4RJ5A

Egfr kinase (t790m/l858r) with inhibitor compound 5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
323
structure length
296
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKETSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of Selective and Noncovalent Diaminopyrimidine-Based Inhibitors of Epidermal Growth Factor Receptor Containing the T790M Resistance Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 88
structure length 296
sequence length 323
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rj5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rj5A01
1Y6AA 2GNHA 3F61A 1RQQA 4ZSLA 5JEBA 2CHLA 5FXQA 3ZEWA 1CKJA 3ALNA 1L3RE 3Q96A 2C47A 5CU2A 3ZO4A 4W9WA 4EZ7A 4F1TA 5L2TA 4GFMA 5CYIA 5KZ0A 3R7VA 3W2CA 5AP4A 3QRKA 4QP9A 4CG8A 2BRHA 2OK1A 3UP7A 4EOIA 3L8SA 3R7OA 3EN5A 4RWIA 4TYJA 2W1GA 3BE2A 5EKNA 4TZRA 1Q5KA 4EHEA 3KK9A 5AAEA 5HVJA 4QMYA 1ERKA 2W1IA 4AOJA 1FQ1B 2DYLA 2QD9A 2YFXA 4AT5A 2J2IB 4WSQA 1NVRA 4FEVA 4O84A 3Q60A 3NW5A 4EUTA 4AXAA 2JITA 5IA4A 4XG3A 5IH4A 4DGOA 2W1EA 3I0OA 3KXNA 4E3CA 4GVJA 5GJDA 2BZJA 2XNNA 2O2UA 4LUDA 1OIQA 5D1JA 3Q4TA 5JRSA 3W1FA 4JS8A 5H3QA 3EQDA 3CD8A 3DLZA 5ETCA 3QLFA 2BAQA 4F7LA 1PXKA 3MVJA 5IH5A 4NZWB 5IU2A 4HGTA 3TNQB 3GCPA 4BTKA 2E2BA 4GYIA 4R5YA 5F20A 3KK8A 4FIIA 2VTJA 5AP6A 5C9CA 4C8BA 3K3JA 5AV4A 3LFAA 4CQEA 5IISA 5LVLA 1Q3WA 4EZ5A 3OEFX 2XCHA 2CKQA 3KL8A 4U80A 3DLSA 5CASA 5LWMA 5HO6A 3TT0A 4CZUA 1DI9A 2SRCA 2W96B 4GKHA 3RPOA 5FG8A 1YOJA 1RW8A 4X6RA 2WTWA 3EHAA 4RZWA 4TN6A 3VW6A 3AT2A 2VO6A 1KE5A 3MVLA 4IDVA 2R3QA 4A7CA 4BCNA 3OBGA 4IJPA 4DINA 4YR8A 2J0KA 3RAIA 5FBNC 1XQZA 3NNVA 3UDBA 1OITA 1SVHA 3NUPA 2X81A 3DXQA 3F2RA 5AM6A 3PIXA 3A4OX 1H07A 5H8GA 4G3EA 4RC3A 4EOMA 4IVCA 2YIXA 4KA3A 4WA9A 3R8UA 4EQUA 5KCVA 2PE1A 4PTGA 4F64A 4QTCA 4WT6A 4BI2A 3KCFA 3FBVA 5K4IA 2XBJA 4LFIA 2P33A 3G0FA 4FTJA 4GIHA 3F2NA 2ITVA 3FYKX 4IAIA 4NM5A 3E92A 4O21A 4Y5QA 1NT2A 1AQ1A 1SVEA 2W4KA 3R9HA 3LMHA 4XEYA 4RG0A 2CNQA 3PIYA 5E8ZA 5K0XA 4JR3A 3MPTA 4AF3A 4L52A 3PP1A 4EWQA 3UIUA 3KRRA 3O8TA 4GKIA 5IMEA 5FP6A 2RG6A 2C69A 3PVWA 4LI5A 3R8ZA 3KEXA 4FTTA 3PJ3A 1Q8WA 4FT5A 5F4NA 2BHHA 5LXMA 3MWUA 5C4KA 4G2FA 4ZLZA 4ITJA 5EOLA 3AMYA 2ZJWA 2O65A 3FZOA 4HYIA 5KZIA 4AW5A 3R8VA 1H4LA 3KQ7A 2G9XA 5ANEA 2BKKA 3B2WA 4R8QA 4K0YA 4EBVA 5B7VA 5GIPE 2C6IA 3FY2A 5DR6A 3QX2A 4CRLA 1H01A 3ANRA 4FSQA 3ZRMA 3ORIA 5FTQA 3FZ1A 1XWSA 3QTZA 3OXTA 2IWIA 1XBCA 4S34A 1NVQA 1OGUA 2X7FA 4L44A 4X2GA 5A4CA 4NKSA 4ZJIA 5CVHA 3HRBA 4PDSA 3R9NA 4JNWA 3F2AA 4E5BA 5M56A 4GRBA 5CSVA 2BZKB 4O27B 3OY3A 4XG8A 1PHKA 3CJGA 3QWJA 3ENMA 2JKKA 3KKVA 4MNEB 3TIYA 2QU6A 4DTKA 4PV0A 3ZCLA 4L3PA 3SQQA 4Q9ZA 3D5WA 4WNKA 3GP0A 3NCGA 1UU3A 5ANIA 4ANQA 2WTIA 4WBBB 3FDNA 3FMEA 4BGHA 1GNGA 5CAPA 4X3FC 1IAJA 4CCBA 5CU0A 4KKGA 4YPDA 3AD6A 4FV2A 5AUXA 4OW8A 4HZSA 3CC6A 2IVTA 4PMTA 4D9UA 3TG1A 4MF1A 5AP2A 3W8LA 4D2VA 4ZJVA 3TUDA 2ZDUA 4OUCA 2W5HA 3FZTA 2BFYA 3CIKA 3QZGA 4L43A 1J7LA 5FUTA 4DEBA 2JDRA 4BCFA 3FC1X 1FMKA 2ETKA 5BYZA 3ZU7A 4D5HA 3PIZA 3Q9ZA 3TIZA 2PZYA 4YZ9A 4Q2AA 4NM0A 4CYIA 4EQCA 2XNBA 3OXZA 4KS8A 4RVLA 5AR8A 4EK5A 5JGBA 5JFWA 4FTRA 5JFSA 2OJJA 2R3GA 3R04A 4EHVA 2C5VA 1ATPE 3E64A 4CKRA 5KMNA 4WG5A 2XJ1A 2WEIA 5J5TA 2P4IA 4YMJA 3RJCA 4XOZA 5D7AA 4IM0A 3BHVA 3G15A 5E1EA 3ZS5A 2PE0A 2HWPA 4F1OA 3BU5A 5FXRA 1PXJA 5A6NA 3EYGA 4CFNA 4FIEA 2OO8X 2YIQA 4IH8A 3W32A 2C6MA 2GU8A 4AE6A 3PE2A 2WU7A 5CEKA 4AGDA 4JT3A 3ROYA 4JG7A 3FHIA 4FOCA 2UVYA 3LAUA 3QQLA 3CJFA 2QO7A 2WOTA 4QMSA 3ZBXA 3KF4A 3GU4A 3KXGA 4XLVA 3C4EA 3ULIA 4BCIA 3BBWA 3RWPA 4FZ6A 2YDKA 3FQHA 2Y9QA 2WMBA 3NYXA 3HECA 4OGRA 1XH6A 3U4WA 1A9UA 1PXLA 3LFEA 2RL5A 3VJOA 3GCVA 3MIYA 5L3AA 2X9EA 5DA3A 3VULA 2GS2A 3IOKA 4GFOA 1CKPA 2F7XE 3D5VA 3Q5ZA 5J1WA 4FKGA 4HNIA 2C6KA 3LM5A 5GINE 2BDWA 3C13A 3FKNA 4QYHA 1V1KA 1VYWA 3BV2A 1GZNA 1NVSA 2UZLA 4GSBA 3WF9A 1ZY4A 5M55A 2WMXA 5HE1A 3ZUTA 3TNHA 3OXIA 4RMZA 5AV3A 5AR7A 2YDJA 2GQRA 3RHXA 4OBPA 3LVPA 3EQBA 3HV6A 3QHWA 4MAOA 3PSBA 3OT8A 5T3QA 3KA0A 4NEUA 1GIIA 2OF2A 4F08A 4TNBA 4QP8A 4NIFB 4F9YA 4R3RA 4FIJA 1B39A 1MUOA 3CTQA 3MYGA 4Z7GA 4FZAB 4RJ4A 3DNEA 4I6QA 4IWPA 3OEZA 4R1YA 3TV6A 4CEGA 2WMVA 4CFMA 3UGCA 3DPKA 3HV3A 3W55A 4HYSA 3QZHA 2YCSA 1JKSA 1BI7A 3WZJA 3DKGA 4U79A 3HMMA 5HG9A 1PXIA 5HIBA 4CD0A 1OIUA 3ORXA 4DFNA 2VWUA 3KF7A 4PWNA 4AUAA 4AOIA 3WF7A 4I6BA 5KBQA 1REKA 5BUEA 4KIOA 4TYHA 3G51A 3EFKA 3Q9XA 1UU8A 4GJ3A 4UWCA 4IAYA 2YJRA 5KMLA 4IAAA 3SHEA 1FBNA 4YTFA 3EQIA 4MKCA 2BDFA 2WEVA 5TR6A 3VUGA 1K3AA 3ZFXA 3NYNA 3MJ2A 5HG7A 4HGSA 2QLUA 3HV4A 2Z2WA 5LVOA 2XIYA 3TKIA 3KRXA 4M69A 1YI3A 3N51A 3QCQA 2F9GA 2XNMA 3I5ZA 1PMUA 3QRIA 4I22A 4R5SA 2XK4A 2E9PA 4RT7A 4YZCA 5TKDA 5D7VA 4TL0A 1OUKA 2XH5A 3QUEA 4Y5HA 5EK7A 2CNVA 1GZOA 4XLIA 2UZOA 2CJMA 4FV0A 2R3LA 5EM7A 4I0TA 4DFLA 2Y6OA 3NIZA 4W4XA 1KE6A 1YXXA 3DA6A 3HV7A 4O91A 4O0YA 2R3KA 3DB8A 4W4WA 4ZTQA 3MV5A 3I6UA 3LXNA 4MYGA 5I9UA 5IZFA 3PVUA 4TYGA 3MY1A 3UIXA 5FLFA 3R0TA 3LQ3A 1YI6A 3V8TA 2J6MA 2VO7A 3ODZX 4KWPA 1WFCA 3AMAA 3QA8A 4ACGA 4QQTA 2IO6A 2VWXA 4PMSA 1FINA 3UVQA 5IQFA 3KXXA 4DA5A 4HPTE 3NMUF 4D1ZA 3UTOA 1OBGA 5DE2A 2Q83A 4XG7A 5HBHA 5JQ8A 1UNHA 2G1TA 4C4HA 1W98A 4O1PA 4FKIA 4F6UA 2BFXA 3D7TB 4X6QC 4L8MA 5CWZA 5JFVA 4IIRA 1WBTA 1ZYJA 4D4VA 2XNEA 2BILB 3BX5A 4QTDA 3ZDIA 1Q8UA 4S30A 4RQVA 4BCJA 5L4QA 5JK3A 2PUNA 5AR2A 5H8EA 4F9BA 2C0OA 4IAKA 3A8XA 5LCJA 3FXXA 3PFQA 3KN5A 5HQ0A 2E9UA 3L8VA 4JX7A 3BYSA 5EW8A 2W0JA 2Z8CA 3IECA 5DG5A 3TUCA 3KREA 2BHEA 4FEUA 4D2SA 2PUUA 4H3PA 4D28A 4IXPA 2UZNA 5F95A 3H9FA 2B4SB 3ZXZA 4F9AA 5BMSA 4CVAA 4EJ7A 5EQYA 3I1AA 5HVKA 4DTAA 4PPCA 4NFMA 5DRBA 3HX4A 3LFQA 4BZNA 1M2RA 3QUDA 3DT1A 5AAGA 4DH5A 4FA2A 3U54A 4IHPA 2ITUA 3EYHA 3PE1A 4BGQA 3ZTXA 4E4MA 2XRUA 5CU3A 4BI1A 5GZ8A 4XV1A 3E5AA 1ZLTA 2X2MA 4GK4A 2PHKA 2PZPA 2JEDA 1GAGA 4W8EA 4YSJA 2FUMA 3TV4A 2XVDA 5LMKC 3GC7A 4FT3A 1WAKA 3FL5A 3N4VA 1SNXA 5JFXA 2J5EA 2Q0BA 2BUJA 3QD0A 4RGJA 4FNYA 3G6GA 2OG8A 2C6EA 3ZO1A 5A6OA 5FDPA 3V8SA 4JBVA 2YM5A 4W8DA 4YC6A 5JKGA 3CPBA 3FSFA 2OF4A 4GG7A 4PDPA 1T45A 4XP2A 2HENA 4IAZA 5EHYA 3LOKA 4I6FA 4U0IA 2XM9A 2PVJA 3KCKA 2I0VA 3LCKA 5CT7A 1Y8GA 4ZTLA 2OLCA 2ERZE 4RA4A 3UJGA 5E91A 3G9LX 3IDPA 3ZFMA 1IEPA 3NW6A 3IKAA 3MFRA 3F3UA 3IGOA 2RG5A 3FLQA 2P3GX 3W2SA 3FLSA 4ZLOA 4DEHA 3FMDA 3HRFA 4IB0A 4IFCA 1V0PA 4ZS0A 3TWJA 4C2VA 1S9IA 2VNYA 4M14A 4U44A 3WF6A 5BVOA 1QPEA 2W9ZB 5AP0A 4HYUA 1WVXA 3DAKA 1R0PA 3A60A 2QOLA 2ZV9A 3TXOA 3AXWA 3TJCA 2FSLX 3BQCA 4YURA 2WU6A 2H96A 4J98A 3IW7A 2JIIA 5HD7A 1IAHA 2WTVA 5FTGA 2WQMA 2UW5A 3LFCA 3C5UA 4R6VA 2JDTA 3VBWA 4BDBA 5IDNA 5L8LA 2I1MA 3UPXA 5EM5A 2ZVAA 3OS3A 1OUYA 2R5TA 5IQBA 5ITAA 4JDHA 4RIYB 2VTMA 4L6QA 2X0GA 5K9IA 2W4OA 3UQFA 4JBOA 4DHFA 2X6EA 3M11A 4RC2A 4O83A 4YUQA 4RIWB 4QMNA 4JDIA 2R3JA 2IVVA 2UW7A 3EZVA 3DK7A 4C37A 2I6LA 5ETAA 2C1BA 3D94A 2CGWA 4APCA 4C58A 2R4BA 2YERA 1YXUA 2B53A 1Z57A 4Y83A 4G9CA 2J0IA 2JLDA 3U87A 4C4JA 4TNDA 3DXPA 4NT4A 4JQ7A 3NX8A 4EWHA 4UWBA 5BVFA 4ACMA 1TQPA 4OR5A 2PZRA 2VWIA 5D12A 4ZY4A 2OJ9A 2BZIB 1ZZ2A 5CAQA 3P7AA 4LOQA 3L9PA 3PXFA 4EH2A 3FE3A 4XCUA 1PXMA 2ZM1A 3A7FA 4BDGA 5HO7A 2XZSA 4HVGA 1PKGA 4RVTA 1TQMA 2YWVA 1IRKA 3BLQA 4KIQA 1A06A 2RGPA 4M66A 4O0TA 2I0HA 4Q5HA 3OOGA 3TCPA 4BDIA 3PLAE 1XBAA 4XV3A 3LXKA 5G6VA 3OG7A 5FTOA 3R7EA 1J7IA 3UQCA 1O9UA 4BL1A 2C5OA 3NVKI 5BMMA 1PYXA 3QL8A 3Q4UA 4RIXA 4ZAUA 1H1WA 1DM2A 5C1QB 1IA9A 3FKLA 3MTLA 3GOPA 3ODYX 4FV7A 3PA4A 4ZS4A 3QTQA 2WTKB 3NVMB 1WBNA 4I21A 3L8PA 1BL6A 2VTRA 3AMBA 2PZ5A 3HL7A 3LFDA 3R1QA 5AX9A 3P23A 4EH9A 2XKFA 2Y8OA 1DAWA 3PSDA 5J79A 3QU0A 4G9RA 3EJ1A 5K4JA 3IONA 5GIOE 4WD5A 3WZEA 2JKQA 2VWVA 4RVKA 3Q32A 3UOJA 3LFBA 1V0BA 3ETAA 4IZ5A 4WO5A 3UZRA 4L01A 1MP8A 3BWFA 3DV3A 1R39A 4XRJA 4MTAA 4KRDA 3FZSA 3DAEA 2GNGA 2C4GA 4MXZA 4WHZA 4UWYA 3Q9WA 3ORZA 3D14A 3E8DA 1WBPA 3OWJA 5KBRA 3G0EA 1OKWA 2HIWA 2YITA 3P7CA 4D0WA 1H27A 5CU4A 1OPLA 4CFFA 4AZFA 3QGWA 2XYNA 3FMLA 3R1NA 2ZV7A 4R7BA 3E3PA 2CN8A 3EH9A 5J9ZA 4FIHA 3DBCA 2FB8A 3DJ5A 3EQHA 3KC3A 4UMQA 3CLYA 5BVKA 3RCJA 1X8BA 2QCSA 4D4RA 4J95A 5KMMA 5DEWA 5L2IA 2BR1A 5IUGA 2AC5A 2HYYA 4X3JA 2QR7A 4UALA 5FDXA 1WBOA 4CFWA 4AAAA 4OLIA 4C3PA 3LIJA 4YJSA 4OAUC 2QONA 1P4FA 2HY0A 5DH3A 4F7SA 4G6LA 5JZJA 3IPHA 3DBDA 3W2OA 1ND4A 1V0OA 4CTBA 1OB3A 4GU6A 2LGCA 4O0XA 4CV8A 4FGBA 2VWBA 3QTRA 3FYJX 5DBXA 3ZUVA 1OPJA 5J8IA 3RAWA 3TZ8A 3MY5A 2C3IB 2UZEA 3LFNA 3EN6A 2CKOA 4C0TA 3QQJA 4CMOA 3R00A 1M52A 4CQGA 3ZDUA 4YJVA 5AM7A 4PDYA 3D15A 2ITQA 2OBJA 2BVAA 4C57A 1UKHA 3CS9A 5IQAA 4E6QA 5IEXA 2W1FA 3OF0A 3PG3A 4HGEA 4DH3A 1H25A 1K2PA 3AC5A 3COKA 2PY3A 3QXOA 4O0RA 3VN9A 3E8NA 4Y72A 4G3GA 3NYVA 3MH1A 4FSRA 3WZUA 1FMOE 1H0VA 2XJ0A 4G5PA 3ROCA 4D2PA 4JLCA 1YXVA 3DZQA 5HLPA 4C62A 3RPVA 2Z7SA 2IJMA 1W82A 4FSMA 4BICA 3E88A 4B8MA 4C2WA 3NUYA 4CGAA 4RIWA 1XR1A 1B38A 3BLHA 3KRJA 3REPA 2XIZA 4LGHA 3C51A 4NKAA 3QF9A 5AV2A 5JGDA 3WF8A 3H30A 3SA0A 5LWNA 3EFLA 4FTUA 5IEYA 2ZM4A 2F2CB 1ZWSA 3E93A 3O2MA 2EVAA 4J8MA 2OXDA 5H9BA 2A2AA 3AGLA 2OJGA 4GU9A 1ZYSA 5TE0A 3G6HA 5EOBA 2ZAZA 5DFPA 3COIA 1KV1A 1G5SA 2XNGA 4RFZA 4UYAA 4XNEA 5AWMA 3G2FA 4G6NA 5IQDA 2IW6A 4ZIMA 1MQBA 3O51A 5AP5A 3VUMA 4UYNA 3HMOA 2BRMA 4BBFA 3BU6A 5EYKA 5LMBA 5CSPA 4IE9A 1GZ8A 4JIAA 5HNGA 4BHNA 2A19B 3GQIA 5FEEA 1TQIA 3AC2A 4JR7A 5FM2A 4NFNA 4GUEA 5HBJA 2W17A 2XUUA 4FTKA 3MS9A 3PJCA 4R7IA 2B52A 3SGCA 4NM3A 1OL1A 2ITNA 1JSVA 4QO9A 4M3QA 3LE6A 3BYUA 2W1HA 4L42A 1VEBA 5AADA 4QQ5A 3U8WA 4N70A 4QP7A 2WQEA 4PTEA 1KOBA 4RFMA 3UYTA 4DEIA 4FSZA 4EORA 2WO6A 1ZYLA 2I0YA 5HCYA 4GH2A 1WVYA 3M42A 4N4SA 2XP2A 1OL7A 4L45A 4EOQA 2UVXA 3PPZA 2UZVA 3SOAA 3JVRA 4HGLA 3LFSA 3UOKA 4OTDA 4AU8A 4EK8A 3U51A 4HCVA 2WFYA 5AP3A 4AWIA 4KBKA 4FICA 2E9NA 4YTHA 3KN6A 3ID6C 3K5VA 5AAFA 2IVUA 2V22A 2CKEA 3MSSA 4NW6A 2R0UA 4RX8A 4BYJA 4P5ZA 3VS4A 2V62A 4QYYA 3RBWA 5CXZA 3OTVA 4MXCA 4EH6A 3UODA 2UZUE 4TY1A 3KGAA 4F09A 4YJPA 1J1BA 2PUPA 2PVNA 5AV1A 4I24A 4AZTA 5E9EA 4BDFA 4O7RA 4XBUA 5FEQA 1OECA 2PVKA 2XK6A 4D0XA 3BELA 1JLUE 2XIXA 3MFTA 5AV0A 4AFJA 3TKHA 5J1VA 3A7IA 5DI1A 4FSUA 2G15A 4DC2A 2QURA 4GS6A 1Z5MA 2UV2A 2YDIA 3F82A 5CZIA 4NYEA 4I92A 5JN2A 3TTJA 1FVTA 3FI8A 3NUAA 2B7AA 3F6XA 4MD8E 4TYEA 4YLKA 4WRSA 3DOGA 3MH3A 2WMUA 5HIDA 2ONLC 2P2IA 5EM6A 5IQIA 5CF4A 4EKLA 2W1CA 2WMRA 4FSNA 4FG8A 3A7HA 4IB3A 4ASZA 4H1JA 1OKYA 2YM4A 2YLFA 4AZSA 4ZXTA 3TDWA 3NAXA 3PXKA 4WRGA 4AZEA 3E3BX 3F88A 4YHFA 5KNJA 5IG1A 3NYOA 1PW2A 5ANJA 3EZRA 1Q99A 2RSVA 2XIRA 3CY2A 3AC1A 3DK6A 4K9YA 4WG4A 2XKDA 2HELA 4DT9A 4K1BA 5AUVA 5LMAA 2UW6A 4CG9A 4E6AA 2GTNA 3R8PA 4FTNA 3PWDA 4DE4A 4IACA 3QTUA 1CTPE 3ZLXA 3F5GA 3VO3A 4ZY6A 3DJ7A 4NIFA 5B2LA 2WMWA 2V7OA 4FEXA 5ETFA 3D2KA 3R21A 2OJIA 4O0WA 4U43A 5L8JA 4O1OA 4PX6A 4QMWA 5FRIA 2HZNA 5K5XA 1H0WA 3V3VA 4MCVA 2WQBA 2VTPA 3TEIA 2IW8A 1BUHA 2CSNA 4FNWA 5HD4A 2VRXA 4ITIA 4J1RA 4AZWA 5JT2A 3DB6A 5EG3A 3W10A 3MGYA 1YHVA 3I0QA 3C1XA 4NH1A 4EC8A 4UMPA 4H05A 3HMNA 4HCUA 5IMXA 3TNPC 5A54A 3T9IA 2WTKC 1MQ4A 3H0ZA 4U7ZA 1YDTE 3R8LA 4AQCA 3C5IA 2I7QA 2PVYA 4X3FA 3IDCA 4ZOGA 4ERWA 3LZBA 5M4IA 3B2TA 4G5JA 3VAPA 1OKZA 4P4CA 3BU3A 4LL0A 3H10A 4ENXA 5HX6A 1P5EA 2J0JA 3FY0A 3I7CA 3LCTA 4TRLA 4E8AA 4EL9A 4GVAA 4O86A 4MD7E 4E26A 3ACJA 1LEWA 3ZM9A 2C6LA 2X8IA 4FNXA 4OTHA 4FL1A 4DGNA 3GBZA 4BCMA 4IEBA 3VHKA 4M97A 4CFUA 3FXZA 4BTJA 3EOCA 3ATSA 4Q9SA 2VX1A 4ZSEA 4BDCA 4BDHA 3TUBA 4FOBA 5CENA 3QRUA 3PLSA 4BVUA 3PYYA 3SG8A 4BCKA 3FLNC 3QCXA 3OW4A 5IQEA 4GK2A 3GC9A 2ITWA 3BYVA 4M68A 2UUEA 4QD6A 4BYIA 4CV9A 3ORTA 3R7UA 3SC1A 3WI6A 1PKDA 4RRVA 3WIGA 4UBAA 5AA9A 3PVGA 4U45A 1OI9A 3LHJA 3RPSA 3CD3A 3R71A 3GFWA 4BCHA 4UN0C 5AJQA 2ETMA 3QC9A 3SV0A 4FZDB 5HICA 3LM0A 5CVFA 5DWRA 4BCQA 5BNJA 4O22A 2GHGA 5HX8A 2GFCA 2C1AA 3I4BA 4DFXE 3HLLA 4FIGA 2PYWA 4NSTA 4FI1A 3RINA 3CEKA 4FTQA 5E1SA 2J5FA 5E8VA 5KKRB 2Z60A 1PMEA 4BWKA 4FUXA 1I44A 1QPDA 4FNZA 4A06A 4E5WA 3D7ZA 3W2PA 5HO8A 5HIEA 4DFZE 4C34A 4GT4A 4IJ9A 1FVVA 3SLSA 2BRBA 2PMIA 3FMJA 4CFVA 3DKFA 3GQLA 3ZO2A 2QKRA 4RIOA 4Y73A 4LOOA 4F4PA 5E7RA 3O8UA 3IW5A 3ZOSA 4CZTA 5CAVA 3BWJA 4ZSJA 3MVHA 4DG3E 1MRUA 3AG9A 4H3QA 4FG9A 4HPUE 4IX3A 4ZEGA 3TI1A 2EXCX 1R1WA 3GU6A 4RJ8A 4U42A 1WMKA 2O5KA 2XJ2A 4QPSA 3DS6A 4ALUA 1H1PA 3D5XA 2WNTA 4G6OA 3PTGA 1Q24A 3MY0A 4YPSA 2WXVA 5BVDA 3R73A 2NRYA 1JSUA 4U3YA 2IVSA 1FOTA 5D9HA 2UW9A 4F1MA 3QQHA 4E93A 4K18A 2EWAA 2VGPA 3HV5A 3TNWA 3T9TA 1H26A 1VR2A 4II5A 3RKBA 5HG5A 2R3PA 3E8EA 2JKMA 3GENA 4ZZOA 4YHJA 5CF6A 4FX3A 3R9DA 4D1SA 2JAVA 2CLQA 3VUIA 1O6KA 5C8MA 4ZY5A 2C68A 3UO6A 4CXAA 3WBLA 3WZDA 1OL6A 3GFEA 4IM3A 4TPTA 3FLWA 2E9VA 4JDJA 2BROA 4FKWA 5CY3A 4UMRA 3K2LA 1OL5A 3THBA 4W4VA 2XEZA 2EB2A 4RJ6A 3RM6A 4KUJA 1LEZA 4FSTA 3GU8A 2A0CX 4EYJA 5J9LA 3KULB 5CI6A 4C35A 4K11A 3FJQE 2X4FA 4C59A 4JQ8A 2WMTA 4U8ZA 3MJ1A 4AE9A 3ORKA 4YHTA 4NL0A 3DDPA 5TO8A 3R1SA 3GU5A 4CCUA 4FV1A 5HU3A 4IADA 3NNXA 1JSTA 4KRCA 3W2QA 3PP0A 4BFMA 3DU8A 5EHOA 1CKIA 2JDVA 4YZBA 4JIKA 4YO4A 3COMA 3KVXA 3SXFA 4U40A 2OJFE 3NNWA 3PPJA 5AFVA 3JPVA 4O2ZA 4FL3A 3D4QA 4UXQA 3LMGA 4QTEA 5A4EA 4L00A 3ORNA 2JAMA 3CQEA 2E9OA 4MF0A 2VX0A 4N6YA 4OBOA 4Y85A 5EYDA 3RNYA 3RI1A 4EJNA 4Z3VA 2HY81 3NRMA 3RGFA 2W4JA 4MK0A 1OVEA 2BKZA 4IVBA 3QQKA 4KB8A 4KS7A 4N6ZA 4OTWA 5EKOA 4FL2A 3S3IA 3FEGA 1OKVA 3H9OA 4ZMFA 2CPKE 4QP4A 5JSMA 4P5QA 3C0HA 3L8XA 3LLAA 1AGWA 3QAME 4ASEA 1J3HA 2WELA 5IDPA 1MRVA 3QTIA 3VBXA 3K5UA 4IB1A 2JBPA 4FEWA 2XM8A 3HMIA 3FMNA 3NLBA 1MRYA 3Q04A 4M15A 3F69A 5KO1A 4IWQA 4MXYA 2BTRA 3GGFA 4FK6A 5CNNA 4USFA 4RPVA 2QOHA 5M44A 4A4XA 5CEPA 3TL8A 1KE9A 3KXZA 3B8RA 3UYSA 4AACA 5M51A 5J5SA 1LPUA 2C5NA 1K9AA 3CPCA 5AEPA 5IA0A 1WZYA 2X6DA 4Y8DA 2XA4A 2DQ7X 1E1VA 5IEVA 3OROA 3IG7A 2VWYA 1WBWA 2VN9A 3DQWA 4PPAA 1I09A 2ZOQA 4A9SA 3ZFYA 3FI4A 5AMNA 4HVIA 1OIYA 4OTFA 2BRNA 4G17A 2OFUA 4DH7A 2CN5A 4Z55A 4YLJA 3QUPA 4E73A 5DR9A 5E8WA 1NXKA 4YBKA 5HE3A 4L9IA 5K3YA 1JWHA 3R6XA 2R2PA 3PDTA 4AN9A 2JIVA 3CKXA 5AIKA 4E4LA 5JMSA 3L9LA 5I9ZA 1ZOGA 3R8MA 4TWOA 2OZAB 3ITZA 5AIRA 4FKLA 3VVHA 2YWPA 3UNZA 2ERKA 5TOZA 4RJ7A 4AW0A 4IMYA 4FTMA 5DN3A 4FKPA 3WYYA 4IZ7A 5EYCA 2HW6A 5AX3A 2GMXA 3QKMA 4BDDA 2WPAA 1LP4A 3A61A 3PY0A 4UB7A 3GCSA 3NZ0A 2WTDA 5ANKA 3BHUA 2PVHA 1OBDA 1Q3DA 1BI8A 3O7LB 4M69B 4MD9E 1J91A 2QU5A 3IW8A 4NWMA 4RX7A 3R01A 2JIUA 4FKOA 4KKEA 2C6TA 3V5LA 4BR3A 2YIWA 4YTIA 3U6IA 2H9VA 2V0DA 2VZ6A 3JS2A 5A14A 3CQUA 1XH4A 1G3NA 3OHTA 4PF4A 3EL8A 2GS6A 3DTWA 3H3CA 2AC3A 4OTIA 4L67A 2YAAA 5IH6A 4TXCA 3U4UA 3UNKA 5F1ZA 3I60A 5HGIA 3WARA 4IBMA 3FC2A 3QTXA 4WOVA 3QXPA 5ACKA 2F7EE 3EL7A 4LM5A 4MQ2A 3LCOA 4Z9LA 3DBQA 5FGKA 3RK7A 2W5AA 4NK9A 4V0GA 5A9UA 3BI6A 3PA3A 3N4TA 1WCCA 4Y46A 2QVSE 4CRSA 5I9VA 1URWA 4AW1A 2A1AB 1M7NA 3L1SA 4FEQA 4B8LA 5IA2A 5M53A 1M2QA 4FUYA 4JJRA 5FBOA 2CCHA 3OUKA 1PXPA 3MB7A 4RA5A 4BCOA 5DNRA 1QPJA 4XG2A 2PSQA 2OXYA 4FKRA 5KHWA 2HXLA 3EN9A 3F3VA 4O6EA 2NO3A 3QTWA 3F5XA 2R3MA 3T3UA 1O6LA 1FGKA 1O6YA 3VW8A 1PF8A 2P55A 2GNLA 4IAFA 3TV7A 4RWLA 2YM6A 5C26A 5KKRC 3EKKA 1Z9XA 2JGZA 4FTAA 4ANLA 5F9EA 4JOAA 5IUHA 5CQWA 3S0OA 3T8OA 3EIDA 1JOWB 2UZTA 3M1SA 3R22A 3NWWA 4K77A 4ALVA 2QG7A 1XBBA 2WQOA 5CS6A 4MBLA 5CI7A 3DXNA 2IZSA 3QKKA 4MNFA 4EQMA 4RX5A 5EDQA 2R3IA 3PWYA 3QCYA 4R3PA 5HLNA 3NUUA 2QR8A 3KY2A 2XEYA 3AD5A 4EI4A 4DF3A 4E1ZA 3PRIA 2YISA 2XNPA 3FMKA 2YCRA 4GJ2A 4O7YA 5IQHA 1WBVA 4QMUA 5HESA 2HXQA 5DHJA 5IA1A 3QD2B 3E7VA 2WTJA 1GJOA 5EI6A 2NRUA 3VQUA 3C0GA 5C8KA 4A4OA 4UMUA 4HCTA 4JI9A 4JBQA 3G5DA 5ANDA 2JFMA 5B2MA 2IG7A 4LG4A 4PRJA 1E9HA 2Z7QA 4FKJA 2YACA 3VS1A 4YZDA 5GNKA 4R7HA 4BGGA 4X2NA 2CMWA 5AR5A 3V6SA 3IS5A 4UMTA 4BIEA 4XG4A 4EONA 2FSTX 4EK4A 3NIEA 1PMVA 4O96A 1YOLA 3VUDA 1PMNA 5B0XA 4PTCA 4BI0A 5DT3A 3CR0A 3OT3A 4XS2A 3RNIA 3FHRA 3I81A 4D2RA 3EQRA 4BCGA 5HTBA 4AA4A 3BYMA 3QFVA 1H1RA 4FMQA 5T68A 3UQGA 5DT0A 2QOFA 3HVCA 4ORKA 4J53A 2RF9A 3WF5A 4QP3A 4WNMA 1NA7A 4YLLA 4RIXB 4XX9A 3ZUUA 3BV3A 3FLZA 2B0QA 3KRWA 2C3LA 3POOA 1W83A 4QMXA 1NW1A 2V5QA 1XH9A 4WSYA 4DEGA 3DZOA 1Q8ZA 4DAWA 4F0IA 5LVNA 2YAKA 3DTCA 4JQEA 4FT0A 3FXWA 4WNOA 4AGWA 1QL6A 5IA3A 5M4CA 4LOPA 4YU2A 4DCAA 3P08A 5LJJA 3I5NA 3DFCB 2C3JA 4A9TA 3O8PA 2XMYA 4KINA 4GW8A 1AD5A 4PP7A 5KHXA 2CKPA 2X2KA 5DGZA 5AUWA 2VU3A 3NDMA 5HOAA 3UG2A 3CCNA 3RK5A 1ZYDA 3BEAA 1YWVA 2QOCA 3RVGA 3SX9A 5EDPA 2B9JA 5IPJA 3LXLA 4B0GA 3PJ8A 3ZZEA 1KUTA 3GXLA 3KMWA 5CXHA 3EMGA 3MPAA 3PY3A 2VNWA 4TKSA 3PZHA 5CX9A 4AA5A 2PTKA 2UZBA 3BIZA 3VC4A 4L7FA 2AYPA 4XOYA 4XYFA 4RQKA 2C5XA 4BTMA 4EYMA 4DN5A 4EK3A 3N9XA 1U4DA 4E6CA 2ZYBA 4QMVA 4XRLA 2R7BA 4LYNA 3RK9A 4O38A 4CMUA 2G2IA 4N0SA 3SVVA 3B8QA 2B54A 4RX9A 4W4YA 4DITA 4EBWA 2RFNA 2GHLA 4ZTNA 2OZAA 3I79A 5JZNA 2J0LA 3R63A 1G8AA 3FL4A 3A2CA 4EC9A 3Q52A 3SW4A 2B1PA 1PY5A 5HCXA 5EQPA 4AN2A 2CCIA 3WE8A 2I40A 3UIMA 5BVNA 2ONLA 3JY0A 4BF2A 3O71A 3BHYA 1YWNA 4G3FA 3CXWA 5HEZA 4R3CA 4AN3A 3ZRKA 2XF0A 3BE9A 2VUWA 3MN3A 4CTCA 5CALA 2XS0A 4RZVA 5HCZA 4TYIA 2GPHA 3IGGA 4F0FA 5HU9A 3S2PA 1L8TA 4FBXA 3QQFA 4NM7A 4QMQA 5CANA 4RFYA 2VTIA 2OIDA 5IA5A 3NCZA 3FMMA 2WMAA 1YW2A 3NUXA 4FKSA 4FVPA 2F2UA 2X39A 3QLGA 3QKLA 4MBJA 3BHTA 4IC7A 4NU1A 4D1XA 3L9NA 2J50A 3MB6A 2C3KA 4TYHB 2G01A 2J51A 2FH9A 4B4LA 2QLQA 1JKKA 5CNOA 1OIRA 2HAKA 3CP9A 4YJUA 2CGXA 5CSWA 1Y6BA 2B9IA 2VTSA 4O0UA 4PP9A 3ZHPC 3V5QA 2BZHB 1H08A 2ITTA 3IO7A 3RMFA 4PQNA 2J7TA 4WKQA 3TJDA 4C3RA 4MWHA 5C27A 2UVZA 4MEDA 2JFLA 1IG1A 3VHEA 2WKMA 3QRTA 4O7SA 5E90A 2BPMA 4MHAA 3NGAA 4EHGA 3HYHA 3ORMA 5IQCA 4CMTA 3DY7A 1XKKA 2EU9A 2XCKA 3ZRLA 3TZMA 4EH7A 5J87A 2B9FA 2QOIA 3QGYA 4M0YA 4QMZA 5LVPA 4QMMA 5L6OA 3AT4A 4LRMA 3JR1A 5DEYA 1KSWA 2ZB0A 3UE4A 2FGIA 3EQGA 3R30A 5D10A 5M09A 5AP1A 3R9OA 2VTLA 2VO3A 4CSVA 5I9XA 3H4JA 4E5AX 3RAHA 4B7TA 2X4ZA 2ITXA 2PVLA 2X1NA 4E4XA 3LW0A 3H0YA 3VUTA 2OI4X 2A4LA 4DLIA 4MVFA 4O7VA 1YI4A 3V01A 2W9FB 3S4QA 4C33A 1ZAOA 2WHBA 4I23A 2LAVA 1U59A 4KBAA 2F57A 4QNAA 3Q9YA 3ZXTA 3SW7A 4DGLC 2GCDA 3ANQA 3GI3A 2VTOA 4J52A 4LRJA 2R3RA 3P7BA 5HE2A 5CZHA 5M57A 4LQMA 3VRYA 4ZTRA 2PU8A 3FI2A 4YTCA 4ZK5A 4L53A 1YXSA 1LUFA 1Q62A 2HK5A 3OMVA 4HNFA 4QQCA 3FZPA 5K0KA 3SG9A 3U55A 4APPA 3HDMA 5EM8A 1JAMA 1KWPA 2BAJA 3UPZA 5FQDC 4V05A 4ACHA 5C8NA 5CEQA 5E92A 3R7YA 4M7IA 4MXAA 1FPUA 4C4IA 2HZ0A 4GG5A 4HW7A 4DTBA 3AD4A 4FV9A 4DG0E 2QHMA 4ONAA 4M8TA 2FO0A 2QG5A 2IZTA 3UIBA 1M2PA 5ICPA 2QNJA 5EQEA 4I94A 1RDQE 4LL5A 4O6LA 4NCTA 1JNKA 4JVGA 4KSPA 4U6RA 2VWWA 3LLTA 3LQ5A 2VD5A 3O96A 1F3MC 3QYWA 4TWNA 4MQ1A 3E62A 4U97A 2UW3A 4F6WA 2XRWA 4EHZA 3DK3A 3R2BA 4ACCA 2IPXA 5DYJA 4DT8A 2Z02A 3OP5A 5AR3A 3HA6A 2ESMA 2NP8A 3GEQA 3R02A 4GK3A 5AP7A 1BKXA 3HRCA 3PRFA 4X21A 5EI8A 4AGCA 3UO5A 2REIA 3OOMA 3P78A 2WTCA 1XH7A 2BMCA 3C7QA 5LARA 3TN8A 3W2RA 4Z7HA 4DFBA 4GEOA 5GJGA 2OGVA 4XP3A 1U5QA 4NJ3A 1JBPE 2OZOA 4BHZA 2JDOA 3OWKA 4ZP5A 1P2AA 3HUCA 5GHVA 1U54B 2WIPA 3UNJA 4BRXA 4O82A 4YGAA 4JG8A 4F6SA 5M4FA 1NY3A 4DFYA 4ZSGA 1DS5A 3GC8A 5BPYA 3E7OA 1UU9A 1YOMA 1RJBA 3DGKA 3HEGA 4IZAA 5J9YA 1F5QA 3PJ1A 4P2KA 3P1AA 4DEAA 4QT1A 3UG1A 3T3VA 3TM0A 2YZLA 1KV2A 3AT3A 5IUIA 3ZC5A 3ZMMA 3U9NA 4F65A 3G90X 5I3RA 3F5UA 3V5PA 4F70A 4DFUA 1JKLA 1DAYA 4IANA 4YJOA 3HDNA 5HKMA 3ZBFA 4CYJA 4B6LA 1STCE 5BX0A 1H1SA 3PXYA 2ZDTA 3RZFA 4J71A 4BIBA 5DMZA 3RWQA 5DR2A 4EEVA 3OBJA 4QNYA 4U5JA 3ZM4A 4ZZMA 4D58A 1XJDA 2R3FA 3PXRA 5JH6A 2BIKB 4C4FA 3K54A 2O64A 1BX6A 4OT5A 2BRGA 4HJOA 4C36A 4TW9A 5IF1A 2VX3A 1UNGA 4GL9A 2QO2A 4LMUA 2YHVA 3CTJA 4JDKA 5LCKA 4FKUA 3QRJA 3ATTA 4M0ZA 3PVBA 4PUZA 2PZIA 4AG8A 3ACKA 5JRQA 4CZYB 4EUUA 3P9JA 2VO0A 3C4WA 3DDQA 3VIDA 5CAOA 3OUNB 3C4FA 1BMKA 3OY1A 4ANOA 2OSCA 3GCQA 4L3LA 2ITZA 4IFGA 4EH4A 3MVMA 4AX8A 2VTHA 3A62A 5CT0A 2BDJA 4L46A 5C01A 4FTOA 5L2WA 1SVGA 3MH0A 3QWKA 4J99A 2F4JA 3O7LD 3OCTA 1KOAA 3NNUA 2QODA 3MI9A 1GIHA 3U6JA 4IC8A 5AUZA 3OD6X 2VGOA 2XK9A 1GIJA 3MW1A 2B9HA 3VUKA 2X8EA 2KTYA 3GNIB 4KIKB 3ELJA 4QTBA 2C0IA 4YJQA 4F7JA 2OU7A 2YN8A 5CEOA 5KMKA 2F7ZE 1APME 2BCJA 3VQHA 2HCKA 4AS0A 4UX9A 3ZYAA 2PMNX 3NR9A 3NSZA 1P14A 4EOLA 1UWHA 3BRBA 3IOPA 4O7WA 3VBTA 4OBQA 4H1MA 3ZSIA 4O7ZA 2B55A 4GT5A 4LMNA 3UC3A 3HP2A 3V5TA 4ZSAA 4I5PA 1EH4A 2BAKA 3IDBA 4YNEA 1UV5A 1IA8A 4YZNA 3VS7A 2GNIA 1PXOA 3BCEA 1YRPA 3UZTA 2YZAA 3DKCA 5A4LA 1UU7A 4QP2A 3LMIA 3KMUA 4IB5A 4ASXA 4R77A 4X2KA 3OW3A 3FV8A 5HZNA 5DVRA 4C4EA 5JGAA 2QHNA 3NPCA 4MH7A 4USDA 1H8FA 5KE0A 3R2YA 3ULZA 3KMMA 4FE2A 2JD5A 3VS6A 1DI8A 2CLXA 3FSKA 2R0IA 4KBCA 3MA6A 4O0SA 2PK9A 5FD2A 5EDRA 3FUPA 1VZOA 4U81A 5HNBA 4ZTSA 3VBYA 5HNIX 3I7BA 4KD1A 3P0MA 3MBLA 3OVVA 3P4KA 2OH0E 4QYFA 4KKHA 5A4TA 5GZ9A 3OCGA 4E20A 2EUFB 2Y0AA 5ANOA 3EKNA 4NTTA 2ITPA 4GMYA 5AUTA 1IR3A 1CMKE 5FM3A 5CF5A 3HAMA 3C4XA 2GDOA 3DCVA 1TVOA 2VTQA 4BWXA 4HVDA 5J7BA 5L6WL 2IW9A 3E87A 3PUPA 4IQ6A 2GS7A 2IZUA 3QX4A 3V51A 4FKQA 3VS3A 1JKTA 5J7HA 4F9WA 3DAJA 1UVRA 1BLXA 1HCKA 2R3OA 4YP8A 4U41A 2GSFA 4JBPA 2RIOA 3HAVA 4RVMA 4EOOA 3EQCA 2OKRA 3LQ8A 5EHLA 3O50A 3ZZWA 2RKUA 3SRVB 3PA5A 4C02A 3S1HA 1Q8TA 5DLSA 3EFWA 1R78A 2GNFA 2HZ4A 4UEUA 2RFSA 4G3CA 2OFVA 4FZ7A 5HBEA 2ETRA 4X2FA 4BDAA 4TT7A 2UW0A 1ZMUA 3FMHA 3IW6A 3D9VA 4DCEA 3MFSA 5IKWA 3F7WA 3F9NA 5AUUA 4ZMEA 2GQGA 2C0TA 5I0BA 4LRKA 1YDRE 2PULA 2YEXA 4L7SA 4M12A 2YJSA 2ACXA 2O3PA 2QOQA 3COHA 3DBFA 5CF8A 1YKRA 2F49A 2J9MA 3RHKA 3CTHA 2VTNA 3ZEPA 5E8YA 4WNPA 5FEDA 3CQWA 5B2KA 5T6KA 4DH8A 4KIKA 1Q97A 4I41A 4JG6A 2WQNA 2ZMCA 3DFAA 4D2WA 2CGVA 4QP1A 3FZRA 5F94A 3Q53A 3EQFA 4RJ3A 2QOOA 4JAJA 3VBQA 3GC0A 4IDTA 4O7TA 3Q5IA 4ASDA 3LCSA 2PMLX 4UV0A 4RJ5A 4J8NA 5EFQA 2W1ZA 3W8QA 4BDJA 4BKJA 4MBIA 3ZSGA 4F63A 1RE8A 2HZIA 1M14A 1HOWA 5E8TA 4P7EA 3SKCA 2Y4IB 4YBJA 4CKJA 4BTFA 2FSMX 1U54A 3D2IA 2JKOA 3OWLA 1M17A 3QYZA 4KABA 3LXPA 4U9AA 2UW4A 2ITOA 2W99B 2O0UA 3D5UA 3ET7A 5L2SA 1R3CA 3MFUA 3D83A 3JXWA 4AT4A 3PXZA 2JC6A 3KU2A 2GHMA 3QD4A 4YJRA 1Y8YA 4EOJA 5BUIA 4WBOA 4YC8A 3BKBA 3MDYA 4F7NA 5KMOA 4IWDA 3WZKA 2R3NA 2X7GA 2YM3A 3F7ZA 4LUEA 2JBOA 3FPMA 4J7BA 3IK3A 4I4EA 4R1VA 5AA8A 5M07A 3QBNA 4CKIA 1SMHA 4DEEA 3FI3A 3D7TA 3GU7A 3PPKA 4PL5A 4XV2A 3V04A 3FLYA 2W06A 4IX4A 5AR4A 4IX5A 4RWKA 5HG8A 3DBEA 1ZZLA 4KSQA 4RSSA 4MWIA 3RP9A 5KMJA 4ALWA 4QQJA 4UZHA 3NAYA 4G34A 2ZM3A 3PG1A 5A46A 1T46A 4ARKA 2CNUA 2O8YA 3LPBA 4A4LA 3BEGA 4TWCA 4FGRA 4LGDA 4K8AA 3TZ7A 2GFSA 2FYSA 3WIKA 4C61A 1WBSA 4XJ0A 4YNOA 4ZJJA 5ACBC 5I5ZA 3EFJA 4OTQA 3C0IA 2ZV8A 4BIDA 3LJ2A 2XK7A 4FTCA 4D2TA 3R9RA 2VTTA 2Y7JA 4QOXA 4K2RA 4O2PA 2A27A 3BGQA 5EYMA 3EB0A 2WZJA 4OTPA 2QQ7A 4S32A 4FF8A 2IN6A 3S95A 5E8SA 4AA0A 3KULA 3ZH8A 3OC1A 2OH4A 4I0SA 5J95A 5E4HA 4DBNA 4FKTA 4AFEA 3H9RA 2XKCA 3NEWA 4I3ZA 5TT7A 3CSVA 5DIAA 5D41A 1PRYA 2DUVA 4FV6A 1XH5A 4JAIA 4CT1A 3C4CA 5HVYA 3ZC6A 1H1QA 3FQSA 1Q61A 3NS9A 2XK8A 3CGFA 3ORPA 5L2QA 4JL9A 1E1XA 3BZ3A 4D4YA 2R3HA 4YJNA 1UNLA 4FYNA 4BWPA 4Y95A 4XUFA 4ANSA 4QMTA 3KXHA 4GIIA 2PVMA 3FKOA 3UMWA 2CDZA 3VF9A 4EOPA 2C5YA 4LV8A 3P86A 2FVDA 4G31A 4AOTA 4N57A 4DYMA 1Y57A 2OW3A 4X2JA 4FVRA 1ZYCA 3KXMA 3W33A 4XH6A 3E63A 2Z7LA 2YABA 4EZ3A 3C4ZA 3D0EA 4OTGA 4GCJA 3SRVA 1VJYA 4C7TA 3QQUA 3O23A 4NTSA 2C6DA 2OICA 3AQVA 3P5KA 2QOKA 2QO9A 2ZV2A 3F5PA 1ZARA 3GUBA 3FPQA 4M67A 3PXQA 3A8WA 4DH1A 1FVRA 3W18A 2UZWE 5HORA 4FZFB 4FIFA 2CGUA 5TF9A 1VYZA 1PYEA 1UWJA 4E6DA 4P90A 2V55A 3SDJA 4C4GA 4BZDA 4NCTC 2VV9A 4RLLA 1YDSE 4XHKB 3LKMA 3IW4A 3EQPA 4DBXA 3VJNA 3HUBA 1U5RA 4QRCA 1URCA 5M06A 2H34A 4M13A 1REJA 3SXRA 3ZO3A 2YCFA 1QMZA 4PNIA 4QPMA 4BN1A 2QC6A 3F3WA 4I5MA 1YWRA 4PL3A 2YLEA 3QC4A 3POZA 4G3DA 4RBLA 5H8BA 2W05A 4BDKA 4KAOA 3MESA 3WOWA 4XV9A 5CLPA 4BBMA 2WD1A 1UA2A 4FT7A 3Q2MA 2HW7A 3E8CA 4X3FB 3QHRA 3R28A 2IZRA 3GCUA 2BALA 1OL2A 3BPRA 3O17A 3OWPA 4FTIA 1LR4A 4EKKA 1ZRZA 2PMOX 1QPCA 1U46A 2W5BA 4ANMA 4HVSA 5DPVA 3ZLWA 2PL0A 3GVUA 3ZSHA 4Q5EA 4FSYA 3FWQA 3UMXA 3ZLYA 4WG3A 2XB7A 1ZY5A 1CDKA 4H58A 4ANBA 4D5KA 1J1CA 1R0EA 4RC4A 4TTHB 3SOCA 3MPMA 3QCSA 4Z16A 3F3TA 2R64A 2W1DA 3KRLA 3Q4ZA 5EW3A 2XYUA 1XO2B 4GV1A 3AC4A 4FV5A 3KFAA 3QQGA 2WB8A 3HA8A 2XNOA 5KMIA 4YO6A 3I6WA 1A48A 3MA3A 1W84A 5BQ0A 3FQEA 2PVFA 4I93A 2WOUA 3DJ6A 3GOKA 3KB7A 1ZOHA 2J0MB 4ID7A 3VS0A 5CAUA 1YXTA 3ERKA 4QMOA 2PUIA 2I0EA 5HI2A 4PMMA 3RM7A 2VAGA 4FR4A 4DEDA 5LOHA 1XHAA 5I3OA 3C50A 3A99A 2AUHA 4IVAA 3UZPA 4I5HA 3ALOA 4A9RA 4BCPA 2VWZA 4BKZA 1ZMWA 3CE3A 3VBVA 4NJDA 5CU6A 2NPQA 3VNTA 3OCSA 4OAVB 3QZIA 3VUHA 1GOLA 4MXOA 4AT3A 3OFMA 4J96A 3TZ9A 3BGPA 2BIYA 4BBEA 4DG2E 1P4OA 3KVWA 2RFDA 4YSMA 5CVGA 2EXMA 3HNGA 5CQUA 1H24A 3ZONA 4FG7A 1OMWA 1S9JA 4PL4A 5H2UA 3A7GA 4AGUA 3SAYA 3NW7A 3V5WA 5FP5A 4IZYA 3PY1A 4FODA 2FA2A 5GZAA 3WILA 2Y4PA 3Q6WA 2P2HA 5CSXA 1KE7A 5AUYA 4V04A 4YJTA 4BDEA 2OWBA 4IW0A 2WGJA 4QYGA 3RTPA 3Q4CA 3GT8A 2W7XA 2WMSA 4CT2A 3BYOA 4EK6A 3AGMA 1JVPP 4JRVA 5FWKK 2KULA 2X7OA 4CFXA 2DS1A 4MX9A 3UO4A 2G2FA 1YHWA 3JUHA 1H28A 2OIBA 4M84A 2X2LA 3PSCA 1YVJA 4D55A 5C03A 4FSWA 1Q41A 4RLKA 2XK3A 5IQGA 3ORLA 4LGGA 4HVHA 1BYGA 3F3ZA 3P79A 4K33A 3RPRA 2JDSA 2R9SA 3VWAA 2ZMDA 5L8KA 4PNKA 2J90A 4D9TA 4DGMA 5CEMA 1SZMA 3CY3A 3OZ6A 3TNIA 5HLWA 5K5NA 5BYLA 5M4UA 4G16A 4QPAA 2Y4IC 3HKOA 4A9UA 5LQFA 3S00A 3Q2JA 3TDVA 1M7QA 2YCQA 4XMOA 5CEIA 4EH5A 3N4UA 1F0QA 4ZLYA 4H39A 2VTAA 5DT4A 5FXSA 5HTIA 3G9NA 3R83A 4ERKA 5I4NA 4ZZNA 2XIKA 4CLIA 4CNHA 1PJKA 1UKIA 4QYEA 4OTRA 4R78A 4TWPA 3HMPA 4AP7A 3PZEA 5HHWA 4ACDA 3UVRA 4OT6A 2OXXA 1WVWA 3HGKA 4I5CA 4PY1A 2QKWB 3ZLSA 3JVSA 3U6HA 4MXXA 3TACA 2WAJA 5I9WA 2UW8A 1W8CA 4X7QA 2NNWB 1B6CB 3R7IA 3UC4A 5BUJA 3Q3BA 1W0XC 4JXFA 1G8SA 3BGZA 3ENHA 5DOSA 5D11A 1Q4LA 3UOHA 4BC6A 4E7WA 4EOKA 2Y6MA 4QTAA 2XKEA 1Q8YA 4IVDA 2H6DA 3Q6UA 3A4PA 4S2ZA 4O0VA 3UP2A 3AC8A 2WMQA 2RFEA 2OIQA 3A7JA 4I20A 2YIRA 4IM2A 2GQSA 4E4NA 3FAAA 4F0GA 4LV5A 4FKVA 2WIHA 3QALE 1PXNA 4L3JA 4XG6A 4FVQA 2GTMA 3CGOA 4I4FA 3NUNA 4J97A 5E8XA 4HOKA 3RAKA 3VS5A 1ZOEA 2HOGA 3QZFA 1OPKA 4QP6A 4BZOA 2ITYA 3IQ7A 4FV4A 5I9YA 3JY9A 4WIHA 4XBRA 3EWHA 5A3XA 2X8DA 1BL7A 4GUBA 5G1XA 2GNJA 1W7HA 3LJ1A 4HZRA 4ENYA 4F9CA 4FV3A 4V01A 3MIAA 4U3ZA 5EI2A 3V8WA 5CSHA 4USEA 3SD0A 4JRNA 2P0CA 3RPYA 4F99A 4HYHA 1Y91A 2X9FA 4ZTMA 4O7NA 2UZDA 1YHSA 3C9WA 5BVEA 5LVMA 1CSNA 1IASA 3CBLA 3M2WA 4FTLA 5LMKA 1J7UA 4XG9A 4S33A 1GY3A 2PE2A 4GYGA 3K3IA 4G1WA 2Q0NA 1ZXEA 2V7AA 3CKWA 2PPQA 2YA9A 4NW5A 3WE4A 4C3FA 3HZTA 4JX3A 4A07A 4FK3A 5E8UA 3QA0A 5A4QA 3QTSA 4H3BA 1QCFA 2ZB1A 5BVWA 4WUNA 3TKUA 3VRZA 1OM1A 4CLJA 1XH8A 2YIYA 4O81A 3LCDA 1YQJA 3MTFA 4W9XA 5EW9A 4UXLA 4BB4A 1ZMVA 3L9MA 3UVPA 4DLJA 4XP0A 4B9DA 4ZTHA 2R7IA 3WYXA 3QD3A 4ANNA 3V5JA 4FT9A 3BQRA 4UZDA 3BHHA 1KE8A 3TTIA 1TKIA 3UBDA 3JYAA 2PVRA 3G33A 3OTUA 4RIYA 3RCDA 3U9CA 3V6RA 3NUSA 4X0MA 4PDOA 2H8HA 4YC3A 4KNBA 5KX8A 3O0GA 2YM7A 3AOXA 3F66A 1FGIA 3R1YA 2BTSA 4IWOA 4UY9A 3RZBA 4EH8A 5DRDA 4H36A 3OCBA 4QMLA 1SYKA 2QI8A 3RALA 5BYYA 4S31A 3PJ2A 1SNUA 1JQHA 3VF8A 5HE0A 3AC3A 5JQ5A 5CTPA 4BY9E 3MH2A 2PWLA 3DNDA 4IX6A 2O63A 3EN4A 3II5A 4I6HA 3BBTB 5GJFA 4D4SA 3HP5A 4FV8A 4KIPA 4GFGA 3GB2A 4FC0A 1GZKA 4K6ZA 2Z7RA 4L68A 5ETIA 4NUSA 2FSOX 4C38A 4FYOA 3LFFA 3DKOA 3UOLA 5KUPA 5EH0A 1JPAA 4QMPA 4B99A 2EB3A 1OZ1A 4ITHA 2C6OA 2G2HA 4WUAA 5ANGA 4AW2A 4AZVA 3VS2A 3W16A 5L6PA 3BLRA 2C30A 5C4LA 2XBAA 2HWOA 3DQXA 3LJ0A 4GT3A 3R7GA 1SM2A 4I1ZA 4RWJA 4BKYA 4A9YA 4PMPA 4YZMA 2J4ZA 4I0RA 1CM8A 4O7LA 2QOBA 4MNEA 3SXSA 4DGGA 1HCLA 3EN7A 5HTCA 2EXEA 2DWBA 4EOSA 4EH3A 5M08A 1H00A 4PPBA 2YM8A 4V0GB
chains in the Genus database with same CATH superfamily
1Y6AA 2GNHA 3F61A 1RQQA 4ZSLA 5JEBA 2CHLA 5FXQA 3ZEWA 1CKJA 3ALNA 1L3RE 3Q96A 2C47A 5CU2A 3ZO4A 4W9WA 4EZ7A 4F1TA 5L2TA 4GFMA 5CYIA 5KZ0A 3R7VA 3W2CA 5AP4A 3QRKA 4QP9A 4CG8A 2BRHA 2OK1A 3UP7A 4EOIA 3L8SA 3R7OA 3EN5A 4RWIA 4TYJA 2W1GA 3BE2A 5EKNA 4TZRA 1Q5KA 4EHEA 3KK9A 5AAEA 5HVJA 4QMYA 1ERKA 2W1IA 4AOJA 1FQ1B 2DYLA 2QD9A 2YFXA 4AT5A 2J2IB 4WSQA 1NVRA 4FEVA 4O84A 3Q60A 3NW5A 4EUTA 4AXAA 2JITA 5IA4A 4XG3A 5IH4A 4DGOA 2W1EA 3I0OA 3KXNA 2XAOA 4E3CA 4GVJA 5GJDA 2BZJA 2XNNA 2O2UA 4LUDA 1OIQA 5D1JA 3Q4TA 5JRSA 3W1FA 3W0SA 4JS8A 5H3QA 3EQDA 3CD8A 3DLZA 5ETCA 3QLFA 2BAQA 4F7LA 1PXKA 3MVJA 5IH5A 4NZWB 5IU2A 4HGTA 3TNQB 3GCPA 4BTKA 2E2BA 4GYIA 4R5YA 5F20A 3KK8A 4FIIA 2VTJA 5AP6A 5C9CA 4C8BA 3K3JA 5AV4A 3LFAA 4CQEA 5IISA 5LVLA 1Q3WA 4EZ5A 3OEFX 2XCHA 2CKQA 3KL8A 4U80A 3DLSA 5CASA 5LWMA 5HO6A 3TT0A 4CZUA 1DI9A 2SRCA 2W96B 4GKHA 3RPOA 5FG8A 1YOJA 1RW8A 4X6RA 2WTWA 3EHAA 4RZWA 4TN6A 3VW6A 3AT2A 2VO6A 1KE5A 3MVLA 4IDVA 2R3QA 4A7CA 4BCNA 3OBGA 4IJPA 4DINA 4YR8A 2J0KA 3RAIA 5FBNC 1XQZA 3NNVA 3UDBA 1OITA 1SVHA 3NUPA 2X81A 3DXQA 3F2RA 5AM6A 3PIXA 3A4OX 1H07A 5H8GA 4G3EA 4RC3A 4EOMA 4IVCA 2YIXA 4KA3A 4WA9A 3R8UA 4EQUA 5KCVA 2PE1A 4PTGA 4F64A 4QTCA 4WT6A 4BI2A 3KCFA 3FBVA 5K4IA 2XBJA 2IEWA 4LFIA 2P33A 3G0FA 4FTJA 4GIHA 3F2NA 2ITVA 3FYKX 4IAIA 4NM5A 3E92A 4O21A 4Y5QA 1NT2A 1AQ1A 1SVEA 2W4KA 3R9HA 3LMHA 4XEYA 4RG0A 2CNQA 3PIYA 5E8ZA 5K0XA 4JR3A 3MPTA 4AF3A 4L52A 3PP1A 4EWQA 3UIUA 3KRRA 3O8TA 4GKIA 5IMEA 5FP6A 2RG6A 2C69A 3PVWA 4QDEA 4LI5A 3R8ZA 3KEXA 4FTTA 3PJ3A 1Q8WA 4FT5A 5F4NA 2BHHA 5LXMA 3MWUA 5C4KA 4G2FA 4ZLZA 4ITJA 5EOLA 3AMYA 2ZJWA 2O65A 3FZOA 4HYIA 5KZIA 4AW5A 3R8VA 1H4LA 3KQ7A 2G9XA 5ANEA 2BKKA 3B2WA 4R8QA 4K0YA 4EBVA 5B7VA 5GIPE 2C6IA 3FY2A 5DR6A 3QX2A 4CRLA 1H01A 3ANRA 4FSQA 3ZRMA 3ORIA 5FTQA 3FZ1A 1XWSA 3QTZA 3OXTA 2IWIA 1XBCA 4S34A 1NVQA 1OGUA 2X7FA 4L44A 4X2GA 5A4CA 4NKSA 4ZJIA 5CVHA 3HRBA 4PDSA 3R9NA 4JNWA 3F2AA 4E5BA 5M56A 4GRBA 5CSVA 2BZKB 4O27B 3OY3A 4XG8A 1PHKA 3CJGA 3QWJA 3ENMA 2JKKA 3KKVA 4MNEB 3TIYA 2QU6A 4DTKA 4PV0A 3ZCLA 4L3PA 3SQQA 4Q9ZA 3D5WA 1TFFA 4WNKA 3GP0A 3NCGA 1UU3A 5ANIA 4ANQA 2WTIA 4WBBB 3FDNA 3FMEA 4BGHA 1GNGA 5CAPA 4X3FC 1IAJA 4CCBA 5CU0A 4KKGA 4YPDA 3AD6A 4FV2A 5AUXA 4OW8A 4HZSA 3CC6A 1ST0A 2IVTA 4PMTA 4D9UA 3TG1A 4MF1A 5AP2A 3W8LA 4D2VA 4ZJVA 3TUDA 2ZDUA 4OUCA 2W5HA 3FZTA 2BFYA 3CIKA 3QZGA 4L43A 1J7LA 2NYAA 4DEBA 5FUTA 2JDRA 4BCFA 3FC1X 1FMKA 2ETKA 5BYZA 3ZU7A 4D5HA 3PIZA 3Q9ZA 3TIZA 2PZYA 4BJJB 4O4CA 4YZ9A 4Q2AA 4NM0A 4CYIA 4EQCA 2XNBA 3OXZA 4KS8A 4RVLA 5AR8A 4EK5A 5JGBA 5JFWA 4DDGA 4F78A 4FTRA 5JFSA 2OJJA 2R3GA 3R04A 4EHVA 2C5VA 1ATPE 3E64A 4CKRA 5KMNA 4WG5A 2XJ1A 2WEIA 5J5TA 2P4IA 4YMJA 3RJCA 3P5JC 4XOZA 5D7AA 4IM0A 3BHVA 3G15A 5E1EA 3ZS5A 2PE0A 2HWPA 4F1OA 3BU5A 5FXRA 1PXJA 5A6NA 3EYGA 4CFNA 4FIEA 2OO8X 2YIQA 4IH8A 3W32A 2C6MA 2GU8A 4AE6A 3PE2A 2WU7A 5CEKA 4AGDA 4JT3A 3ROYA 4JG7A 3FHIA 4FOCA 2UVYA 3LAUA 3QQLA 3CJFA 2QO7A 2WOTA 4QMSA 3ZBXA 3KF4A 3GU4A 3KXGA 4XLVA 3C4EA 3ULIA 4BCIA 3BBWA 3RWPA 4FZ6A 2YDKA 3FQHA 2Y9QA 2WMBA 3NYXA 3HECA 4OGRA 1XH6A 3U4WA 1A9UA 1PXLA 3LFEA 2RL5A 3VJOA 3GCVA 3MIYA 5L3AA 2X9EA 5DA3A 3VULA 2GS2A 3IOKA 4GFOA 1CKPA 2F7XE 3D5VA 3Q5ZA 5J1WA 4FKGA 4HNIA 2C6KA 3LM5A 5GINE 2BDWA 3C13A 3FKNA 4QYHA 1V1KA 1VYWA 3BV2A 1GZNA 1NVSA 2UZLA 4GSBA 3WF9A 1ZY4A 5M55A 2WMXA 5HE1A 3ZUTA 3TNHA 3OXIA 4RMZA 5AV3A 5AR7A 2YDJA 2GQRA 3RHXA 4OBPA 3LVPA 3EQBA 3HV6A 3QHWA 4MAOA 3PSBA 3OT8A 5T3QA 3KA0A 4NEUA 1GIIA 2OF2A 4F08A 4TNBA 4QP8A 4NIFB 4F9YA 4R3RA 4FIJA 1B39A 1MUOA 3CTQA 3MYGA 4Z7GA 4FZAB 4RJ4A 3DNEA 4I6QA 4IWPA 3OEZA 4R1YA 3TV6A 4CEGA 3BL7A 2WMVA 4CFMA 3UGCA 3DPKA 3HV3A 3W55A 4HYSA 3QZHA 2YCSA 1JKSA 1BI7A 3WZJA 3DKGA 4U79A 3HMMA 5HG9A 1PXIA 5HIBA 4CD0A 1OIUA 3ORXA 4DFNA 2VWUA 3KF7A 4PWNA 4AUAA 4AOIA 3WF7A 4I6BA 5KBQA 1REKA 5BUEA 4KIOA 4TYHA 3G51A 3EFKA 3Q9XA 1UU8A 4GJ3A 4JMQA 4UWCA 4IAYA 2YJRA 5KMLA 4IAAA 3SHEA 1FBNA 4YTFA 3EQIA 4MKCA 2BDFA 2WEVA 5TR6A 3VUGA 1K3AA 3ZFXA 3NYNA 3MJ2A 5HG7A 4HGSA 2QLUA 3HV4A 2Z2WA 5LVOA 2XIYA 3TKIA 3KRXA 4M69A 1YI3A 3N51A 3QCQA 2F9GA 2XNMA 3I5ZA 1PMUA 3QRIA 4I22A 4R5SA 2XK4A 2E9PA 4RT7A 4YZCA 5TKDA 5D7VA 4TL0A 1OUKA 2XH5A 3QUEA 4Y5HA 5EK7A 2CNVA 1GZOA 4XLIA 2UZOA 2CJMA 4FV0A 2R3LA 5EM7A 3PFYA 4I0TA 4DFLA 2Y6OA 3NIZA 4W4XA 1KE6A 1YXXA 3DA6A 3HV7A 4O91A 4O0YA 2R3KA 3DB8A 4W4WA 4ZTQA 3MV5A 3I6UA 3LXNA 4MYGA 5I9UA 5IZFA 3PVUA 4TYGA 3MY1A 3UIXA 5FLFA 3R0TA 3LQ3A 1YI6A 3V8TA 2J6MA 2VO7A 3ODZX 4KWPA 1WFCA 3AMAA 3QA8A 4ACGA 4QQTA 2IO6A 2VWXA 4PMSA 1FINA 3UVQA 5IQFA 3KXXA 4DA5A 4HPTE 3NMUF 4D1ZA 3UTOA 1OBGA 5DE2A 2Q83A 4XG7A 5HBHA 5JQ8A 1UNHA 2G1TA 4C4HA 1W98A 4O1PA 4FKIA 4F6UA 2BFXA 3D7TB 4X6QC 4L8MA 5CWZA 5JFVA 4IIRA 1WBTA 1ZYJA 4D4VA 2XNEA 2BILB 3BX5A 4QTDA 3ZDIA 1Q8UA 4S30A 4RQVA 4BCJA 5L4QA 5JK3A 2PUNA 5AR2A 5H8EA 4F9BA 2C0OA 4IAKA 3A8XA 5LCJA 3FXXA 3PFQA 3KN5A 5HQ0A 2E9UA 3L8VA 4JX7A 3BYSA 5EW8A 2W0JA 2Z8CA 2XAMA 3IECA 5DG5A 3TUCA 3KREA 2BHEA 4FEUA 4D2SA 2PUUA 4H3PA 4D28A 4IXPA 2UZNA 5F95A 3H9FA 2B4SB 3ZXZA 4F9AA 5BMSA 4CVAA 4EJ7A 5EQYA 3I1AA 5HVKA 4DTAA 4PPCA 4NFMA 5DRBA 3HX4A 3LFQA 4BZNA 1M2RA 3QUDA 3DT1A 5AAGA 1W2FA 4DH5A 4FA2A 3U54A 4IHPA 2ITUA 3EYHA 3PE1A 4BGQA 3ZTXA 4E4MA 2XRUA 5CU3A 4BI1A 5GZ8A 4XV1A 3E5AA 1ZLTA 2X2MA 4GK4A 2PHKA 2PZPA 2JEDA 1GAGA 4W8EA 4YSJA 2FUMA 3TV4A 2XVDA 5LMKC 3GC7A 4FT3A 1WAKA 3FL5A 3N4VA 1SNXA 5JFXA 2J5EA 2Q0BA 2BUJA 3QD0A 4RGJA 4FNYA 3G6GA 2OG8A 2C6EA 3ZO1A 5A6OA 5FDPA 3V8SA 4JBVA 2YM5A 4W8DA 4YC6A 5JKGA 3CPBA 3FSFA 2OF4A 4GG7A 4PDPA 1T45A 4XP2A 2HENA 4IAZA 5EHYA 3LOKA 4I6FA 4U0IA 2XM9A 2XANA 3UDTA 2PVJA 3KCKA 2I0VA 3LCKA 5CT7A 1Y8GA 4ZTLA 1OGYA 2OLCA 2ERZE 4RA4A 3UJGA 5E91A 3G9LX 3IDPA 3ZFMA 1IEPA 3NW6A 3IKAA 3MFRA 3F3UA 3IGOA 2RG5A 3FLQA 2P3GX 3W2SA 3FLSA 4ZLOA 4DEHA 3FMDA 2AQXA 3HRFA 4IB0A 4IFCA 1V0PA 3VONA 4ZS0A 3TWJA 4C2VA 1S9IA 2VNYA 4M14A 4U44A 3WF6A 5BVOA 1QPEA 2W9ZB 5AP0A 4HYUA 1WVXA 3DAKA 1R0PA 3A60A 2QOLA 2ZV9A 3TXOA 3AXWA 3TJCA 2FSLX 3BQCA 4YURA 2WU6A 2H96A 4J98A 3IW7A 2JIIA 5HD7A 1IAHA 2WTVA 5FTGA 2WQMA 2UW5A 3LFCA 3C5UA 4R6VA 2JDTA 3VBWA 4BDBA 5IDNA 5L8LA 2I1MA 3UPXA 5EM5A 2ZVAA 3OS3A 1OUYA 2R5TA 2X0QA 5IQBA 5ITAA 4JDHA 4RIYB 2VTMA 4L6QA 2X0GA 5K9IA 3AKLA 2W4OA 3UQFA 4JBOA 4DHFA 2X6EA 3M11A 4RC2A 4O83A 4YUQA 4RIWB 4QMNA 4JDIA 2R3JA 2IVVA 2UW7A 3EZVA 3DK7A 4C37A 2I6LA 5ETAA 2C1BA 3D94A 2CGWA 4APCA 4C58A 2R4BA 2YERA 1YXUA 2B53A 1Z57A 4Y83A 4G9CA 2J0IA 2JLDA 3U87A 4C4JA 4TNDA 3DXPA 4NT4A 4JQ7A 3NX8A 4EWHA 4UWBA 5BVFA 4ACMA 1TQPA 4OR5A 2PZRA 2VWIA 5D12A 4ZY4A 2OJ9A 2BZIB 1ZZ2A 5CAQA 3P7AA 4LOQA 3L9PA 3PXFA 4EH2A 3FE3A 4XCUA 1PXMA 2ZM1A 3A7FA 4BDGA 5HO7A 2XZSA 4HVGA 1PKGA 4RVTA 1TQMA 2YWVA 1IRKA 3BLQA 4KIQA 1A06A 2RGPA 4M66A 4O0TA 2I0HA 4Q5HA 3OOGA 3TCPA 4BDIA 3PLAE 1XBAA 4XV3A 3LXKA 5G6VA 3OG7A 5FTOA 1VLRA 3R7EA 1J7IA 3UQCA 4DHJA 1O9UA 4BL1A 2C5OA 3NVKI 5BMMA 1PYXA 3QL8A 3Q4UA 4RIXA 4ZAUA 1H1WA 1DM2A 5C1QB 1IA9A 3FKLA 3MTLA 3GOPA 3ODYX 4FV7A 3W0QA 3PA4A 4ZS4A 3QTQA 2WTKB 3NVMB 1WBNA 4I21A 3L8PA 1BL6A 2VTRA 3AMBA 2PZ5A 3HL7A 3LFDA 3R1QA 5AX9A 3P23A 4EH9A 2XKFA 2Y8OA 1DAWA 3PSDA 5J79A 3QU0A 4G9RA 3EJ1A 5K4JA 3IONA 5GIOE 4WD5A 3WZEA 2JKQA 2VWVA 4RVKA 3Q32A 3UOJA 3LFBA 1V0BA 3ETAA 4IZ5A 4WO5A 3UZRA 4L01A 1MP8A 3BWFA 3DV3A 1R39A 4XRJA 4MTAA 4KRDA 3FZSA 3DAEA 2GNGA 2C4GA 4MXZA 4WHZA 4UWYA 3Q9WA 3ORZA 3D14A 3E8DA 1WBPA 3OWJA 5KBRA 3G0EA 1OKWA 2HIWA 2YITA 3P7CA 4D0WA 1H27A 5CU4A 1OPLA 4CFFA 4AZFA 3QGWA 2XYNA 3FMLA 3R1NA 2ZV7A 4R7BA 3E3PA 2CN8A 3EH9A 5J9ZA 4FIHA 3DBCA 2FB8A 3DJ5A 3EQHA 3KC3A 4UMQA 3CLYA 5BVKA 3RCJA 1X8BA 2QCSA 4D4RA 4J95A 1G8KA 5KMMA 5DEWA 5L2IA 2BR1A 5IUGA 2AC5A 2HYYA 4X3JA 2QR7A 4UALA 5FDXA 1WBOA 4CFWA 4AAAA 4OLIA 4C3PA 3LIJA 4YJSA 4OAUC 2QONA 1P4FA 2HY0A 5DH3A 4F7SA 4G6LA 5JZJA 3IPHA 3DBDA 3W2OA 1ND4A 1V0OA 4CTBA 1OB3A 4GU6A 2LGCA 4O0XA 4CV8A 4FGBA 2VWBA 3QTRA 3FYJX 5DBXA 3ZUVA 3PUFC 1OPJA 5J8IA 3RAWA 3W0NA 3TZ8A 3MY5A 2C3IB 2UZEA 3LFNA 3EN6A 2CKOA 4C0TA 3QQJA 4CMOA 3R00A 1M52A 4CQGA 3ZDUA 4DHIB 4YJVA 5AM7A 4PDYA 3D15A 2ITQA 2OBJA 2BVAA 4C57A 1UKHA 3CS9A 5IQAA 4E6QA 5IEXA 2W1FA 3OF0A 3PG3A 4HGEA 4DH3A 1H25A 1K2PA 3AC5A 3COKA 2PY3A 3QXOA 4O0RA 3VN9A 3E8NA 4Y72A 4G3GA 3NYVA 3MH1A 4FSRA 3WZUA 1FMOE 1H0VA 2XJ0A 4G5PA 3ROCA 4D2PA 4JLCA 1YXVA 3DZQA 5HLPA 4C62A 3RPVA 2Z7SA 2IJMA 1W82A 4FSMA 4BICA 3E88A 4B8MA 4C2WA 3NUYA 4CGAA 4RIWA 1XR1A 1B38A 3BLHA 3KRJA 3REPA 2XIZA 4LGHA 3C51A 4NKAA 3QF9A 5AV2A 5JGDA 3WF8A 3H30A 3SA0A 5LWNA 3EFLA 4FTUA 5IEYA 2ZM4A 2F2CB 1ZWSA 3E93A 3O2MA 2EVAA 4J8MA 2OXDA 5H9BA 2A2AA 3AGLA 2OJGA 4GU9A 1ZYSA 5TE0A 3G6HA 5EOBA 2ZAZA 4DDIA 5DFPA 3COIA 1KV1A 1G5SA 2XNGA 4RFZA 4UYAA 4XNEA 5AWMA 3G2FA 4G6NA 5IQDA 2IW6A 4ZIMA 1MQBA 3O51A 5AP5A 3VUMA 4UYNA 3HMOA 2BRMA 4BBFA 3BU6A 5EYKA 5LMBA 5CSPA 4IE9A 1GZ8A 4JIAA 5HNGA 4BHNA 2A19B 3GQIA 5FEEA 1TQIA 3AC2A 4JR7A 5FM2A 3W0PA 4NFNA 4GUEA 5HBJA 2W17A 2XUUA 4FTKA 3MS9A 3PJCA 4R7IA 2B52A 3SGCA 4NM3A 1OL1A 2ITNA 1JSVA 4QO9A 4M3QA 3LE6A 3BYUA 2W1HA 4L42A 1VEBA 5AADA 5BV3A 4QQ5A 3U8WA 4N70A 4QP7A 2WQEA 4PTEA 1KOBA 4RFMA 3UYTA 4DEIA 4FSZA 4EORA 2WO6A 1ZYLA 2I0YA 5HCYA 4GH2A 1WVYA 3M42A 4N4SA 2XP2A 1OL7A 4L45A 4EOQA 2UVXA 3PPZA 2UZVA 3SOAA 3JVRA 4HGLA 3LFSA 3UOKA 4OTDA 4AU8A 4EK8A 3U51A 3NFFB 4HCVA 2WFYA 5AP3A 4AWIA 4KBKA 4FICA 2E9NA 4YTHA 3KN6A 3ID6C 3K5VA 5AAFA 2IVUA 2V22A 2CKEA 3MSSA 4NW6A 2R0UA 4RX8A 4BYJA 4P5ZA 3VS4A 2V62A 4QYYA 3RBWA 5CXZA 3OTVA 4MXCA 4EH6A 3UODA 2UZUE 4TY1A 3KGAA 4F09A 4YJPA 1J1BA 2PUPA 2PVNA 5AV1A 4I24A 4AZTA 5E9EA 4BDFA 4O7RA 4XBUA 5FEQA 1OECA 2PVKA 2XK6A 4D0XA 3BELA 1JLUE 2XIXA 3MFTA 5AV0A 4AFJA 3TKHA 5J1VA 3A7IA 5DI1A 4FSUA 2G15A 4DC2A 2QURA 4GS6A 1Z5MA 2UV2A 2YDIA 3F82A 5CZIA 4NYEA 4I92A 5JN2A 3TTJA 1FVTA 3FI8A 3NUAA 2B7AA 3F6XA 4MD8E 4TYEA 4YLKA 4WRSA 3DOGA 3MH3A 2WMUA 5HIDA 2ONLC 2P2IA 5EM6A 5IQIA 5CF4A 4EKLA 2W1CA 2WMRA 4FSNA 4FG8A 3A7HA 4IB3A 4ASZA 4H1JA 1OKYA 2YM4A 2YLFA 4AZSA 4ZXTA 3TDWA 3NAXA 3PXKA 4WRGA 4AZEA 3E3BX 3F88A 4YHFA 5KNJA 5IG1A 3NYOA 1PW2A 5ANJA 3EZRA 1Q99A 2RSVA 2XIRA 3CY2A 3AC1A 3DK6A 4K9YA 4WG4A 2XKDA 2HELA 3ML1A 4K1BA 4DT9A 5AUVA 5LMAA 2UW6A 4CG9A 4E6AA 2GTNA 3R8PA 4FTNA 3PWDA 4DE4A 4IACA 3QTUA 1CTPE 3ZLXA 3F5GA 3VO3A 4ZY6A 3DJ7A 4NIFA 5B2LA 2WMWA 2V7OA 4FEXA 5ETFA 3D2KA 3R21A 2OJIA 4O0WA 4U43A 5L8JA 4O1OA 4PX6A 4QMWA 5FRIA 2HZNA 5K5XA 1H0WA 3V3VA 4MCVA 2WQBA 2VTPA 3TEIA 2IW8A 1BUHA 2CSNA 4FNWA 5HD4A 2VRXA 4ITIA 4J1RA 4AZWA 5JT2A 3DB6A 5EG3A 3W10A 3MGYA 1YHVA 3I0QA 3C1XA 4NH1A 4EC8A 4UMPA 4H05A 3HMNA 4HCUA 5IMXA 3TNPC 5A54A 3T9IA 2WTKC 1MQ4A 3H0ZA 4U7ZA 1YDTE 3R8LA 4AQCA 3C5IA 2I7QA 2PVYA 4X3FA 3IDCA 4ZOGA 4ERWA 3LZBA 5M4IA 3B2TA 4G5JA 3VAPA 1OKZA 4P4CA 3BU3A 4LL0A 3H10A 4ENXA 5HX6A 1P5EA 2J0JA 3FY0A 3I7CA 3LCTA 4TRLA 4E8AA 4EL9A 4GVAA 4O86A 4MD7E 4E26A 3ACJA 1LEWA 3ZM9A 2C6LA 2X8IA 4FNXA 4OTHA 4FL1A 4DGNA 3GBZA 4BCMA 4IEBA 3VHKA 4M97A 4CFUA 3FXZA 4BTJA 3EOCA 3ATSA 4Q9SA 2VX1A 4ZSEA 4BDCA 4BDHA 3TUBA 4FOBA 5CENA 3QRUA 3PLSA 4BVUA 3PYYA 3SG8A 4BCKA 3FLNC 3QCXA 3OW4A 5IQEA 4GK2A 3GC9A 3UDZA 2ITWA 3BYVA 4M68A 2UUEA 4QD6A 4BYIA 4CV9A 3ORTA 3R7UA 3SC1A 3WI6A 1PKDA 4RRVA 3WIGA 4UBAA 5AA9A 3PVGA 4U45A 1OI9A 3LHJA 3RPSA 3CD3A 3R71A 3GFWA 4BCHA 4UN0C 5AJQA 2ETMA 3QC9A 3SV0A 4FZDB 5HICA 3LM0A 5CVFA 5DWRA 4BCQA 5BNJA 4O22A 2GHGA 5HX8A 2GFCA 2C1AA 3I4BA 4DFXE 3HLLA 4FIGA 2PYWA 4NSTA 4FI1A 3RINA 3CEKA 4FTQA 5E1SA 2J5FA 5E8VA 5KKRB 2Z60A 1PMEA 4BWKA 4FUXA 1I44A 1QPDA 4FNZA 4A06A 4E5WA 3D7ZA 3W2PA 5HO8A 5HIEA 4DFZE 4C34A 4GT4A 4IJ9A 1FVVA 3SLSA 2BRBA 2PMIA 3FMJA 4CFVA 3DKFA 3GQLA 3ZO2A 2QKRA 4RIOA 4Y73A 4LOOA 4F4PA 5E7RA 3O8UA 3IW5A 3ZOSA 4CZTA 5CAVA 3BWJA 4ZSJA 3MVHA 4DG3E 1MRUA 3AG9A 4H3QA 4FG9A 4HPUE 4IX3A 4ZEGA 3TI1A 2EXCX 1R1WA 3GU6A 4RJ8A 4U42A 1WMKA 2O5KA 2XJ2A 4QPSA 3DS6A 4ALUA 1H1PA 3D5XA 2WNTA 4G6OA 3PTGA 1Q24A 3MY0A 4YPSA 2WXVA 5BVDA 3R73A 2NRYA 1JSUA 4U3YA 2IVSA 1FOTA 5D9HA 2UW9A 4F1MA 3QQHA 4E93A 4K18A 2EWAA 2VGPA 3HV5A 3TNWA 3T9TA 1H26A 1VR2A 4II5A 3RKBA 5HG5A 2R3PA 3E8EA 2JKMA 3GENA 4ZZOA 4YHJA 5CF6A 4FX3A 3R9DA 4D1SA 2JAVA 2CLQA 3VUIA 1O6KA 5C8MA 4ZY5A 2C68A 3UO6A 4CXAA 3WBLA 3WZDA 1OL6A 3GFEA 4IM3A 4TPTA 3FLWA 2E9VA 4JDJA 2BROA 4FKWA 5CY3A 4UMRA 3K2LA 1OL5A 3THBA 4W4VA 2XEZA 2EB2A 4RJ6A 3RM6A 4KUJA 1LEZA 4FSTA 3GU8A 2A0CX 4EYJA 5J9LA 3KULB 3W0RA 5CI6A 4C35A 4K11A 3FJQE 2X4FA 4C59A 4JQ8A 2WMTA 4U8ZA 3W0MA 3MJ1A 4AE9A 3ORKA 4YHTA 4NL0A 3DDPA 5TO8A 3R1SA 3GU5A 4CCUA 4FV1A 5HU3A 4IADA 3NNXA 1JSTA 4KRCA 3W2QA 3PP0A 4BFMA 3DU8A 5EHOA 1CKIA 2JDVA 4YZBA 4JIKA 4YO4A 3COMA 3KVXA 1TZDA 3SXFA 4U40A 2OJFE 3NNWA 3PPJA 5AFVA 3JPVA 4O2ZA 4FL3A 3D4QA 4UXQA 3LMGA 4QTEA 5A4EA 4L00A 3ORNA 2JAMA 3CQEA 2E9OA 4MF0A 2VX0A 4N6YA 4OBOA 4Y85A 5EYDA 3RNYA 3RI1A 4EJNA 4Z3VA 2HY81 3NRMA 3RGFA 2W4JA 4MK0A 1OVEA 2BKZA 4IVBA 3QQKA 4KB8A 4KS7A 4N6ZA 4OTWA 5EKOA 4FL2A 3S3IA 3FEGA 1OKVA 3H9OA 4ZMFA 2CPKE 4QP4A 5JSMA 4P5QA 3C0HA 3L8XA 3LLAA 1AGWA 3QAME 4ASEA 1J3HA 2WELA 5IDPA 1MRVA 3QTIA 3VBXA 3K5UA 4IB1A 2JBPA 4FEWA 2XM8A 3HMIA 3FMNA 3NLBA 1MRYA 3Q04A 4M15A 3F69A 5KO1A 4IWQA 4MXYA 2BTRA 3GGFA 4FK6A 5CNNA 4USFA 4RPVA 2QOHA 5M44A 4A4XA 5CEPA 3TL8A 1KE9A 3KXZA 3B8RA 3UYSA 4AACA 5M51A 5J5SA 3CPCA 1LPUA 2C5NA 1K9AA 1W2CA 5AEPA 5IA0A 1WZYA 2X6DA 4Y8DA 2XA4A 2DQ7X 1E1VA 5IEVA 3OROA 3IG7A 2VWYA 1WBWA 2VN9A 3DQWA 4PPAA 1I09A 2ZOQA 4A9SA 3ZFYA 3FI4A 5AMNA 4HVIA 1OIYA 4OTFA 2BRNA 4G17A 2OFUA 4DH7A 2CN5A 4Z55A 4YLJA 3QUPA 4E73A 5DR9A 5E8WA 1NXKA 4YBKA 5HE3A 4L9IA 5K3YA 1JWHA 3R6XA 2R2PA 3PDTA 4AN9A 2JIVA 3CKXA 5AIKA 4E4LA 5JMSA 3L9LA 5I9ZA 1ZOGA 3R8MA 4TWOA 4FRFA 2OZAB 3ITZA 5AIRA 4FKLA 3VVHA 4AXDA 2YWPA 3UNZA 2ERKA 5TOZA 4RJ7A 4AW0A 4IMYA 4FTMA 5DN3A 4FKPA 3WYYA 4IZ7A 5EYCA 2HW6A 5AX3A 2GMXA 3QKMA 4BDDA 2WPAA 1LP4A 3A61A 3PY0A 4UB7A 3GCSA 3NZ0A 2WTDA 5ANKA 3BHUA 2PVHA 1OBDA 1Q3DA 1BI8A 3O7LB 4M69B 4MD9E 1J91A 2QU5A 3IW8A 4NWMA 4RX7A