2BZJA 4UY9A 4YPDA 3DK7A 5GZ8A 3T3VA 1ZRZA 2J0IA 2XALA 1V1KA 3LZBA 4IC8A 3D5XA 5LWNA 4GMYA 2ZV9A 4BFMA 1WBVA 5D11A 2CNVA 3N4UA 5GNKA 2BAJA 5FBNC 2OJIA 3EHAA 3B2TA 1P14A 3C4XA 3A8XA 3MH0A 4JIKA 5AV1A 3PUPA 4AFJA 2RKUA 4OTQA 2UW5A 4K77A 2IN6A 4GYGA 2ITOA 3WZEA 4BCHA 5EM7A 1H8FA 2B1PA 5ANGA 3W32A 2FSOX 4FKSA 4UEUA 4YHJA 3EN9A 3LCKA 3EKKA 2YA9A 4QMUA 4V0GA 4H58A 1S9IA 3ZCLA 2Q0BA 4QMZA 5HGIA 4XP2A 3RINA 3TN8A 1T45A 4FKGA 4MHAA 4BDEA 4FT9A 2WQNA 3GOKA 4FIIA 3K3JA 4BHNA 4ACMA 3EQPA 3EN6A 3N51A 2GQRA 2JITA 4FV6A 3QZGA 4X3FC 3VUDA 3V3VA 4E6QA 3E7VA 5CAPA 2ITZA 3DV3A 5T3QA 1YOLA 2OH4A 4PNKA 5IQHA 3GUBA 2VO0A 3DPKA 3FI2A 4FK6A 4W4YA 3TG1A 3PSBA 1ZY4A 3ET7A 3ZO4A 3BWFA 5M06A 4DYMA 4FEWA 1Y6AA 1E1XA 4GSBA 4QMNA 3C51A 5CF8A 3WBLA 4DFNA 3OBJA 4EH3A 4TWOA 2C3LA 3EFLA 3FY0A 1WBSA 4RIXB 4RLLA 3F2RA 2C6LA 3GU7A 4IWDA 1H1RA 3EFKA 4I20A 4XYFA 2WMAA 4DGOA 2JDRA 3KGAA 4NKAA 4BN1A 4RA5A 5DRDA 4FBXA 4D55A 3HECA 1L8TA 2X8IA 5EFQA 2EXEA 3ANQA 4PWNA 3IOPA 4XMOA 1CM8A 3ZLYA 4GKIA 5K5NA 4BHZA 4MCVA 5L6OA 1KE5A 3WZDA 5M4FA 4ACGA 4O0TA 4QMVA 4ASEA 4F4PA 4BI1A 1MUOA 1O9UA 1WVWA 4FIHA 4GL9A 4H39A 3FBVA 4UMUA 3CTQA 4S2ZA 2CKOA 2OLCA 3D94A 4AZWA 2OO8X 4O1OA 4CZYB 4YJQA 5I3RA 5FUTA 2YEXA 3WZUA 3V5TA 3HEGA 4L3JA 3NNWA 5FBOA 4FTKA 1OBDA 4FIJA 4HCTA 4BTJA 4W8DA 2O0UA 1GNGA 4F9WA 1FVVA 3TUDA 3GENA 1QL6A 3PJ1A 3UZPA 2W1HA 3QCQA 4J99A 4U8ZA 3C0IA 1K3AA 3LFEA 4EONA 5M57A 1VLRA 3SXRA 2UZEA 2VTAA 4M14A 5E1EA 2Z7QA 4EOLA 1ZMUA 3P1AA 2R3OA 3RAHA 3Q60A 5AIRA 4QP2A 2H6DA 2ACXA 3DBEA 2F49A 3GFWA 5JKGA 3KIOC 3Q2JA 3L8SA 2LAVA 4JX7A 3MH3A 2WMWA 2XA4A 4UN0C 4FTRA 1OIYA 5G6VA 4CXAA 2W05A 4TNBA 4MXCA 1PYEA 3QQFA 4QQCA 2WTCA 2J90A 2WTKB 3JVSA 5H3QA 3VONA 2YIXA 4RRVA 2XNBA 4AWIA 3MY0A 3O17A 4E20A 5I4NA 1PXIA 3OCTA 5L2WA 2Y9QA 5EI6A 3DDPA 3ZM9A 5KCVA 4JOAA 1P5EA 4K11A 4O22A 5LVOA 1MRUA 3GEQA 2P0CA 4JNWA 1NVRA 1TVOA 2ONLA 4V0GB 3DAKA 4PDSA 4D2TA 4O4FA 2R3MA 4U45A 3KF7A 4BZDA 4DGNA 5BQ0A 1BKXA 2VN9A 5F9EA 3U6JA 4CT1A 5IQGA 4KRDA 4CMTA 1YXUA 3KN5A 2YJRA 5HE1A 5ITAA 5HOAA 3A4OX 2E9NA 4FIGA 2R3HA 1BLXA 1J3HA 2GCDA 3WF8A 2XKDA 5HCYA 2ZMCA 3AT2A 1DI8A 2I0HA 5CX9A 3CC6A 3QTZA 5L3AA 2Z7LA 2ITTA 5D12A 3SW7A 4EZ5A 1W98A 2VTIA 3NCZA 3U4UA 2XIZA 3UNJA 5EDPA 5LQFA 4P90A 5DRBA 4HPUE 2E9PA 4JG6A 1IEPA 2W9FB 3IPHA 4LOQA 3VHKA 4CYJA 2ITQA 3QWJA 1XJDA 3QGWA 5FTOA 2J4ZA 5C8NA 2RFNA 3TUBA 3D14A 4K33A 4RC2A 4DHIB 3C5UA 4JVGA 4XG6A 3BGQA 4UBAA 4YHTA 1QPCA 4FSTA 3PZHA 3H4JA 4C4IA 2JDOA 3QRTA 4X7QA 4B6LA 5LOHA 2G2HA 4FMQA 2R2PA 4JAIA 4J53A 4X2GA 3ZO3A 3OD6X 3HV3A 4YBJA 5DVRA 4FOBA 3ORNA 3NYNA 3PIXA 5TR6A 3RKBA 3JYAA 5AR3A 1HOWA 4FKIA 2JEDA 4USFA 5FTGA 5A46A 4MWIA 3U87A 4EWQA 2QQ7A 4EZ3A 1RE8A 4YZMA 3MFUA 5IEYA 3NPCA 4RWLA 3A7JA 3O7LB 4XOYA 1GAGA 5DG5A 4I4FA 1G5SA 3NX8A 5HE3A 4KIPA 2YM7A 5HE0A 2BRBA 5KMOA 1GIHA 3QRJA 3R9OA 4KABA 1PXPA 4CTBA 3F3WA 3R2BA 2VTRA 4M68A 1ND4A 4XG2A 5AV3A 2OIBA 5J9ZA 2AC3A 3ZTXA 2DWBA 3FL5A 4JR3A 4G3EA 4EI4A 4QO9A 4ZP5A 1M2PA 5DA3A 1W2CA 2B55A 1JPAA 1QPDA 1NT2A 4ACDA 2RFSA 4LMUA 5EHLA 4TPTA 2QHNA 2GNGA 5CEKA 3ORTA 5CVHA 1YHWA 3FZRA 3P78A 4DGLC 4UZHA 3ZOSA 4G9CA 4KSPA 3KRJA 2WD1A 2W99B 4OT6A 3S4QA 4R7HA 4O91A 4C3FA 1UU8A 4BCGA 4RFYA 4BDFA 5A4TA 3ZU7A 3UDZA 1UVRA 2B54A 4DITA 2QO7A 5CSVA 4XEYA 3EH9A 3HV5A 5JZJA 2BVAA 2FB8A 4E4MA 1J7IA 3HNGA 3TDVA 3W0MA 5DR2A 4HGEA 5EQYA 5EHYA 1R0PA 3PSCA 3F88A 2X1NA 2GDOA 4Q2AA 4QTDA 1E9HA 4IVCA 5DLSA 3ULZA 4I0TA 1R39A 4FUYA 4YNEA 2CCHA 3VF9A 3Q2MA 2P33A 3WE4A 2P3GX 2QLUA 4DA5A 3TV7A 2EB3A 3QRUA 3BHVA 1ZZ2A 3COKA 3O8UA 4FRFA 4Y95A 5HCZA 4DC2A 4EHZA 2VAGA 3LMGA 5CVFA 4D4YA 2PMIA 2BDFA 1AD5A 2X39A 3RWPA 3KREA 3NUUA 4O83A 5K9IA 1M7QA 4O0YA 1YI6A 3BU5A 2A27A 5FGKA 4WRSA 3VQUA 3DJ6A 2UUEA 4IW0A 2VWXA 1OECA 1SM2A 3LXLA 2IZTA 4GUEA 4JT3A 1OZ1A 4QRCA 1FINA 2ITUA 1H28A 4ID7A 4I92A 2YCFA 2VTMA 4U43A 4R5YA 3H10A 3K2LA 4IJPA 1Q4LA 1ZOEA 3UZRA 2XP2A 3AD6A 5D9HA 3WYXA 3HMMA 3I5NA 4LI5A 4NWMA 3LFCA 5CI7A 2YZLA 5FP6A 4C38A 4YJRA 5AJQA 3QTXA 3R21A 4L3LA 5HBEA 3DK3A 3I60A 4BICA 5AA9A 3UQCA 1X8BA 3FZSA 5HHWA 4I5HA 1OITA 2W1ZA 4PPCA 2OG8A 5CAVA 4CMUA 3VRZA 5LVNA 4D4VA 3F3UA 3LFDA 3QUDA 1OI9A 5JQ5A 4GVAA 3I7CA 4LGHA 3VVHA 3G9NA 4G3GA 4BCNA 3EWHA 3NSZA 5L6WL 5IQEA 2OWBA 4YC6A 1ZZLA 1ATPE 2VTPA 4CSVA 3EB0A 3CKXA 3NZ0A 4IAYA 5BVOA 1XH6A 3UVRA 3SQQA 3GC7A 2UW4A 5HNGA 3SG9A 1DAYA 2YM8A 3L8PA 2PVMA 4KUJA 4E6CA 2UZNA 3G90X 2OZAB 4EKLA 3UO5A 2BROA 4J71A 3KA0A 3DKOA 2C69A 3TNPC 4RSSA 4MKCA 2AC5A 4LRJA 5FEDA 1B38A 4FTAA 3AQVA 1A48A 3TZ8A 4O6EA 4CD0A 4GG7A 5KO1A 2GU8A 4YBKA 2R3LA 5T68A 1KV1A 2XK6A 3AC8A 3K5VA 3NS9A 3T9TA 3QTUA 2OXXA 4QYEA 4RIYB 4QQTA 5J95A 3HV4A 4L46A 5IA0A 4Y5HA 4RGJA 5IH5A 3LLAA 3C7QA 2ZM1A 4BC6A 2Z60A 3GU6A 2ZB0A 1VYWA 4PX6A 3V5JA 3QLFA 4F7NA 3FMHA 4PMSA 5AP6A 5BUJA 4FJVA 2XH5A 3LCTA 2QODA 3FL4A 3UP2A 3QYWA 3POZA 3HMOA 5E92A 4BIEA 2VD5A 3PA3A 4FKWA 5HQ0A 2C1BA 4I94A 4W4XA 4LM5A 2O63A 3LFSA 4DEDA 3SVVA 3ZSHA 2Z7RA 3BHUA 2V0DA 5CAUA 3P86A 3FLWA 2FUMA 3MB7A 3VBQA 4V04A 2W1CA 3NAYA 3RZBA 2B9JA 4O7VA 2XNPA 3HZTA 3A7HA 3E64A 3FQEA 4FTNA 2YM3A 1OVEA 3VS4A 4S33A 5EKNA 3E3PA 3ZXTA 4BJJB 4FV8A 1IG1A 5CENA 2OXYA 3E5AA 5LXMA 3OWLA 1M17A 2AUHA 5KKRC 3C5IA 3CS9A 4PV0A 4G6LA 3MS9A 4G3CA 4IM3A 4HCVA 4EEVA 3ZO1A 4IVAA 4DHFA 5AR2A 2W4OA 3R9DA 4XG9A 3UVPA 2C0IA 4EORA 4QMYA 4EOIA 3CXWA 4GK4A 5EM5A 4A9RA 3R1SA 5BVNA 2XM9A 2RGPA 3A2CA 5LCKA 4KKGA 3D7TB 3WF5A 4RC3A 1DI9A 5FTQA 4O7LA 2PUNA 2UVXA 1JKLA 4Y5QA 5HX6A 2R0IA 4C61A 1IA8A 4OTPA 3UJGA 1IRKA 3ATTA 3TDWA 4CGAA 3FI3A 1W0XC 5CSWA 4TN6A 4RFMA 3M11A 1IR3A 2PL0A 4IWQA 2ERKA 2BHEA 5D10A 4RJ8A 2PULA 4B99A 3D5VA 5HLPA 5IQFA 3LMIA 3FJQE 5AV2A 3T8OA 3R8LA 3V8WA 2BKZA 4RQKA 3GC0A 5CEIA 4HVSA 4TWCA 4BZNA 2VTOA 4X2FA 3MIAA 2I7QA 2XBAA 2ZMDA 4AFEA 4ZLYA 4NL0A 4ASXA 2ZV2A 3KCFA 3EYHA 3RK5A 3FYKX 4DFXE 4GV1A 3BGPA 4PF4A 2G15A 4XP0A 2E9UA 1YWRA 4LQMA 3R7VA 3EQHA 2HZ0A 4AZSA 1YOMA 2OI4X 4X3FA 3H0YA 4IQ6A 5DIAA 3R6XA 4YZ9A 3GC9A 4UMPA 5LARA 4AQCA 3HKOA 3KXHA 4S32A 5HG8A 4A9SA 4F6UA 3WYYA 4NH1A 4EKKA 5AADA 4FTCA 5HVYA 1JVPP 4ANMA 5B2MA 3U9NA 4P5QA 1YWVA 2QOQA 3CQWA 3DBFA 4IC7A 3R9HA 2WMQA 2ETRA 4BTKA 2X8DA 4R3CA 5CF5A 5KBRA 3AXWA 5ACKA 2PWLA 3QA8A 2PPQA 2QHMA 4R3RA 3LPBA 3FQSA 5AA8A 3ID6C 4XRLA 4F7JA 4O4EA 2YACA 3FEGA 1GZOA 5HD7A 3ZSGA 3A7IA 3DGKA 3G0FA 5IH6A 3GNIB 4BGHA 4ALWA 5KMMA 4HVGA 4RZWA 3IONA 3ETAA 5L2TA 4AF3A 2VTNA 5KMLA 2J51A 4GJ3A 3DXNA 1H24A 4YJUA 4P7EA 1WBNA 4BCKA 5A14A 4AE9A 4PL4A