4RJEA

Aerococcus viridans l-lactate oxidase mutant
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
369
structure length
367
Chain Sequence
IEYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIGAHGLAHATKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKGDGATAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate oxidase
publication title The Ala95-to-Gly substitution in Aerococcus viridans l-lactate oxidase revisited - structural consequences at the catalytic site and effect on reactivity with O2 and other electron acceptors.
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
total genus 136
structure length 367
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rjeA00
4JYEA 4MY8A 1FWNA 1GVQA 2FB3A 5F4SA 3G0UA 4JTLA 3NQ7A 4CQ8A 2CW6A 4LNYA 1CW2A 2A7NA 1LP6A 2X1RA 2WNQA 3CIXA 5K9CA 3SY5A 3C2EA 4U4MA 3L66A 1XUUA 1IXQA 3FFSA 1OFBA 1QCWA 3KAOA 3GXNA 2V81A 4UTMA 1FXPA 4XQ6A 2DZPA 1DJQA 4EF8A 3W3OA 3ABOA 5CZTA 2C3ZA 3W1XA 3LCGA 3LTYA 4MUZA 1TJRA 4KKXA 4AF0B 1OYAA 3M44A 4FIRA 2Z6IA 3SECA 2YYTA 1IXNA 1MEWA 1SZFA 3G0XA 4PC8A 1Q45A 1KW1A 3FYPA 4LS2A 4FNPA 3PSVA 4EOUA 3NZRA 1W8SA 3UWYA 3ZWSA 4WY0B 3NDOA 2CFFA 1H5YA 1WDWA 2CZDA 4OWGA 1SFLA 1F76A 2AGKA 3PUEA 4LC8A 3KRSA 3O06A 3W2MA 1R2SA 1GYLA 1GEQA 3DHFA 3N3MA 4YLWA 2PRLA 3OHIA 3N2XA 5DBTA 1Q3NA 3GX9A 2YXGA 4UFIA 1XI3A 3P60A 1OX4A 4K39A 1N8FA 2BX7A 1LM1A 4OHQA 2ZCGA 3NM1A 1H62A 5LGXA 2A6NA 4UCGA 4GRSA 4U28A 3IVSA 3GYEA 4GUFA 2P10A 1DBTA 3PR2A 3EX6A 1RZMA 3LRMA 3P82A 3GXPA 4JIPA 1DHPA 3W85A 5AFDA 4AXKA 3C2OA 3GIYA 3VNDA 1ALDA 2J88A 4ICNA 5EKYA 1VLWA 3W2LA 5ABTA 5DCDA 3LCXA 4GJ1A 1TPDA 1TV7A 3W7RA 1VCVA 1SU5A 3DI1A 3GVGA 3ABRA 1S5TA 3H55A 3LERA 5LSMA 1TRDA 1TTQA 3BPWA 5KITA 3LI1A 4CNPA 2A5HA 3W1UA 1IXPA 1F73A 3N9SA 4CCEA 3KRUA 3QZEA 3G3DA 3LV5A 4UUIA 2NX9A 3TDFA 3T40A 2R8WA 1OFDA 4AWSA 3CWNA 4ZQCA 2G95A 2HS8A 1OG0A 4AHQA 2QCLA 4A22A 3S9YA 2A21A 2FJKA 3HGJA 2CZ5A 5DCBA 1EP3A 4A2SA 1NSJA 5KZEA 3LLFA 1GPWA 4X9SA 2F84A 1W54A 5HJLA 5K4XA 4UC5A 3HGOA 1HUVA 1H7PA 1AW5A 3K30A 1WBJA 3PB2A 4JTHA 4N9BA 5HWJA 1I45A 3LHUA 3TFCA 3BGJA 1XBXA 3W6YA 2TPSA 3L68A 5K2ZA 4ADUA 4OU1A 3W1MA 3NL5A 4CCDA 1T99A 2XN2A 4ZMGA 1TV5A 3QF0A 1M7OA 2Z6JA 3PBYA 3RK8A 4B5NA 6TIMA 2YGYA 1YTDA 3NQGA 2V5BA 2QUTA 5HNRA 1LZOA 3HOJA 2Y7DA 5J5DA 3O6CA 3UZJA 1TPH1 1Z41A 3TSDA 2VKZG 3FKRA 4NUWA 4JX5A 3TQVA 4Y90A 3A5VA 3S1XA 2I14A 3HG4A 1YPFA 4QJ1A 3SI9A 5L9FA 2Q8LA 2C13A 4TMCA 1FWWA 1ZAHA 1LROA 5AYXA 3DFQA 3SGUA 2OT1A 1KM4A 4O1BA 1EX5A 1X6UA 1TPFA 3BLFA 2J24A 3T55A 4X22A 1JUEA 5I3FA 4DO5A 3UD6A 2C15A 3G1YA 2A7PA 5DXYA 2RKXA 5G4WA 4BWLC 3S5OA 2G5WA 4NNBA 3NZ1A 1ZAIA 2QCDA 1RQEA 3LCIA 1XUZA 1KM0A 3L5MA 1JCXA 1FDZA 1WAUA 2DJXA 2CLFA 3UXAA 3DKJA 1QMLA 2CZEA 3OEXA 4LVFA 3PC0A 5KMYA 5KSWA 2ZZ2A 4MFDA 5KTLA 1XBVA 1YXCA 3HPXA 3EWBX 4YXGA 5G5IA 3IV3A 5FEWA 2VEMA 3QYQA 3HG2A 5CSSA 2PRHA 1OFRA 2JGYA 4FX6M 3NQMA 2ATSA 3P62A 5F2GA 3A23A 4Z08A 4L4LA 3FIGA 5H91A 1VJIA 2OJPA 4UNLA 1YYAA 4WUIA 4N6FA 5FEPA 1NEYA 3PWAA 3F4WA 2ZZ6A 3OA3A 3L9CA 2VFGA 2NWSA 1KFBA 4QIUA 4JIQA 5LNVA 1W5QA 3A21A 3GB6A 3ZFHA 1H7RA 3W83A 1KFLA 3GAYA 4M5PA 1GG1A 4TIMA 2C18A 3TQ0A 4MLJA 3HQ1A 1VS1A 4FNRA 2YW4A 1JJKA 2PC4A 5BNKA 2WSQA 2YFOA 3Q37A 1AW1A 2WNNA 2NLIA 2DZTA 1AW2A 1JVNA 3MUXA 1ICSA 1XM3A 3QFEA 1L2UA 2WSRA 3P80A 1WYIA 1H7OA 5EBUA 3UYCA 1K03A 2Z2UA 1RVGA 2QCHA 4JY8A 1D9EA 2X2GA 3G3MA 1OF8A 5DXXA 2QCFA 5F2LA 4O10A 1D3GA 3ABSA 2A85A 1Z42A 3JR2A 1TJPA 3TJLA 5CPOA 3W07A 5G2IA 4N4PA 4ORMA 1XXXA 2ZRUA 4BK9A 5AHNA 3W73A 3S0CA 3EX2A 3LHVA 4PL2A 5D33A 4HN4A 2E6AA 3PUDA 3W22A 2HMCA 4LU0A 4IMGA 2B7QA 3B0UX 3NA8A 2J27A 4UFMA 3W2KA 1GYNA 3NNTA 3F03K 5F4XA 3Q94A 3R89A 3TCEA 3TNOA 3P8IA 3S1VA 3M41A 5D04C 3LDVA 4YMZA 3P81A 3NQDA 1IGSA 1SSDA 1XKYA 6ALDA 5HR7A 4GUJA 3HPZA 4H3DA 3NEVA 2EHHA 3N9RA 1I2NA 1VLIA 4LS0A 5AC6A 3DU0A 4Q32A 3S1UA 5L6UA 5A5WA 5C55A 5F2MA 3PM6A 3F4NA 3UXDA 1F7BA 4QISA 1M6JA 4XBSA 3S5ZA 1RQHA 1KV8A 3IVTA 3USBA 3W7NA 4O15A 1XL9A 2LLEA 3O16A 1F2JA 4JD4A 2VOMA 1UCWA 4JEQA 2F7FA 4N9CA 2VENA 1TIMA 4JTUA 3PUOA 4XUGA 1Z44A 3NQ2A 4HNTA 4HIBA 3E0IA 5IM51 4KWWA 1MZHA 4O18A 3M5VA 4HPXA 4S2BA 4K7VA 4WOQA 4DELA 4J9JA 4DF1A 3NQAA 1GVOA 3STGA 3OIXA 4ZL1A 5FESA 3YPIA 2WSYA 1DORA 1JCMP 4M19A 1H7NA 3Q2DA 2ZZ3A 2VXNA 1RD5A 2H8ZA 2QJIA 2GJLA 1JQXA 1JRCA 4O4VA 4RK8A 4NU7A 4Z0SA 3BLIA 3ATYA 2CLOA 1P1XA 4IXHA 4R33A 2Y89A 2YZRA 1DV7A 5FF0A 3HIJA 1JRBA 4RKAA 3E12A 3EX1A 3I65A 3UWUA 2VFDA 2VELA 1TYGA 1A5AA 1EUNA 3QPZA 3MYPA 1L6SA 2HSAA 2NZLA 4TX9A 4ZZ9A 5LZLA 3W7PA 5D32A 1JULA 1KFKA 1YXYA 3QMSA 4QNEA 3HG5A 5HMSA 1QOQA 3G22A 5U7SA 3THAA 3A24A 4UTTA 3NVTA 3CPRA 4UIOA 1WV2A 4GXMA 4CCCA 1OX6A 1QPOA 2VC6A 3ZWTA 3MHGA 2H8XA 3CB8A 2Y85A 3NL2A 4RX0A 1H51A 1W3IA 3OG3A 3W7OA 4DBDA 4RZ6A 3I7SA 4RXFA 3WJXA 1I2OA 3O6DA 2AQWA 1ZALA 3EXRA 4ZVJA 4MJMA 2FFCA 3MW7A 4H4IA 3NOEA 2QDHA 4ML9A 3SW6A 4JX4A 3LHTA 5D03A 3WK0A 3CEUA 4Y9AA 2QR6A 1PHQA 1K02A 4LRSA 3S1WA 4ZQMA 4XWUA 1OX4B 2E6FA 3G1SA 3TK7A 3BW3A 1OYCA 1KTCA 3NL3A 1TQXA 3GDLA 3G8RA 4UTUA 2XN1A 1G4SA 1X1ZA 3FYOA 2Y88A 1TTPA 3ZR4A 3W23A 3KX6A 4Y8FA 4AB4A 1EWDA 5K4ZA 2WO5A 3GKAA 3WJYA 3W2JA 4IGHA 5D2YA 3A9IA 4O4WA 1TPC1 1B9BA 4IJBA 1NVMA 5U4NA 4LY8A 4O57A 4Q33A 2GPTA 5EL1A 2VEIA 1ZY9A 3NAVA 3QQ0A 1DOSA 4AMAA 3UPWA 1A5BA 3DGRA 3IRDA 3UWZA 1EUAA 1GOXA 2QCNA 2I1OA 4NJKA 2YFNA 1FWSA 2BZNA 4NX0A 2NX3A 4O53A 3O63A 1TO3A 3FOKA 3T7VA 1YPIA 3KRZA 3WJZA 5C2XA 5AHFA 5TQLA 5DN1A 1W0MA 2ZA1A 3BV4A 1R2RA 4O1AA 3MI2A 4UTHA 3LBCA 3TXZA 1K3UA 2DZUA 4X3ZA 3H54A 1X7FA 4JS3A 4MFEA 1WOAA 1W56A 5G2WA 2C6QA 5KZMA 3TA6A 2JKAA 3HJZA 5CPMA 2OX1A 3NYZA 4RZ4A 4WOZA 2QCGA 3B06A 3TW7A 4JXCA 1IIGA 1HTIA 2GVGA 2P0OA 2J9YA 3PULA 4O54A 3MP5A 4A21A 1XDMA 1WBHA 3ANYA 1S5WA 1O60A 1FWRA 5AHEA 3TC7A 4P2VA 1H61A 3QJAA 4MPQA 2X16A 3GDRA 3QQ1A 2ZRXA 5BMWA 1XC4A 2WQPA 3LCWA 4NX5A 5GVJA 1PVNA 2O7SA 3DBPA 5AB3A 3GNDA 1KTBA 3NQFA 1O5XA 5BRBA 1OFPA 1Y0EA 1HFBA 4GUHA 2VFFA 1D3HA 1FCQA 1SW0A 2A0NA 4UTIA 3LM7A 3TMLA 1W5NA 2O7QA 3VE7A 1M5WA 3OVRA 3BLEA 1UB3A 1WOBA 3DHDA 1T96A 1F5ZA 4QNWA 1B4KA 3DFNA 3MWAA 2H6RA 3CEPA 3H53A 5D2XA 4ADTA 3NR0A 4RZ5A 1UUOA 1ME8A 1NF0A 2BWGA 4CQAA 1C8VA 1NF7A 1OF6A 4FHAA 5D2WA 3RU6A 4WD0A 3IGUA 2BTMA 1XDLA 4MJZA 2E5BA 5F1UA 4E2DA 5CG7A 1MO0A 2QJHA 1G6CA 1L6YA 4FNSA 4Z1AA 1ZCOA 1WQ5A 2EAWA 4NJGA 4UTKA 4YCOA 5EA9A 2KZHA 4JTTA 4Z1DA 3M5ZA 1OFEA 4O50A 2WJZA 3FEMA 4IX0A 4OE7A 5KINA 4WQ6A 3NO5A 3GZ3A 1W3TA 3W84A 1H7WA 3U6WA 2E6YA 1H63A 3CT7A 2FDSA 3QM3A 5K7JA 4NJJA 3P5ZA 5AHLA 3W7EA 4K6AA 2DJLA 1J4EA 2FPVA 3W75A 4AF0A 3S5NA 1QFEA 2ZZ4A 3PAJA 3T78A 2NWRA 1P0NA 2CZFA 4K8EA 3QSRA 4L4MA 4LVDA 2WV8A 1UBSA 3DFTA 4WY0A 4UFJA 3IIPA 1PV8A 4AAJA 4DF0A 3G1XA 2B4GA 4JICA 2QF7A 3IIVA 1DKWA 3B0VC 2TRSA 3B0PA 5EYWA 2RDTA 2QDGA 4R34A 1QDSA 5AHMA 1OFOA 3W76A 5I3HA 5LKYA 1FXQA 3TSBA 1IIHA 2CLKA 4Z1CA 1RPXA 1W37A 5CSRA 3PY2A 4LRTA 1VR6A 1SW7A 1EB3A 4KFPA 3TC6A 3STEA 3BG9A 4IXXA 4C1LA 1ME7A 2ZFAA 3DFOA 2A1YA 1G4PA 1LBMA 1Q6QA 3EXTA 1U5JA 1T8XA 2V30A 1TPEA 3L0NA 3LHYA 3GR7A 4H6KA 1JCNA 4LV4A 1RQBA 1ZNNA 3W71A 4O8RA 5G1YA 1MEHA 3I6RA 4LVBA 1DQXA 2ZA3A 4N6EA 4AWUA 1LOLA 3BARA 2YDAA 3A5FA 3QPYA 3CM4A 1VQTA 4N02A 2A6LA 1HO4A 1RV8A 2CLLA 3M0ZA 3MHUA 2E1DA 1N7KA 3HGSA 4O0ZA 3RLUA 3GK0A 2ABAA 2ZBTA 2FIQA 2RDWA 3LRLA 1QPRA 2CLIA 1O5KA 3G8EA 3DKLA 4HPJA 4R53A 3W7DA 3UNDA 4LUJA 1Q6LA 4PA8A 3W1LA 4Q4KA 2H3BA 2OT0A 2HS6A 3G1FA 5FF3A 1SO6A 3WJSA 3D0CA 1JUKA 3IIOA 3IIXA 3LXAA 4IX2A 5F1VA 5I3GA 5H2ZA 2WKJA 3W7IA 4E38A 3QW4B 1OK4A 2QJGA 1OFAA 1ICQA 3KXQA 2OMAA 2YPIA 5MHBA 2B7PA 1SQ7A 3BO9A 3B8DA 4IPJA 4EF9A 3S5YA 4LUIA 4NXSA 1PCWA 4ZQOA 2GQ9A 2Y62A 1VCGA 2R94A 1SO4A 2EPHA 1Z48A 4XKYB 3P84A 2QUVA 3N73A 2V2CA 4UTWA 5DCEA 2V5LA 3UQNA 4FXRA 1A5SA 4WJEA 3R8RA 2WPBA 4NT0A 4TR9A 3WJWA 1KV5A 1X1OA 5C5YA 3W74A 4OBTA 2BLEA 4I9AA 4HNNA 4Z0JA 1YDOA 3EX3A 5AC7A 1N55A 3L0KA 4JTKA 2P1FA 1FCUA 3CU2A 1I4NA 3MBFA 3P7YA 1F05A 1TPUA 4UXDA 4PTNA 1W5OA 5DY3A 3F1QA 4LC6A 3TXVA 5C6MA 2HTMA 1A53A 1YXDA 2J9ZA 4IMEA 4ONVA 5HWMA 3VI2A 1YDVA 1GJPA 2AAMA 5D02A 3S42A 4HHPA 4DO4A 2ZTJA 3W1AA 4K36A 2ZYFA 4HSOA 1G4TA 1PE1A 3MI6A 4WXYA 3GR8A 3T44A 2BXVA 4UNKA 3KHJA 1H50A 3G24A 3EWUA 3PG8A 2H90A 1GT8A 1JCLA 2Y7FA 3R2GA 5CZ0A 1CI1A 1G67A 3ABQA 2ZZ7A 2J9XA 3DFPA 3QEZA 3JRKA 4X2RA 1G7UA 3L5LA 3MHFA 3GAKA 5I3JA 5CZSA 4UR7A 1R46A 5D09A 1FUYA 2QAFA 3SJ3A 3WK3A 3TMQA 2TMDA 1F6KA 1OX5A 3AJXA 1EPXA 1SZNA 3QC3A 5LNUA 3L21A 1A5CA 4AHOA 1FDYA 2NV2A 1R2TA 3UY8A 5K9DA 1FCBA 4BR1A 4JGDA 5LNSA 5D30A 3MMTA 1S5VA 3KVJA 2G96A 4IWWA 3TE9A 3M1ZA 1UUMA 5F2IA 2ISSA 3CQ0A 3C2FA 4M7TA 4ADSA 1QOPA 1OYBA 4GFSA 3I68A 4GUGA 2V9DA 2YX0A 1GVRA 2ZZ5A 2PCQA 5KZDA 3B04A 1Q6RA 3L67A 2WOQA 4LV9A 3M16A 1V5XA 1FDJA 1GTHA 1QAPA 3QRHA 3EKZA 3R5EA 3TJXA 4UTTC 2FPYA 3C2RA 3EKLA 2EF9A 2Y61A 2ZTKA 5HQEA 1TCDA 4N4QA 3P74A 3INPA 4LWWA 3C52A 5EMUA 4O16A 2V0TA 4JTEA 1I2RA 1WX0A 5FI8A 3E49A 3HO8A 3RLVA 3MYOA 5FF4A 2JBMA 4QSHA 1ME9A 1VZWA 5TBOA 1K8YA 3FLUA 2QCMA 3ELFA 2CU0A 4KWVA 5CKSA 3QH2A 4ORIA 3W1TA 1AG1O 3EEGA 3BK0A 4HNUA 5E0KA 1VGAA 3LI0A 1Q6OA 3MBDA 3UWQA 3W7CA 3C0JA 4LW7A 1LORA 4IMCA 3MO7A 3FJ6A 1X8FA 4UMAA 3KOFA 3Q58A 5AYYA 1OABA 4TMBA 2ZRWA 5DELA 3GDKA 4O17A 3LCLA 3OVPA 2EKCA 3E02A 2WNZA 3VE9A 3M6YA 2Y70A 3FKKA 2FQIA 3G1AA 4MY9A 3C8FA 3U2OA 1LOSA 4FX7A 3C4UA 4FEZA 1H60A 1VYPX 4HT3A 1XBZA 4RCXA 3TUUA 3DZ1A 1LRQA 1QNVA 3NPUA 5DBUA 2FTPA 5LHEA 1NFBA 1ONRA 5AOUA 1GTEA 3M9YA 4BI5A 4JR5A 3W1PA 3TKFA 1NAL1 2E09A 1TPWA 2DZVA 2A2IA 4TO8A 4LS1A 3W1QA 1IXOA 3HBLA 1HG3A 3NQ8A 1G69A 5C54A 5F4WA 4RXGA 3TU9A 1YLVA 2VEPA 5G1TA 3W7HA 1IF2A 3CLMA 3LV6A 1PIIA 3JS3A 3NPWA 3ZS4A 4O1CA 1XCFA 4I7WA 1W31A 3EX4A 5J5RA 4TU1A 2DZSA 4YL2A 2ZRVA 1W5MA 2OZ0A 2I9EA 5AC8A 2A4AA 3LCHA 1KA9F 3AO0A 4CLMA 1LRTA 5IBXA 1GG0A 3PG9A 3G0SA 1EP2A 4XTIA 1TPVA 4NQ1A 4A3UA 3M43A 4K7YA 4WX2A 1JUBA 4O52A 1SZEA 1J2WA 3EWWA 3IGXA 2Q8ZA 1K8XA 2G97A 2H3DA 4UFKA 3THQA 1H1YA 4IMDA 4JYDA 1HO1A 1UJPA 3M5XA 4PCFA 1UASA 4MYXA 5EPDA 4GUIA 3M5YA 3W7QA 3HG3A 4JTIA 1K8ZA 4FO4A 3P5YA 1BTMA 1I2PA 3N19B 3NQEA 2V82A 4OV4A 3TIMA 1DL3A 1PHWA 2GQ8A 3BG5A 1GZGA 1YADA 1QPNA 4LT9A 4QM1A 4O0KA 3LLDA 3WK2A 4JTGA 4OT7A 4GWEA 4K8HA 1OVDA 3NQCA 3PBVA 5FF2A 1KBJA 4EIVA 1HL2A 2E77A 4CNNA 1BWKA 4S1FA 1PCKA 1EIXA 4O19A 3B03A 3NL6A 2ISWA 3SSJA 3NM3A 1VH7A 3R13A 4N2YA 5AYZA 4JX6A 3PS7A 2QCCA 1LTDA 4A29A 2JGQA 1THFD 1QWGA 2X30A 3FA5A 2CWNA 5EY5A 4R7JA 5BOOA 4GE8A 4ALDA 4O12A 3TX9A 3EWYA 4MY1A 2V8ZA 2R14A 5CGQA 1TMHA 2CLMA 3HPSA 1FX6A 1BWLA 2PE4A 3PSWA 2FLIA 1VPXA 3W2UA 4CQ9A 4KFNA 2VFHA 4Z1BA 3HMJG 5HUOA 2YSWA 3STFA 2BSLA 4LVAA 1YTEA 3BG3A 3O05A 5I3KA 1LBLA 4PEKA 1JCYA 1VHNA 3G1DA 4WZHA 5D37A 3PBWA 1KM2A 1VYSX 1I2QA 3W7MA 4JTJA 1P5BA 3W86A 2QCDB 3LOTA 4FF7A 3TR2A 3L65A 1TREA 1ML1A 3TW6A 3NQ6A 3VFLA 1BKSA 3GXTA 3DAQA 4QAIA 3W87A 3P8JA 1OFQA 5D38A 1KM3A 4DO6A 2OCZA 2DZXA 7TIMA 3LHWA 4DQWA 1C9DA 1O94A 1LLWA 3P61A 1VCFA 3HB9A 1JR1A 2Q3RA 1K7XA 1OHLA 2NXIA 1ZAJA 2V2HA 1TV8A 2YYUA 5LHFA 3KFTA 3LB0A 3IIZA 1CX9A 2W79A 2Y7GA 3BW4A 3FS2A 1A50A 2Y63A 4LOCA 2GVJA 2VEKA 4CNOA 1JQVA 3U8GA 1EWEA 2ATMA 1F74A 3GDMA 4GC4A 1DQWA 3NPXA 1KFEA 1XFBA 4QITA 4MZ1A 4HKPA 4IPIA 3DXIA 4IMFA 2DP3A 4JYFA 3W1NA 1LOQA 4RLIA 5K9XA 5HWNA 5DLCA 4NNCA 1YTKA 2NUXA 1E51A 2E68A 1B57A 4N9EA 4QQ3A 4O14A 4XZ9A 3TAKA 4FXSA 3IEBA 4UTLA 1KLZA 1LCOA 2C14A 3B4UA 3W9ZA 1ZHAA 3IVUA 1XBYA 4K38A 1W5PA 3PF3A 2QEZA 4PH6A 4WY0F 3SR7A 4GNJA 3UY7A 1FCVA 4PL1A 1ICPA 2NV1A 1FWTA 3LTSA 2DZWA 3W7KA 2JK2A 3W7LA 1O95A 4O1DA 5BW6A 1OK6A 1SSGA 4UFLA 1P4CA 1PS9A 3MJYA 5FEZA 1SW3A 2QUUA 3N2MA 2RDUA 3BVJA 4BF9A 2Z0IA 1QR7A 4UTWC 2CLEA 1QO2A 3PBUA 5FF7A 3IGSA 4JN6A 3EB2A 3V75A 4DPQA 3LXCA 1SO3A 4BFAA 2Z1BA 1TSIA 5HUPA 5A8GA 2W6RA 1PL9A 3QW3A 2RH9A 2ZRYA 1LRNA 3EXSA 2E5DA 4AWTA 3P67A 3C6CA 4M7SA 5CPNA 3RF9A 3QMRA 5D2TA 4W9TA 2ZQ0A 1VRDA 1EEPA 5LGZA 5CZJA 5HINA 4PODA 3LHZA 2VFEA 2NUYA 3S8HA 3RFAA 4BI6A 3OVQA 2B7OA 4UMBA 4AEOA 4JTSA 3L2IA 1KM6A 2QCEA 1C29A 4FB7A 3M47A 3BW2A 3O15A 4LVGA 1TB3A 2C16A 3NG3A 3I7QA 3DENA 1TQJA 4ZQPA 2NUWA 3G1VA 3KVMA 3LBMA 3GDTA 3LXBA 5DY2A 2FPTA 2VFIA 1L6WA 1LBFA 3TV8A 3RMJA 3A22A 1W1ZA 1ADOA 3PVFA 2ABBA 4BWLA 3T4CA 3CTLA 3UPBA 4S2CA 4OQVA 4RR4A 1EA0A 4IQLA 4A2RA 1VYRA 5LNRA 3VCRA 4M6QA 5LNWA 1O4UA 4JY9A 4UFHA 4GBUA 4I7UA 3KVKA 5G2HA 2R91A 1AK5A 1R30A 3QSTA 4AHPA 1GQNA 2C1HA 4ZQRA 4FX8A 3HGRA 1J5TA 2ISVA 4NNAA 4DXVA 4I7VA 5T26A 4KFOA 1I8JA 1K7FA 1VC4A 1DJNA 4Y6GA 3CC1A 4MYAA 4MOZA 5SWUA 3L0GA 1G4EA 3SIZA 4IOTA 4POCA 4K37A 4DF2A 1KTNA 2EGZA 4JTFA 3G1HA 2RFGA 3LX9A 4NJHA 3KVLA 4FNUA 1P0KA 3N14A 4D2JA 3W72A 3CIWA 4JDYA 3RNDA 3LRKA 3O07A 3MI3A 4HNVA 1B3OA 4O28A 4YWIA 4N9DA 1TTIA 2ZZ1A 3UWVA 1DVJA 1SZGA 1TTJA 4MKNA 2C19A 5BMXA 2YCEA 3R12A 4ZQNA 3W7GA 2JKEA 1AMKA 2W0UA 3DFSA 2ALDA 4MIMA 4AVFA 4NJIA 2GJNA 2RHGA 2GOUA 1TRIA 4EWND 1KFJA 2TSYA 1S3HA 2C0AA 4YCPA 4NXKA 3CWOX 4M6VA 2TYSA 1BEUA 1W3NA 3C56A 4MZYA 3W7JA 4P61A 1WA3A 1MXSA 3NPVA 2UV8G 3TFXA 2NX1A 3SGZA 4M6PA 3STCA 1K7EA 3MP3A 4G1KA 3TROA 1R47A 2XN0A 2QAPA 5G4EA 3LGEA 2GVLA 2E5CA 3B05A 1LYXA 5D05A 4O13A 4MLRA 2X1TA 1FQ0A 2D73A 3TSMA 4UTJA 1U83A 5FEXA 2GQAA 2PURA 1QPQA 2ZRZA 1JCJA 1B4EA 1LDCA 1GWJA 1M7PA 1RR2A 4JDBA 2B0MA 3I7RA 4XKYA 4OGZA 3C2VA 1GVSA 4C1KA 4RJEA 1SR9A 3WK1A 1L9WA 2DORA 1GVFA 3ATZA 5E1QA 4MZ8A 3C3NA 3W88A 4DBEA 3N34A 4OV9A 3C61A 3W2NA 3O6YX 5E93A 2YR1A 3TAOA 3M7WA 1KLYA 1H1ZA 1T0OA 3V1PA 1FY6A 1KM5A 4IUOA 3BGGA 2XFWA 3UWWA 3SZ8A 3O1NA 4UR8A 4E2BA 4FNTA 4DPPA 3E9AA 4WXZA 3W70A 4XBKA 3G18A 5CPLA 1TPB1 3L5AA 1G7VA 3HF3A 3OBKA 4HSNA 3WFAA 3NQVA 3MP4A 1ZFJA 3TQKA 3NGJA 8TIMA 4MVAA 5IBXC 1QO5A 5TIMA 4NZJA 3O8AA 4O11A 2Y6ZA 4Y96A 3PB0A 3GLCA 2GUUA 4EVZA 1SPQA 5K3VA 1H7XA 1VHCA 3W1RA 1ZJIA 3FJLA 4E0CA 2FB2A 4DEFA 1AL7A 1MSSA 4JNMA 4BI7A 5HR6A 2E6DA 4NVTA 1SFJA 2ZA2A 4LTSA 3DH7A 1LLZA 5AHIA 3UZ5A 4RV8A 2X1UA 2NXGA 1FBAA 3QMTA 3GNNA 1SUXA 3E96A 1F6PA 1EP1A 2JKPA 1AL8A 1ZENA 3LCFA 1MEIA 3GKFA 2PRMA 1KM1A 2NXHA 3EWXA 4FIQA 5I3IA 1SO5A 2Y7EA 5D2VA 2DU2A 2QKFA 3VKJA 1OJXA 2V2DA 2IQTA 4XTDA 2CLHA 3S6DA 4PFMA 4UMCA 1KFCA 5HULA 3CHVA 2ZDRA 1YDNA 2B7NA 3EWZA 3TH6A 1WXJA 1V7YA 2X1SA 3DI0A 3SFKA 2A7RA 3LTPA 4NZFA 2Q3OA 4AH7A 2YW3A 3NXFA 2J6XA 5AN7A 1KBIA 4FNQA
chains in the Genus database with same CATH superfamily
1HJQA 2FB3A 4DIAA 3G0UA 3NQ7A 4LNYA 3CIXA 1JFHA 1H1NA 1M03A 3ITXA 1JZ3A 3AWOA 4UNIA 3T2OA 1OFBA 4XVEA 3MKKA 3GXNA 4M6UA 1GZJA 1XIFA 5HMDA 4FP1A 3ABOA 2ZWZA 4YWSA 3LTYA 5A6TC 4MUZA 1FFQA 1OYAA 3D46A 2ZE3A 4FIRA 3WMLA 2Z6IA 4LUTA 2RGLA 3G0XA 1Q45A 4PC8A 1KW1A 4LS2A 4L61A 4WCJA 1U30A 3UWYA 1G0CA 3E2RA 4L4OA 3QGKC 5E0FA 3T8QA 2J74A 4EX4A 2XSAA 1QW9A 3GXIA 3VTRA 4PR4A 5A6AA 4LC8A 4P7QA 2XVLA 3QLLA 3TN6A 2ZVIA 3VX0A 1XI3A 4BEQA 1LM1A 3WQWA 1VENA 3NM1A 2OGYA 3RX4A 4GRSA 2HBVA 4D6CA 1FA2A 1NDWA 4LF1A 3GYEA 3ZJ7A 3CQKA 1V6TA 4GJIA 1RZMA 3TP4A 1DHPA 2R82A 4GMEA 3VD5A 3FHAA 3GIYA 3BQ6A 3CJPA 5EKYA 1Z8AA 4OUIA 4HJWA 3CO4A 1FWGC 4KIRA 1VCVA 1SU5A 2E8ZA 3DI1A 3ABRA 1S5TA 3H55A 1KQZA 3UR5A 1UMYA 3LI1A 3GH4A 3ZSSA 1V3KA 4O1FA 1IXPA 2E9BA 2F8QA 3N9SA 1CPUA 3G3DA 3PZUA 2NX9A 3GW3A 3VZYA 1LF1A 2NV9A 4AHQA 3SCPA 3MSDA 4A22A 3DECA 3B40A 1AODA 1NSJA 1BYAA 5CCZA 1RUSA 1ZP4A 3LLFA 1FP9A 1ODZA 3OP2A 5K4XA 5FCZA 3D3FA 3N29A 1JPHA 3I6EA 4O1EA 1HUVA 1OC5A 1AW5A 3PB2A 1E9ZB 3LHUA 1Q6FA 3BGJA 1XBXA 5K2ZA 3KBNA 2XN2A 1TV5A 1F4AA 1M7OA 2Z6JA 3SADA 2WCAA 3AS2A 3WMCA 4B5NA 3POHA 3UR7A 2V5BA 3AQUA 3V0SA 4GK8A 3EMQA 3HOJA 5J5DA 1RP8A 3O6CA 4IG2B 2VKZG 3SY1A 1OG6A 4JX5A 3TQVA 2PWVA 3S1XA 3RG6A 5L9FA 2PDLA 1ZAHA 1DJYA 4I90A 4TTGA 1KM4A 3KRBA 1TPFA 3BLFA 3BQ5A 4X22A 3RILA 3UD6A 3WH8A 3MDUA 1KXQA 4BWLC 3WQVA 3S5OA 2G5WA 3O7UA 3ITTA 3PK7A 3BLKA 3SCUA 4TUFA 1E3XA 2CLFA 3PNZA 3DKJA 1QMLA 2CZEA 3H22A 3OEXA 4XSLA 4ES4A 5KMYA 2PTXA 1UR8A 3N17A 3MU7A 1WPCA 1UD4A 2XH4A 2QZRA 1UZDA 5CSSA 3B9EA 4HHMA 2JGYA 1C8QA 1P48A 2Z28A 2ATSA 4L4LA 4WKAA 4Y9OA 4Y8EA 2CHRA 1VJIA 2OJPA 1YYAA 1R38A 4Q4RA 4WUIA 4N6FA 1C9WA 1CGTA 3F4WA 2EO7A 3ZLGA 3L9CA 2FGLA 3NTYA 4JIQA 3UP8A 3PWGA 3B97A 1XH2A 3W83A 4HHHA 1GG1A 1NDYA 5A2AA 1VS1A 3AU6A 1V3IA 3B8SA 3VIOA 2YW4A 1JJKA 2WSQA 3TLLA 2PP0A 4AMCA 3V5FA 2Q09A 1JDAA 1AW2A 1R9ZA 4W84A 5HPOA 1A5MC 3CUHA 1XRFA 1K03A 1V0MA 3TN3A 2Y0FA 3W0KA 1F8IA 4XAGA 2VC5A 1K9EA 3MT1A 3BTNA 5F2LA 1D3GA 1E1CA 1FWAC 4ATDA 1ZJAA 1Z42A 3JR2A 2BMBA 1XYFA 4LCSA 4IGMA 3W07A 1XDJA 5A2BA 1HJUA 3W73A 4RNIA 4JL1A 1U1HA 3LHVA 4QHRA 2QJMA 4DHGA 4NSBA 1XICA 4LB4A 5A94A 2HMCA 4LU0A 4RNFA 4IMGA 2B7QA 2J27A 4UFMA 1GYNA 3F03K 5F4XA 3CL8A 3L4WA 1EGZA 4XZLX 3TCEA 1C91A 3LDVA 3NQDA 1XKYA 6ALDA 3RHGA 4H3DA 2O56A 3GG1A 4DY1A 4Z1YA 3R6IA 1OGSA 2OTDA 1V77A 5A5WA 2PZ0A 4PMUA 3PM6A 2BXYA 4GVIA 3PFRA 1NOFA 3F4NA 1OSEA 2WBGA 4XBSA 4U33A 1GOIA 1VPYA 5JIWA 1XL9A 2QQ6A 3KM8A 2E25A 1F3TA 1RAKA 3SO7A 3SRDA 4AQLA 1KRBC 5E9XA 1FTXA 1WKFA 1SMDA 1XLFA 4CD5A 2DV0A 4FPSA 2BBFA 5BYWA 1KXHA 3OODA 3RLHA 1CXIA 2PLKA 3CAQA 4KWWA 2Y1HA 3M5VA 4S2BA 4K7VA 4PMDA 1WDSA 1I9CB 1E6NA 3H7UA 4KGLA 3SN0A 3STGA 4D8LA 4XD4A 1DORA 3VDHA 1E5JA 4PMRA 1B3VA 3T0AA 1WZMA 4ACYA 2QJIA 2GJLA 2PDKA 1VFFA 5ENLA 3KWXA 1UWQA 3UR8A 2VCBA 3UJ2A 2CKRA 2XWEA 4QEHA 4P8WA 4LCQA 1XGDA 1Z9AA 2YZRA 3FAXA 2AQOA 1J01A 1TYGA 1A5AA 1EUNA 3QPZA 2WMIA 1J18A 5LZLA 1UKPA 3QMSA 1MW3A 4QNEA 2ZADA 1QOQA 3G22A 4ZBCA 1SJCA 1MI3A 2HNEA 3IS4A 2I5QA 3F5LA 1XLEA 5AZ0A 1WV2A 1FHDA 1OX6A 3A4XA 3MHGA 4HA3A 2H8XA 4FF5A 1Z89A 2D23A 5D8WA 1H51A 1UH4A 3OG3A 4DBDA 4MAVA 4D6GA 1W9UA 3BDKA 5I0DA 2OX4A 4ZVJA 1EQCA 4H4IA 3SW6A 4F79A 3OZYA 4JX4A 4MTVA 3SCNA 5D03A 3WK0A 1JNDA 2VGIA 4UCFA 2OOGA 2ZDSA 1EHNA 5E09A 2PWFA 4PN2A 4ZQMA 3S1WA 1UR0A 2IPFA 4G7FA 2E9MA 4GYJA 4UTUA 2XN1A 1G4SA 1TTPA 3ZR4A 5FKYA 2WMFA 2OSWA 1CXHA 2WO5A 3W01A 2YB4A 4O4WA 5ECVA 3I10A 1D8WA 4PUNA 4LY8A 1ZY9A 3NAVA 1HN1A 2HISA 2ZC1A 3PZQA 1ZB5A 4IICA 3K4WA 2QCNA 4NJKA 1E1FA 1TO3A 3T7VA 3CIVA 1AH4A 2FH8A 1JL8A 1W0MA 3QY6A 4I8YA 3QR3A 4KT2A 3O0KA 2VTFA 1PPIA 1K3UA 2VZSA 3IJ7A 3KL0A 2DZUA 3VFCA 2C91A 1XIJA 1W56A 1NWTA 1B9ZA 2XIQA 3TA6A 5FSEC 3RO8A 3NYZA 4RZ4A 4XSMA 3B06A 2XUCA 4JXCA 4S3BA 4QLKA 1HTIA 2GQ3A 2PF0A 5DRCA 3PULA 8A3HA 2PAJA 3II1A 4O54A 3T42A 4A21A 3NSNA 1RH9A 3M0LA 3NSXA 3GS6A 1QATA 2WZEA 1PYFA 5AHEA 1FWRA 4QTGA 4HOWA 4W5ZA 3GDRA 4WDWA 2ZRXA 2PEVA 3K4DA 3WUEA 1M41A 4NX5A 2YZ5A 5HPCA 4DBUA 2Z24A 1M68A 1XLKA 3R4IA 1UR4A 3UA3A 3VXGA 1XH1A 3FYYA 1HFBA 1ZSXA 1D3HA 3OBAA 3UF9A 3LM7A 3XIMA 5BOFA 3VE7A 3MB9A 1F5ZA 3DFNA 4HYRA 3CEPA 5D2XA 4ADTA 3UBPC 4QDPA 2Y5JA 3BJFA 3CZEA 3AUOA 1UUOA 5JUVA 2BWGA 1IGWA 3ITGA 1HL8A 1AD1A 4FHAA 4WD0A 3S2LA 4KCVA 4TX6A 4MJZA 3KS5A 1NJJA 1TVPA 1EFZA 5F1UA 3HMCA 3VUPA 3H6OA 1JDFA 1XW8A 2HK0A 1ISWA 4YCOA 4NJGA 5EA9A 2QGYA 3AMGA 3VC5A 1XRTA 2I56A 5KINA 4WQ6A 3NO5A 4PUJA 3LPOA 3L4TA 1H7WA 2E6YA 1XIBA 3CT7A 4JQAA 5K7JA 3DC8A 3P5ZA 1WCGA 3EPOA 4XIAA 2FMOA 2DJLA 1J4EA 1TVLA 3IWPA 5I02A 5BRQA 3AXMA 2J8GA 7CGTA 2VMFA 3V36A 3QSRA 4LVDA 1UKSA 2RGMA 3PZOA 4H1ZA 3UNTA 3S1GA 4BJHA 4ZCWA 6XIMA 1TZ7A 4AAJA 4DJEA 3GU1A 5EMJA 2QF7A 1DKWA 3K4AA 3B0VC 2TRSA 1F6YA 1RCXB 1PTGA 4R34A 2D3LA 3AIBA 3USZA 3TSBA 3ALGA 1W1VA 2J7GA 2PI6A 3N9KA 3PY2A 1VR6A 1SW7A 3IV8A 1EB3A 2BASA 1UBPC 2Q6ZA 1QRQA 2F38A 4HU4A 4S3EA 2P5NA 5BWAA 4IXXA 4C1LA 1ME7A 3M46A 1G4PA 1ZBKA 1QBAA 4XAFA 3MCNA 1HX0A 1WUFA 3N2TA 3GR7A 1BVWA 1H5VA 4H6KA 4NRSA 4LV4A 3SDOA 5HJYA 3FJNA 3I6RA 4N6EA 2IKJA 1LOLA 2AMXA 4NI3A 1PTAA 1IEQA 1RV8A 1KWKA 1R3YA 3M0ZA 1N7KA 3COTA 3RLUA 2FIQA 2RDWA 3LRLA 1O5KA 3W7DA 3DKLA 1O7AA 3UNDA 3SBFA 1C3FA 3W1LA 1EJUC 1IZCA 3KBWA 5FF3A 4JIHA 4AIEA 4MHBA 2HV5A 4S39A 4E38A 4GISA 1OK4A 2QJGA 4GINA 5DMLA 4P7OA 4CU7A 2HDJA 1EDQA 3GFXA 1SQ7A 3BO9A 3B8DA 4EF9A 1BSLA 1E0WA 1KR0A 1PCWA 2WVTA 1XYBA 1VCGA 1S2WA 2R94A 3A64A 2A3EA 3EKGA 4AD1A 4XKYB 4JHZA 4HD5A 4IIFA 4UTWA 2V5LA 3THDA 4NT0A 2PDMA 5C5YA 5AC5A 3MZNA 1YNPA 4RDWA 4HNNA 3A3XA 4H9MA 2VM8A 3AHZA 1YDOA 5AC7A 2JF7A 5GPRA 4KMQA 1F05A 3RRAA 2V6AA 1W5OA 4LC6A 5XIAA 1YXDA 1YDVA 2WMGA 4NG3A 4PTXA 4DO4A 3W1AA 2ZYFA 3OLGA 3P0WA 4DXKA 4WXYA 2PDXA 1LG2A 3GR8A 3T44A 3QBUA 4UTFA 1RPKA 5G1MA 1H50A 3AHXA 1D3CA 1KCZA 4R9XA 4XD3A 1US0A 2NQ5A 1CEOA 1CI1A 4J3UA 4B91A 3ABQA 3WD4A 1AH0A 5FJJA 3JRKA 1G7UA 3VOCA 3MHFA 4ZSUA 4XZHA 4UR7A 1R46A 5D09A 1XYCA 1F3EA 3WUBA 2TMDA 4P7RA 3AJXA 1EPXA 2VGGA 3PZVA 5LNUA 1FDYA 2NV2A 1R2TA 3UW6A 1X96A 3VIJA 1VRXA 5LNSA 3R25A 2XZ9A 5GNYA 1S5VA 3KVJA 4IWWA 1UUMA 5JMUA 1YW1A 1CWYA 1QOPA 4GFSA 2V9DA 3NFUA 4L65A 3B04A 3L67A 2WOQA 2B31A 3ZM8A 3E74A 1V5XA 1FDJA 1GTHA 3R7MA 2XM1A 3R5EA 5D9MA 3B9DA 1BVZA 3RO6A 3C2RA 1VEOA 2EF9A 3WIJA 1TCDA 3IANA 4QBXA 3WNMA 4AC7C 1OD0A 5I6SA 1WX0A 5FI8A 3KP1A 2JBMA 4F66A 1K9DA 2PDCA 2P76A 5TBOA 1TVNA 1R8LA 2W5FA 2CU0A 3VD7A 1ZU8A 3EA3A 1S39A 3BK0A 4HNUA 5E0KA 2HQAA 3LI0A 3T2QA 3MZ2A 2WMHA 4LW7A 3RM4A 1MW0A 4IMCA 4DZAA 4GC3A 3UG3A 4UMAA 1PTDA 4WK9A 4Q4QA 1E43A 3W37A 3GDKA 3LCLA 3E02A 4S3DA 2WNZA 4WKFA 2Y70A 1FWBC 1WE5A 5FJIA 1RY8A 1SFSA 2PDFA 4S38A 2EXOA 2WHMA 3N4EA 1XBZA 3DERA 3MCOA 4RCXA 3GXMA 4HZ7A 1GNXA 3IJQA 3SEPA 3NPUA 2FTPA 2YLAA 1ONRA 3ME3A 5AOUA 3M9YA 4BI5A 3W1PA 3MS8A 3PHAA 1TPWA 2A2IA 3EDFA 3APTA 5I06A 3IK4A 3HBLA 3CL6A 1HG3A 2OVLA 2FTYA 3AICA 1G69A 3NQ8A 2GJXA 4FOJA 5C54A 4RXGA 1GK8A 3QQWA 3M64A 2GUBA 3TU9A 3GFYA 1XRVA 2VEPA 4QX4A 2IUZA 3QYSA 4W7UA 3VMNA 3JS3A 4JKLA 1XCFA 3EX4A 5J5RA 1W3LA 2ZRVA 2QVNA 1FHLA 1HKKA 1N2VA 1QI5A 2OZ0A 2W27A 3AS0A 3EPMA 5AC8A 1O5QA 2F2KA 1HJSA 3V1HA 1SFTA 4CLMA 5C9ZA 5IBXA 1H41A 2CBUA 4AZHA 3CTTA 5LXXA 4A3UA 1E4MM 2ZIDA 4K7YA 4DO7A 4O52A 3UZXA 4H8HA 1EO7A 1PWLA 5IDZA 2E67A 3IGXA 3THQA 2H3DA 1H1YA 1TWZA 4ZR8A 3AXXA 1LUCB 4RE2A 1HO1A 2PP3A 3SQSA 4NY2A 4PCFA 3K2GA 4CD7A 5EPDA 2CWXA 4JTIA 3P5YA 3N19B 3TIMA 4J27A 4R88A 1DL3A 1PHWA 3QZ6A 4Z2JA 3U2CA 1QPNA 3H2NA 4M3PA 1J79A 3ZJ6A 4LSBA 1DIKA 4O0KA 3LLDA 1W9PA 3VCNA 4TQTA 4QCFA 4KRZA 5FF2A 1KBJA 4JN7A 1HL2A 1X6LA 3FVDA 1BWKA 4X9YA 1PCKA 3UR2A 2D2HA 1PB0A 5CBIA 2D0FA 4MNKA 4DZIA 3K8KA 2PB1A 2ISWA 1E9LA 4JFSA 3OLEA 4HCHA 5HDRA 2VO5A 4DXXA 2J7CA 2Z29A 4LJ3A 4OFCA 4O12A 3M7SA 4DYKA 2ZX8A 4QE1A 2CLMA 3NJ3A 4H9XA 3CV1A 2PE4A 3PSWA 4C6DA 3WLSA 4FSAA 2BY0A 2YSWA 3STFA 1YTEA 5I3KA 1DXIA 3SM0A 3WEMA 2UY2A 1R6WA 1JCYA 5JVLA 4WZHA 4ZGYA 3E5PA 3TN4A 1KM2A 1VYSX 2VVSA 2DVUA 2PCEA 2QCDB 1CECA 2WZMA 4MB3A 3BICA 1HKMA 3C8NA 1ADDA 1R85A 4UZSA 3VFLA 2BG5A 1E0TA 4QAIA 3W87A 5GJPA 4DVOA 1OFQA 2QS8A 4LH8A 4DO6A 1Q6DA 4DQWA 1C9DA 4XO7A 3FHQA 2WCSA 4KERA 4LEQA 4MMWA 4QDWA 2OWWA 1JR1A 2Q3RA 1OHLA 1ZAJA 5CJMA 3AJ7A 3KFTA 3IIZA 4QG6A 4IIHA 1CX9A 3GVWA 2I5IA 4OKDA 3FS2A 3S9ZA 1OQFA 4LOCA 3I4KA 3CUJA 4CNOA 1WAWA 2ATMA 3WLLA 3PJUA 3VM7A 2R9RA 3NPXA 4RDYA 4QITA 4L6HA 3WH9A 3GUGA 1LOQA 2DY3A 4OBRA 1BYCA 3ARXA 5DLCA 1TJ2A 3ITOA 2ZKMX 4NNCA 2RAGA 3TLQA 2DH2A 2NUXA 1PIGA 2E68A 3IEBA 1W9DM 4MG4A 4DAFA 2PDWA 4G7EB 4GYPC 3PZTA 4PH6A 4WY0F 3OU8A 4GNJA 3UY7A 3MKCA 2NQJA 1ICPA 3EOOA 3K8MA 1FWTA 3LTSA 2DZWA 3WELA 1GKRA 4MJ2A 3W7LA 4O1DA 5JH2A 1BFNA 5FEZA 4TVUA 4JQ4A 4BF9A 4HTYA 1I60A 1QR7A 2CLEA 4DJFA 3UJSA 3PBUA 5FL0A 5I5RA 1SO3A 1TSIA 5HUPA 1FH9A 3DYMA 1FWDC 1LRNA 4HVXA 1YHTA 2E5DA 4AWTA 3KZPA 4G56A 4L1WA 4GCXA 1XH0A 3RF9A 5IOBA 3LGDA 3EOSA 2VR5A 2VFEA 2NUYA 5IXEA 1VFSA 4JTSA 3ENLA 2HCVA 4F48A 1UIPA 3P0XA 1VEMA 4OOZA 2NUWA 3G1VA 1PEZA 3N12A 2VFIA 1RLCL 1HIZA 3A22A 3BAIA 2VX4A 3T4CA 2XVGA 3DG3A 3TJIA 1E56A 2J62A 3UPBA 4OQVA 4IQLA 1BXNA 1GKPA 3LLXA 4QS5A 4M6QA 1O4UA 3TJ4A 4GBUA 4AZ5A 2YDQA 1B30A 2V3DA 3QSTA 3DN5A 4FR6A 4J3ZA 3WBXA 3HGRA 2R1KA 1A0CA 5AYIA 1UP2A 3KTSA 3S6TA 3T0CA 5HXMA 1XD0A 3CC1A 4Q8TA 1HP5A 4MOZA 2Y8KA 3I3DA 3L0GA 4L6DA 1JZ8A 4K37A 4LXFA 4DF2A 1PZ0A 5A1AA 4JPGA 2INFA 3N6HA 2QPSA 1TX0A 3G1HA 4JTFA 3TONA 5I07A 2RFGA 4FNUA 4J3TA 1P0KA 3N14A 4D2JA 3W72A 3WLRA 2E4TA 3RNDA 3LRKA 3LBOA 3O07A 4QJ5B 2BDQA 4O28A 5A6JA 3VGGA 4N9DA 1TTIA 4GCAA 2ZZ1A 2CBIA 1SZGA 1TTJA 1XSJA 4MKNA 4HA0A 2YCEA 3W7GA 4NHVA 3QZAA 3F4CA 4MIMA 1BWVA 2ZVRA 3LK6A 3IAPA 2X41A 3W26A 3RMEA 3HN3A 1S3HA 2C0AA 4M6VA 4G5DA 1IEIA 4DUOA 4AY1A 2IKIA 1HJVA 2GFTA 1MXSA 2QHAA 3BV7A 3SGZA 5DMMA 4BCEA 3H21A 1K7EA 5G4EA 4GQQA 1A5NC 1HNYA 2UZ9A 1LYXA 5FJRA 1DJWA 1LL7A 3AHYA 2X1TA 4DBSA 1FQ0A 4NAEA 1LQ0A 4GKLA 3TYCA 3RDKA 2D73A 1QPQA 2ZRZA 1B4EA 4JEJA 3WUGA 4G8TA 2PS2A 4GZ7A 3IUHA 4QAWA 3H2AA 3WFZA 5HQMA 2B0MA 4XKYA 2X0SA 5CSYA 3EB4A 1AVAA 1XKJA 4RJEA 4XB3A 4J1OA 1SR9A 3WK1A 3VKDA 1XIMA 2J6VA 2HNHA 3ATZA 4AWEA 3UJFA 4U5KA 4PRRA 3C61A 4LX4A 5MKGB 3PTQA 2XSBA 4D6JA 3A4JA 1MRQA 4U10A 3WLOA 1KLYA 1H1ZA 3V1PA 2WZHA 3BGGA 3SZ8A 1W17A 2AL2B 2DQWA 3OLIA 4WXZA 4KETA 1G7VA 1TG7A 4UZUA 3B9AA 3TQKA 1QO5A 5TIMA 4NZJA 1J8VA 3PJTA 4C6PA 4YTRA 1W1YA 5DX7A 2FZ9A 3W1RA 1ZJIA 3FJLA 1AL7A 1MSSA 2P50A 1SFJA 1VPQA 3OYXA 5CC6A 3AIWA 4W8BA 1FBAA 3QMTA 3GNNA 1SUXA 4ZOBA 3ITVA 3IJLA 2PRMA 1KM1A 3EWXA 4FIQA 4PCTA 4AZCA 3HZ3A 3VKJA 2V2DA 1JGIA 3UGVA 4C6IA 2CLHA 2ZC8A 4JFWA 3QGAC 4UMCA 3VIFA 3GBDA 2ZDRA 3K1GA 3VOIA 4FR1A 2CKSA 2BNJA 3SCRA 2OLSA 5I09A 5DFAA 3WG6A 4CD8A 4MADA 1HXJA 1U5VA 4ZXOA 4AH7A 5I24A 2YW3A 2J6XA 4JYEA 2NQ9A 5F4SA 4JTLA 5FA5A 2ZX6A 4Q8OA 1CW2A 4AYSA 2A7NA 3S46A 2XFRA 2WPGA 3STPA 2OB3A 2WANA 1TE1A 5K9CA 3OB8A 3L66A 3CL7A 4CQCA 4DWDA 2DT2A 3KAOA 1NM9A 4XQ6A 4JTDA 1PXGA 4EAYA 1DJQA 1E4IA 3L2MA 1M3UA 2C3ZA 4LAOA 1FOBA 1TJRA 4YVPA 3T9PA 1E70M 1ZUAX 3ZT6A 4RPPA 2YYTA 1IXNA 1SZFA 3UERA 1NOWA 2O4MA 1W8SA 1XYAA 1UD3A 1H5YA 4XZMX 5BU6A 3RX2A 1F76A 1LG1A 2AGKA 3GTXA 4PB3A 5TF0A 1GOKA 3IAQA 4HB7A 2HXUA 1MYRA 1TJ1A 1V7AA 2TODA 2VDGA 1S2VA 3KRSA 3O06A 1CB2A 2DFAA 4J7RA 1R2SA 1GYLA 4YLWA 2PRLA 3OHIA 3N2XA 2YXGA 4UFIA 3MVTA 2Z1VA 4K39A 1O66A 1MW1A 1OCBA 4UCGA 4WKHA 5ABHA 3GC5A 4LBRA 3IVSA 4GUFA 2P10A 1DBTA 3NUKA 3PNUA 3LRMA 3P82A 3T09A 4IJCA 3IARA 4IM4A 2BOEX 2SFPA 1XF0A 3VNDA 1ALDA 4C1NA 1A5LC 2Z7GA 1AMYA 2WVVB 2AL1A 2J7FA 4GJ1A 3VNIA 5A2CA 3GVGA 3WLHA 1UROA 1TTQA 4I6KA 1UOZA 2A5HA 3E2QA 4MWAC 2XINA 1E1EA 2REQB 1T8QA 5BU9A 1ZZMA 4AD5A 3Q45A 4UUIA 1QNRA 1VBHA 3CWHA 2R8WA 1OFDA 4AWSA 2OEMA 3G5EA 4ZQCA 2G95A 1OG0A 5DMYA 3S9YA 3CHEA 2FJKA 2CZ5A 1X39A 1S5MA 1GPWA 1W54A 4UC5A 2FFIA 4HU8A 3WLJA 1UC5A 4PCPA 2PDPA 2QPXA 1B3ZA 2O4QA 2WZIA 2V5DA 1H7PA 4JTHA 4N9BA 3TFCA 4AD0A 3W6YA 2XGZA 5TD4A 1EJXC 3W1MA 4ZMGA 1SM9A 2ZX9A 3RK8A 4US5D 5IFTA 3UWEA 3NQGA 4A3RA 4HTBA 2OU4A 5HNRA 2ZE0A 3UZJA 1C93A 2QMJA 1JZ5A 1TMQA 3E0FA 3VGEA 3NDYA 4FXJA 2Q8LA 1FWWA 3SFWA 1LROA 5AYXA 4FLOA 1LWHA 5A8MA 4R85A 2OT1A 1EOKA 1EX5A 1TZZA 3PWIA 2J24A 3RCYA 4DO5A 4GZIA 2C15A 1NP0A 3UZWA 1PYMA 4LBSA 2WMJA 1QHZA 1J0ZA 1ITQA 5CJ5A 1ZAIA 2QCDA 1RQEA 2HPMA 4V33A 1KM0A 3UCDA 3EOUA 3GHTA 1XQKA 1WAUA 3UXAA 1XIGA 4LVFA 3S6OA 2WC4A 2WHLA 2GSEA 3PC0A 5KSWA 2ZZ2A 1M7JA 1UYQA 5JU6A 2XYLA 1KRAC 4MSSA 4KQNA 5G5IA 3IV3A 2HPIA 2YL8A 3TYBA 5FEWA 1OFRA 3P62A 2HZGA 5JIPA 3FIGA 5BCAA 4B2DD 4ZA0A 3OA3A 1I6NA 2VFGA 2XVPA 2NWSA 1KFBA 2XZ7A 3QKZA 2E1WA 1CNVA 3BURA 5LNVA 3MANA 2VCCA 3A21A 2WKGA 3AHVA 1KFLA 3MUY1 4M5PA 4TIMA 3MMWA 3E5BA 3TQ0A 3CMFA 2WCGA 3BXWA 4TXEA 4HSHA 3IK2A 4GD0A 2UBPC 1RBAA 4S3AA 3AHTA 1GW1A 2WNNA 2WSRA 2HROA 3P80A 3KTCA 1WYIA 1IR2A 1DXFA 5EBUA 2Z2UA 4MAZA 1RVGA 2QCHA 5CEWA 4JY8A 1D9EA 1HGYA 2RDXA 3NZPA 2VP8A 2ZUMA 4GFIA 4ZOEA 4G7EA 3E0VA 5LIXX 2WZTA 1TJPA 2ACRA 2XTKA 4JTQA 1F3WA 3TJLA 3RJYA 1SJAA 4ORMA 1XXXA 2DW6A 2ZRUA 2VC9A 3THUA 3GDBA 4WSKA 2W63A 3EX2A 1BG4A 4H6QA 4A8RA 4PL2A 3GRIA 3LQGA 4LAZA 1RBOB 3PUDA 3W22A 1E4LA 3NA8A 4ERIA 3W2KA 3NNTA 4ZXLA 3UCCA 3Q94A 3R89A 4YMZA 1HVQA 1IGSA 1SSDA 5HR7A 3OQEA 4GUJA 1XLGA 1I1XA 3QLDA 4XAYA 1BPLB 2OKOA 5AC6A 5M17A 4C90A 3M0YA 5L6UA 5F2MA 3FGCA 5FL1A 3PZGA 1XS2A 3WF1A 4KWUA 4CKQA 5HOSA 3MY9A 5EFFA 3E0LA 3OGSA 4I8DA 3ECQA 3W7NA 4O15A 3RPTA 2LLEA 3O16A 5I03A 3BMVA 1JNEA 1UCWA 1WXYA 4GNVA 4ZEPA 4Q3MA 3CZGA 3PUOA 4XUGA 4D6IA 3NQ2A 4HNTA 2WM0A 1UQZA 4GVGA 3B8WA 1YNYA 1MZHA 1J11A 3RAOA 3AIQA 3U2ZA 4EK7A 4J9JA 4DF1A 4YTSA 1DJXA 1GVOA 3OIXA 2ESCA 4ZL1A 1OB0A 3Q2DA 2NVCA 2ZZ3A 1K6WA 2H8ZA 1OGBA 2VX5A 3FDGA 1JQXA 3WQOA 1HKWA 1BTCA 4TVCA 2XIIA 4I9JA 2PU1A 1P1XA 2D0HA 1DV7A 1JRBA 3RJXA 4UOQA 5IFPA 2VELA 4WSJA 3MYPA 3K8LA 4B3ZA 2HSAA 2NZLA 1W2VA 3ARQA 3QPEA 2CLPA 2J79A 5HMSA 4G2DA 5CGMA 1FWIC 1A4MA 5CGTA 2QV5A 4H7ZA 3CPRA 4CCCA 3M6DA 2VC6A 1L8NA 3SQMA 2E28A 1BF2A 1D7KA 2D1ZA 3ARYA 3W7OA 3I7SA 5A69A 3RN6A 3MSRA 4FALA 1ZALA 2A3AA 3MW7A 4PCNA 1RJRA 4GI8A 2QDHA 3GTHA 4ML9A 3V0UA 4Y9AA 1PHQA 4LRSA 4M51A 4ZB2A 3TK7A 1XSIA 3NL3A 4A35A 1TQXA 2FZ8A 2XG9A 3D3AA 3B8IA 2PBOA 1SYTA 5ABEA 4Y8FA 4AB4A 5J04A 1J2BA 3PAOA 3A9IA 3TYAA 3ZT7A 1B9BA 3UG5A 1POJA 2VGFA 2DUAA 4HK5A 4IJBA 2NQZA 4CN6A 3KCOA 4AMAA 3VD9A 3GNXA 3GQYA 3VIMA 3UWZA 3ZLFA 5EMMA 2PTZA 3SCSA 1GOXA 1YBQB 3BLOA 4NX0A 2DIEA 4O53A 3O63A 1BQCA 4PBEA 1F4HA 1V08A 1YPIA 5DN1A 2BVDA 1GKQA 2ZA1A 4BF7A 4O1AA 2AL2A 4UTHA 3TXZA 4F0MA 4C6CA 1IZJA 3H54A 1W9BM 4HOXA 1JD9A 4KS0A 2YCLA 1SJBA 1OM0A 5KZMA 3VABA 4GXPA 4PUMA 2QCGA 1UZHA 3H4XA 1EJSC 4DWSA 1YIXA 3BMXA 3HV9A 3UEQA 1XDMA 3AI0A 1VEPA 3FY1A 2HJPA 1WBHA 1S5WA 1SJDA 5BWFA 3BAYA 4P2VA 1H61A 1J0HA 3FSUA 4PCSA 3QQ1A 1XC4A 3LCWA 3GM8A 4U31A 3OOQA 2O7SA 4JN8A 3DBPA 4RW5A 4DJFD 1KTBA 1V0KA 5CJNA 3W82A 3DC0A 5E70A 3BL3A 3T6CA 4DZ5A 5DEZA 1W5NA 2FTWA 1EOMA 1Q4NX 1UB3A 1WOBA 5DMNA 3DHDA 3WX7A 1PZ2A 4MKVA 4YN5A 3OIHA 2IXUA 4RZ5A 4E5TA 2AGTA 2DSWA 1C8VA 1JZ2A 1NF7A 4K1GA 3RU6A 2BTMA 1TX2A 3BOLA 2VWSA 4EXAA 3V5CA 3TC3A 1MO0A 1JGMA 4U3AA 4FNSA 3WBWA 2PA6A 4LALA 1ZCOA 3REQB 2KZHA 3ZYZA 3URQA 3M5ZA 1G9HA 5FIPA 1FWEC 1GQIA 1Q7MA 1QASA 1XIDA 3FK4A 3GZ3A 3TCSA 1QK0A 1GONA 4GACA 4PMYA 1NP2A 4DZHA 1GHRA 3MDWA 3R0DA 2VC7A 2P88A 2J8FA 5A95A 3W7EA 1XISA 1LQ2A 2EPLX 3TYEA 3QKEA 1QFEA 4IPLA 3AIEA 3VAVA 3PAJA 4FA3A 5BXSA 2G50A 1ENUA 1UBSA 4XAPA 1V02E 4UFJA 3W24A 3IIPA 1JZ7A 1MVYA 3SY8A 4JICA 1MUCA 2Z7KA 5EYWA 5AHMA 4GGBA 5LKYA 1FXQA 1IIHA 2CLKA 3WBAA 4CNSA 3IJ8A 1W37A 2O9PA 3ARRA 4HP5A 1IWAA 5CSRA 3L4VA 2XGIA 3CK5A 4M0XA 4M8UA 4LUYA 7ODCA 1NY1A 1ZLPA 3BG9A 2X42A 3GD6A 1SGJA 3LHYA 4V1XA 1LQAA 1JCNA 1EO5A 3ZR5A 3MMDA 1ZNNA 5G1YA 1MEHA 2ZWYA 1DQXA 3OHMB 4Y9NA 3H2FA 2YDAA 3UG8A 9RUBA 1CBGA 2DPEA 1VQTA 2A6LA 2CLLA 3UXLA 2REQA 4MWAE 2ABAA 2ZBTA 4R53A 1JF6A 4S3JA 1BRLA 4LUJA 5FJOA 1T41A 2VL4A 3WNOA 1CGUA 2H3BA 4AIBA 1E6QM 4ROQA 2ZX7A 1JUKA 4IX2A 5H2ZA 1VFHA 3S2MA 1XYLA 2YPIA 5MHBA 1UJQA 4LUIA 3N04A 4W8AA 5JBDA 1FWCC 4FLSA 4K8GA 3CPGA 4B5TA 4ZODA 4LYRA 3PPGA 3P84A 3N73A 2V2CA 3M0MA 4FXRA 2JF6A 3R8RA 1KV5A 1X1OA 3W74A 1XPYA 4UQDA 1G01A 3A3HA 2BLEA 3SN4A 3WENA 3E3HA 3GTNA 2P1FA 3MBFA 3P7YA 4UXDA 4PTNA 1EF2A 1Z7AA 2HTMA 5F7UA 4PTDA 1GJPA 2OQLA 5D02A 3S42A 3DEQA 4HHPA 4H41A 4K36A 6PTDA 3GTIA 1G4TA 1PE1A 1A3XA 2BXVA 1DIEA 4F0SA 4HNLA 3EWUA 3PG8A 1JCLA 4HK7A 5CZ0A 3U48A 2X0HA 5JH1A 3GU9A 3VPLA 2ZZ7A 2L5HA 4X2RA 2ZUUA 1TMLA 1A5UA 5I3JA 1MMFA 5CZSA 4BS0A 5I77A 3VZZA 4CGTA 1CGVA 5E0CA 1ITCA 1OX5A 1SZNA 4EANA 2E7FA 3EMCA 3L21A 4AHOA 5K9DA 2CHNA 3GUWA 1VBJA 1CXKA 5D30A 3T08A 3MPGA 1TV3A 3MMTA 3TE9A 2PDUA 1XYMA 3L4UA 4L56A 3CQ0A 3WDIA 4W89A 3GNRA 4L80A 3TOPA 2YX0A 3S2NA 1Q4WA 3WDRA 3ZJ8A 3EWCA 1DJGA 2V38A 2HRWA 2OFJA 3M16A 4ATLA 1QAPA 2J7BA 2FMNA 3EKZA 3EA2A 1ZQ5A 3GXDA 2FPYA 1JZ6A 2QULA 2Y61A 3EKLA 5HQEA 1K4GA 4N4QA 1UD5A 1YRRA 1QTWA 1FHUA 3INPA 4LWWA 4O16A 4IH3A 1I2RA 2FZBA 2I57A 3HO8A 3RLVA 1ME9A 1S1RA 3FLUA 5EMYA 2AOSA 3BGAA 4KWVA 4Z17A 4GY1A 1V4YA 1ZBCA 3EEGA 2BGNE 1S2TA 1VGAA 3H7VA 5C8BB 3C0JA 1REQA 1X8CA 3RX3A 1M7XA 3TA9A 1RVKA 3AU2A 4Z2IA 4I5UA 5AYYA 4KWOA 4TMBA 5A6BA 4PMJA 2W66A 3OVPA 1L0PA 2NSXA 3S2CA 5AY7A 3VE9A 4ACZA 3T2PA 3NSMA 3BAKA 2WLYA 3HQPA 1UC4A 3G1AA 1LOSA 1H60A 1OT2A 4DBWA 5GQBA 1VYPX 4F0KA 4HHLA 2OWXA 3DG6A 2QPUA 1B31A 1GTEA 4PMXA 3R43A 1FRBA 5CAHA 4V28A 2VUYA 3W1QA 4LS1A 3VD3A 1IXOA 4Q8WA 3TTQA 3FX4A 1IF2A 1U22A 1OZQA 4IP4A 1PIIA 3QGVA 2DZSA 3APYA 4XKMA 2QVHA 2NT1A 3LCHA 1KA9F 1EF3A 1TWIA 4JTAA 2E9LA 1GG0A 3PG9A 1NWRA 3K1DA 4NQ1A 2VI0A 4YPJA 4C6LA 2BVTA 5D9NA 2WC3A 3ZVIA 2ZUVA 1MZRA 3EWWA 5FOOA 2G97A 4UFKA 4DJDA 4CEUC 1P6WA 5C0QA 1UJPA 5T9CE 1NTHA 4EP8C 1KC7A 4QP0A 4AIUA 4JNZA 1QWKA 3QFWA 1AQMA 4FO4A 2FKPA 1BTMA 2XIMA 2V82A 4O8AA 3WF2A 4AD4A 4MNLA 3BG5A 1XCWA 4QM1A 2PDJA 4BZYA 4L64A 3WK2A 4JTGA 3RXZA 5B7YA 4QLJA 4BKNA 1E0XA 1OVDA 3PBVA 4EIVA 2E77A 4CNNA 4D1IA 1EIXA 3SB0A 4O19A 3NL6A 3R13A 4N2YA 4DUVA 1K9TA 1HGWA 4S23A 5AYZA 4JX6A 3PS7A 1GHSA 2JGQA 1QWGA 2X30A 3LZ3A 2VX7A 5EY5A 3AIRA 4D8ZA 4MDOA 3PJXA 4MB1A 4GE8A 4ICMA 7PTDA 1XPGA 1EZ2A 4W8LA 1TMHA 1FX6A 5B7ZA 1QBBA 1BWLA 1W8GA 1VPXA 2OELA 2W3ZA 4KFNA 1FP8A 2VFHA 4B16A 6TAAA 3O05A 2AQVA 3N2CA 1GVIA 5HNTA 4AZ6A 3BWWA 1E0UA 4PEKA 3G1DA 1VHNA 2BHZA 1CCWB 4CEXC 3PBWA 1I2QA 4JTJA 1P5BA 1B3WA 4PMOA 3L65A 2W62A 3NQ6A 2OEKA 2IKGA 1Q85A 1BKSA 1DJHA 1TR9A 3GXTA 4DJEC 3DAQA 2TAAA 4HPGA 3GHUA 4FLRA 1KM3A 3N11A 3CH0A 4TV5A 3MVIA 1N8IA 1YBQA 1GPFA 2DZXA 1BXCA 3LHWA 3ID7A 2VHLA 3P61A 1VCFA 4KCWA 2EQDA 3ZO9A 3CHCA 2NXIA 2V2HA 4CVUA 3IUIA 2YYUA 4B5SA 3U2EA 5LHFA 3I6TA 1J0JA 2W79A 5CXPA 3EPNA 1A50A 2Y63A 2VX6A 3TR9A 1R87A 3WZ0E 1XFBA 1VKFA 1IEXA 1WKDA 4M29A 3DXIA 4IMFA 1R86A 3LMYA 3TTOA 7XIMA 3C3UA 1Q63A 1J12A 1E51A 1XLMA 2YL6A 1CGXA 4O14A 4UTLA 4Y2WA 1QI4A 1BAGA 2BY3A 2HE5A 2GK1A 4DYEA 1ZHAA 3MUAA 5KZ6A 4K38A 4AU0A 1IQ8A 2GUYA 3NCOA 2QEZA 3EMZA 3U57A 1YE4A 1H49A 3DCPA 2VJXA 1QI2A 3W7KA 5LA2A 3WQ8A 1O95A 1OK6A 1SSGA 1EC7A 4JCLA 4UFLA 1O5RA 3VIPA 3DOPA 3I3EA 1L6GA 5BRPA 2QUUA 7TAAA 4H8VA 3ES8A 3M0IA 2CBVA 2RDUA 4F2UA 1HP4A 1JYNA 4UTWC 1WZKA 5FF7A 3CV7A 5M5DA 3V75A 4DPQA 4C60A 4WF7A 4C7DA 4BFAA 2Z1BA 5A8GA 2W6RA 3PPFA 1DPMA 1PL9A 3DUGA 3QW3A 3EXSA 2GJRA 1X6NA 1CGYA 1K70A 3KBSA 4B5WA 5BOEA 1TE6A 3P67A 2PSNA 1FFRA 4M7SA 2V5JA 1RHCA 2PF8A 3QMRA 3REQA 4W9TA 5HNUA 2ZQ0A 3QR0A 1EEPA 5CZJA 1M1BA 1E72M 3LHZA 3W27A 1CT5A 4KH2A 2E3ZA 3L2IA 2QCEA 1C29A 4FB7A 3ONBA 4V15A 4UQAA 4LVGA 3I7QA 2AKMA 1IT0A 3LXBA 4DAIA 3B3DA 2FPTA 4P7NA 5DY2A 3BOFA 1LBFA 2YXXA 1W1ZA 5HANA 2W9MA 3HFYA 4OIFA 3PP7A 1MNZA 4NL1A 4RR4A 3SUUA 1TELA 3MTWA 4IFRA 5LNRA 4PUDA 3VCCA 3KCLA 4UFHA 3W6LA 3S3GA 1O68A 3KUMA 2R91A 4AHPA 1JYVA 2VQTA 1A3WA 3QXBA 4NNAA 4DXVA 4I7VA 4OUEA 5T26A 1I8JA 1K7FA 1Z32X 4PEEA 4PZVA 1DJNA 3VKBA 2GWGA 2GGGA 4ASTA 4AVOA 3WLPA 1G4EA 4JIEA 1GQLA 4F9DA 2WHJA 3SIZA 3TWAA 4IOTA 2MANA 3AMCA 3KE0A 3FA3A 4P5UA 2EGZA 2CCRA 4AEEA 4NJHA 2A3LA 3KVLA 3OTRA 4JDYA 1JFXA 1HF6A 5HQLA 1FH8A 4ERAA 1E5NA 1VBGA 1DVJA 3NQBA 3FSTA 4XAZA 4RNHA 1NOUA 3R12A 4ZQNA 1ZRQA 3VZXA 4LEFA 2GOUA 1JXKA 3MUZ1 4YCPA 3UG4A 3B8TA 2TYSA 1VFUA 4MZYA 4E6MA 3V5OA 4P61A 3NPVA 2OLAA 3BANA 4HYVA 2UV8G 3FEQA 3STCA 1OD8A 1EDTA 3WKZA 2A3CA 4IHCA 2DT0A 2GJXB 2GVLA 2E5CA 3LNPA 3TZNA 5C2CA 3W38A 1HQTA 2Z27A 3R94A 1YX1A 4NZCA 5FEXA 1JCJA 2NVAA 2XWDA 1GWJA 1R3RA 2W61A 3L12A 1M01A 4A05A 4GO8A 2ZX5A 4DUXA 1ZJHA 3I7RA 4JL2A 3C2VA 1ADSA 1CXEA 3CS2A 2V3FA 4TX8A 1GVFA 5E1QA 1JYXA 4J5NA 3W88A 4E3TA 1AFSA 4W86A 3O6YX 2QV4A 3JU2A 2YR1A 1QW7A 1X1NA 6REQB 3M7WA 3V35A 3AMDA 4IUOA 4BQ3A 1XG4A 1MNSA 3F4DA 4UR8A 2QMKA 4DWSD 4AC1X 4DPPA 2PDQA 3E9AA 2BVYA 1LL4A 3VINA 4HSNA 2NVDA 1ISVA 3NQVA 3MP4A 1V6WA 1ZS2A 2D2OA 2Y5EA 3NGJA 2HK1A 8TIMA 5IBXC 4G6CA 5DT7A 5CH9A 3O8AA 1V3LA 2YXOA 1EBHA 5G4HC 2I9UA 4EVZA 1SPQA 2J25A 1E6PA 1H7XA 1VHCA 3P6LA 4Q8MA 1ECEA 2F6UA 4DEFA 4C6QA 2X7VA 4RE4A 1P1MA 4GYFA 2ZA2A 4LTSA 2PDNA 3OQ8A 5GNZA 2ZOXA 2C0HA 3CAWA 3RCNA 5AHIA 2J7EA 4V2XA 1JI2A 1NQ6A 4D1JA 4KF1A 1ZBVA 1F6PA 5CLWA 1AL8A 3LCFA 2YCKX 2NXHA 5D2VA 2ISDA 3KZSA 4LANA 3HQOA 5A6MA 1UUQA 4R7OA 5MF5A 3PBGA 4JFTA 4L1XA 3AALA 4IMAA 8XIMA 2DVTA 4WHBA 3ISIX 1YDNA 3WQGA 2B7NA 3EWZA 3TH6A 1V7YA 3F4VA 2A7RA 3NZGA 3KW3A 5E9AA 4Q4OA 4LGXA 3N6QA 5H8UA 3WSUA 2WW5A 1FCBA 4FNQA 3DBNA 4MY8A 1A5OC 3KBVA 1GVQA 1QI3A 4CQ8A 4HMEA 3U7BA 1BXBA 2CW6A 1P0BA 2X1RA 2WNQA 3VNKA 2IS7A 2XIOA 2FVLA 3SY5A 1XUUA 1KCKA 1QCWA 3LPPA 1K77A 4UTMA 3UXKA 3CGTA 2DZPA 3AZTA 3W3OA 3CHDA 5CZTA 4CD6A 1TV4A 1LT7A 2P3EA 3W1XA 3LCGA 2XIJA 3M0JA 4AF0B 1KRMA 3M44A 1WB0A 3SECA 1HJXA 1V79A 2VZUA 4INFA 4EXBA 3FYPA 1HKJA 4FNPA 3PSVA 4KRUA 4EOUA 4AY7A 3TTEA 4QDMA 3NDOA 2CFFA 2VRJA 1WDWA 2CZDA 3MJMA 5T91A 1WZLA 2G3NA 4CQBA 5IDIA 3W2MA 5LIWX 3SURA 1GEQA 4IGNA 4NAFA 3N3MA 3TQPA 3THCA 5DBTA 3GX9A 4ICCX 1OX4A 4ENLA 3NXLA 1HKIA 2ZCGA 4DX3A 4B92A 3RYSA 1H62A 2C71A 3R1ZA 2YLLA 4Q4MA 2CETA 4U28A 3EDDA 3WLKX 1PX3A 1UWTA 3M4HA 2EKGA 1KGWA 3PR2A 2ZXBA 1TJ0A 4Q6JA 1PKLA 2D24A 4HCLA 1E55A 3GXPA 3W85A 5AFDA 3DG7A 3C2OA 1XLCA 3KOYA 1JAKA 1UIOA 3U4AA 1GJUA 5EMKA 1TPDA 1TV7A 3LERA 1B3YA 3UT0A 2GSJA 2VURA 4CNPA 1B2YA 3N15A 4PYSA 1CXFA 3VMOA 4WJ8A 4HYWA 4CCEA 4ZO8A 3WN6A 4EKJA 3KRUA 3LV5A 1FWFC 3TDFA 1X97A 3BE7A 3CWNA 2HS8A 2QCLA 3M0XA 3HGJA 1EP3A 1Q65A 4A2SA 2FYMA 2W67A 5KZEA 1F3XA 1H2JA 2F84A 5ECUA 1QOXA 3S47A 4GX9A 3HGOA 4WVXA 4DJFC 3K30A 1WBJA 4MGGA 1I45A 5HWJA 1P7TB 4H7VA 1J0YA 4J35A 1T99A 1RSCA 4U2ZA 3EA1A 1ZL1A 1UWAA 6TIMA 2YGYA 1YTDA 4HK6A 4K2SA 1LZOA 2Y7DA 2OZTA 3EYPA 1TPH1 1QU4A 5H8MA 3FKRA 3BMWA 2G3FA 2PTYA 3KHDA 1NFPA 2I14A 3HG4A 4IISA 3SI9A 1AH3A 2GOKA 2C13A 2H9AA 4TMCA 3OVGA 4M1BA 5CPSA 4DB7A 2YCJA 4YVXA 1QW8A 2FZMA 3BUVA 4O1BA 5IHSA 1X6UA 4UR9A 3GZAA 1QHOA 1XHGA 1IEWA 1JUEA 2GL5A 3PTMA 2VCAA 3GH5A 3G1YA 2A7PA 1JDCA 1JIBA 2DUZA 1FWJC 5G4WA 3UA4A 1QNOA 3LCIA 1XUZA 2XHYA 3WDQA 4TVDA 3L5MA 5AYBA 1FDZA 5HAOA 2DJXA 3RU8X 3F2DA 1QNQA 3NO3A 3IRSA 1XBVA 1YXCA 3B0YA 4YXGA 4XIMA 5C9RA 1OT1A 3FW6A 1POKA 2VEMA 4K1WA 2PRHA 3NQMA 3A23A 2HWGA 5H91A 3H70A 5IHRA 3M0KA 1BHGA 1RCQA 5FEPA 4GYKA 2XH7A 4X61A 4QIUA 5HMFA 1E71M 3DDMA 3GB6A 3ZFHA 3CMGA 3GAYA 3MV01 4RDVA 1VJZA 4MLJA 3WLIA 4XZWA 3RGTA 2IPJA 4NAEB 1P6CA 3TYUA 4FNRA 3URBA 1DE5A 3BH4A 2PC4A 5BNKA 3RIKA 4ATWA 3G6MA 1CLKA 2GVEA 2W4XA 2CEQA 1ICSA 1RA0A 2IW0A 3QFEA 1L2UA 2VD8A 2VZVA 3V3WA 3EOLA 3UYCA 5EBAA 2GGIA 1BGGA 3E1F1 4A8IA 5A6BD 3G3MA 1B54A 1HL9A 1HKVA 1J0KA 5DXXA 2QCFA 1KD0A 2X2YA 1FKWA 2VT0A 4US5A 2J75A 3LENA 1YNQA 3L2LA 4N4PA 3WCZA 2X05A 4Q7NA 4JTRA 1IWBA 4OOUA 1U33A 2W92A 2GDQA 4L9YA 4LUSA 4HN4A 2E6AA 5D33A 4Z2LA 1OINA 1GYMA 3UGRA 3B0UX 4LBUA 4IJRA 2Q71A 4ZB5A 1ONXA 3L4YA 3P8IA 3VM5A 3U9IA 3AAMA 3MV11 2JALA 3T8LA 3O6AA 3HPZA 3NEVA 3N9RA 1I2NA 1C8XA 1VLIA 3S1UA 1K6AA 4D6DA 3K46A 4QRNA 4AISA 4LFYA 2DW7A 1F7BA 1FHVA 4QISA 1PIFA 2JIEA 4PUKA 3S5ZA 1RQHA 4O0QA 1MFUA 3IVTA 1NWUA 3USBA 3VKKA 4AZCB 4JD4A 1R3SA 1KQYA 3W29A 4JEQA 1Q2SA 2F7FA 2W91A 1TIMA 2J78A 4JTUA 1WO2A 1Z44A 2CC0A 4Z2HA 3E0IA 4IPPA 3VGFA 1W9VA 4B2DA 4DJDD 5IM51 3GR4A 4O18A 3SQLA 4Y7EA 5BXRA 4WOQA 2YBTA 4DELA 3QHNA 5CSUA 1XGEA 3NQAA 4X0NA 5FESA 4GXWA 4M19A 3AOFA 4EPBC 3ICJA 2VR4A 1K8CA 2AMGA 2VXNA 4AG0A 3WF4A 3JUGA 3A6OA 4ZFMA 3ZVHA 1JRCA 3PZ9A 2OR2A 1RJQA 3FDKA 4L6OA 4NU7A 4Z0SA 2DT3A 5I23A 2CLOA 2Y89A 3HIJA 3E12A 3UWUA 3I65A 2V63A 1W1A1 4AXNA 9XIMA 1Q8AA 4ZZ9A 4TX9A 3PFMA 3OBEA 5D32A 4B4FA 1JULA 1KFKA 1YXYA 3AYSA 3HG5A 3H26A 1AQHA 5U7SA 1V51A 3THAA 3A24A 4UTTA 4UIOA 2ZXDA 4GXMA 3WQ4A 5AVNA 5CPTA 3ZWTA 4EACA 3CB8A 3SRFA 2Y85A 4Z2KA 3G1RA 4MDPA 2V5CA 1PZ3A 4RXFA 2AQWA 4F2BA 3EXRA 3NOEA 2PFHA 3DGBA 1EKOA 1JDDA 1Y8BA 3CEUA 1K02A 3QOMA 4AVNA 3PZIA 1JPKA 4XWUA 2E6FA 3G1SA 3BW3A 1KTCA 5EU9A 3RM9A 3QC0A 2DIJA 3G8RA 1X1ZA 3FYOA 3WQPA 3W23A 3KX6A 1EWDA 3VGHA 3ARSA 5K4ZA 3W2JA 3GNPA 4IGHA 5D2YA 1TPC1 1L6FA 2OYKA 3WQFA 1MRAA 2D3NA 2WSKA 4O57A 1R3TA 4C1NB 2PUZA 2GPTA 2YIHA 5EL1A 1WNOA 1UKTA 1A5BA 3DGRA 1UKOA 2NX3A 3VNLA 5FAGA 4MM1A 3FOKA 6REQA 3W4RA 3KRZA 2G3JA 5TQLA 3W81A 3GG0A 2Z00A 3BV4A 1R2RA 3CYJA 2C1IA 2J77A 2WYSA 3MI2A 3LBCA 2PWHA 3W25A 4H2HA 1X7FA 4A8LA 2NT0A 1S46A 3H2MA 4MFEA 1WOAA 2J47A 2Y8UA 3VDBA 2JKAA 4F2TA 3QTPA 5CPMA 2CZVA 3B9NA 4WOZA 1Q7ZA 4X0VA 3TW7A 4B90A 2P0OA 2J9YA 2ALRA 2BFGA 1R9XA 3AWNA 4B3KA 5TNVA 3R79A 1A49A 4NRRA 2ZUSA 3H7RA 2XH0A 1O60A 3DHUA 1XIHA 3MUCA 2PGWA 2X16A 4V27A 4GVHA 5BMWA 4UB9A 4RZBA 2WQPA 1Q13A 3WLQA 1R3QA 3E2VA 2R1MA 5GVJA 1PVNA 4W7WA 4IL2A 4GLEA 1KBKA 1O5XA 2CERA 5BRBA 4DNHA 1OFPA 4ML4A 1PO9A 1US3A 1ITUA 4JTCA 2VFFA 5E6YA 3LD5A 1FCQA 1NELA 1KBBA 3OVRA 1D7FA 3BLEA 1T96A 4CN4A 4EWJA 1XWYA 6XIAA 4QNWA 1B4KA 2WWDA 3H53A 4JIRA 4NI8A 3PTKA 1SMAA 2EEXA 4JQ2A 4Q4SA 2F2HA 1ME8A 1RY0A 4ZFCA 4XD5A 5D2WA 1XDLA 3CQHA 4XK2A 2E5BA 4E2DA 1E6SM 4AIOA 3RUBL 3NGFA 1GOMA 2PU0A 1U1UA 2FZDA 1G6CA 3AIUA 5M1TA 4Z1AA 2EAWA 4UTKA 3TWBA 5HK4A 4O50A 2WJZA 4OE7A 1O1HA 3B0XA 3TOYA 3GVQA 3U5YA 3U6WA 5LIYX 1H63A 5AECA 3O2LA 2CITA 4NJJA 4DUWA 4Y9PA 1EJRC 3CZKA 2FPVA 4AF0A 2Y5SA 1E15A 3S5NA 3ZIZA 3PZNA 2WLZA 9CGTA 3T78A 3UXIA 1P0NA 3VKAA 2CZFA 2Z4GA 4IPNB 3WNKA 2DSUA 3DFTA 3CV2A 4R5EA 4KPLA 4J4KA 1PV8A 3MO4A 4XD6A 2B4GA 1GQJA 3G6LA 1S2CA 3IIVA 3NEHA 4NP7A 1M04A 4PMQA 1XP3A 2VDHA 3QY8A 1QDSA 4US6A 3T81A 1V93A 5I3HA 3W76A 1EZWA 3VMPA 1RPXA 1GOOA 5AKQA 1EXBA 1OC6A 1JPMA 4GY7A 3TC6A 3AZRA 2EG6A 3STEA 3BJTA 2ZFAA 2A1YA 3GG8A 4P8XA 1LBMA 4H9TA 2FGZA 3EXTA 4F40A 1U5JA 4XV0A 4Q8UA 2V30A 1TPEA 3Q67A 4FZIA 1M65A 2NQHA 4ILSA 1US2A 4YJ5A 3U0HA 2DQXA 3W71A 2BOFX 1NWSA 3GXFA 3LNMA 1OGGA 2QF8A 4AWUA 3RPMA 3BARA 4M24A 3CM4A 4JOMA 1D2KA 4N02A 3WBYA 3MHUA 2I16A 3HGSA 3SUWA 3SUVA 3SRHA 1QPRA 1V3MA 5I2UA 3FGCB 4W85A 1J6OA 5C9WA 3G1FA 2HS6A 1SO6A 1BG9A 2DUXA 1EDGA 2WMKA 4D8AA 3IIXA 2XGBA 3QOKA 5F1VA 1V8EA 4URIA 1R9YA 4UOJA 3MCMA 3KXQA 3NWRA 3WLNA 3N18A 4IPJA 2YOCA 1EXPA 1GOQA 4NXSA 4GI4A 3FXYA 4ZOAA