4RJEA

Aerococcus viridans l-lactate oxidase mutant
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
369
structure length
367
Chain Sequence
b'IEYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIGAHGLAHATKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKGDGATAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate oxidase
publication title The Ala95-to-Gly substitution in Aerococcus viridans l-lactate oxidase revisited - structural consequences at the catalytic site and effect on reactivity with O2 and other electron acceptors.
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
total genus 136
structure length 367
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rjeA00
1H5YA 5EA9A 4O4VA 3W23A 2NWSA 4UC5A 3NPUA 3KRZA 4O52A 1W0MA 1R47A 1T99A 3C4UA 4N9EA 1SSGA 2R91A 1KM2A 3PWAA 2ZA1A 4XQ6A 5DN1A 4XKYA 1SZFA 5G2IA 4IUOA 3Q94A 1OABA 3G8EA 5HWNA 5FF2A 3G1HA 4JX5A 3DH7A 3NQ2A 4LC6A 5C6MA 1A5BA 2QDGA 1KM0A 1LBLA 3M43A 1YTEA 1TJRA 2BTMA 3UWUA 3QRHA 5EPDA 3W2NA 4DBDA 4ZL1A 3BW2A 1L6SA 1VC4A 3LHYA 5K4ZA 3PB0A 4D2JA 1KW1A 1RZMA 1FBAA 2WSQA 2QJIA 3MP5A 3NNTA 3DFSA 1GTHA 3MI2A 5C54A 2Z6JA 3DKJA 1OX5A 4K6AA 1S3HA 4LC8A 1LLZA 1EEPA 4DO5A 2ZA3A 1KM3A 3W7EA 4NX0A 2CLIA 3E9AA 5A5WA 4KWWA 2PE4A 3C6CA 4IMDA 2QKFA 3QH2A 3TA6A 3GDKA 4LS0A 1M5WA 4UMCA 5G2WA 2NX1A 2ISWA 3BG3A 1TB3A 1SO6A 2CLMA 3P61A 2YZRA 4LS2A 3W86A 1PL9A 5FF0A 1UBSA 3DU0A 1OG0A 2YDAA 3WJSA 4BI7A 3DFPA 1F5ZA 3MP4A 2G97A 3GKAA 1J5TA 4MFEA 4DEFA 5AC7A 2PRLA 3W73A 4IPJA 1G4PA 3W70A 4HN4A 1H7WA 2C19A 1I45A 1FX6A 4DELA 3LLFA 4IJBA 4JX4A 1KV5A 3TMQA 3UXDA 2FPVA 3KOFA 4LOCA 3W74A 3C2OA 1VH7A 1JCLA 1SU5A 3R8RA 1FCBA 3QQ1A 3S8HA 4CQ9A 1NF7A 2QUVA 1GG1A 3LGEA 3R12A 3W22A 4FNPA 3UWZA 3OIXA 4I9AA 1HUVA 2BLEA 1N7KA 4JTLA 4KWVA 3BLFA 1B4EA 3FIGA 4O0KA 2V82A 4MY1A 4DPQA 4UTWA 1F7BA 1X8FA 3RLUA 3G1DA 3FLUA 2GPTA 5FEWA 1AW5A 3STFA 1F6KA 3S5YA 3VKJA 1VGAA 3W7QA 5I3GA 3STEA 3TKFA 3G3MA 5LNSA 3GDMA 4E38A 3NPVA 4E0CA 3LHTA 4DO6A 3ABRA 3GZ3A 1S5TA 3GLCA 2P1FA 3KAOA 1P5BA 3BW3A 2V9DA 3UPBA 2J27A 3OHIA 4AF0A 1VYSX 3INPA 3DGRA 2CWNA 3NM1A 2KZHA 3M16A 3NQVA 1QWGA 3DHDA 4N9CA 2VXNA 5IBXA 2XN1A 1NEYA 3EEGA 3G0SA 3EWUA 2TSYA 3P80A 1P4CA 2PCQA 2I9EA 1FWSA 1H1YA 3TFXA 4NXKA 3VCRA 4WOQA 3N3MA 4M19A 3S5NA 3IIXA 3P60A 3L2IA 4ALDA 4BI6A 1O5KA 3PBVA 4P2VA 3QPZA 1KTNA 1SW0A 1O4UA 4ZQNA 3LDVA 1S5WA 1JVNA 2OCZA 1SR9A 3GYEA 1K03A 1KFKA 2VENA 3NDOA 5F4XA 1LM1A 3GR8A 1KFCA 1SZGA 3E12A 1TREA 4CNOA 5D32A 5FI8A 3PAJA 4LVDA 1THFD 2YSWA 5BNKA 3HJZA 4O0ZA 1XFBA 1LRTA 2RDWA 4Z1DA 4CNPA 1FWTA 3LV6A 2YXGA 3M5YA 4FB7A 1FUYA 2VFFA 5DXYA 4JYDA 1L2UA 4NXSA 3P81A 2A2IA 3S9YA 4HPJA 2AGKA 4TMCA 3I65A 1KM1A 3L5MA 2CFFA 2VFDA 3C8FA 2FLIA 4K7VA 3NQ6A 3HG2A 4LY8A 4OQVA 3G24A 5H91A 4OV9A 1UUOA 1ADOA 2J9XA 5U7SA 1XBVA 1W3TA 3BG5A 3L0GA 1GPWA 4O10A 1K02A 1PV8A 2JBMA 3PF3A 3LERA 2DZSA 3S1WA 4QQ3A 3BGJA 3SSJA 1XC4A 4MZ1A 3S5OA 3IGUA 3O07A 1SFJA 4UTHA 3R89A 1KLYA 3TQ0A 3IIZA 3C0JA 1M7PA 1VJIA 4NJIA 4EF8A 2Z0IA 3DAQA 1T96A 2QCNA 3FOKA 3A5VA 4GC4A 3NQEA 3Q2DA 3TW7A 3FA5A 2Q3OA 4UXDA 4C1LA 4FHAA 1QDSA 2PURA 4O4WA 2NV1A 4UFKA 5C55A 2WV8A 3F4NA 2BX7A 1W5NA 3LCWA 3UYCA 3MHUA 2VEKA 3DFTA 4JIQA 5TBOA 1VHNA 1OX6A 1GQNA 1TMHA 1H7OA 1IIGA 2C16A 4GNJA 3AO0A 4YMZA 4Z08A 1FCQA 2DZPA 2VOMA 5C5YA 3C61A 1Q6LA 3MJYA 1Z41A 1N8FA 4I7WA 4UFHA 4UTJA 3VNDA 2ZZ5A 1F76A 4QJ1A 3ZR4A 3NL2A 1TPDA 1SZNA 1O60A 3RK8A 4FXSA 2EKCA 3IIOA 1KFBA 3MI6A 4EF9A 3LRLA 3OA3A 2WQPA 1H7RA 4MLJA 4AF0B 4ORIA 1ZCOA 3LTSA 4MVAA 1XKYA 3VFLA 4NVTA 3QEZA 3QMSA 4LS1A 3LHVA 3VE9A 5CZ0A 4QNEA 1L6WA 2Y62A 4UFLA 3TIMA 3U6WA 3W85A 3T55A 4RX0A 2E09A 2IQTA 1YADA 4PL2A 5F2MA 3TH6A 3ATYA 3CTLA 3NGJA 1HO4A 4Z0SA 4ORMA 3K30A 3KVMA 5HQEA 4LTSA 2VEPA 3TU9A 3H53A 5LGXA 4ZQRA 1X7FA 2I1OA 1FCUA 3BVJA 1L9WA 4LU0A 4AWTA 1QAPA 2QCDB 6TIMA 3NG3A 4Y8FA 3BW4A 2GQ8A 2UV8G 2WNZA 3STGA 3L0NA 1JJKA 3G0UA 1KTCA 4O57A 1PHQA 2ATSA 3M0ZA 1KFJA 3SW6A 2R8WA 3B0UX 4WY0A 4GUFA 2F7FA 2JKAA 2V5LA 3PM6A 2VFGA 4PA8A 4TO8A 1MZHA 1AL8A 1ZJIA 2YGYA 1QOQA 2WNNA 3MBFA 1VRDA 3WK1A 1KTBA 5F1UA 1WBJA 5D05A 2OT0A 2A85A 1W54A 1KBJA 5F4WA 3OEXA 2C3ZA 4HSOA 1RR2A 4JD4A 1RD5A 3HGJA 1H50A 5FEXA 5IM51 1X1ZA 4JIPA 3T40A 1OFQA 3PUDA 2J9ZA 4POCA 3MHGA 3S6DA 3RLVA 1ZALA 2Y63A 3SZ8A 1VLIA 2VFHA 3QF0A 4LVGA 4HNTA 3PB2A 3NO5A 5MHBA 1TJPA 4O13A 3LTYA 5D03A 4ZZ9A 5I3IA 2OX1A 3R2GA 3LHUA 2Y70A 3G1AA 4UIOA 4UMAA 1SQ7A 3LX9A 1PCKA 3L9CA 1LBFA 1W31A 3NQAA 1LCOA 2DJXA 3PUEA 3TAKA 1TTIA 5KZMA 3LCXA 3EWWA 2FTPA 3CT7A 3IGSA 2WOQA 4LVAA 5HWMA 3N19B 3TXZA 3KVJA 4QISA 5DLCA 4ZQCA 3BO9A 3W1RA 2YR1A 7TIMA 1HO1A 3TNOA 2H8ZA 1K3UA 3W2KA 1OFBA 3G18A 3EKZA 2NX9A 3D0CA 1LBMA 1DHPA 1R30A 1H7NA 1R2SA 1TPEA 5CPNA 5DY3A 4JTUA 3PSWA 3TAOA 3MYPA 5G4WA 3HPXA 3TROA 1VYPX 5FF4A 3P82A 3CWNA 2G96A 3SR7A 1TO3A 2YYTA 2ZZ2A 3NAVA 4QSHA 5TQLA 3L21A 3W7MA 2ALDA 3FEMA 3CEUA 4K8EA 1YXYA 1A53A 5HULA 3W1XA 3OVRA 4RJEA 3PVFA 3TK7A 3PR2A 4OBTA 3UY7A 3W7OA 3CM4A 2NWRA 3IV3A 1K8YA 5C2XA 3TQKA 1W1ZA 2GUUA 3LCIA 2X2GA 5K9DA 3CIXA 1TPUA 3P7YA 5HINA 4C1KA 3CLMA 1GVOA 4FF7A 5LNUA 1AMKA 2Y85A 2QCCA 1EP1A 1A50A 2A7NA 1I8JA 1LYXA 1TTQA 3ZWSA 3MHFA 2JKPA 1NVMA 4IXXA 1QPRA 4AEOA 4IX0A 4ONVA 2FB3A 4WJEA 1Z48A 1W8SA 1VCFA 2EF9A 5DELA 1P0KA 4BI5A 4R7JA 2QAFA 3TV8A 2C6QA 1DBTA 4JYFA 3LXCA 3W7HA 1EPXA 4Y96A 3LB0A 4FNRA 1W5PA 4Z1CA 5E0KA 3DFQA 3PG9A 1S5VA 1LP6A 5K9CA 4TU1A 1FQ0A 3HGRA 1V7YA 2H3DA 3H54A 4UCGA 1ZAJA 4K39A 2J9YA 2HS8A 2ISVA 3QW3A 2G5WA 4DQWA 3I7SA 4MLRA 3P62A 3G3DA 2E1DA 2VFIA 1K8ZA 3DI0A 3E96A 3WJYA 4IMCA 1VZWA 4UFIA 5KTLA 3P8IA 3IVTA 1LOSA 4O53A 5E93A 1OF8A 4UTKA 5CKSA 2NXGA 2PRHA 4G1KA 3W7JA 3LHZA 2QCGA 3P5ZA 5DY2A 2CLHA 1H1ZA 1IIHA 5EBUA 4AWUA 5CZTA 1TPWA 4NNAA 2DZUA 4NJGA 4KFOA 3T7VA 2Q8LA 5LZLA 2A21A 3OVPA 3NQCA 1FDJA 1VCVA 5L6UA 1TIMA 4BFAA 2O7QA 3O16A 4P61A 6ALDA 4Y9AA 4HIBA 3IIVA 2Y88A 5U4NA 1EUNA 1MEWA 2DJLA 5D04C 3L0KA 3QYQA 1I2PA 1WDWA 3KXQA 3LLDA 3LRKA 2ZZ1A 2A4AA 3B04A 3OG3A 3TUUA 3HG5A 2ATMA 1AL7A 3LOTA 2V8ZA 4FNUA 5HUPA 2JK2A 5T26A 1TV5A 2VEIA 4UTTC 3FS2A 3W1TA 4AB4A 3O6DA 4DF2A 4JY9A 5HNRA 4AAJA 3P84A 3GNDA 3W83A 4GUJA 1Q3NA 5AHEA 5SWUA 1H62A 3L66A 2VC6A 3P8JA 3CQ0A 4RV8A 3CB8A 2ZDRA 1ZHAA 2J24A 2ISSA 3I6RA 1SUXA 1UJPA 4H6KA 3B8DA 4WX2A 2Y89A 8TIMA 4UMBA 3G0XA 3W84A 1RVGA 1KFEA 1G4EA 2YW4A 2YX0A 5CPLA 3T4CA 1XM3A 3FFSA 2FPYA 1GG0A 4AH7A 3SIZA 2Z2UA 1AK5A 2TRSA 3W7KA 1GVSA 3W2JA 4YXGA 2C18A 2EHHA 1HG3A 3QC3A 4XBSA 1TPVA 3O05A 4DPPA 1P0NA 2EAWA 1VYRA 3SY5A 1YDNA 3NA8A 3CU2A 4JR5A 1G7VA 4Q32A 2CW6A 2HS6A 3THQA 3QQ0A 2QF7A 1G6CA 5KSWA 3P74A 3LTPA 5EL1A 4S1FA 2YYUA 3W07A 1G67A 3G8RA 3N14A 4EVZA 1JUBA 2CLOA 4M5PA 3DZ1A 1GZGA 2ZRXA 2Y7EA 3OBKA 2ZA2A 3HOJA 4LRTA 5LGZA 3CIWA 3R5EA 4XKYB 1X1OA 3G1VA 4BK9A 4UTMA 2G95A 2CZDA 4IXHA 3MMTA 2B7PA 1GYLA 3L67A 1ZFJA 3EXSA 2ABBA 4TMBA 3QSTA 1KBIA 5AHMA 4UR8A 3MUXA 2EGZA 4LV9A 2NX3A 1FWWA 2QAPA 2Y6ZA 1FWRA 3P67A 2BSLA 4WQ6A 1NAL1 4LW7A 1TTJA 2V81A 4O15A 4O16A 2GJLA 2B7QA 1X6UA 1B3OA 1HTIA 1JQXA 4FX6M 4QNWA 4A21A 4CCDA 3W7NA 3TW6A 3C2FA 1GWJA 4BWLC 1YXDA 1OYBA 4Z1BA 4W9TA 4LNYA 1BWKA 4U28A 3EB2A 4MYAA 3ZWTA 1LLWA 1H60A 4JDBA 4IGHA 1SPQA 5D2WA 2QUTA 3M6YA 2ZQ0A 3B05A 4UNKA 1TPC1 5CZSA 5F2IA 3EWXA 1YTKA 4EWND 3NR0A 3W2MA 1PE1A 1TRDA 3NQ8A 1JR1A 3EX2A 4N6EA 3NL3A 1C29A 4FX7A 1BWLA 1LOLA 5LNVA 1I2NA 3FJLA 1Y0EA 3TFCA 3S42A 1DQXA 5TIMA 5F1VA 3NL6A 3NQFA 2ZRVA 3GAKA 3KRSA 2WNQA 5EMUA 4IOTA 5DBUA 2QDHA 4NZFA 2VEMA 2Y61A 4M6PA 1OYAA 4UFJA 4DBEA 5AHLA 1EA0A 1SSDA 4NJKA 3C2RA 2CLLA 4CQAA 1Q45A 1R2TA 4N9BA 2DZVA 3S0CA 4OWGA 3DBPA 4RR4A 1TPB1 4U4MA 4HNVA 4JTTA 1JCJA 2QR6A 4O14A 2CLEA 1LROA 3LXBA 1K8XA 3R13A 3PS7A 4IWWA 1WBHA 3TDFA 3G1XA 2CZEA 5CG7A 5L9FA 4LVFA 4MOZA 5LKYA 3NZRA 1GVFA 1MO0A 3A22A 3GIYA 4JY8A 1FY6A 4UTIA 1YYAA 3TC7A 1HL2A 3UPWA 2C15A 2TPSA 3H55A 1OFOA 3GVGA 1ZY9A 3KRUA 3WK0A 1OVDA 1VR6A 5D2YA 2QCFA 3IRDA 2V2HA 3HG3A 2WKJA 3W7PA 2A1YA 4MFDA 3VE7A 4LVBA 3M9YA 4M6QA 4ML9A 3SFKA 2QJHA 1YPFA 1RV8A 3IIPA 1FXQA 1LORA 4HSNA 2FPTA 1KV8A 1TV8A 3TR2A 1JUKA 1QMLA 2DZXA 1EUAA 4MIMA 3EX3A 4O17A 5AYYA 1XBZA 2A7PA 1W5QA 4HT3A 4NZJA 3TJLA 3V75A 1TV7A 4WZHA 2NV2A 4N9DA 3PY2A 5G5IA 3HGOA 4ZMGA 1ZNNA 2H6RA 2LLEA 3FYPA 3SGUA 4H3DA 4QIUA 1XUUA 4FNTA 3L5AA 2B7OA 3B4UA 5EYWA 1EWDA 5FEPA 2DZWA 1OX4A 3W87A 3HIJA 1JCMP 3RU6A 1SO5A 4FEZA 3IGXA 1V5XA 2VELA 4MJMA 4GFSA 4CCEA 3ZS4A 1ICPA 1CX9A 4E2BA 4OGZA 2FJKA 3M5VA 3G1YA 1OFEA 1LRNA 3W2UA 3ANYA 1K7XA 4K7YA 5AOUA 3N9RA 4XBKA 1VLWA 3DXIA 3UXAA 5AC8A 5CSRA 2Z1BA 3O8AA 2W79A 4NX5A 4YL2A 1UASA 1I2QA 3LI0A 5D2TA 1H61A 3TSBA 2GJNA 3LXAA 1GVRA 1SW7A 2YFNA 1LTDA 3QJAA 3W7LA 2XFWA 1QOPA 4H4IA 1U83A 3TXVA 5LNRA 3EX1A 1TSIA 4CQ8A 4XTDA 4JXCA 4FIQA 4LUJA 2ZZ4A 2W0UA 1D3HA 2GVGA 1DKWA 3A24A 4J9JA 1OFRA 4L4LA 1C8VA 1C9DA 3IVSA 4KFNA 2W6RA 2JKEA 3QSRA 3DHFA 5KMYA 3M41A 2HMCA 1OYCA 3G22A 1YDVA 3GXPA 2P10A 3M44A 3Q37A 4O8RA 3M7WA 2V2DA 3SJ3A 5FEZA 3W7IA 1F05A 1W3NA 2AQWA 4A22A 4O1BA 5FF3A 3SI9A 4JGDA 1WV2A 1ZAHA 1OHLA 2RHGA 4O12A 4O28A 4O54A 4RKAA 1AW2A 1TTPA 4RXGA 1QO5A 1W37A 4RCXA 3U2OA 2X1UA 4RXFA 1F2JA 1F74A 3HPSA 3NPXA 2ZFAA 1QFEA 4HNNA 3W1UA 5I3HA 4RZ5A 1DJNA 1GOXA 3IVUA 3SECA 4NQ1A 1MEIA 3C3NA 3F4WA 3UNDA 4UTTA 1ME9A 5A8GA 1Q6RA 4NT0A 2C14A 1SW3A 1VHCA 3YPIA 4I7UA 5F2LA 2A6NA 5CPMA 5HR7A 4NUWA 1NF0A 1W3IA 2E68A 3STCA 1F73A 1YXCA 5GVJA 4X22A 3LBCA 5I3JA 3NQ7A 1ME7A 1YDOA 1G69A 3M47A 4UFMA 4N4PA 4R53A 5CSSA 4UNLA 5BMWA 4MY9A 1VS1A 1O94A 1WX0A 2A6LA 1WXJA 1IGSA 4K36A 1I4NA 4XZ9A 5D09A 2X1TA 1DJQA 4MZ8A 2E5BA 1OF6A 4M7TA 4N4QA 1JCNA 4N02A 5E1QA 3ABQA 4HHPA 3CEPA 1TPFA 3LCGA 3PUOA 4B5NA 4NJHA 5HJLA 4XWUA 2ZCGA 4S2CA 4K38A 1GEQA 4WY0B 5J5DA 3I7QA 3E49A 3KFTA 1AG1O 1ZENA 4AXKA 2CLKA 2Y7GA 5LHFA 1K7FA 2X1RA 3LM7A 3WJXA 5AFDA 3MO7A 3T44A 3GXNA 3W7CA 4WUIA 2FIQA 2NLIA 1TQJA 3G1FA 3W6YA 1EB3A 2RH9A 1MSSA 1W56A 2ZTKA 3BG9A 2V5BA 2YPIA 3ABOA 3QM3A 4Z0JA 4N6FA 1GT8A 1EP2A 3TQVA 4AHQA 5I3FA 1QCWA 2Y7FA 4O1CA 1P1XA 4PODA 1J2WA 5HUOA 5HWJA 1F6PA 3WFAA 2CU0A 4TIMA 1CW2A 3W1PA 4GXMA 5DXXA 4DF1A 4BWLA 4JTGA 4RK8A 1L6YA 4IPIA 3L5LA 4S2BA 5KITA 4OV4A 1KM6A 4TX9A 2X30A 1EP3A 5EKYA 1OK4A 3NQDA 1JRCA 3MYOA 2GQ9A 4A29A 4AHPA 5D30A 2X1SA 3GKFA 1FDYA 3EWZA 1D3GA 3A5FA 1PHWA 2DP3A 3NM3A 3HG4A 2J6XA 3W88A 2OZ0A 1G4SA 2P0OA 1TPH1 3P5YA 3CPRA 4PC8A 5BW6A 3QZEA 4JTSA 3HBLA 1ZAIA 2QCMA 3GDRA 3MWAA 1GVQA 4TR9A 5G4EA 1VCGA 4Y6GA 3UY8A 4NNBA 3W7DA 4PEKA 3ELFA 1H63A 3RMJA 3M5XA 2OT1A 4HPXA 3JRKA 3WK3A 3KX6A 1RQBA 3NVTA 2V0TA 3O06A 1OFDA 3MP3A 4MY8A 2ZRZA 1NSJA 1YPIA 3N34A 3ATZA 3B06A 1GJPA 4GWEA 3WK2A 3W7GA 4OU1A 5CGQA 3WJWA 4EIVA 2D73A 4ZQMA 3PSVA 5CPOA 3NL5A 4ZQPA 3N73A 4RZ6A 5K7JA 2DORA 3GR7A 4FX8A 3BK0A 2WSYA 2A5HA 1TCDA 1ICSA 5KZEA 4NNCA 3TJXA 3PBUA 4JYEA 5AYXA 2E6YA 5AHIA 2ZZ3A 3UZ5A 3VI2A 4JTJA 3TCEA 1YTDA 5K4XA 3NOEA 4MPQA 4WOZA 4JTEA 5FF7A 4E2DA 1LRQA 3Q58A 4LWWA 2ZRUA 3BGGA 4YCOA 1FWNA 2WO5A 5AB3A 4YWIA 4GUGA 1XBXA 1OJXA 1ONRA 3W1QA 2JGYA 1BTMA 3LHWA 3A9IA 1RQHA 3FJ6A 3N2MA 5BMXA 1KM5A 3B0PA 4PL1A 1YLVA 4MJZA 2PRMA 3NQGA 5DCBA 3KVLA 3S1XA 4QM1A 4M6VA 3THAA 3MBDA 2QUUA 4O1AA 4LT9A 1A5SA 3OVQA 1DQWA 4ADTA 3TMLA 4BR1A 3GDTA 1WYIA 2CLFA 3TE9A 3KHJA 3W1MA 3A23A 4IMEA 4MKNA 1RPXA 3JR2A 1OFPA 2RFGA 4Q4KA 1RQEA 3PG8A 3M5ZA 5HMSA 1TRIA 2GVJA 3BPWA 4AHOA 3BLIA 4JEQA 5DCDA 2ZZ7A 2ZBTA 2C0AA 3LCLA 4XUGA 3DFOA 2Q8ZA 4LV4A 2ZYFA 5G1TA 2DU2A 4PH6A 3E02A 1O5XA 2YCEA 3G1SA 1H7XA 1Z44A 1ALDA 3W72A 1B57A 1IXOA 4A2RA 4MYXA 2FB2A 1R46A 3DI1A 3NYZA 2ABAA 2QCDA 2QCLA 3BV4A 3TC6A 4CLMA 3L68A 1Z42A 5BRBA 3GXTA 2ZZ6A 4ICNA 1Q6OA 4OE7A 5I3KA 3RNDA 5LSMA 5AHFA 3TX9A 1MXSA 2R94A 3QMTA 1UUMA 1QPQA 1QO2A 2OJPA 1GYNA 3PBYA 2B7NA 1MEHA 4Y90A 3O63A 2NUXA 1W5MA 1FCVA 2XN0A 2NZLA 5AHNA 3LV5A 1EIXA 5D37A 1XL9A 4UR7A 2VKZG 2R14A 2GVLA 1ICQA 2H8XA 5D2XA 2ZRWA 5KINA 1OFAA 2AAMA 2RDTA 3GAYA 3L65A 3HQ1A 1JUEA 1XDLA 5F2GA 2E6AA 1M7OA 5D38A 2Y7DA 2V30A 2TMDA 4IX2A 3GNNA 2WPBA 3LI1A 1I2RA 4IMGA 3CC1A 4JTKA 2E5CA 2B4GA 3TSDA 1WAUA 2V2CA 5EY5A 1J4EA 1HFBA 3EXRA 3B03A 4WD0A 2BXVA 5ABTA 2HSAA 5D02A 3FYOA 3W76A 4ZVJA 2FDSA 2B0MA 1B9BA 4JTHA 1QPNA 3W3OA 4R34A 2X16A 5DCEA 3NEVA 4UTWC 2F84A 3M1ZA 3FKRA 5K2ZA 1WA3A 3W9ZA 3QW4B 2O7SA 1LDCA 3EWBX 3LBMA 4FNQA 1JCXA 4PTNA 3U8GA 3UWYA 2J88A 1XXXA 1SO4A 4X2RA 4OT7A 3B0VC 2QEZA 2C13A 1KA9F 2A0NA 4GE8A 3ABSA 5K3VA 3UWQA 1KM4A 3IEBA 3NZ1A 4AMAA 1DV7A 4EOUA 3HGSA 1G4TA 4AVFA 1CI1A 2Z6IA 3RF9A 1U5JA 2Q3RA 1D9EA 3DKLA 3DFNA 5D33A 1EX5A 3QPYA 4JNMA 4JTFA 4PCFA 5IBXC 1I2OA 1IXQA 3MI3A 4AWSA 1XDMA 1IF2A 2BZNA 3LRMA 3HPZA 4N2YA 3HMJG 1M6JA 4DO4A 3W1LA 2OMAA 3O6YX 5G1YA 4JX6A 4JDYA 1KFLA 4JS3A 3C2VA 1SFLA 3UD6A 3O15A 4IQLA 5DBTA 4O11A 3O1NA 1QR7A 3EKLA 3LCFA 4ADSA 2TYSA 5LHEA 4ZQOA 1R2RA 5D2VA 2NUWA 3PBWA 4FO4A 1NFBA 1XBYA 1IXNA 4KFPA 1PIIA 3WJZA 1XCFA 4GUHA 3N9SA 3I68A 2E5DA 3USBA 1DORA 1JULA 3BARA 4NJJA 1T8XA 3AJXA 4WXYA 4UTUA 1FXPA 3FKKA 2GQAA 4QITA 2JGQA 3BLEA 1PS9A 3EXTA 4JTIA 3V1PA 3KVKA 4FNSA 1VQTA 1KLZA 1WOAA 3S1VA 1JRBA 3W1AA 3GK0A 2QCEA 4LUIA 3LCHA 3PC0A 4HNUA 3C2EA 4OHQA 3QFEA 3NQMA 2NXIA 3DENA 1G7UA 1T0OA 2YW3A 3C56A 5FESA 2RKXA 4FXRA 1IXPA 1UCWA 4JICA 4Z1AA 3RFAA 2ZRYA 4MUZA 2RDUA 2NUYA 4I7VA 2QJGA 4DXVA 3HB9A 4X9SA 3S1UA 4QAIA 3GB6A 4XTIA 1BKSA 1ML1A 5F4SA 4LRSA 1LZOA 2H3BA 5AYZA 5H2ZA 1K7EA 1LOQA 1DL3A 3T78A 2CZFA 1FDZA 5J5RA 1OK6A 4O19A 1SO3A 4WY0F 4CNNA 3C52A 1WQ5A 1ME8A 4O18A 4UTLA 1DVJA 1B4KA 1W5OA 2BWGA 5KZDA 4DF0A 3GDLA 1E51A 5HR6A 1O95A 4Q33A 1EWEA 1A5CA 3UZJA 3W75A 4ADUA 4IMFA 4R33A 1TYGA 4YCPA 3CHVA 2EPHA 4K8HA 1QNVA 2E6FA 2HTMA 5LNWA 1JQVA 3EWYA 3GX9A 2FQIA 3EX6A 4FIRA 3CWOX 4GBUA 2WJZA 3JS3A 4JN6A 3I7RA 1WOBA 4MZYA 4RLIA 4RZ4A 3UWVA 4CCCA 1GTEA 4M7SA 4HKPA 1BEUA 5AN7A 1XUZA 2YFOA 4A2SA 3UQNA 3F1QA 4GJ1A 2XN2A 3W7RA 4BF9A 1QPOA 4GUIA 2FFCA 4PFMA 3W1NA 1DOSA 3W71A 3SGZA 4WXZA 2CZ5A 2I14A 5CZJA 2H90A 1UB3A 3PULA 1XI3A 4GRSA 2QCHA 3A21A 3W2LA 4YLWA 1VPXA 4KKXA 4X3ZA 5K9XA 2VFEA 3S5ZA 2DZTA 3NPWA 1H51A 3UWWA 4A3UA 3F03K 4O1DA 1A5AA 1JCYA 1OX4B 1SZEA 2ZTJA 2C1HA 1H7PA 2PC4A 2NXHA 5BOOA 3QMRA 2GOUA 3ZFHA 3HO8A 3E0IA 3EX4A 1N55A 3MW7A 1TQXA 1PVNA 3O6CA 3NXFA 2A7RA 4L4MA 2WSRA 5G2HA 3TSMA 1PCWA 4K37A 2E6DA 5AC6A 3HF3A 3N2XA 1AW1A 4NU7A 4O50A 1Q6QA 4UUIA 2E77A
chains in the Genus database with same CATH superfamily
2YBTA 1A4MA 1FWBC 2BXYA 1TVLA 3VMNA 2J77A 3W23A 2NWSA 3M4HA 3NPUA 3THUA 1DWHM 4O52A 3IJ7A 1XLDA 1XV8A 1KQYA 3B97A 2CESA 2ONEA 1MW0A 3GR4A 4JIEA 2VI0A 3CGTA 4IUOA 2OQHA 3G1HA 1QVBA 1US0A 4MUPA 4LFYA 1E6NA 3EDDA 3AI0A 1BHGA 1YTEA 4HMEA 1R6WA 2V69A 1EF3A 2R1PA 4D2JA 1RZMA 1FBAA 4PCPA 3DFSA 3DKJA 2ON3A 3NVDA 1XIEA 4DO5A 1KM3A 4KWWA 2YCJA 1UQYA 4FS9A 3NYDA 3QH2A 3TA6A 3M46A 5G2WA 2NX1A 2ISWA 1BYBA 1P6CA 2YZRA 4LS2A 1PL9A 5IDZA 4AD5A 8A3HA 1UBSA 5IRPA 3S6TA 1V51A 3RXZA 2WCAA 3WF0A 3WJSA 4ZFMA 3CH9A 4BI7A 3S6OA 1S2TA 3DHUA 4DUVA 4MFEA 4DEFA 2J7BA 2A3LA 2PRLA 3W73A 4IPJA 1G4PA 4ATLA 2FPVA 1QOXA 3C2OA 1YE4A 1TE1A 4CNUA 1JCLA 1BYDA 3R8RA 4WDWA 4A05A 3S8HA 1UPMB 3N18A 4XV0A 1ISWA 4FOKA 3T0BA 3RR1A 3R12A 2OR2A 1XD0A 2BLEA 1LJYA 3CZ8A 4KWVA 2BY1A 2QYGA 4NRSA 1B4EA 3FIGA 4EPKA 2GLKA 4O0KA 1TWZA 4MY1A 4DPQA 1RBOB 1X8FA 2W27A 3G1DA 2GPTA 4J3ZA 3STFA 2PWEA 1F6KA 1VGAA 2V5KA 3W7QA 5I3GA 1E9YB 2VUNA 2B81A 3HU7A 2GSEA 3LLXA 1T41A 3ABRA 2CBJA 3N4FA 1S5TA 1P5BA 3OTRA 3AISA 2V9DA 6ENLA 3QC0A 3OHIA 2PGWA 2DVTA 3KP0A 3NM1A 4NAEB 3VINA 2ZKMX 4AD2A 2V3GA 3DHDA 5RUBA 2VXNA 3WD4A 1W2VA 3JW7A 3EWUA 2TSYA 3REQA 1FWSA 2J8TA 4HNOA 2FVLA 1EYWA 1GGOA 1S3TC 2CBIA 3P60A 1O5KA 1C7TA 3CUGA 1B3WA 1JVNA 3FGCA 2OCZA 3R0DA 1MFUA 1SR9A 3GYEA 2O92A 3NDOA 2J7DA 5T91A 3S4TA 1D7KA 1LM1A 4GNKB 1YX1A 1SZGA 3E12A 5FKYA 1TREA 3BOFA 1W8GA 4CNOA 4IG2A 1UH2A 3GC2A 3QY6A 4M6UA 2XGZA 4DJDA 3KZPA 1ZZMA 2W3ZA 3GZAA 4B2DD 1HGYA 3LV6A 4C6FA 3GUWA 3IUHA 3MMUA 3BLDA 4JYDA 3N29A 4HNLA 1XH2A 2ICSA 1WNOA 4J4KA 3UP8A 1CT5A 4XZNX 1V6YA 3AMLA 3WLPA 2VCCA 1IEIA 4K7VA 5I6SA 4RW3A 2VR2A 4HP5A 1FHDA 5TAOA 1ZP4A 3ALGA 2J9XA 5U7SA 2PP1A 2VP8A 1Y65A 2POTA 1PV8A 5AZ0A 3VUSA 4K2SA 3S1WA 3VNLA 4MZ1A 4ZO8A 4QLJA 3IGUA 4GVHA 1SFJA 3R6IA 2WBGA 3C0JA 4F0SA 4XO6A 1R9YA 4EF8A 3DAQA 3AIEA 3A5VA 3Q2DA 3C5QA 3FA5A 4UXDA 4C1LA 4HA3A 2JF7A 1QDSA 4BEQA 4UFKA 5C55A 2QULA 1W5NA 3UYCA 2HXUA 3VDHA 5GQBA 5TBOA 5DQPA 3VOFA 1DJIA 1GQNA 1H7OA 3GQYA 2XTKA 4HMNA 4M56A 1FCQA 2VOMA 3GG0A 1WB0A 4UFHA 2C1IA 3L4VA 3RHGA 3H4GA 3ZR4A 1F3XA 5HA7A 5H8MA 1SMAA 4PFHA 3IIOA 1WP6A 5HXMA 3LRLA 3CMFA 3H7UA 3OW1A 1O1ZA 4GC3A 1ZCOA 5CJ5A 3OBAA 3RRAA 3QMSA 3AMDA 4L64A 3VE9A 1S2VA 2E40A 4QNEA 3OU8A 3TIMA 1EGVA 2PDIA 5FJTA 3VIOA 1A47A 2E09A 2IQTA 1WZKA 1J01A 3NGJA 4PUNA 4EKJA 4LBRA 4WHBA 1HJVA 3VKCA 4PMDA 1V93A 3H53A 5DT7A 1NELA 2I1OA 3STPA 1LQ2A 1RY0A 2QMJA 3BVJA 3VUPA 1L9WA 1RVKA 3RGTA 4IHCA 3W81A 2FGLA 3NG3A 3VU2A 3BW4A 4V15A 2WNZA 1JJKA 5IFPA 3IJ9A 2ATSA 2I5IA 3CPUA 2V3FA 3M0ZA 3UF9A 3WF3A 2DT2A 1KFJA 3B0UX 4NZ5A 4WY0A 3ES8A 1JEZA 2F7FA 3V35A 1OCJA 2YGYA 3UG3A 3T08A 5JVLA 4HVXA 1F3TA 2QQ6A 1CXIA 4AZHA 3VGHA 4PUJA 4NL1A 1RD5A 2WJDA 1H50A 5FEXA 2CBVA 1E0WA 5I00A 3ITGA 4L56A 1OFQA 1DJHA 2G3IA 1UR8A 4NKCA 1ZBCA 4H9UA 2Y63A 1IWPA 4YYFA 1KCXA 5MHBA 2PDHA 1EDTA 1TJPA 1RY8A 2PPGA 5LIWX 5D03A 3KDNA 4ZZ9A 2EXOA 1EZ2A 4UIOA 4UMAA 3SFWA 5IHRA 1RLDA 3LX9A 4JTAA 1YPXA 3WQ4A 3LCXA 5HOSA 3EWWA 5HWMA 3B0XA 4C7DA 1TUXA 3KVJA 4OOUA 5DLCA 2PUZA 2V67A 2QGYA 1HO1A 2INEA 3G18A 1I6NA 2G0WA 4J5NA 4Z2LA 2XGIA 5AYIA 2PC8A 1K9TA 1R2SA 4JQ1A 4IISA 2OWCA 1HX0A 5CPNA 4Z1YA 4JTUA 2CIPA 3TROA 1KXQA 1EGMA 3IACA 1TO3A 5BCAA 3K1DA 3L21A 1CZ1A 4A3HA 4XZMX 2VJXA 1LL7A 1Z9AA 4K8EA 1N82A 3T0TA 3CHCA 5HULA 2ZUVA 3OVRA 4RJEA 3B3DA 4TVUA 2NWRA 1VFTA 3F5LA 2X05A 3LMYA 2GUUA 3TYCA 4CD8A 1TPUA 3WIJA 3S47A 5C0QA 3ZWSA 3MHFA 2JKPA 4F0KA 4ONVA 3U57A 5I78A 4QLKA 3RCYA 4KPLA 2EF9A 2QAFA 2C6QA 2FMNA 1Q85A 4GA8A 4AIBA 3W7HA 4IL0A 4PMUA 5CLWA 1W32A 2C0HA 3N4EA 4HPNA 1LP6A 1GOMA 3SQMA 3H54A 4HZMA 4F2BA 4JHZA 4K39A 2HCVA 3LM3A 3FN9A 1UR0A 1VEOA 2G5WA 4DQWA 3L7RA 4RNHA 2DQWA 1E1FA 4LEFA 5ECUA 5E09A 2VFIA 4V27A 1M1BA 1F3WA 3W02A 4EX4A 3D46A 3V0TA 3QGVA 2NXGA 4PUDA 3WY1A 4Z2KA 2QCGA 3CBWA 3O6AA 1JXKA 2CLHA 1XYLA 4GNVA 4NJGA 3N25A 3AAMA 3B9DA 1MQRA 3OVPA 1SJAA 4ZO6A 3UG8A 5L6UA 1EHAA 1TIMA 2XIBA 1EXPA 4IGMA 1KB3A 5U4NA 2JEPA 5D04C 5JIWA 3WLIA 3SCVA 3HURA 3L0KA 3QYQA 3QLLA 4IFKB 4WK9A 4GQ0A 1MW3A 3LUTA 3PAOA 3UA3A 3LOTA 4D6JA 2WCSA 4UTTC 1R38A 3DX5A 3PJWA 2PEVA 1GQJA 4JY9A 3USZA 4C6IA 4GUJA 1XGEA 4CEUC 3P8JA 3CQ0A 3Q67A 3GIPA 2AQOA 3VIFA 3LMZA 1Q63A 3MANA 3SCUA 3H70A 2J24A 3B4YA 2I9UA 2WLYA 1XG4A 2XUCA 1PIFA 3CB3A 1SUXA 2HVNA 2PWDA 1JDDA 1XIJA 4WX2A 1FWEC 2Y89A 4C6NA 4IIEA 1V0KA 1YNQA 1RVGA 2YX0A 2ZVIA 1XM3A 2FPYA 1GG0A 4AH7A 3SIZA 3DCPA 1AK5A 2TRSA 4W87A 1GVEA 3LS9A 4CEXC 1O68A 4YXGA 1E5NA 1HG3A 4XBSA 4AD1A 1VYRA 1AQHA 3K4WA 2UY4A 4Q32A 1E6ZA 2OOFA 3QQ0A 1WUEA 2OB3A 4C5ZA 2YYUA 3W07A 4EVZA 4CD4A 2CLOA 1A3WA 3DZ1A 1LLOA 1GZGA 3LPOA 3OBKA 1GUVA 4Q8UA 3CMJA 3CIWA 3R5EA 2FTWA 2WMIB 1X1OA 2EKGA 4LB3A 1NWRA 1QT1A 4W85A 3TA9A 1FHVA 2B7PA 3L67A 4TMBA 3QSTA 1V8EA 2NX3A 1FWWA 1Q7QA 4AEFA 2TAAA 2DV0A 1FWRA 4A8NA 3WQGA 4O15A 3SEPA 2JIWA 3FSTA 4LUSA 2GJLA 1JQXA 1HTIA 4J1OA 5M03A 4A21A 5A8NA 3W7NA 2BY2A 3FCPA 1U5VA 4LNYA 1BWKA 4IFOA 1XIIA 3FVDA 4IJCA 4MYAA 4JDBA 3MPGA 1LWJA 1H1NA 2WK2A 1UR1A 5MF5A 3B05A 4UNKA 1CGYA 4U2ZA 3IJ8A 4W8LA 3NR0A 4GI4A 3W2MA 1TRDA 1LOLA 2DIJA 1Q6CA 1I2NA 3UXKA 4L4PA 5F1VA 3LBOA 3NQFA 2ZRVA 3PZTA 3GAKA 5EMUA 4KT2A 5CC6A 1IWBA 5HPOA 2Y61A 3GNPA 4Q4QA 1CECA 4DRSA 4H6RA 1SSDA 4GQRA 1TWWA 3RRXA 3DBPA 4U4MA 2WWDA 4JL1A 2A3BA 3UW6A 3UA4A 1K8XA 2X2YA 2VGFA 3EKGA 3G1XA 4UQDA 4YNGA 5A6JA 4LVFA 3R94A 5LKYA 1JZ4A 1EJRC 1ZBKA 3MZNA 1A5UA 1H11A 2C15A 5A8MA 4EAYA 1W1IE 2GGIA 1XLEA 5D2YA 4Q7BA 3U7BA 3AYVA 2D23A 4RPPA 3MUCA 3WFLA 1QHPA 3HG3A 1DWJM 5HAOA 2P76A 3M9YA 4ML9A 4PZVA 4X63A 3F5KA 2NQZA 3SFKA 1W9XA 2BVYA 3W29A 5REQA 1FXQA 2QLYA 1V6VA 2XVPA 4JKMA 4QDMA 3MA8A 1KV8A 1TV8A 3TR2A 2DZXA 2DDXA 1EUAA 1WCGA 2J7HA 4L6OA 5HBFA 1H0IA 4L9ZA 1J12A 1W5QA 3FNDA 3TJLA 4GKTA 3REQB 4KH2A 3AXIA 1PDZA 4UWMA 3PY2A 3LN3A 5G5IA 3HGOA 3KL0A 2H6RA 3RLHA 2OYMA 2Z2AA 3VNMA 3VKBA 2NVAA 3W87A 1Z32X 3RU6A 4IG2B 1E3XA 3SO7A 2WVUA 1YBQA 2OODA 3L4ZA 3AIRA 5M1TA 3JU2A 4Q6JA 1RCQA 1EBHA 3UWEA 5JQ9A 4QX4A 5AOUA 1XLBA 3N9RA 5HJYA 4JKLA 4XBKA 1XX1A 5AC8A 1EJWC 2Z1BA 3MUAA 1E40A 3VAVA 1XCXA 1UASA 5D2TA 1HKMA 4CQCA 4TQTA 1MFVA 4UOQA 5LNRA 3KDOA 2PD9A 4JXCA 3CNYA 4U31A 1B3ZA 2ZZ4A 2W0UA 2GVGA 3A24A 4IUGA 1IGWA 1YNPA 2W6RA 3UR5A 1EL3A 3EMQA 1ZJBA 4DI8A 2HMCA 1OYCA 3G22A 5H8PA 3Q37A 1F9CA 5A6LA 3I4EA 4LY4A 3WNLA 1F05A 4QAWA 4O1BA 1QRQA 3SRHA 1DP0A 1PX8A 1ZPTA 2VL4A 3RCNA 4O28A 3KBWA 4QQUA 3MO4A 1PWLA 5JBFA 6CGTA 2BASA 5DRCA 3PZQA 1F2JA 1JXJA 4L7ZA 1OINA 3VIMA 4AIEA 2E9MA 1QFEA 4IIBA 4Q8PA 3CQIA 4J3TA 3W1UA 5I3HA 2EPOA 2E1WA 1VKFA 3IVUA 3C3NA 4W89A 3F4WA 1XKJA 3UNDA 4B5XA 4QGCA 1J96A 1ME9A 1Q6RA 2C14A 5FA5A 1G94A 5FJRA 5HR7A 3BH4A 3MB9A 5A8QA 1YXCA 3VYLA 1E4IA 4Z2JA 2VTFA 3OODA 3GTHA 1XW8A 2D24A 2W5FA 3QN3A 1ME7A 4DBWA 1YDOA 3MU7A 4PB4A 1MW2A 4UFMA 4R53A 1RPKA 2MNRA 1W3HA 3WMLA 2PWFA 3II1A 3A47A 4M8UA 4MY9A 2ZXBA 2GQ3A 1G9HA 1WX0A 3WUGA 1ITUA 3GG7A 5GNXA 1WXJA 5CGTA 3F4DA 4NHVA 1CXEA 4MZ8A 3PWGA 3PPFA 1RXOB 2VQUA 4BCEA 2XSBA 4X2PA 3IUDA 1A5NC 3LCGA 5HMDA 2PODA 4IICA 4S2CA 4PULA 4WY0B 1XG3A 4PYSA 4FALA 4XX6A 3I7QA 5IXEA 4J3VA 2Y7GA 3VIPA 1JFHA 1K7FA 1K9DA 2E0PA 4U3CA 3GXNA 3W7CA 2WZEA 2ACRA 3SRKA 3W6YA 4YTSA 2CERA 4GOAA 1MSSA 2ZTKA 2V5BA 1E3ZA 3CO8A 3U3HA 4Z0JA 1GT8A 3AROA 4QE5A 1A0EA 4AHQA 3WNNA 2Y7FA 4V1YA 4LUYA 1TWSA 5GJPA 2EO7A 4W5ZA 4DXKA 5HWJA 1M41A 3WFAA 2WMHA 2CU0A 3W1PA 1RA0A 4BWLA 1Z89A 4XSLA 1DJZA 4AVOA 4BEUA 1C8XA 1UHVA 4MHBA 5EKYA 4JHOA 4GVIA 1VENA 4FLQA 1SMDA 5D30A 1EPVA 1P0EA 2D2HA 2B31A 1MXGA 4Y7EA 3W88A 4NRRA 3CPRA 3HBLA 3MWAA 1GVQA 3UY8A 1G0CA 4NNBA 3SJNA 3ELFA 1CGWA 1W9PA 1RQBA 3NVTA 4AX7A 3O06A 3EGJA 1NSJA 2PDQA 1A49A 2I5QA 4HU8A 3ATZA 3B06A 1GJPA 4DJEA 4HN8A 4PN2A 3W7GA 4L6DA 2ANUA 1VBRA 5CPOA 1JD7A 6XIMA 3NL5A 4C6JA 1KQZA 4FX8A 2GDVA 5H8UA 5T9BG 4S39A 2A5HA 2J8GA 3PBUA 4Z2GA 1E9IA 2E6YA 4I90A 2Q6ZA 2Y24A 4JFUA 4LSBA 4JTJA 3VO0A 3ARYA 2XPKA 4XKMA 4E2DA 1LRQA 1MNSA 2XDFA 2QZRA 1ECQA 3AUOA 2WO5A 5AB3A 4YWIA 4XD3A 4MDOA 1DPMA 1ISVA 3LGDA 1BTMA 4MJ4A 3FXGA 4NILA 1RQHA 2YCKX 3N2MA 4R88A 2V68A 1Q6GA 2HPIA 1YLVA 1UD4A 2BOEX 4MJZA 2W4XA 3UJRA 4M6VA 4HU3A 5JXQA 3NFUA 1WYIA 3T81A 7CGTA 1E56A 4PMXA 3KHJA 3ARPA 4IMEA 3SBFA 3JR2A 1Q8AA 3A64A 3WYZA 2RFGA 4Q4KA 1J5SA 1P1MA 4LAMA 3OA5A 3BLLA 3MUY1 3GO2A 4D72A 2OPJA 3BPWA 5I06A 1EZWA 4DJFA 1FWGC 4GIRA 2ZBTA 2VOTA 2Q8ZA 4LV4A 1GKPA 1XISA 4FOUA 3LEPA 4PH6A 4QHRA 1H7XA 1Z44A 4GY1A 3GVWA 4A2RA 1UC5A 4M1BA 1R46A 3DI1A 2P88A 2QCDA 3E0VA 5D8ZA 4ICNA 3P2VA 4RZBA 1ZBVA 1UUMA 4H7VA 1GYNA 1MEHA 2XFRA 1VP5A 2D0HA 4W88A 4AXNA 2VKZG 1LG2A 5E0CA 2O4QA 4QTGA 1FVPA 2WMKA 4DN1A 4DX3A 1EDQA 1QK2A 1V08A 3HQ1A 2F6KA 5F2GA 2E6AA 4NI8A 3PZIA 1SVDA 1NWTA 3CASA 1E6XM 3GNNA 3TN4A 2WPBA 2V63A 5BU9A 3N2OA 1I2RA 2DFAA 1R3SA 4HZ6A 3KOXA 3UXLA 3B0YA 3TVAA 3EXRA 3B03A 4O1FA 1REQA 2Z24A 5ABTA 2HSAA 3GTNA 4YS1A 3W76A 1EGZA 4BY3A 2B0MA 2VZUA 2QUNA 4JTHA 1QPNA 3W3OA 4GI6A 3BZJA 2XJ7A 2BHZA 1N8WA 5DCEA 4UTWC 3OPSA 2OLAA 5K2ZA 4LCRA 3CQKA 4GYKA 3WF2A 3VZYA 2ZC1A 4PGLA 2J88A 1XXXA 1SO4A 2I56A 4RUBA 4X2RA 5A2BA 4OT7A 2J74A 2HVOA 3T8QA 2JALA 3OZMA 1KA9F 4E8GA 2O4MA 1GPFA 1KM4A 4FA3A 1KXVA 1DV7A 4MMWA 1G4TA 4AVFA 2OFJA 1CI1A 3VMPA 2Q3RA 3VOCA 5I09A 4CD5A 3I6EA 5D33A 2J62A 4WLCA 4JTFA 1I2OA 1IXQA 3MI3A 4N2YA 3HPZA 3UETA 4LBUA 5EMYA 1BSLA 3O6YX 4AY7A 9CGTA 1W17A 3LNPA 4DNHA 1SFLA 3UD6A 5IFTA 3ZT6A 3VDGA 3DG6A 4U10A 5DBTA 3WD3A 4B3LA 1BYCA 3O1NA 1QR7A 3EKLA 4QBXA 2V6AA 4ADSA 4QS5A 5D2VA 4TX6A 1DXIA 1J18A 1XCFA 4QE4A 4LUSB 1JULA 1OT1A 3BARA 1T8XA 4NJJA 4WXYA 4UTUA 1FXPA 4WDTA 4QITA 2GDUA 3BLEA 1R3RA 4AIOA 2XZ7A 4JTIA 1DJXA 3QXBA 1WOAA 4IT1A 3S1VA 4GH1A 2CEQA 4JIIX 3WQWA 3VIKA 2V3EA 3T09A 4IQEA 2HK1A 3PC0A 3IPWA 5B80A 2DVXA 2J25A 2NXIA 1X96A 3N9KA 1T0OA 3G2GA 3QPEA 4P7RA 1IXPA 4OIFA 4Z1AA 3G1RA 3UZYA 5D9PA 4CNTA 4X9SA 3S1UA 3GB6A 1GOQA 1BKSA 2QW5A 1M7JA 1GCYA 2PLMA 2WZHA 3CT2A 3DBNA 1FWHC 2IQ0A 4WY0F 4D1JA 3C52A 3PZOA 2VUYA 3KWSA 3OBEA 5HR6A 1J0JA 2OYLA 1WE5A 4OKDA 1XIMA 2HDJA 3W75A 2CHNA 4HQVA 4MKSA 3GG8A 3MZ2A 2WAGA 4K8HA 4S3FA 4PMNA 3UXIA 1QNVA 1UW9A 2JQXA 2E6FA 3BJFA 3EWYA 1X39A 3ZJ7A 3EX6A 1XLMA 3WENA 3CWOX 4GBUA 2JIEA 1SJBA 4RLIA 1DWAM 4TV5A 4HKPA 5AN7A 1NU5A 5REQB 1AMYA 1H41A 1XSJA 1XH1A 2XN2A 2WZIA 1VIZA 2FFCA 3K46A 3W1NA 1DOSA 3SGZA 4D1IA 2CZ5A 5A8PA 5CZJA 4IIHA 5FD0A 1UB3A 2QF8A 1XI3A 3PNUA 5AECA 3A21A 3TTQA 1VPXA 1JZ6A 5K9XA 3L2MA 3F2DA 2PDUA 3NPWA 4PMJA 3UWWA 1J2BA 1L0PA 3B9EA 3M0XA 1JYXA 1BSIA 3FYYA 3C86A 1UD3A 2PC4A 1BQGA 4H01A 1YBQB 1E0VA 2BMBA 4WDUA 3EX4A 1N55A 1JYVA 1L8PA 1WKYA 3PZUA 1VJZA 1CB2A 1S39A 1PVNA 3O6CA 3NXFA 2WSRA 5G2HA 1NM9A 1E4MM 3HF3A 2QVNA 4NU7A 3URQA 1Q6QA 1H5YA 5EA9A 3NDZA 4O4VA 5C70A 2WWCA 2O9TA 4UC5A 1CCWB 1VF8A 1UUQA 4WSHA 4OECA 1SSGA 2R91A 3PWAA 1AZ2A 3EPNA 1DIOA 4XKYA 4ERGA 1E6SM 3Q94A 1UD6A 5HWNA 2P8BA 5FF2A 1JDFA 2FGBA 5EB8A 4JX5A 3FY1A 1O6IA 2OGYA 2VEFA 1UA3A 3R4IA 1TJRA 3QRHA 3PZ9A 4JOMA 3EYPA 1UIPA 4F9DA 3W2NA 4ZL1A 3RO6A 3BW2A 1L6SA 3LHYA 4QCFA 2QXWA 3PB0A 3H7RA 4UZSA 1E0XA 3ZT5A 5A69A 2FYMA 2OQYA 3HQNA 4K6AA 1S3HA 4LC8A 3GNXA 1UPPA 2YA2A 2CLIA 3E9AA 5MKGA 4XUYA 1JDAA 3TTEA 2QKFA 2WJFA 4CD7A 5ABEA 3GC5A 3WL0A 4ZXLA 2CLMA 4D6IA 3W86A 5AVHA 4E6MA 5F7UA 2XIIA 1NH6A 3AS1A 1JZ2A 1OG0A 1BF2A 2W66A 2VRQA 1OC6A 3ISIX 3NZGA 1UD2A 2G97A 4H9MA 1R87A 3UT0A 5BZAA 3PZMA 3ZSSA 4DELA 3LLFA 3F4CA 4JX4A 1KV5A 3TMQA 2J6VA 5LYRA 2GJXB 2ALRA 3HZ3A 1VH7A 4UQEA 4JBRA 3BQ5A 1JD9A 5LXXA 2PP3A 3AWNA 4DLMA 1FCBA 3H24A 1GG1A 3W6LA 2XSXA 4AYGA 3QOKA 4FNPA 3UWZA 3EDEA 1A5LC 2ACQA 1JAEA 1H3GA 1PTAA 2NQJA 2Z7KA 4UB9A 1Z3NA 4HSHA 2YCIX 3FLUA 1TCMA 5FAGA 5A1AA 1VPYA 3STEA 3G3MA 1V0LA 1QHZA 4E38A 4QJ5B 1HF6A 3LHTA 3L4YA 1UZ4A 1RP9A 2P1FA 4FZIA 2X7WA 1UZDA 2NVCA 4AISA 1XRSA 4KCUA 1EC8A 5I03A 3EPMA 4Q7IA 3DGRA 2CWNA 5FJPA 4ZOEA 1R9XA 3M16A 1UP3A 5IBXA 1NEYA 4D6GA 3P80A 1VFFA 2I9EA 1H1YA 4DWSC 3TFXA 4NXKA 3VCRA 1PO9A 4WOQA 1JF5A 3LSBA 3N3MA 4M19A 4IQJA 4ALDA 3PBVA 3WO8A 4P2VA 1SW0A 1S5WA 4LCQA 3SB0A 4X61A 5HMEA 1K03A 1KFKA 2VENA 5F4XA 4F4RA 4G1NA 3GR8A 1M03A 2FMOA 7TAAA 3OGSA 5FI8A 1SYTA 2FJUB 4LVDA 4EP8C 2J7CA 2YSWA 4LAZA 2OSYA 4B3KA 2MUCA 5BNKA 4O0ZA 2G3FA 1LRTA 2PTWA 1L6GA 5CBIA 4LPCA 2YXGA 4FB7A 3VC5A 3SUVA 3L23A 5DXYA 4PMQA 3VGBA 3S9YA 5GJMA 1NQKA 4TMCA 4G7EA 1KM1A 4DYEA 2CFFA 4AC7C 2VFDA 1ESWA 7ODCA 3K13A 1OZMA 4QLLA 1B0IA 2HNEA 4LY8A 3AYTA 3TZNA 4OQVA 3G24A 5H91A 1VEMA 4V2XA 1UUOA 4GXWA 2QPXA 3BG5A 1GPWA 1XYZA 2HE8A 4JEJA 1K02A 1XINA 1LUCB 2JBMA 2POZA 4GH3A 4PBFA 3LERA 5E6YA 4QQ3A 1XC4A 3S5OA 3MSDA 2D69A 4H41A 1KLYA 4V28A 3MCNA 5KEZA 4XZHA 4W8BA 1T96A 1GOWA 3NO3A 4UOJA 3BLOA 2Q3OA 3T2PA 2NV1A 1NFPA 3IS4A 2WYSA 4YTTA 2WV8A 3F4NA 2G37A 2GUYA 3LCWA 1XIBA 2PLKA 3WNKA 1F6YA 4KGJA 1VIWA 4JIQA 2EQDA 6A3HA 4AD3A 1OCNA 2W67A 3BL3A 1OX6A 5A8OA 2ZUNA 1TMHA 6PTDA 1XLLA 3LQLA 3D5HA 1ZB5A 5C5YA 4Q6XA 5HNTA 1PTDA 4I7WA 1U30A 3NZQA 1VFSA 2ZZ5A 3VNDA 2PGFA 1PAMA 2GYIA 4PMOA 5IDIA 3AMGA 2UY3A 1XYAA 3TOYA 1KFBA 5BROA 3GFYA 1WAWA 5HPCA 1C92A 3MUZ1 2QNEA 4MNLA 4MLJA 1FWJC 4Z2IA 4AF0B 1X7IA 3LTSA 2FZBA 3QEZA 4LS1A 1US3A 4WKAA 5CZ0A 4C6OA 4ICCX 2Y62A 3SY8A 2PDPA 4RL3A 3MV01 3M07A 5BWAA 1YADA 4PL2A 1HO4A 2WANA 4Z0SA 4ZO9A 3KVMA 4XZWA 3TU9A 1ONEA 4KRTA 1EHNA 1AJ2A 1QBAA 2PMQA 1HKVA 1DTUA 1YHTA 2REQB 4FXJA 3D6NA 5T9CE 2QCDB 3N17A 4Y8FA 4A3QA 4AZCA 2DT1A 2VRKA 4OUEA 3S9IA 3UCQA 4HB7A 4JTCA 3EPOA 2R8WA 1NP2A 4QJ4B 2O9PA 2RJGA 2QV4A 3PM6A 1V3IA 4TO8A 1MZHA 1AL8A 1ZJIA 1Q66A 3CXOA 3E2SA 2WNNA 3MBFA 2XIOA 1VRDA 3OQEA 1VRXA 4IPLA 1GYMA 2OT0A 2A85A 1RR2A 3GHUA 3E5BA 3BOXA 4F0LA 5IM51 1UKTA 4GO8A 3T40A 1HW6A 2J9ZA 3S6DA 3RLVA 1OGBA 3GRIA 1UWQA 1VLIA 2VFHA 1CPUA 3ZVHA 4ZSTA 1HT6A 4O13A 3LTYA 1REQB 2Y0FA 3R2GA 2Y70A 2YIHA 1SQ7A 1W31A 3NQAA 3TAKA 1TTIA 3EWCA 1OCQA 1KC7A 3IGSA 2YXOA 3K5XA 1GONA 4H8HA 2IPFA 5KZ6A 3SDOA 4LAKA 2OELA 3ITCA 3TXZA 2W92A 4Q8QA 4QISA 1OCBA 4W4QA 4ZQCA 2PDCA 3W1RA 3VNJA 3GNOA 2OG9A 1K3UA 3AC0A 3W2KA 1BTCA 1EJSC 2PZ0A 3PK7A 1YIXA 3CWHA 3D0CA 1LBMA 1PSCA 1I1XA 1DHPA 4RE4A 2XVNA 4MJ2A 2GGJA 5G1MA 1XWYA 3ABXA 1J6PA 3TAOA 3MYPA 2CXGA 1UP0A 1DQUA 3A6OA 2YYTA 2ZZ2A 4IPNB 4QSHA 2CZVA 5CSYA 3PFMA 1YXYA 4J3UA 3XINA 3W1XA 3WH9A 1EYEA 3IJQA 4HCDA 3PVFA 4OTKA 4XAGA 3UY7A 3CM4A 3IV3A 4NAFA 1ITCA 2X2GA 3RU8X 4QXIA 2E4TA 2Z1KA 3CIXA 3MSRA 4UQBA 5HINA 4HHLA 4C1KA 5LNUA 1FP8A 2QCCA 4D8ZA 2A7NA 1LYXA 4O8AA 1NVMA 1W8SA 1BKHA 3R8HA 1TWDA 1P0KA 2Z1XA 2DUXA 4BJHA 5CZKA 1IT0A 4EAMA 1EPXA 4Y96A 1W5PA 4W86A 4Z1CA 5E0KA 1S5VA 5K9CA 3XIMA 3HGRA 4ZCWA 1V7YA 2H3DA 3TLQA 3CV1A 4UCGA 1KGWA 4H19A 1AH0A 1AD4A 2ISVA 2Q02A 1W3LA 3ID7A 1FFQA 1P43A 4HU4A 3DI0A 4QFUA 3GFZA 2YBUA 2VVNA 4WEVX 4W7WA 3G6MA 1IZCA 4UFIA 5KTLA 5TD4A 1X6NA 3SY1A 1OF8A 1RP8A 1F4AA 4UTKA 2PRHA 4B5WA 3P5ZA 1DYSA 5DY2A 1H1ZA 5C9XA 1EXBA 4AWUA 1TPWA 3VKKA 3T7VA 1PEZA 5LZLA 4AVNA 1CXFA 1M01A 1DIDA 4BFAA 3O16A 3WQPA 3UR2A 3IIVA 2YCLA 4AY8A 3RR4A 2GSHA 4Q4MA 3LLDA 2A4AA 4B9YA 4JAWA 1AH4A 3TUUA 2PTYA 3HG5A 4LYPA 4B3ZA 1QNQA 4TX8A 4MAVA 2Y8UA 3GXIA 3AXHA 3W1TA 4AB4A 1DTNA 3EA3A 4HMDA 3SCWA 3QR1A 3P84A 3GNDA 1KXTA 3S9ZA 3L66A 4OUIA 4AMCA 1JZ3A 2JFEX 1XSKA 3KS6A 2SFPA 1UJPA 2P3ZA 4H6KA 5C7HA 1U5HA 4KESA 2WZMA 3G0XA 3N13A 1G4EA 2YW4A 5CPLA 4G6CA 2F38A 1IYXA 4QG9A 3VIGA 1GK8A 1K70A 3W7KA 3BDKA 1EF2A 1GVSA 3EOUA 3W2JA 2EHHA 3O05A 4WR3A 3H22A 3SY5A 2QPUA 2A79A 4JR5A 1ADSA 5DMNA 2ZVRA 1JFXA 4B16A 2HS6A 4JZ5A 3THQA 4XZIA 1FOBA 2FVKA 3CUJA 3V0SA 3CS2A 4RPQA 2ESCA 3RIKA 4M5PA 1XLHA 2ZRXA 3H23A 4US5A 4LQ1A 1ODUA 3EOEA 5LGZA 1JF6A 1RBLA 4XKYB 4PTDA 4BK9A 4XSMA 2WMGA 4B5SA 2OO0A 4MNKA 1KBIA 3MUXA 3MJMA 4LV9A 4IP7A 5I7GA 3H2OA 2QAPA 5E5CA 5GPRA 3WNPA 2BSLA 1UWIA 4LW7A 1TTJA 2GWGA 1J0ZA 1H0GA 2WSPA 4QNWA 2X7VA 3DC0A 1UKOA 4CCDA 3C2FA 1YXDA 4W9TA 1I0BA 4H9ZA 3MKCA 1LLWA 1CB7B 4IGHA 3A9BA 5D2WA 2QUTA 3BOLA 2XVLA 3U0HA 5HNNA 4US5D 3EWXA 3RG6A 2Z7GA 3SUUA 4EWND 1PE1A 3QQWA 3EX2A 1BPLB 4GQQA 2XH0A 3AHTA 5E6ZA 3S42A 1DQXA 2QVHA 3KTCA 3NL6A 1MI3A 1Z7AA 1V0NA 3VZXA 2R6OA 1RSCA 1XPYA 2CITA 5G4HC 2X42A 5HQLA 1D8WA 2P8CA 4UFJA 1A80A 4HJFA 5AHLA 1EA0A 2VYOA 4CQAA 1Q45A 1J93A 2DZVA 4RR4A 4JTTA 1JCJA 1E0TA 2NQ5A 1DJWA 4US6A 6REQA 1WBHA 3WDHA 5FSEC 3A22A 4REQA 1YYAA 2QDEA 1HL2A 3UPWA 1W1A1 1S2WA 2TPSA 1EOKA 1OFOA 1ZY9A 3WK0A 4R3UA 4WGXA 3BMWA 3IAQA 4LUTA 3IRDA 4XAPA 4JIHA 2V2HA 5BU6A 3QV9A 2IQDA 1VBUA 4LVBA 2BVDA 3W6MA 4PMYA 1ZJAA 1RV8A 3IIPA 4HSNA 4ZOBA 3T9PA 4QEEA 1JUKA 3W00A 1BAGA 5AYYA 1XBZA 2WW5A 1UC4A 4JN8A 2G3MA 1TV7A 1H09A 4WZHA 1UYQA 2HVMA 4B5VA 1PZ2A 5CC7A 7PTDA 1A0CA 4B91A 4E4UA 3PPHA 2P3EA 3R7MA 1UQZA 3LK6A 4QIUA 1XUUA 5EMLA 3AALA 5FEPA 4GVGA 4GISA 1CGXA 3EDFA 4ACYA 1W3JA 2YKKA 4GFSA 1KR0A 3T07A 1EO7A 2J79A 1LT7A 2C8NA 1XCWA 2PDKA 4DVOA 3GIQA 3G1YA 1C3FA 3ANYA 1K7XA 1PIGA 4K7YA 2X1IA 2EPKX 4ATWA 3GTIA 3TN5A 3O8AA 4NX5A 1V6TA 2VD8A 2VX5A 3BCJA 1I2QA 2ZXDA 2F6XA 1H61A 3K1GA 3WD0A 2FZNA 2FH8A 3VOHA 3TTYA 1GW9A 2XWDA 1WDSA 4H4IA 2G41A 3OIHA 3EX1A 3E0LA 3W25A 1XIDA 4YVPA 1XLJA 2PDNA 3WKZA 3QBUA 4FIQA 5DMYA 4IFRA 1IEQA 3H2CA 2ACSA 4LAUA 3EBVA 4L4LA 1C9DA 4KFNA 4YHGA 3G77A 3AFBA 5EFFA 3L4UA 4GIEA 2ZE3A 4O8RA 4BF7A 5FEZA 5GJNA 5DX7A 2KAUC 3IJ6A 2AQWA 3APTA 4D8LA 1OHLA 3UESA 3VKAA 1LWHA 4CNSA 4O54A 1JDEA 4RKAA 1AW2A 1JI2A 1UH4A 3M0KA 1GNXA 3B8VA 3PBGA 1XS2A 4NI3A 4ZTXA 4HBKA 2IKJA 3T0CA 2J8FA 2G4JA 5E9XA 3ARSA 1BXBA 4RZ5A 1W9UA 3EDKA 3LGGA 3RDKA 3ARTA 3SECA 4NQ1A 2X8RA 1KKRA 4UTTA 2GL5A 4NT0A 4Q4OA 1SW3A 1VHCA 2PWVA 4I7UA 4IF2A 1CGTA 5F2LA 1WDRA 5CPMA 1XGZA 2E68A 3STCA 3EDJA 4PB3A 4G56A 4IH3A 3LBCA 5FOOA 4PBEA 2WCGA 3NQ7A 4AFYA 1WKFA 5JH2A 2Y1HA 3GXDA 4N4PA 2D0GA 4KCWA 2GVYA 1WZLA 1XYCA 1XRTA 5LA0A 4F9JA 3PANA 1SZRA 5A2CA 1KBKA 4MNJA 1IGSA 2NV9A 1I4NA 5FL0A 1OIFA 4AZCB 3WBAA 1OC5A 1OF6A 2VZSA 4N4QA 1Q2SA 3WDJA 4K8GA 3ABQA 1RBAA 3AHVA 5HJLA 3AIQA 4K38A 4GHRA 1ISZA 3ITLA 3TQPA 5J5DA 1PKMA 1VBHA 3E49A 2PSNA 2WVVA 1KCLA 3KFTA 4AXKA 2P53A 2CLKA 2YLAA 3RJXA 5LHFA 2X1RA 3WJXA 5AFDA 4GCXA 9RUBA 4WUIA 2OWXA 3MY9A 3NJ3A 2FIQA 4YYCA 3ZJ8A 5DEZA 3E1F1 3UG5A 1TG7A 2RH9A 4LYQA 4K1GA 1RJPA 3ABOA 5DRIA 3M7SA 1QCWA 2ISDA 4LYKA 4O1CA 5A94A 4PODA 5HUOA 3BAYA 5FSDC 1OWQA 3UJFA 4KWUA 4MTVA 4WF7A 1XP3A 3CYVA 4H04A 4L65A 4GYPA 1S46A 3A3XA 3IGHX 4IPIA 4IM4A 3L5LA 3POCA 1XIFA 3GW0A 1T7LA 3MCMA 3NXLA 4HCHA 4TX9A 1UOZA 1OK4A 3WQDA 4PUEA 3ZLHA 5M2FX 3AIVA 4AHPA 3GKFA 3M0HA 3ERPA 1FDYA 4UNIA 1J0IA 4GX9A 1PXGA 2DP3A 1MRQA 3HG4A 2J6XA 2OZ0A 1EBGA 2ZADA 3L4WA 3QZEA 1ZAIA 4TR9A 3N4AA 4FR1A 1MRAA 4FR6A 2J4GA 4J3XA 2XH4A 4AZ7A 4PEKA 1DXFA 3M5XA 2OT1A 3O3RA 1MUWA 3ARQA 3WK3A 1OFDA 4MY8A 3U7VA 3UCCA 3BLPX 2PDMA 3UVIA 5I02A 4GWEA 1PB0A 3WK2A 1DXEA 3KEHA 1FA2A 3WJWA 1JAKA 3CZGA 4QG8A 3U2ZA 3N73A 1GOKA 3GR7A 2WSYA 1ICSA 3FA4A 1TMQA 3RLGA 3TJXA 2YOCA 4JYEA 2DVUA 1RCOB 3TCEA 2ZC8A 3NOEA 4JTEA 5FF7A 2GGHA 4H1ZA 4QSFA 4LWWA 4ACZA 4YCOA 4NAFB 4GUGA 2PF0A 1TVNA 2D0FA 2IKGA 1OJXA 3APGA 3W1QA 2JGYA 1TUFA 2QDDA 5M5DA 3A9IA 2OSWA 3FJ6A 3CTTA 5BMXA 1V4YA 3TYAA 4PL1A 5DCBA 3K4AA 3CHEA 3MBDA 3L2LA 2QUUA 3VOIA 3S2JA 4MWAE 4G2DA 1A5SA 4BR1A 4ADTA 1OT2A 3GDTA 1IE7C 2CLFA 1QJWA 4RDWA 1FHUA 2VX7A 3WLJA 2PS2A 3MTWA 3W1MA 4WGHA 1RPXA 3SCQA 1OFPA 2V5DA 3NWRA 3SAZA 3E74A 1RQEA 3PG8A 5HMSA 1E55A 4BHYA 3U5YA 4NSBA 4ATDA 2CKRA 3SM0A 2ZZ7A 3CQJA 1TWIA 3LCLA 3DFOA 3DOPA 2ZXQA 5G1TA 1O5XA 1US2A 5DFAA 1ALDA 1B57A 4BKNA 1R3YA 4F0RA 3WMSA 3NYZA 2D1ZA 2FHFA 3BV4A 2F9RA 3L68A 2XG9A 1RUSA 3GXTA 3QTPA 4JFWA 3RNDA 1Q6OA 5LSMA 4YHEA 3T42A 2J13A 4RDVA 4UQ9A 2R94A 1QPQA 1UZHA 1XLCA 3PBYA 2E28A 3SURA 4Y90A 2NUXA 4JPGA 1EIXA 3W28A 4UR7A 8CGTA 3EB3A 2XU2A 5ABGA 2YCLB 2ZRWA 3KS5A 5A6MA 3DESA 3L65A 1JUEA 4X60A 2Y7DA 4TVDA 3ARZA 5DT5A 2TMDA 1ZUAX 1FRBA 3LI1A 3F4VA 2OOGA 3EB4A 3OP2A 4JTKA 2OTDA 4DJDD 2VQTA 1J4EA 3HM7A 1E6PA 4WD0A 1E43A 4WSKA 3CH0A 4WRHA 3CZJA 1OQFA 2UZ9A 4PUUA 4GYJA 3B9NA 4WSJA 4ZVJA 2FDSA 1B9BA 3R10A 4RE2A 4R34A 1W1VA 2X16A 1V02E 2AMGA 2PDJA 4MADA 3NEVA 1OD0A 3AS3A 3W9ZA 3DFYA 2VR5A 3ARXA 3LBMA 1Q4NX 3WDIA 1B2YA 2OEMA 4DLFA 3WLQA 4GKLA 1KNWA 5CLTA 5D9OA 1JPDX 3T0DA 1EQPA 2XH2A 1PZ0A 4ZE5A 3TR9A 3EZ4A 1BG9A 2HNHA 3JZUA 2QHAA 1HKIA 2YZ5A 2V5CA 3K8LA 5K3VA 3IEBA 1B1YA 3HGSA 3GU9A 2WPGA 1U5JA 3QYSA 1D9EA 3DKLA 3OYXA 3WN6A 3AXMA 3AYSA 3MS8A 4NYUA 2Z4GA 3LRMA 3IARA 3HMJG 1M6JA 3QTGA 4LANA 2BDQA 1G01A 4CVWA 4Q22A 3PTDA 1X97A 2ZUMA 4JX6A 4JDYA 4JS3A 4KEVA 4ZO7A 3ZYZA 4AU0A 1RK5A 2DGAA 2EBNA 2TYSA 3B8UA 4XD5A 2EJ1A 4ZQOA 5XIAA 5LHEA 4H7CA 1V3JA 4XZLX 4DM2A 4FO4A 1NFBA 1IEXA 1XBYA 3R0KA 4KFPA 3DUGA 2GJRA 4LX4A 1S2UA 3P0XA 4GUHA 2VC9A 1AZ1A 1D2KA 1UOKA 2WM1A 4CD6A 5D9NA 2GQAA 2JGQA 3EXTA 4D6DA 5EMJA 4JHMA 3S3GA 1HJWA 3QFEA 1LF1A 2AOSA 1G7UA 2YW3A 4U33A 4FXRA 4JICA 2PCEA 4DUOA 2NT1A 4PEEA 4DBUA 4DXVA 3HB9A 1GEHA 4S3CA 5LIYX 4XTIA 1ML1A 5CJMA 3T78A 2J75A 5J5RA 1OK6A 3SCSA 4O19A 4R9OA 4AD0A 1WQ5A 1QI0A 3UGRA 4C90A 4DF0A 1UZ1A 4S3JA 4UR9A 2ISFA 1O66A 4Q33A 4BQ4A 3ARWA 2QMKA 2AKZA 3TEVA 1EWEA 1A5CA 4ADUA 3VCCA 4R33A 3LSCA 3QR3A 4YCPA 3SQSA 1HL9A 5LNWA 4LUTB 2CHOA 4FP1A 4PRTA 1E70M 3ZVIA 1V3LA 3JS3A 4JN6A 2VCBA 4L61A 4MZYA 3UWVA 4CCCA 4EXAA 4M7SA 4DO7A 2NT0A 1BEUA 2F8QA 1WXZA 3A4XA 2YFOA 4A2SA 3GY1A 4GJ1A 1IT8A 3AU2A 3LQGA 3AHYA 4BF9A 3W71A 2H90A 4B5TA 1TR9A 1VFMA 4RNJA 4HMCA 4LEQA 1IEWA 4KKXA 2VFEA 3LD5A 4A8LA 2DZTA 3WCZA 1A5AA 1PUDA 3GH7A 2D20A 2OZ3A 4ENLA 2J47A 3DERA 1Z8AA 3QMRA 1NDZA 3ZO9A 2VMFA 3UVAA 3E0IA 5HATA 2GWNA 1YKWA 1JIBA 3MW7A 1TQXA 3IUIA 4CU7A 2A7RA 3OVGA 1M04A 4MB5A 4E4FA 1WDPA 2NSXA 4HD5A 3E38A 4M82A 1MDRA 2E8ZA 3ANUA 1MWOA 1XQLA 4ZSUA 3KRZA 3ZJ6A 3MV11 1R47A 2D22A 4N9EA 5BRPA 3KRBA 1KM2A 2IPJA 4XQ6A 5G2IA 3S46A 3G8EA 3OQ8A 3CV2A 3BXWA 2VC7A 4IL2A 3AIUA 3DH7A 2VX4A 1A5BA 1KRBC 1KM0A 2PBOA 3M43A 3O9NA 3HPAA 5EPDA 2J7FA 4FSAA 4E3VA 3KBNA 3V5FA 4DBDA 2A3CA 2BHUA 1VC4A 2DW7A 4MNMA 4IJRA 1KW1A 3CAWA 3RUBL 1HP4A 1NIUA 1GTHA 2YA0A 3MI2A 1ODZA 7A3HA 3M0JA 4DNMA 3BAXA 3W7EA 5A5WA 4PMZA 3MSYA 1UROA 2Y5SA 3C6CA 7ENLA 4HPHA 4LS0A 1M5WA 1QI3A 3HPFA 3UJ2A 3VILA 1TB3A 1SO6A 3DGBA 4DZHA 2DQXA 3WBEA 4Q8MA 5FF0A 1E73M 1UD5A 4J7RA 4C6DA 1A5MC 3I10A 4U5IA 2R1MA 3CUIA 4INFA 1EO5A 3DFPA 1ZTVA 2FTYA 1QPKA 2FZDA 2ZUTA 1F5ZA 3B40A 3MP4A 4H8VA 1J5TA 5AC7A 3N15A 3AIBA 3TTSA 2IXUA 1H7WA 2C19A 1FX6A 1C9WA 3KOFA 4LOCA 3W74A 2V38A 1OIMA 2WVTA 1YNYA 2GZXA 1JPHA 4YPJA 3VD5A 3QQ1A 4CQ9A 4A35A 4X0NA 2QUVA 4I9AA 2IPWA 2OX4A 3H12A 4Y9MA 4KF1A 1L8NA 3CO4A 1HJSA 2V82A 4UTWA 1F7BA 1PX4A 4CN1A 2PAJA 5I77A 3S5YA 2VNCA 4HPGA 3TKFA 4GACA 4C5YA 5FJOA 3GS6A 5LNSA 1UP2A 1K6WA 3NPVA 1GQIA 4E0CA 3VOGA 4JNYA 1GVYA 3GZ3A 4AC1X 4DYJA 4DY1A 3UZZA 2VGBA 4Y2WA 3VK5A 1VYSX 3ZMRA 3SCPA 4HTYA 3LENA 3JVAA 4R85A 3DIPA 1D3CA 2E67A 3DYMA 2A3EA 2XN1A 2WVVB 3EEGA 3G0SA 4CUCA 3SQLA 1P4CA 2PCQA 3SADA 1QASA 1R86A 4P8UA 3S5NA 5HQMA 3IIXA 3L2IA 4S3GA 4BI6A 2OZTA 1K4HA 5BRQA 3PNZA 4ZQNA 1Q13A 4XIMA 1A5KC 3K8MA 4RW5A 3FAXA 1QNOA 2AGTA 3H4WA 3SRDA 1KFCA 5CAHA 4FI4A 3C0SA 1GW1A 3VA8A 4MM1A 3PAJA 3V1HA 3BSMA 1THFD 5JBEA 3HQPA 4HYVA 4LNCA 3HJZA 4C7GA 2WNWA 1XFBA 3SUSA 3HTWA 1FUYA 2VFFA 3RM8A 1FFRA 1L2UA 3P81A 4TV6A 2MANA 3D3FA 4HPJA 5M17A 4ROPA 3C8FA 1UWRA 5D9MA 3PP7A 3WMCA 4U2YA 3NQ6A 4HOWA 3AJ7A 1OD8A 4OV9A 1XBVA 1W3TA 4NZ1A 1M53A 3AXKA 1MDLA 1HGWA 3PF3A 1EJXC 3NSNA 4W7UA 3FVMA 4M0XA 1XR2A 1E9ZB 4C60A 3SSJA 4LYRA 3VGFA 4UTHA 2QGHA 3R89A 3TQ0A 1HXJA 3IIZA 3BAIA 2DSVA 3W27A 4PUMA 4M24A 2Z0IA 4BQ5A 4GC4A 3P6LA 3TW7A 4FHAA 1W6TA 2PURA 4O4WA 2IKIA 3URNA 2BX7A 1JPMA 3I3DA 3MHUA 2VEKA 5ABHA 1VHNA 1IIGA 3MDUA 3OGRA 2C16A 1E6QM 4I3GA 5A95A 2I17A 3AO0A 4YMZA 1XH0A 2DZPA 2ZIDA 3DEQA 1HVXA 2VR4A 3C61A 3MJYA 1Z41A 3G5EA 3J7HA 4UTJA 1F76A 3N2CA 2DY3A 2P0IA 1TPDA 1P7TA 3ZT7A 3QY8A 3MI6A 4EF9A 2PDFA 2G3JA 3URBA 3OA3A 2WQPA 3W26A 4GJJA 2FVMA 1BVWA 4BF5A 2BOFX 1XKYA 3B8SA 1OBAA 4NVTA 2A3AA 3WLRA 1TZZA 3LHVA 1SGJA 1L6WA 2CHRA 2F2KA 4G5DA 4RX0A 4J2PA 3UPMA 3ATYA 5A6SA 3CTLA 1JDCA 4I9MA 3GHSA 2WHMA 4ORMA 3POHA 1TFVA 3K30A 4GY7A 5LA1A 1Y5VA 3FGCB 2VEPA 3LPFA 3NSXA 2J7EA 5LGXA 1C90A 4B90A 1FCUA 3ARVA 5J04A 4HGXA 3EWDA 3BMVA 1HIZA 4AWTA 1V79A 3MQTA 3VZZA 2GQ8A 2UV8G 3STGA 3L0NA 3PHAA 1PHQA 1EJVC 4H8NA 4X9YA 1DWGM 3C0QA 3N6HA 2D2JA 3SCTA 3SW6A 4IIDA 3K8KA 4Q4PA 3KZSA 4M81A 3VX0A 4EPDC 4TXEA 4S3AA 1EFZA 1Q7MA 3AMKA 4A8IA 2VGIA 5HK4A 3Q65A 3WK1A 1KTBA 2OU4A 1GKRA 1WBJA 2VDHA 5D05A 4A8RA 1W54A 3OEXA 3OO2A 4HSOA 4KS0A 4JD4A 5CH9A 4AUBA 1ZP3A 4CCZA 5CEWA 1X1ZA 4JIPA 5BYWA 3PUDA 4N42A 4DIAA 4POCA 1ZALA 3FW6A 3QF0A 4LVGA 4HNTA 3PB2A 1DWFM 1M7XA 1V7AA 2VX6A 1BGAA 5I3IA 1WZMA 3LHUA 1FWFC 2C7FA 4H9TA 1LBFA 1SR0A 4W5UA 3HQOA 1LCOA 3PUEA 4QP0A 3WUBA 3RAOA 2FTPA 4YU1A 1J79A 3CT7A 4LVAA 4YWSA 1VAHA 5AZ1A 3N19B 3AZSA 1BWVA 3DDMA 3KBVA 2ZX7A 4IFKA 2XZ9A 3ITXA 4LXFA 2YR1A 3TNOA 2PLJA 2VC5A 2ZWZA 3EKZA 3QLDA 1HJQA 1R30A 1E4NA 1H7NA 1TPEA 3SUTA 2BVWA 1K4GA 3CAQA 3HPXA 1XIHA 5AVNA 1VYPX 1MNZA 5FF4A 4HCLA 3P82A 3CWNA 1X98A 2G96A 3R43A 4GGHA 3NAVA 3S1GA 3W7MA 5TQLA 2ALDA 1O5RA 3GXFA 1A53A 4H2HA 4OBTA 3W7OA 2NQLA 1K8YA 1B3XA 2ZUSA 1UKSA 3ITYA 4ZOCA 3WLLA 5C2XA 3TQKA 3LCIA 1NOUA 3P7YA 3AYRA 4QROA 4DXXA 3CLMA 1GVOA 1AMKA 4GIYA 3M6DA 1I8JA 2R82A 1TTQA 1CTNA 2BV9A 4IX0A 4WJEA 1Z48A 1VCFA 2OZ8A 2PB1A 4DWSA 4BI5A 4R7JA 5E9AA 3TV8A 4DUWA 2WMIA 3ORWA 3VNKA 3LXCA 4TTGA 3U4AA 4TOQA 3LB0A 4FNRA 5B7ZA 2PDYA 2GDQA 3VNZA 4C6LA 4F2TA 1GZ1A 1FQ0A 3FHAA 1JPIA 3WQCA 2J9YA 2QJNA 5C2CA 1BF6A 3URAA 2WHKA 3HA1A 3QW3A 1X8CA 3B8WA 1B90A 2HISA 2GVEA 3P62A 1PKNA 2E1DA 3ANVA 3WJYA 1BRLA 1XFCA 4GMEA 2PTXA 1NJJA 4GJIA 3IVTA 4O53A 3T6CA 3QOMA 3Q4DA 4Z42C 3W7JA 2ADAA 1IIHA 4JNZA 4NNAA 2DZUA 3MKVA 5LIXX 4DWSD 1A3XA 2Q8LA 3NUKA 4ZBCA 3RX3A 1QU4A 4M51A 1VCVA 3MDWA 4IP4A 3V18A 4P61A 2IKHA 6ALDA 1O7AA 4Y9AA 5LXEA 4HIBA 2DJLA 3CUFA 4DUXA 1NP0A 3E0FA 1WDWA 1CLXA 2ZZ1A 2GSJA 3RO8A 3OG3A 1V77A 3MUIA 2ATMA 1AL7A 2V8ZA 3EMZA 1TZ7A 5T26A 2NQ9A 2VEIA 3O6DA 5A2AA 1UWTA 3GD6A 1Q3NA 5AHEA 5SWUA 1H62A 1ZU8A 2VC6A 2E25A 3CB8A 3A13A 1WZAA 1V6WA 2RGLA 2ZDRA 4KW2A 2INZA 5A6KA 3AWOA 3EOOA 4KEZA 2XM2A 4HZ8A 2VDIA 2E7FA 4UMBA 4L9YA 3SSZA 1KFEA 4TUFA 5JMUA 3T4CA 3CV7A 4M80A 1NOWA 3TJ4A 2NW0A 3TC3A 2Z2UA 4B2DA 2WC3A 3UG4A 2VGGA 4WCJA 4AIUA 1P48A 2C18A 3QC3A 1TPVA 2KX9A 1EH9A 3NA8A 3KTXA 4FLSA 3QV7A 1BFNA 3DECA 5KSWA 3I3BA 2FGZA 1XLGA 1V03A 3GSMA 4ROQA 1QK0A 4DJED 5CPTA 4AWEA 3KE0A 2Y7EA 4Y9PA 4MWAA 2ZA2A 4HK7A 1B54A 1Y5WA 1LL4A 2UY5A 3HOJA 2Z28A 4LRTA 1UMYA 1I75A 3GM8A 1QBBA 4UTMA 2G95A 4BS0A 4DZ5A 3H2EA 3MMTA 1GYLA 2ABBA 5AHMA 4UR8A 2EGZA 3OG2A 4KRUA 2ZICA 3W01A 1KO0A 1CGUA 3WD1A 1GOIA 2Y6ZA 3VOJA 4D6CA 1NAL1 2V81A 3V5OA 4GZEA 3LA4A 3PZVA 2B7QA 1X6UA 4FX6M 3R8GA 4P5UA 4DI9A 4GBDA 3TW6A 2BOGX 2G50A 1GWJA 4S3EA 2RDXA 1HJXA 3ZWTA 1F07A 1C91A 1H60A 1XRFA 1SPQA 5KETA 1B3VA 1FTXA 3QHOA 1EJTC 1QHOA 3M6YA 4GIAA 1JL8A 1R3VA 4JTDA 4CQDA 4MWAD 4Q4RA 1Q7ZA 4JKKA 1EX1A 1YTKA 3D3AA 3TONA 4W7VA 3WEOA 1JR1A 3NL3A 1C29A 1BWLA 3FXYA 5LNVA 2XIQA 3FJLA 4H6EA 2CCRA 3TFCA 3FK4A 5HNUA 1XYFA 1NDWA 2RJHA 4DJFD 2Y4SA