4RJEA

Aerococcus viridans l-lactate oxidase mutant
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
369
structure length
367
Chain Sequence
IEYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIGAHGLAHATKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKGDGATAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ala95-to-Gly substitution in Aerococcus viridans l-lactate oxidase revisited - structural consequences at the catalytic site and effect on reactivity with O2 and other electron acceptors.
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
molecule keywords Lactate oxidase
total genus 136
structure length 367
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rjeA00
2ABBA 1SZFA 2Y7GA 4RLIA 3G3DA 1K8XA 3EWXA 3SZ8A 5E93A 3S6DA 3LDVA 2CLHA 3PY2A 4JTGA 3LRMA 2ZBTA 4K8EA 1K7FA 3KAOA 4N4PA 5CG7A 3EX4A 3NQVA 3BW4A 4UTTA 5DCEA 3LCWA 3TQVA 3OVQA 2QDGA 3LBCA 4IXXA 3STGA 3BARA 1HO4A 5AOUA 1F5ZA 5CPMA 1VZWA 3QFEA 3B04A 1LROA 1WOBA 3SFKA 3NXFA 4TX9A 5HJLA 1H50A 2NZLA 4N2YA 4UTTC 5ABTA 4NXKA 4KFOA 1VPXA 3TIMA 4UNKA 5G1YA 2A85A 3GAKA 1H61A 3K30A 1EWDA 4GUFA 1ZALA 3W70A 3PBVA 1XBZA 1Q3NA 3F4NA 4HSOA 4TIMA 3N9RA 1FCVA 3N9SA 2B0MA 1AK5A 2JBMA 4FNQA 3W22A 2B4GA 5BNKA 5E1QA 1ONRA 2I14A 1H7RA 1TPUA 3B4UA 4MZ1A 3DFSA 2W0UA 5F2GA 1XBXA 3W2UA 1VJIA 4AHPA 1LBFA 4I7WA 5FESA 5KZDA 3C61A 4FF7A 1D9EA 2YYTA 2PRHA 4ZQCA 4ALDA 4O4WA 4UR7A 3DFNA 1YTDA 2B7NA 4PTNA 2A0NA 1O5KA 4ICNA 4FIQA 3LV6A 4JY9A 4K37A 5EL1A 1BTMA 4LVDA 4ORMA 3W72A 3YPIA 3TX9A 3NM3A 4CNPA 1JCMP 3VFLA 1GG1A 4GC4A 3PBYA 3O05A 4M7TA 2E77A 4QQ3A 1W8SA 3UWWA 2QR6A 4MIMA 3TMLA 4AWUA 2E6YA 3GX9A 3W7KA 3OA3A 3W86A 3QMRA 2E1DA 1S5VA 3LHTA 4GNJA 1LCOA 1XUUA 4AF0A 5K3VA 4HSNA 3L66A 5CZSA 1KM6A 1TPWA 1ZHAA 2Q3RA 4Q33A 3A21A 3MYPA 4TMCA 1N8FA 5U7SA 2H6RA 3W84A 2GJNA 3F03K 2V81A 2P0OA 1TIMA 2V5BA 4GFSA 3WK0A 1PHQA 4CQAA 1TQXA 5D30A 2GVLA 3QSRA 1QMLA 1SW3A 3LI0A 3N2MA 1W3IA 4XBKA 2A6LA 3SGZA 3SJ3A 3PR2A 4IX0A 4O17A 2NLIA 2QUVA 3QC3A 1TPDA 3QF0A 1YDNA 1W3NA 4QIUA 4XTIA 1TPFA 1DVJA 3HGSA 3GR8A 1GTEA 1WX0A 4P61A 2QUUA 3QYQA 5AN7A 5TBOA 5LNUA 1R30A 1WA3A 3PWAA 1Q45A 1Z44A 5D04C 4MVAA 1BEUA 3L67A 4LS2A 2E09A 5G1TA 1QAPA 1L6WA 1D3GA 5AB3A 3S1XA 1JRCA 5CZJA 3R89A 1A50A 4D2JA 1T96A 3TXVA 2YW4A 1UBSA 4O18A 3LLFA 2J88A 2G97A 3STEA 3IGUA 3W7HA 4PL1A 1KFBA 4NJJA 4FXRA 4EIVA 1ME9A 3FS2A 3KRZA 4UTHA 3RU6A 4AAJA 3W73A 3TQ0A 1K7XA 3G1HA 2ATSA 3HG4A 3M44A 4JDBA 1AW1A 2Z6IA 2Y7EA 1LDCA 3EXRA 3NZ1A 5AHLA 4WY0F 3W75A 4ONVA 1ZAHA 2QCDA 3SGUA 1PHWA 2C3ZA 4DO6A 4GUHA 3W1NA 1IXOA 1WV2A 2EPHA 4LC8A 3FYPA 1QPNA 4XWUA 2P1FA 3EXTA 2R91A 2TPSA 3BLFA 5AYXA 4GUIA 3NG3A 4LRTA 5L6UA 2PRMA 1TV5A 4LC6A 1J5TA 2CZDA 3LCLA 3TW6A 4GWEA 4O8RA 3PM6A 1TSIA 4JDYA 3TMQA 1GJPA 1EX5A 3LHWA 2VFFA 2B7QA 1W3TA 3CQ0A 4R34A 2DZXA 2W79A 4NX0A 5KINA 4M5PA 1BWKA 4UUIA 2ABAA 1VGAA 1KTCA 1XUZA 3LCGA 3ZWSA 2G95A 1HTIA 2JKPA 4PCFA 2CZ5A 3W7EA 3HGOA 4WXZA 1KM4A 3DFQA 3PVFA 3NQ7A 3FIGA 3S42A 1ICPA 3P5YA 2A4AA 3LOTA 1OFEA 5AHNA 3SSJA 2Y85A 4JXCA 2ZRVA 4K6AA 2JK2A 4K8HA 3PAJA 2E6FA 5LKYA 5FEWA 3KOFA 3F1QA 2ALDA 5CSSA 3NEVA 1VC4A 2ZZ6A 3B03A 2ZZ4A 3AJXA 3FEMA 2NUWA 1H51A 1DORA 1HO1A 3CWOX 4O13A 2ZYFA 2RHGA 1F74A 3TW7A 1LTDA 2AAMA 3CEPA 4R33A 1TTPA 5J5RA 1QOPA 5C5YA 1SU5A 4E0CA 5HWNA 5DN1A 3W2KA 5K7JA 5I3GA 3GIYA 5HINA 4DPQA 4QJ1A 3LHVA 1AG1O 1QO2A 1IIHA 2YCEA 2C13A 3BV4A 5D2TA 4O19A 4MY1A 3H53A 3MBFA 2VEMA 1PIIA 2CLOA 3DHDA 2A7NA 3G24A 4ZL1A 3P67A 4CCDA 2QJIA 1FXQA 1KLZA 3C52A 4NJHA 1I45A 1F73A 4N6FA 5I3HA 4UTMA 3INPA 1H1ZA 3R13A 4GXMA 3LHUA 1LYXA 1VRDA 1WBJA 4JX4A 3IIXA 3NQFA 1XKYA 1O60A 3QEZA 2VC6A 2Y70A 4J9JA 5G2IA 1VYRA 2V9DA 1AW5A 4XUGA 3EKZA 4JX6A 2ISWA 4K7YA 5L9FA 2CLIA 3W7OA 1K8YA 3W7IA 4O1BA 1UCWA 4DBDA 4M19A 4IMFA 3PF3A 4RX0A 4N6EA 2JKAA 2J9ZA 4EVZA 1W5OA 2GUUA 1G6CA 2CU0A 4AF0B 5TIMA 4S2BA 4O15A 3L0NA 4LVAA 2FDSA 2QCGA 3MJYA 1O4UA 3TCEA 1DBTA 4U4MA 3SECA 1KM5A 3G1XA 4QAIA 3GNNA 3S5YA 3I68A 3A9IA 2R8WA 3GZ3A 4ORIA 3MP5A 2HS8A 1QPOA 4UXDA 1YXCA 1XFBA 3L5AA 3MI3A 2ZQ0A 3SY5A 2Z2UA 3S5OA 1G67A 3STFA 3UXDA 3CTLA 3TV8A 5EBUA 2NX3A 5HUPA 2FIQA 2E5CA 3EB2A 2JGQA 2HS6A 1WAUA 2BTMA 2C16A 4IQLA 2UV8G 4B5NA 3LRLA 3TSDA 1VS1A 1KM1A 2GOUA 3MBDA 3TFCA 3RMJA 3R12A 3DH7A 3I65A 3QMSA 3WFAA 3B0PA 3C3NA 3WJWA 4UR8A 3VNDA 5LHEA 1LRTA 5CGQA 2F84A 2DZVA 1EP1A 1UUOA 3SW6A 1TJPA 4NJGA 4LS0A 1N55A 1T0OA 4LVGA 1JUBA 2E5BA 3FFSA 4CQ8A 4NNAA 3DI0A 5AHMA 1LLWA 4NNBA 3TA6A 1PS9A 3WK3A 3UPBA 4JD4A 2NV2A 3BPWA 2CFFA 4BF9A 2Q3OA 1H7PA 3NZRA 4QNWA 5F4XA 3W1PA 1JQVA 1GWJA 1H7XA 3QW3A 5HMSA 1OFPA 5AYYA 3QH2A 5LZLA 1WXJA 3NPWA 3N14A 1KFKA 1D3HA 3P60A 1ML1A 1TPB1 1G4TA 4OBTA 1SQ7A 5D37A 1PCKA 5D05A 1KTBA 4MY9A 5HULA 1F7BA 3M0ZA 3R2GA 4JTHA 3W87A 3B0VC 2A7PA 2QKFA 1EP2A 2EKCA 4NU7A 1AW2A 1CI1A 4FX7A 4IPJA 5E0KA 1C8VA 4JEQA 1CX9A 4LUJA 1FDJA 4LW7A 2QF7A 1DL3A 3HGJA 1QPRA 4LV9A 2V5LA 2FFCA 2H8ZA 1TMHA 1IF2A 2QAPA 3LI1A 4HPXA 5AFDA 3MHFA 1ME8A 2Y62A 1PV8A 4MLJA 1VHNA 3DXIA 4U28A 3UWUA 5EPDA 3W1QA 1DOSA 4HNVA 3GDLA 1XM3A 3FKKA 1OYCA 3RFAA 3BGGA 2QCEA 1LLZA 2ZRZA 5F2LA 2VFDA 3OBKA 4RR4A 1OG0A 2QAFA 2QCLA 3I7QA 3KX6A 4ADSA 1TPVA 1MSSA 1EP3A 4RXFA 5A5WA 3RNDA 3TSMA 4W9TA 4N9BA 3W07A 4UTWA 4IJBA 3M1ZA 5HR6A 1LOSA 4IXHA 4JX5A 2WKJA 3QJAA 4JR5A 5D32A 1JVNA 5TQLA 2A7RA 4M6VA 3T44A 3DU0A 3EX2A 3JRKA 3S9YA 1H62A 1VCGA 4YXGA 3G1FA 4CCEA 1XL9A 3R8RA 4JTFA 2G5WA 1JCYA 4O12A 3FKRA 4MYAA 4NQ1A 2X2GA 3CLMA 1TCDA 4WUIA 2Q8ZA 3CWNA 3W9ZA 3WJYA 5D38A 2R14A 1GVQA 1Q6OA 2TRSA 5FEPA 4MFEA 4BI6A 5CSRA 2ZZ3A 1GQNA 3T4CA 1JCNA 3O15A 3HB9A 4FO4A 1FWNA 1H7WA 3QSTA 4XBSA 3UYCA 1Q6RA 3RK8A 2PE4A 3NL3A 1MZHA 4HHPA 4OGZA 2H3BA 2J24A 3W7MA 3P81A 2TSYA 2ZTKA 3VI2A 3LRKA 3IV3A 3F4WA 4LT9A 4OE7A 3OIXA 3GKFA 3OVPA 1TREA 1UUMA 2YDAA 4A21A 3TROA 1Y0EA 3OG3A 2CLEA 1GYLA 2WNNA 4ZMGA 4TO8A 1TYGA 1UJPA 3N3MA 4LVBA 3A24A 2ISVA 2Z0IA 4H3DA 4PODA 5GVJA 2YX0A 1N7KA 4GBUA 3NQAA 1KFEA 3IGXA 3W85A 4IMEA 4FNSA 4RZ6A 2NUYA 4BK9A 5DCDA 3UZ5A 4NVTA 3O6CA 3FYOA 1H63A 2Y89A 2VFHA 2JGYA 4UFJA 4JGDA 1H60A 3PG9A 3B8DA 5K9XA 1F05A 2C18A 3OHIA 2ZTJA 3NDOA 1K03A 2A1YA 4I7VA 2DZSA 3C56A 1SSGA 2QDHA 1Q6QA 2CWNA 5DY2A 4PEKA 3EX6A 2CW6A 1VLWA 4A29A 5F4WA 4HPJA 4JS3A 2VFIA 3EWUA 2ZZ7A 4E2DA 1HUVA 3G1SA 1LM1A 4OQVA 4FX8A 1NAL1 5J5DA 1OK6A 3HBLA 3GLCA 3W7JA 1K3UA 4FNRA 4LVFA 4FNPA 3M7WA 1UB3A 3O8AA 1R2SA 2CZEA 3G0XA 3IIPA 3KVLA 3GNDA 3ABRA 3T78A 1H7NA 3I6RA 5U4NA 1OFRA 5AC8A 3P8JA 1AMKA 4JYEA 1DJNA 3TFXA 5LGZA 1R2RA 1L2UA 4ZQMA 2NWRA 4DF0A 4LS1A 1S5WA 4O14A 1EA0A 4BI5A 2DJLA 5LSMA 3LCIA 4POCA 3UY7A 3T7VA 3GDTA 1TTIA 3W1MA 5FF2A 1XBVA 2NXIA 4R7JA 5DY3A 3S1VA 5LNVA 1KM0A 1I2PA 3D0CA 3QM3A 2YGYA 3PUDA 1IXQA 1F2JA 1KFCA 3PC0A 1LRQA 1OFDA 2BX7A 4UTKA 5AYZA 4O11A 3M16A 1F6PA 1JRBA 1P0KA 1B4EA 1AL7A 1YDVA 5K2ZA 2Z1BA 1TRDA 4AHQA 1ZAJA 4I9AA 3CU2A 3ABQA 1KA9F 2WSQA 2YYUA 1ZAIA 5AHIA 1I2NA 3NL2A 3PBUA 3C2VA 3G0UA 2BWGA 1TPH1 3ELFA 3CT7A 3LV5A 2FPYA 4LNYA 5HR7A 4A2SA 4C1LA 2Y7FA 3UWQA 5FF0A 2X1SA 2PC4A 3G1AA 4UTLA 5EMUA 3CHVA 3MP4A 4NJKA 4X22A 2VXNA 1PE1A 2QCDB 3W2LA 1QO5A 3C2FA 1PCWA 2NX1A 1M6JA 3P82A 1RVGA 5I3IA 4UTUA 2X16A 3MHUA 1E51A 3DKJA 1PL9A 4BR1A 3L0KA 1OFAA 5T26A 1EIXA 1WBHA 3H54A 2TYSA 3ZWTA 1SUXA 3UXAA 4RXGA 3DENA 1ADOA 3P62A 4O16A 5D2VA 3NPUA 3HIJA 1OJXA 5BOOA 5AHFA 3TXZA 4ADTA 3KXQA 1ZJIA 1FY6A 5G4EA 1TV7A 1OX6A 3KHJA 2FQIA 1ZENA 4LV4A 2ZZ5A 4WQ6A 4Z1CA 2ZZ2A 4UC5A 5EYWA 3MUXA 4KFNA 3U6WA 1DQXA 3N19B 4Y96A 4AMAA 1ICQA 2D73A 4JY8A 3NPVA 4UIOA 3USBA 1SO3A 2AGKA 3EEGA 4E2BA 4MJMA 2YPIA 4UTIA 3P7YA 2ZRUA 4O50A 3O06A 4Z1BA 3VKJA 3LXAA 4FXSA 4UFLA 3G18A 1SW7A 3LHYA 1VLIA 4HNTA 1R46A 1Z48A 1NFBA 1FWSA 2ZA3A 3MMTA 3BW2A 4LUIA 3PB2A 4MPQA 2FPVA 1EPXA 3ATYA 5LNWA 5CPNA 1XDMA 2J9YA 2ZZ1A 5IBXC 1XCFA 2ZCGA 2DZPA 3EXSA 1P4CA 4L4LA 2OT0A 3CB8A 3W1UA 3LTSA 4O52A 3L21A 4A3UA 4AH7A 4K7VA 1O94A 3BO9A 3NL5A 3UWYA 1W54A 2ZRWA 3NQMA 3QMTA 5DELA 3GK0A 5K4ZA 4JYDA 1KFJA 3W23A 1LZOA 5D09A 5I3KA 3QZEA 3MI2A 5AHEA 4O4VA 3FOKA 4OHQA 1W1ZA 1X7FA 1J4EA 3M6YA 3S0CA 4DF2A 4JIPA 1SO5A 3PBWA 4Z08A 2WOQA 4JTTA 1G7VA 4E38A 2PURA 2XN2A 1JUKA 1KV5A 2PRLA 3AO0A 2VEIA 4A2RA 3IIOA 3P5ZA 3VE9A 4WJEA 3UWVA 7TIMA 4G1KA 2VFGA 4JTLA 4HT3A 1YTEA 4JYFA 1A5SA 3KRSA 1P0NA 3NPXA 4IWWA 4IMCA 3O1NA 4L4MA 3ABOA 3B06A 5F1UA 3UQNA 1W5MA 3W2NA 2BZNA 1DKWA 1LRNA 2ATMA 3ATZA 3TH6A 1HFBA 4ML9A 1I2QA 1QNVA 1R2TA 2J6XA 5BW6A 5MHBA 3PB0A 3QPZA 1QOQA 3TJXA 4MZYA 4BWLA 4GJ1A 1RQBA 1K8ZA 1JULA 1LBLA 1M7OA 2YFOA 1GOXA 4KKXA 3UZJA 4N9EA 4HIBA 4WY0A 3N2XA 4ZVJA 4YLWA 3W3OA 4Y6GA 1Q6LA 5HWJA 1TPC1 4RJEA 1X1OA 1XDLA 2B7OA 4FX6M 4DEFA 5F4SA 3MWAA 5KZEA 4NZJA 1GVSA 2A21A 2C0AA 1GEQA 5BMWA 2FTPA 5I3FA 4MYXA 3NVTA 3L65A 4A22A 3BVJA 4YL2A 3BG3A 4K38A 1FCBA 1OYAA 3NO5A 3O6YX 1ZY9A 2NXHA 3LBMA 3C8FA 2ZA2A 4UCGA 4MY8A 1B9BA 4YWIA 2JKEA 3C2OA 5D2YA 2C14A 2Y61A 4LWWA 1GYNA 1TTQA 3BK0A 5D2WA 3P61A 3A22A 3EWZA 5H91A 4WY0B 2GQAA 4NXSA 3ANYA 1OFQA 5D03A 6TIMA 3TSBA 2C19A 4JTIA 1SFJA 3QQ0A 4X2RA 3TJLA 1NF0A 4CNOA 1MEHA 3NA8A 3UD6A 4BWLC 4FNUA 4UFHA 1IXNA 1SSDA 4H6KA 3MO7A 1QR7A 2WSRA 1OABA 3GVGA 1DV7A 3U2OA 4M6QA 1NSJA 2WPBA 3IVSA 4Z0JA 3TUUA 5F2IA 2EF9A 4IMDA 3DBPA 1UASA 1WYIA 2X1UA 1SZEA 3KVJA 3NQ2A 4LY8A 3ZR4A 2QJGA 2HMCA 2FB2A 3RF9A 4C1KA 3S8HA 1T99A 1F76A 1WOAA 3GDMA 1VCFA 3G22A 4DF1A 2OJPA 1FWWA 3NQGA 1OFBA 2H8XA 2XN0A 5KSWA 5FF3A 3U8GA 5C54A 3FLUA 2WNZA 2OT1A 3GDRA 4LRSA 3T40A 1U83A 2NUXA 3NAVA 5G2WA 3HF3A 3NNTA 4XKYB 1Z42A 2FJKA 3IEBA 2QEZA 3E12A 1FWTA 1M7PA 3A23A 3CIXA 1FDZA 5EA9A 1FWRA 4O1CA 5FEZA 3E9AA 1L9WA 1FQ0A 2RH9A 4OV9A 3PUOA 5F1VA 2Y88A 1KBIA 1GTHA 2C1HA 4FNTA 3ZS4A 1FDYA 5KMYA 1PVNA 3G1VA 4DXVA 2DZTA 1GVFA 3M5XA 3PG8A 1YYAA 1VR6A 3FA5A 3DKLA 3LLDA 3HPSA 3OEXA 4EF8A 2OZ0A 1SFLA 4WX2A 5I3JA 5G2HA 3G8EA 4Y8FA 3GDKA 5HNRA 1YADA 1YTKA 4FIRA 4NX5A 1P1XA 1YXDA 2ISSA 4JTJA 4WOZA 4ZQNA 3HGRA 3SR7A 2ZA1A 4N4QA 4DO4A 2ZFAA 3GKAA 4DO5A 3EX3A 1T8XA 1GZGA 1W0MA 4X3ZA 3LERA 3A5VA 5C55A 1OF6A 1JR1A 1SO4A 2A6NA 2CLFA 1V5XA 2HTMA 4IUOA 1O95A 4UFKA 3QW4B 1YDOA 4AXKA 3M41A 2PCQA 5FF7A 5FEXA 4AEOA 4WXYA 3QPYA 2EHHA 3C2RA 2O7SA 3KVKA 4MLRA 5LGXA 1A53A 1A5AA 3W7NA 3A5FA 3LXCA 1TPEA 3GYEA 1IIGA 3PSVA 4O1DA 3NYZA 1SPQA 1Z41A 2EAWA 1H5YA 4QM1A 5BRBA 2DU2A 4MOZA 3W7DA 1DQWA 5C2XA 3LTPA 1FCQA 2H3DA 1K7EA 4M7SA 1W31A 5FI8A 4GE8A 1B57A 3LTYA 4NZFA 4N9CA 8TIMA 3W7GA 1DHPA 4LU0A 2WO5A 4O0KA 3P80A 5HWMA 3GAYA 3O63A 2QCFA 3DAQA 3O6DA 3Q37A 5KTLA 1KM2A 3M5VA 1JCLA 4TR9A 3E0IA 4PA8A 1MEWA 1OK4A 4UMBA 3BG5A 3M47A 1GG0A 3DZ1A 4NT0A 3SIZA 4RCXA 2CLLA 2J9XA 2XN1A 1TQJA 1KTNA 3BG9A 3Q58A 3MW7A 4Q4KA 4DBEA 2GVJA 2EGZA 1GPWA 3MYOA 3G1DA 1LP6A 4S1FA 2DJXA 2E6AA 3HQ1A 1NEYA 2QUTA 3C4UA 4IMGA 3W7RA 3OVRA 5IBXA 3NM1A 1ALDA 2VENA 1TRIA 5KZMA 2LLEA 4OWGA 1W37A 4HNUA 3L2IA 1LOQA 1THFD 1MEIA 3LM7A 3V75A 3W7CA 1G4PA 1JCXA 3DI1A 2CLMA 3B0UX 2F7FA 3CIWA 2DZUA 3W83A 1GVRA 2WV8A 1J2WA 3W7QA 3EWWA 3LCFA 1OYBA 3TAKA 1HL2A 4BFAA 1FXPA 4LOCA 3LGEA 2VELA 1QDSA 3IVTA 2GPTA 2RDTA 4Q32A 4UTWC 4X9SA 3G8RA 2RKXA 4HNNA 2Y7DA 3L9CA 3Q94A 4DQWA 3PUEA 1ZNNA 1XC4A 3G3MA 1JCJA 3PULA 3TR2A 3B05A 4IX2A 4ZQRA 5BMXA 5G5IA 2V0TA 1OF8A 1VQTA 4QISA 2Q8LA 4Y9AA 1G4SA 3THQA 1C9DA 3DHFA 2NX9A 4MKNA 4EWND 1LBMA 1XBYA 3E49A 3S1UA 3DFPA 2FB3A 4XZ9A 5DXYA 1FX6A 2DORA 3THAA 2HSAA 3GXNA 3NQ6A 5D2XA 2E6DA 3RLUA 1JJKA 2V2CA 1HG3A 2XFWA 3LCHA 3MP3A 3W1AA 4DPPA 1DJQA 4FEZA 4NJIA 1EEPA 3TKFA 2Y63A 4JTSA 3TQKA 3RLVA 3SI9A 5DBTA 2RDUA 3VCRA 3EKLA 3Q2DA 4CCCA 2J27A 3MHGA 4JTEA 1NVMA 3FJ6A 2Z6JA 3L0GA 1QCWA 1RQHA 4RV8A 3WJZA 4IOTA 4YCOA 3W74A 3TAOA 5EY5A 4ZZ9A 5KITA 1OVDA 2ZDRA 3HJZA 4QNEA 2R94A 2GQ9A 4PFMA 1P5BA 3W7PA 4JTKA 4KFPA 1X1ZA 4PC8A 1G69A 3HG5A 4RK8A 3EWBX 5IM51 1ZCOA 3HG3A 4MZ8A 4ADUA 4RKAA 4RZ4A 1YPFA 5DLCA 2H90A 1I2OA 1A5BA 1QPQA 5DBUA 3S5NA 2I1OA 1JUEA 3TNOA 2V82A 1YPIA 1I4NA 2VFEA 3M5YA 3W71A 2YR1A 1F6KA 4JN6A 4N9DA 1TV8A 1KW1A 4IPIA 4NNCA 5DXXA 1IXPA 5G4WA 2W6RA 3T55A 3HPZA 3BLEA 1SR9A 4WZHA 4Y90A 4RZ5A 1I8JA 2NWSA 4XTDA 1TB3A 1JQXA 1WQ5A 2C15A 5HUOA 3BGJA 3P74A 4GUGA 4K36A 1H7OA 1OX5A 2DP3A 1KM3A 1RD5A 1OX4A 3R5EA 3W2JA 4PH6A 1WDWA 2YXGA 2ZRYA 1LORA 1VH7A 1ZFJA 1KBJA 3TK7A 1B3OA 3M5ZA 4CNNA 4O28A 3LCXA 3JS3A 1K02A 3HOJA 3NQCA 2QJHA 1MO0A 3WK2A 3HPXA 2YW3A 3IGSA 3NQDA 3KFTA 4UFMA 5LNSA 4PL2A 3L68A 3P84A 3S1WA 1IGSA 3NQEA 5FF4A 4QSHA 4KWVA 5EKYA 1MXSA 4OV4A 2QCHA 4MJZA 1R47A 1G4EA 5AC7A 3C0JA 1AL8A 2A2IA 1W5NA 1TJRA 3PSWA 1CW2A 2VEPA 2GVGA 1VCVA 5CZTA 4NUWA 2X1RA 3GXTA 1YLVA 4AWSA 3W1LA 1EB3A 5LNRA 2OX1A 3BW3A 1NF7A 5CPLA 1KFLA 1FBAA 4Z1AA 3E02A 1SO6A 4UMCA 3M9YA 4UTJA 3EX1A 2B7PA 3KVMA 1S5TA 3WJXA 4JICA 3TC7A 3CC1A 4O57A 3HG2A 1RQEA 3TU9A 1OFOA 2NV1A 3EWYA 1C29A 2WSYA 2NXGA 3LXBA 4GUJA 4AHOA 4O10A 1SZGA 3W1RA 2VKZG 3NL6A 1W56A 3NGJA 4XQ6A 1A5CA 2OCZA 5CZ0A 4DELA 3W1TA 3W2MA 2I9EA 2X30A 3I7SA 5K4XA 1V7YA 3N34A 1EUAA 4I7UA 1VHCA 3BLIA 4R53A 2G96A 4Z0SA 2QCCA 2AQWA 4AVFA 2ZRXA 4K39A 4MFDA 4ZQOA 1M5WA 2VOMA 1L6YA 1QFEA 4YMZA 3UY8A 3TDFA 3KRUA 2Y6ZA 1H1YA 5D33A 2E5DA 2QCMA 5D02A 3IIVA 4WOQA 1YXYA 3IRDA 1VYSX 4UFIA 1U5JA 3W7LA 2QCNA 2RDWA 2V2DA 3QRHA 4WD0A 1EUNA 5DCBA 1TTJA 1ICSA 5K9CA 4TMBA 2DZWA 4GRSA 2YSWA 3GXPA 1FCUA 1G7UA 1XXXA 3UWZA 5F2MA 4CLMA 2IQTA 4JIQA 3NQ8A 2GJLA 1VYPX 2YZRA 1GT8A 3DFOA 2FPTA 4MUZA 1S3HA 4EF9A 3WJSA 4TU1A 3PS7A 3IIZA 1ME7A 3W76A 2X1TA 4JTUA 5AC6A 2CZFA 5SWUA 4P2VA 5C6MA 4HN4A 3VE7A 1QWGA 5CPOA 4M6PA 3MI6A 4AWTA 4ZQPA 1GVOA 3LHZA 2YFNA 3I7RA 3IVUA 3CPRA 3W6YA 1W5PA 4XKYA 1X6UA 3LB0A 4FHAA 5A8GA 3STCA 3W1XA 1I2RA 3TC6A 4S2CA 3E96A 3P8IA 4UMAA 1RR2A 3M43A 4UNLA 5HQEA 3JR2A 1BWLA 2WJZA 2C6QA 4CQ9A 6ALDA 1LOLA 3CEUA 2OMAA 4LTSA 4H4IA 1TO3A 4HKPA 3C6CA 4OT7A 4KWWA 4O0ZA 2WQPA 4Z1DA 1B4KA 2WNQA 3O07A 4AB4A 1SZNA 4BI7A 4N02A 3G0SA 1X8FA 3S5ZA 4FB7A 3UPWA 2V30A 5LHFA 2E68A 3ZFHA 1RPXA 3NR0A 2CLKA 2TMDA 4QITA 2FLIA 3NOEA 1BKSA 2O7QA 4YCPA 2V8ZA 2VEKA 3HO8A 1XI3A 1OHLA 3G1YA 3HMJG 2KZHA 3O16A 1RV8A 3WK1A 1W5QA 5K9DA 2BSLA 2RFGA 2GQ8A 2A5HA 3GR7A 5H2ZA 5CKSA 3ABSA 1KLYA 1EWEA 3H55A 3GB6A 1KV8A 3DGRA 2P10A 3V1PA 2V2HA 2BLEA 4O1AA 4OU1A 3QQ1A 1OX4B 3TE9A 4JNMA 1SW0A 1FUYA 3LX9A 3DFTA 4O54A 3CM4A 3UNDA 3W88A 4EOUA 3L5MA 1RZMA 2BXVA 3N73A 3L5LA 1O5XA 3FJLA 4IGHA 3C2EA 1L6SA 4O53A
chains in the Genus database with same CATH superfamily
1SZFA 1TE1A 1UWRA 5DT5A 4RE4A 3G3DA 5I6SA 2VGGA 4JTGA 2ZBTA 4X61A 3VUPA 3IANA 1PTGA 1R0MA 4AIOA 5CJ5A 4UTTA 3HA1A 3OVQA 4C6NA 4PMUA 2OO6A 1HO4A 1S2UA 3N17A 3AIVA 2GVEA 1VZWA 2YDSA 1RD6A 4JZ5A 2OQLA 3R58A 1OCNA 1YMYA 1PUDA 3SFKA 5E9AA 4TX9A 2VX4A 2XHYA 4GOAA 2Z2BA 3PZQA 4KFOA 1VPXA 3MT1A 2XVLA 4Y9PA 3T0BA 1H61A 4CEXC 3F4DA 3PBVA 1DWGM 1XYCA 1WKYA 5I78A 3N9SA 4L61A 4NAFB 1AK5A 1VBRA 3BUVA 3W22A 2B4GA 3H2AA 2IXUA 3UZYA 1JDEA 1ONRA 1H7RA 2AMXA 5F2GA 2W0UA 1XBXA 1UROA 1AZ2A 3W2UA 3VIOA 1MUWA 1VJIA 3KOYA 5JBFA 4I7WA 5KZDA 4G7EA 2PCEA 3C61A 4XKMA 4FF7A 4FR6A 4O4WA 2W62A 4GACA 3U5UA 4UR7A 4PTNA 1O5KA 3HV8A 4FIQA 2JEPA 4JY9A 1XQKA 3QQWA 5EL1A 1IEXA 1UKOA 2QV4A 1LT7A 4CNPA 3DYPA 3T8QA 4DBWA 4M7TA 2E77A 4PUEA 3GXDA 5CBBA 4PUKA 4Q8NA 3W7KA 5KETA 1Z89A 3QMRA 3OYZA 3HM7A 3CV6A 3WQVA 1KM6A 3DHUA 4LAOA 4QJ4B 6REQB 4TMCA 1UKPA 4WF7A 1IYXA 1GKPA 5U7SA 4RW3A 2GJNA 1TIMA 2BVDA 2V5BA 1EHAA 1TQXA 1X38A 1SW3A 3N2MA 1CB2A 4IISA 4XBKA 3VNYA 4IX0A 2XH0A 4GX8A 4GYJA 4R88A 1YDNA 1CXEA 1DVJA 3ALGA 4H6RA 1WX0A 1MNSA 4TVDA 4A3HA 3L4XA 4C6FA 5TBOA 3B8TA 2E1WA 5LNUA 4H8VA 3QHMA 2R1LA 5D04C 4H9YA 1X1NA 5G1TA 4HVXA 1GGOA 3REQA 2PU0A 5AB3A 1F61A 2XZ7A 5B80A 4D2JA 4MAVA 3UF9A 4B9ZA 3OPSA 6CGTA 3ITYA 2YW4A 3TXVA 4U31A 4O18A 3UNTA 2FHFA 5A1AA 4B90A 4PCNA 3G77A 3MSRA 2G97A 4DNMA 4NJJA 5E9XA 2O9RA 3FK4A 4H7ZA 3AQUA 3BJTA 3KWSA 3G1HA 2ATSA 3HG4A 3R8GA 3BAIA 4JDBA 2IKGA 2BY3A 1S1RA 4BEQA 1LDCA 1JD9A 3W75A 3KUMA 4QDWA 2NSXA 2B81A 2QXWA 1ZAHA 2OLHA 3H24A 2VX6A 1UA7A 4M3PA 1WV2A 5GJMA 1QPNA 5M17A 3EXTA 2R91A 2V3FA 5AYXA 4GUIA 5G4HC 2IKHA 2PRMA 3GTHA 5ABEA 1TV5A 4GVGA 3LCLA 1CB7B 3PM6A 3TMQA 1EX5A 3BICA 1W3TA 3CQ0A 4S23A 3WUBA 4DZ5A 2DZXA 3WD0A 3LY0A 4ZSTA 2FGLA 3PFMA 1OWQA 1NDWA 3VA8A 1VGAA 3LCGA 2OZTA 5CPQA 2XIIA 2JKPA 2P8CA 3VD4A 2FZ9A 4PCFA 4C6JA 5LA1A 1KWGA 3HGOA 4WXZA 3DFQA 1E55A 3AZRA 2I5QA 3TYUA 4NZ5A 3RITA 3LOTA 4S3JA 3OBAA 5AHNA 4HMDA 2F2KA 2Y85A 3G2GA 5LXEA 4L1WA 4IIGA 5LKYA 3KOFA 2ALDA 1VC4A 3AJXA 3FEMA 2GJXA 1ISXA 1JZ8A 4MPKA 1YKWA 3GNXA 4O13A 5CZKA 2XIOA 4OTKA 3FDGA 4GZEA 2E8ZA 2C79A 4D6DA 2C7FA 2G37A 1FH9A 4BQ3A 1WNOA 3DDMA 3IAQA 3N11A 4XAPA 4E0CA 5K7JA 5I3GA 1XF0A 2ZKMX 3N4EA 5EGRA 1VFOA 3CS2A 1QO2A 3BV4A 4MY1A 3HV9A 4PB4A 3MBFA 4RZBA 2DIKA 4FOKA 2A7NA 4XVDA 2GSEA 3P67A 3QKEA 1TMLA 4CCDA 3GVWA 1NWRA 5I3HA 4UTMA 4X0NA 2BVWA 1W1YA 3LHUA 1LYXA 1ADDA 1CDGA 4W5ZA 4Q7BA 3CZJA 1AZ1A 1GHRA 2VC6A 5CPTA 5FJUA 2Y70A 4GZJA 2OVLA 4XUGA 4PMVA 1EYEA 2DUZA 5L9FA 3T2PA 4L9ZA 5HMFA 3W7IA 4O1BA 1UCWA 4PBFA 4M19A 3PF3A 4RX0A 4WKHA 1K70A 2CU0A 4YN5A 4HYWA 3L0NA 2G0WA 4LVAA 5LA2A 4U4MA 5D8WA 3WNKA 3G1XA 3GNNA 3S5YA 4Q8UA 1AFSA 3AXHA 3QY8A 4JEJA 4HA3A 3VD3A 4DYKA 3MI3A 1YEYA 3QLLA 3RCMA 2J6VA 4H8HA 4J3VA 1G67A 3DN5A 4DYJA 2EKGA 2OEKA 2E5CA 3EB2A 1M53A 3TLLA 3U9IA 2C16A 3Q67A 2UV8G 2YLAA 3TSDA 1VS1A 1BVNP 3L7RA 1KM1A 3MBDA 3R12A 3DH7A 3I65A 3QMSA 4UR8A 1LRTA 5CGQA 4NIRA 3F2DA 1UUOA 3EWCA 1T0OA 4P7OA 2D24A 1AJZA 4NNBA 4UNIA 1RLDA 1PS9A 1CECA 3PAOA 4LQ1A 4D1JA 2VX5A 3UPBA 4JD4A 3BPWA 4ZB0A 2CFFA 2A3AA 1H7PA 4M24A 3QV7A 1GK8A 2WM0A 4WHBA 4IFKB 4UQEA 1EIBA 4KEMA 5BU6A 1MW0A 4MG4A 4M6UA 5LZLA 2SFPA 1CLVA 1KFKA 1D3HA 3P60A 1ML1A 4HNOA 1CGWA 2Z4GA 2VD8A 4KRUA 5BROA 4IFOA 4HA0A 1RP9A 1F7BA 1FWBC 5JBEA 4YIWA 3WUFA 3K1GA 4AZIA 3GG0A 3B0VC 2QKFA 2EKCA 3GG8A 3EOOA 1AW2A 1VFUA 5E0KA 3TTQA 1C8VA 3DFHA 4V15A 4LUJA 2WB5A 1QPRA 1OGGA 1U22A 1RALA 1UHVA 1IF2A 4HPXA 1ME8A 3MVIA 4CD5A 4A3YA 2X09A 5EPDA 4CD8A 4AY8A 3WBAA 4HNVA 5BZAA 3GDLA 4ZE4A 3BLLA 3FKKA 1E0VA 3BGGA 2ZRZA 5F2LA 4GY1A 4RR4A 1GEHA 2QAFA 4FLRA 1VBHA 4B2DD 4IJBA 3T42A 4HK5A 4UQCA 2JFEX 1XLKA 3QJAA 4JR5A 5TQLA 3DECA 3W6MA 3VGBA 2POTA 3JRKA 4GI9A 3S9YA 1H62A 4V1YA 1DHKA 1UR8A 3G1FA 4CCEA 3FVDA 1H4PA 1POJA 4LCRA 4KWSA 5ABGA 1XL9A 3VMNA 2DFAA 4O12A 3FKRA 3M4HA 4MYAA 3VIPA 2X2GA 3MB9A 3LENA 3CLMA 3CO4A 5JU6A 2GVYA 3A3XA 1UOKA 4JKMA 4YHGA 1ISYA 1FH7A 4MFEA 3NIYA 5FEPA 5FCZA 3VCCA 1SGJA 3SRKA 1E1EA 3O15A 1Z6KA 2VZSA 5HAOA 1V93A 2E4TA 4GQQA 4XBSA 2PE4A 4OGZA 3W7MA 2ZTKA 2WW5A 4LT9A 5IDIA 3WF0A 3URQA 1TREA 2YDAA 3FEQA 1DE6A 1A5UA 1DIOA 3O2LA 5JUVA 2CITA 3RX2A 5ABFA 1TYGA 1MUCA 4LVBA 2ISVA 5DMMA 4U2ZA 3CZKA 4KCVA 2YX0A 1N7KA 3NQAA 3IGXA 4IMEA 4XAYA 1YIXA 3BJSA 3WEZA 3KOZA 3UZ5A 5DEZA 3LLXA 1W9XA 3BAYA 1O1ZA 1LQ2A 4MWAC 1PZ1A 4UFJA 5B7YA 2DEPA 2E67A 2ZTJA 3NDOA 1K03A 4I7VA 2EPKX 1E4NA 1SSGA 3CZEA 2YL9A 5DY2A 3EX6A 1VLWA 4QHRA 1XLGA 4H8NA 2DVUA 4JS3A 2VFIA 3EWUA 2ZZ7A 1YE4A 1LM1A 3HTWA 4OQVA 1GOOA 1OK6A 2WCGA 4NZ1A 4LVFA 1UB3A 3CMJA 2CZEA 3O8AA 3GNDA 3T78A 4W4QA 1AVAA 3I6RA 1OCBA 5AC8A 2I7GA 1TMQA 4I5XA 2Q71A 1DJNA 3EA3A 4B3KA 1F8IA 4DY1A 5LGZA 1S5MA 2NWRA 2CXEA 5IFPA 2D2HA 3GH4A 4O14A 1EA0A 2DJLA 5LSMA 2ZX7A 4C6KA 4EP8C 1FFRA 2VQTA 5LNVA 3M0MA 3D0CA 1E40A 3WF4A 3PUDA 1BRLA 2J78A 4DJEA 1KCXA 4XG1A 3REQB 1F07A 3LBOA 4P8VA 3PC0A 1LRQA 1KFWA 3CNYA 1UD6A 2VRQA 1F6PA 3WQFA 5K2ZA 2Z1BA 1TRDA 4C6BA 3VOHA 2Q6ZA 1KR0A 1RSCA 2G3IA 4HBKA 1AH0A 3G0UA 1K77A 2NVAA 2RGLA 3ANVA 4QLJA 3ELFA 1MUMA 2WWDA 4A2SA 3JU2A 3UWQA 2CXGA 3G1AA 3O0FA 1YDYA 4UTLA 3MP4A 4NJKA 4X22A 1WDPA 2P53A 2QCDB 1JFHA 3AHYA 3W2LA 3XISA 3E3HA 4Q8QA 1RVGA 1ESWA 6REQA 1Z32X 3DKJA 3N1AA 3S9IA 5T26A 4L1XA 1EIXA 1Q4NX 1I60A 2HQAA 3ZWTA 2VZVA 2YZ5A 1W3KA 3TN3A 1JL8A 3W82A 4S39A 3O9NA 4DUXA 3NPUA 1OJXA 1VBUA 4XAFA 1EDQA 3ITVA 3KL3A 4LV4A 2ZZ5A 3KP1A 3EWDA 3DG6A 4UC5A 5CLWA 3U6WA 1DQXA 4AMAA 1ICQA 2D73A 4JY8A 2ZXDA 4UIOA 2F9RA 2QIIA 1FFQA 4ZSUA 1M7JA 1JYNA 5EMYA 5CBJA 4E2BA 4XO6A 1OEPA 3P7YA 2GK1B 4KIEA 1VJZA 3DC0A 1F9CA 3MMTA 3BW2A 2FPVA 1EPXA 3NDZA 3L4TA 3MSDA 4DLFA 5EBAA 1XCFA 1PDZA 2ZCGA 3BLOA 2NVDA 4ZB5A 1XIEA 5I5RA 3HMCA 4WSJA 4AH7A 1U5HA 4K7VA 1O94A 3WDPP 4LCSA 1W54A 3NQMA 2O9TA 4XIAA 2CYGA 1FP8A 4JYDA 2BHUA 2NLYA 5MF5A 3MI2A 5AHEA 1UZDA 3M6YA 4MWAA 3RR4A 3BMXA 4V2XA 3OHMB 1M68A 4HCDA 4JIPA 3WQGA 2WOQA 1G7VA 1SM9A 1DJXA 1JUKA 4CNUA 5JIPA 1JCTA 1KV5A 4JN7A 3K8KA 3CYJA 3LUTA 2OFJA 2DW7A 2IXVA 1R3VA 2CZVA 4G2DA 4A2RA 4K2SA 3SCRA 3IIOA 3P5ZA 3VE9A 3WDQA 4WJEA 3UWVA 2Y2WA 1Z69A 4G1KA 2VFGA 2J77A 4HT3A 4JTLA 3S2CA 1W8GA 1YTEA 4JCMA 5IHSA 1HIZA 4ERIA 4IMCA 2EG8A 3B06A 4Q8WA 4ZOAA 3NO3A 3A12A 5AZ1A 1A5OC 1LRNA 2ATMA 3QR0A 2FVMA 2HNEA 2A3EA 4ML9A 1I2QA 1QNVA 7PTDA 1UWSA 4JQ2A 5MHBA 2ZDSA 4ATDA 2IQDA 1QOQA 1U1HA 1RQBA 1V0KA 1K8ZA 1JULA 4UCFA 1P6WA 3UZJA 4ZVJA 4JAWA 2GDVA 1HN1A 1UD2A 1TPC1 4RJEA 1X1OA 2OZ3A 4NL1A 1XIDA 4LEQA 1FWAC 2YBTA 3WD1A 2ZUVA 4NZJA 1GVSA 2HEJA 5XIAA 2ISFA 1GVYA 5BMWA 5I3FA 6TAAA 3KL0A 4AY1A 4K38A 1J0YA 3TYDA 2PEVA 1ZY9A 2NXHA 3C8FA 1GUVA 1KXVA 2FVLA 1GOMA 1AQFA 1B9BA 1UIOA 4HCHA 5KZ6A 1HJSA 1M65A 1AQMA 3BK0A 2VNCA 3A22A 1UC5A 2QMJA 3ANYA 3PANA 3VX0A 3VNLA 4WR3A 1V02A 2C19A 4JTIA 3QQ0A 3PZGA 4ZEPA 1RK6A 4BWLC 2VP8A 3MWCA 4MHBA 2QNEA 2VCCA 1IXNA 1I9CB 3VGHA 1QR7A 4KWUA 3ARYA 2WBGA 3E38A 1MFVA 3O0KA 3E0WA 1DV7A 4X60A 3WH9A 4M6QA 3UR8A 3TUUA 4WSHA 2EF9A 2OTDA 3EDJA 3GXIA 1AUSL 3KVJA 2HBVA 1C93A 3QKZA 4C1KA 3ZM8A 4IIFA 2UY5A 3E0FA 3GDMA 4H00A 1NOUA 1OFBA 3LGGA 1AJ2A 4NAEB 5GPRA 1XIIA 3OIHA 1OCJA 2CERA 3IRSA 1U83A 2E3ZA 2NUXA 3C0SA 5G2WA 3VM5A 3GH7A 1Z42A 3BV7A 5AY7A 3VIKA 2HWGA 3KBWA 2QDEA 1M7PA 4MB4A 4H19A 4N7QA 3ARUA 1FDZA 1UWQA 1F4HA 2BGSA 3WDJA 4H9MA 3M07A 1BYCA 2NQLA 2XGZA 1H5VA 5FEZA 1MXDA 3E9AA 1OGSA 5D9OA 1QI0A 1Z3NA 2RH9A 2W27A 3PUOA 2GJXB 2C1HA 3ZS4A 1FDYA 1T7LA 2EO7A 2Z26A 3WLMA 5KMYA 3G1VA 4C6EA 1CGUA 1GVFA 1C92A 4JTAA 1YYAA 4DWDA 1ODUA 3DKLA 5HANA 2J25A 3LLDA 2WHKA 5I3JA 3GG1A 5BWFA 1BG4A 5HNRA 1I1WA 1YADA 1LG1A 4GXPA 1DP0A 3C86A 3W00A 5A8PA 3SR7A 4MTVA 1NELA 4DO4A 3GKAA 4QLKA 4HMEA 2W5FA 3D3AA 1FWFC 2PTWA 1J01A 1GZGA 5C55A 4Q8OA 2A6NA 2CLFA 2HTMA 1BQGA 1O95A 4UFKA 1HJWA 2QYGA 1P43A 4AEOA 4DLMA 2HISA 3ZLFA 1RUSA 3IV8A 3KVKA 1TX0A 3M0KA 4HNCA 3GYEA 1V0LA 2BOFX 3PSVA 3UG5A 1HF6A 2HK1A 2DT0A 1Z41A 2XM1A 3V35A 2AL2B 1H5YA 4QM1A 3WF3A 3WNPA 3ZR5A 3TJ4A 2CWXA 2DU2A 3EAUA 3SM0A 3MZNA 1FP9A 3OOQA 4GLEA 4PR4A 1S2CA 1XYLA 2GUYA 4M7SA 1UG6A 2BGQA 1W31A 1S38A 3FCPA 3N6QA 5HWMA 3GH5A 3U2ZA 1PO9A 2QCFA 3O6DA 2FH8A 3UXKA 1JCLA 3V7PA 3CUHA 1SJCA 2R82A 3E0IA 4ZFCA 2AGTA 1MEWA 3HZ3A 5I3DA 1GG0A 3BAWA 1DQUA 1N8IA 1R38A 5JVLA 4DBEA 3MW7A 2GVJA 3URNA 3G1DA 2DJXA 1EKOA 4A6GA 3HQ1A 2QUTA 3R79A 2GL5A 5IBXA 2VENA 1W2PA 5KZMA 2H9AA 1G1YA 2LLEA 2VVSA 4I8YA 4NI3A 1YQ2A 3V75A 4ZOCA 2VTFA 3RIKA 4CD4A 3CQHA 3BQ5A 3LCFA 2EXOA 4B5TA 2PDMA 3KBNA 2OU4A 1FXPA 4AX6A 4E8DA 2VC5A 2VELA 1GQIA 3ZLHA 3SN4A 1F3EA 4GH3A 4MADA 1JZ4A 3Q94A 4DQWA 5DF0A 1KKOA 2PDHA 1RJRA 1E6NA 5G5IA 1V6WA 5FOOA 3THQA 2P0IA 3K13A 1LBMA 2GJPA 4CD7A 3E49A 4JKKA 1JYVA 3DFPA 1HXJA 5A6KA 3FY1A 1XD1A 4PGLA 1PX4A 1C8YA 1KD0A 5AC5A 2GQ3A 3GXNA 3NQ6A 3SCVA 3FVMA 1JZ6A 3PFRA 5LIKX 1Q7ZA 1HG3A 3LCHA 3TKFA 3RLVA 5DBTA 2RDUA 3VCRA 3EKLA 4DJDA 1UZ1A 3MHGA 4JTEA 1BYAA 1QCWA 2ZADA 3LSCA 4LB3A 4WJXA 3WJZA 4KMQA 3W74A 2PWGA 4J40A 3AWOA 3QY6A 4CU7A 3KCLA 4Z1YA 4GFIA 2PF8A 4QNEA 2OGJA 3NZGA 4GQRA 3VD9A 4PFMA 1BSLA 3SCWA 2CC0A 4PC8A 1LJYA 5FJTA 3LMYA 5CC6A 5EMJA 3HG3A 5CXPA 2D1ZA 5DBUA 2GLKA 2I1OA 2V82A 4N42A 1DEDA 1DWAM 3M5YA 4DJED 4YWSA 3EMQA 2BXYA 4NNCA 1IXPA 2W6RA 2XISA 3HPZA 3JW7A 2Y8VA 2D2GA 1JQXA 3UETA 4J35A 3DESA 2DSUA 2VHLA 3EGJA 3ENLA 3NTYA 3SSZA 1KM3A 1TWDA 2V3DA 3W2JA 4AX7A 3BH4A 1LORA 1ZFJA 2DVTA 4AXNA 5LIYX 3GXMA 2HXTA 5D9NA 2HBXA 1U5VA 3LCXA 3RJXA 4AZBA 2AL2A 3WK2A 4AZHA 4Q8MA 3IGSA 4HP5A 3NQDA 2PTDA 2G3FA 3KFTA 3BWWA 2REQA 3B8WA 5LNSA 2PAJA 3S1WA 1US2A 4JQ1A 3D5HA 3Q65A 3NQEA 1MXSA 4OV4A 2E9BA 3C0JA 2JF6A 1AL8A 3F5JA 1XLBA 2A2IA 3QFWA 4LBUA 1TJRA 1CW2A 2GVGA 1BGAA 5GNXA 5CZTA 1J2BA 3GXTA 1JZ7A 3CQJA 4L6HA 3BGAA 3BLKA 5LNRA 1NF7A 5CPLA 4H83A 4Z1AA 6PTDA 4LBRA 4UMCA 1GW9A 4ZTYA 3CPUA 4REQB 9RUBA 1XH0A 3WJXA 3H22A 3M46A 1M9HA 2GDQA 3TC7A 3BL3A 3TU9A 1OFOA 2MUCA 3GNRA 1B0IA 2QPSA 4O10A 4XISA 1SZGA 2D3NA 3NL6A 2YA1A 1W56A 4XQ6A 1A5CA 2WMIB 2X30A 3I7SA 4CGTA 5K4XA 1J12A 2YBUA 1VHCA 1H11A 4E3TA 2G96A 2QCCA 2XVNA 1SJAA 5HQLA 1FHUA 4R3UA 4K39A 1US0A 1IZJA 3M0LA 3TYZA 4P7QA 1VEMA 3AYTA 4QRNA 4REQA 5D33A 2WSPA 2E5DA 3CUFA 2QCMA 3IIVA 5BXRA 4PMZA 2DDXA 1VYSX 5DMNA 3SUVA 2QS8A 1U5JA 3S6TA 4DB7A 5I07A 5DCBA 2PLJA 4QG6A 2GWGA 1WUEA 2DZWA 2Y5SA 4PUDA 1JDAA 3UWZA 4CLMA 1B9ZA 3NQ8A 1RH9A 1PEZA 1E0TA 1FWJC 3L4VA 3QHNA 5BCAA 2PDBA 3WJSA 1A3XA 4M8UA 3PS7A 3GS6A 1ME7A 4XIMA 3WMLA 1H09A 2CZFA 5AC6A 4Q7IA 2WC3A 5BWAA 1JG9A 3TEVA 1NP0A 3BCFA 4PTWA 5H1WA 3OG2A 5DANA 3F4VA 2OODA 1GONA 4IGSA 2VL4A 3LHZA 3I7RA 2W91A 2PF0A 3BURA 3RN6A 1X6UA 3LB0A 3A6OA 1D7KA 1I2RA 4S2CA 3E96A 2I16A 1RHCA 2VURA 5TD4A 3JR2A 2WJZA 1XQLA 3B8SA 3PJXA 2FVKA 4LTSA 1TO3A 1NH6A 3MVTA 3QV8A 4KWWA 3AXXA 4O0ZA 4ZBCA 2PFHA 1RCQA 2WNQA 1NM9A 1EJ7L 1X8FA 3DG3A 1EBHA 3WNLA 4DIAA 1E9LA 2Y4SA 3ARRA 3ZFHA 1XGZA 4A3RA 2NVCA 5A6AA 2FLIA 2A3CA 4DJEC 2V8ZA 3S6OA 2VEKA 4PULA 2D0GA 1XI3A 3G1YA 1XLCA 1MXGA 7REQB 2YL8A 2YCKX 4PB5A 3ABSA 2DUXA 3GB6A 1KV8A 1ZS2A 3WLIA 2P10A 2P5NA 3RPMA 2BLEA 4O1AA 4C6OA 4OU1A 4TVUA 3LSBA 5C7VA 2OLSA 2VWTA 3S4TA 2GK1A 1KRBC 4JNMA 4KS0A 4AY7A 4O54A 3AXKA 3WH6A 4CCZA 2E9MA 2GGGA 1R8LA 4PCSA 3KM8A 3N73A 3L5LA 4PUJA 4KRZA 2NW0A 4LBSA 2GFTA 3PJUA 3EWXA 3G6LA 3SZ8A 5E93A 1WKEA 4M29A 1HJXA 4ZTXA 4AD4A 4K8EA 1K7FA 1OIFA 4N4PA 3UCCA 4JTQA 4Z2JA 4KT2A 3NQVA 3BW4A 3UG8A 1PTAA 4Q8VA 2VRKA 2YA0A 1NWSA 3TQVA 3WL1A 1R3QA 3LBCA 2FGZA 3STGA 3QFEA 5FJIA 2YL6A 3NXFA 5HJLA 1O12A 2NZLA 3RLGA 3BOLA 3H4WA 4ICMA 3TIMA 2VR5A 3V16A 4GUFA 1ZALA 3W70A 4FXFA 4AYSA 1XBZA 1OD8A 3CL7A 1FCVA 4GPNA 1B90A 2JBMA 3UGVA 2D3LA 3V18A 1J0IA 1RLCL 2I14A 3POHA 4ZENA 2VDHA 2AL1A 4JFVA 1LBFA 5FESA 4ZQCA 2PRHA 4CVUA 4C6DA 4ALDA 4M51A 2VVNA 3N9KA 4H9VA 4B5UA 4ICNA 4YTQA 3AHXA 4RPQA 1RA5A 3YPIA 3T1GA 3M0YA 3NM3A 3ZJKA 1JCMP 3VFLA 1GG1A 3PBYA 4X0VA 3W53A 3QXBA 3HFYA 2G3JA 4HB7A 4QQ3A 1A5NC 1E5JA 2E6YA 3OA3A 2WSKA 1S5VA 3LHTA 4GNJA 3FSUA 2J4GA 5K3VA 3PJTA 4Y9NA 4HSNA 2QUMA 3L66A 5CZSA 1ZGDA 1ZHAA 1TUXA 3MYPA 4JHZA 4A3QA 1PSCA 3TYEA 1E15A 3F03K 4GGBA 4MNKA 4IFRA 4WDUA 4GFSA 5D30A 3QSRA 3LI0A 1LUCA 2A6LA 1EJWC 3SJ3A 5A6BD 2Y24A 2HV5A 1UP2A 4O17A 1C8XA 4C1NB 3WUEA 3QC3A 1REQB 3KCOA 4XTIA 2PD5A 1O6IA 1MFUA 1QI3A 1XLLA 3VK5A 3QGVA 4P61A 5FD0A 3LPPA 1LL7A 3T9PA 2QUNA 3AWNA 4H9ZA 3PWAA 1Q45A 3NYDA 5M2FX 1D2KA 4MVAA 2EPNA 1BEUA 4HQVA 1UW9A 4GIEA 5AKQA 3R89A 1ODZA 1U30A 1UBSA 2OXNA 3MKKA 4FA3A 2QF8A 4U3CA 2PWFA 3W7HA 1KGWA 5HMDA 4PL1A 4CEUC 3SCSA 2P88A 3FS2A 4UTHA 3W73A 3OGVA 1BF6A 1ZB5A 1H0IA 3VD7A 4L56A 1FKWA 3PNZA 2Y7EA 3I3DA 4IGNA 3ARWA 2EQDA 2FFIA 3VNJA 4ASTA 1PHWA 1FH8A 3CT2A 3XINA 4INFA 1A0CA 4GUHA 3CAQA 4IPLA 2PBOA 2TPSA 4ES4A 1E71M 3T0CA 5L6UA 2OQHA 4LC6A 1J5TA 4R27A 4F9DA 3WDIA 3TW6A 4RDVA 1GJPA 3O6AA 2B7QA 1DTNA 1BWKA 3NXLA 1XRSA 4NHVA 4PMXA 4GKTA 1EA9C 1KTCA 3MS8A 4C90A 1VIWA 1EQPA 4AZ5A 2D2OA 3TYAA 4HZ7A 4ENLA 1ZSXA 3T0DA 5FJRA 3PVFA 3FGCA 3S42A 3V5OA 3D3FA 3IJDA 3P5YA 5HPCA 4Z2IA 1ELSA 3DCPA 2JK2A 4K8HA 2E6FA 5FEWA 1VFFA 4D8LA 3F1QA 3NEVA 5JH2A 1F6YA 2W4XA 1E4MM 3QBUA 4RDZA 1HO1A 3WQWA 1Q66A 4AD2A 3K4AA 2OOFA 1F74A 3WEOA 3TW7A 5D9PA 3AROA 1LTDA 5J5RA 1K9DA 3PN8A 2CKRA 3KBSA 5HWNA 2PLCA 3W2KA 3FV9A 5CC7A 4GCAA 2C0HA 1IIHA 4O19A 4ECLA 3W27A 3NVDA 1PIIA 1E3ZA 2CLOA 3DHDA 4KW2A 4IHCA 3G24A 1NIUA 4V27A 2QJIA 1BWVA 1XLIA 3SDOA 4QTGA 1KLZA 2J75A 4NJHA 1TCMA 4F40A 1CCWB 1J6OA 5HPOA 3MUY1 4JX4A 3V0UA 4YTTA 2ON3A 1JPIA 4IP7A 3CL6A 1VYRA 2V9DA 1AW5A 4J2MA 4B5SA 4JX6A 2O9PA 4K7YA 2Q01A 5A69A 3R7MA 5H8PA 1JYXA 1W5OA 2GUUA 1G6CA 2Y8UA 5TIMA 2YOCA 4O15A 1GQJA 1O4UA 4PTXA 1DBTA 1KB3A 1DJYA 3FSTA 4QAIA 3I68A 4WDWA 5I23A 3QGKC 4A05A 2WZMA 1MZRA 2R24A 3B9DA 4AZ7A 3MP5A 2HS8A 2AQVA 1QPOA 3PK7A 4UXDA 1YXCA 2V5DA 5I7GA 3LPOA 4TQTA 5GJNA 3N2TA 3S5OA 2I5GA 3STFA 2NX3A 2P3EA 2JGQA 2HS6A 4S3GA 1WAUA 2FMNA 1KCLA 1QK0A 3BCJA 1PAMA 3LRLA 3GU1A 3OGSA 1J0KA 5PTDA 1XPYA 3WFAA 3L4UA 2YBVA 3GDBA 2H9AB 2DZVA 3IJ7A 1V4YA 4E2VA 1U1UA 4NJGA 4LS0A 1N55A 3WDRA 2DUAA 4B5VA 4B15A 4CQ8A 2CPUA 5TAOA 5AHMA 1WP6A 1LLWA 1XV8A 4JFUA 4NILA 4YYCA 2RJGA 4O0QA 3WK3A 2POZA 3SFWA 1RBAA 4S3AA 3U3HA 2NV2A 1C91A 1HGYA 4BF9A 4MKVA 3ZLGA 2OYMA 2NV9A 3VDGA 2ANUA 1Q6DA 3OTRA 5HMSA 4DUVA 1WB0A 3LMZA 3T8LA 5CAHA 2BP1A 5AYYA 1YX1A 3FA4A 3NPWA 4DX3A 4R9OA 1TPB1 1G4TA 4Q4OA 2WMIA 1FWGC 1UA3A 3L2LA 1XLMA 3SRFA 3R2GA 3SGGA 4NU7A 2A3HA 4HMNA 4JEQA 4LW7A 4AG0A 5HK4A 2FFCA 3LI1A 2DZAA 3E6EA 1OADA 4B4FA 4MLJA 3KE0A 1VHNA 4DI9A 3UWUA 1DOSA 4DXXA 2QMKA 1DWIM 3RFAA 1S5NA 4XVEA 3RRAA 2KAUC 3I7QA 2RDXA 5DRCA 4ADSA 4HJFA 4MNLA 1MSSA 1FRBA 2YA2A 1PB0A 3RNDA 3TSMA 4N9BA 1YNQA 3M1ZA 3K4WA 2OO0A 3KTSA 1C90A 3DU0A 3EX2A 3CUXA 1VCGA 4YXGA 3SJNA 1UR3M 5I03A 4FAMA 1TJ1A 3R8RA 3MUCA 1Y5XA 1JCYA 3MO4A 3CAKA 3QC0A 1TCDA 1XIGA 1OZQA 4WUIA 2PU1A 1E1CB 3W9ZA 5D38A 1XHGA 7TAAA 2TRSA 2XWDA 4OBRA 4BI6A 2ZZ3A 3DX5A 4AIBA 3NSMA 1JCNA 4FO4A 1H7WA 3UJFA 1XRFA 1UH3A 3LEPA 3RPDA 3UYCA 1XIFA 4HHPA 4EAMA 1Q6FA 2WJDA 3VI2A 1UMLA 3KBMA 1HVQA 2YDQA 3A9BA 1Y7VA 4XD5A 3QVQA 3OIXA 4F0KA 3GKFA 2CHOA 3WKZA 3P3BA 2CLEA 1GYLA 2Z1WA 4GK8A 4ATLA 3T08A 2ZC1A 2Z0IA 5RUBA 3H70A 1KFEA 2BNJA 3GSMA 1UPMB 3TTEA 3LQLA 3CTTA 3B0YA 5FJOA 2Y89A 2VFHA 4MJ4A 2BV9A 2JGYA 1M1BA 2XIBA 1RK5A 5K9XA 1F05A 4ACZB 2DZSA 3C56A 2IQ0A 1Q6GA 3KTXA 1S2VA 5HQMA 3N04A 3GIQA 1E43A 5F4WA 3TA9A 4E2DA 1HUVA 3UZWA 4FX8A 1NAL1 3DG7A 4F2BA 1C9WA 3GLCA 4EKJA 2FZNA 4FNRA 3GIPA 3GBDA 3M7WA 4FNPA 3UXLA 3UEQA 3IIPA 1H7NA 3PP7A 5CSYA 2F61A 3E2VA 3ITOA 1OFRA 4L6DA 4JYEA 4QJ5B 4D72A 3ZT5A 1GPFA 1BSIA 1SYTA 1JI2A 4ZQMA 4LYPA 1E72M 3PTMA 4F3HA 4HZ8A 4HOZA 1VEOA 3I10A 2D22A 2CNCA 1IEQA 1XDJA 3LCIA 1IT7A 3UY7A 2V3EA 1UKSA 3T7VA 4C6QA 2ESCA 2XJ7A 5FF2A 4WDTA 2PGEA 1KBLA 1IR1A 1EJRC 3DYMA 1KFCA 1OFDA 8XIMA 4U5IA 4AZCA 2CLPA 3BDKA 1EJSC 1B4EA 3MSYA 3MSGA 4AHQA 1NWTA 4I9AA 1WPCA 3ABQA 1KA9F 2WSQA 3UZZA 1ZAIA 2X7WA 1I2NA 5CJNA 4PRTA 1DE5A 3C2VA 4L64A 2X42A 2OWWA 3TZFA 2FPYA 4WLCA 3VAVA 2Y7FA 4HTYA 3BE7A 3RU8X 1KQZA 4IT1A 3CHVA 2FDMA 1E0XA 2VXNA 1PE1A 3C2FA 1M6JA 1WE5A 2Z24A 1HKJA 1WKDA 3AS3A 3P82A 1O68A 5I3IA 1J79A 3U48A 2BY2A 3MHUA 3UBPC 2ACSA 3L0KA 3GFZA 1OFAA 3H54A 3VO0A 3KDNA 2UBPC 4KEUA 3UXAA 3A13A 1FWDC 4D1IA 1ADOA 1O1HA 5D2VA 4O16A 4QR6A 3W29A 4Z17A 5DQPA 2NQJA 5AHFA 3TXZA 4ADTA 3KXQA 1ZJIA 3UA4A 3QGAC 4A8RA 4LYQA 4WQ6A 4Z1CA 2OG9A 4C60A 3N19B 4Y96A 2NQHA 1QNPA 3CAWA 3USBA 3MJMA 1SO3A 2AGKA 3HPAA 4QFUA 4MJMA 3FNDA 4JHOA 4O50A 3O06A 4F0SA 2XUCA 1IEWA 4UFLA 4LF1A 2ZOXA 1P6BA 3G18A 1DXFA 1R46A 1FWSA 3ATYA 5CPNA 3Q45A 1XDMA 5I2UA 1V51A 4G6CA 3ARXA 3P0WA 2J7GA 3N15A 3CB8A 3VOFA 4EXQA 4O52A 4DBUA 2OKOA 6XIAA 2BODX 1UPPA 3NL5A 3BO9A 4IMAA 4XAGA 1ENUA 1UR1A 3DIPA 3W23A 1ZRQA 3H12A 4O4VA 3FOKA 1W1ZA 4IP5A 3ZR6A 4PMDA 3WQ4A 1E4LA 3PBWA 4Z08A 4JTTA 4E38A 2PURA 1W1TA 3B8UA 4XD6A 3SQLA 2W3ZA 2PRLA 4GABA 3WD2A 4GX9A 2VEIA 1Q6EA 2XYLA 3B0XA 2WYSA 4BQ2A 1BD0A 4AYGA 1Q2RA 1N82A 3N2CA 4JYFA 2RJHA 4P8UA 1EGMA 1Y65A 4ZOBA 3NPXA 1M04A 2DH2A 1F8MA 2F2HA 4JFTA 5C71A 4IIDA 1RA0A 1W5MA 3W2NA 2BZNA 4BEUA 3WNMA 3ATZA 2ZUNA 4MB3A 3T05A 3WF1A 4OZOA 3WQEA 2PTZA 1DJWA 3NJ3A 1R2TA 4EANA 2DW6A 5BW6A 1OC7A 1E4IA 1UD8A 3A64A 1M7OA 1GOXA 3E74A 1YW1A 4Y8EA 2X1IA 4YLWA 1S3TC 3C2YA 4PMJA 1QBBA 4QCEA 4LSBA 4J3ZA 2E25A 1D3CA 1GOIA 4DEFA 5F4SA 5KZEA 3AYSA 4PUNA 5I24A 4GVHA 1J6PA 3EOEA 1VD6A 2GZXA 3L65A 1JI1A 4NI8A 2R1KA 1A3WA 1FCBA 1OYAA 3H8AA 4D6HA 1VFMA 3K8LA 3KS6A 4MF4A 2VR2A 2F38A 1PKYA 2WQDA 2YLLA 4YWIA 4A8NA 1FKXA 2C14A 2Y61A 4LWWA 1TTQA 5D2WA 4LNCA 1CWYA 1X97A 4I90A 2CBIA 2TAAA 3VOJA 2XZ9A 3L4ZA 2ICSA 1LWHA 4OKDA 5IOBA 2QJJA 1MEHA 2R9RA 3GTNA 3AZTA 3CH9A 1EC9A 2WHLA 4H6KA 1IEVA 4LAUA 2WSRA 3M7SA 1XJBA 4FR1A 3IVSA 4C5ZA 2O4QA 4IMDA 3DBPA 1QNSA 1SZEA 3GTFA 3NQ2A 4LYKA 1QNRA 2IUZA 2ZC8A 3O3RA 4GIYA 1M7XA 1JPDX 3MCNA 1VCFA 4W7UA 2OJPA 3VIIA 1FWWA 1YBQA 3DYOA 1XIHA 1XPGA 2H8XA 5A2AA 4FP1A 2XN0A 2V6AA 3NURA 5KSWA 1NDZA 3U8GA 2QGHA 5FSDC 4JL1A 1MYRA 3WLPA 2XH2A 4XKYB 3WLQA 2I17A 2QEZA 1O66A 2PP3A 1GCYA 2PZ0A 3RUBL 1FWTA 3CIXA 5I09A 1FWRA 1GZJA 1TKKA 4O1CA 3F5LA 4QS6A 1L9WA 4JIIX 1GTHA 3ERPA 4FNTA 4M82A 2CHRA 4I8DA 4XZWA 4KESA 2DZTA 4Q22A 3PG8A 2GGHA 3OZOA 4S3CA 2PP1A 2WMHA 3V4BA 1SFLA 5G2HA 4H6EA 3G8EA 1YTKA 4FIRA 1HP4A 1QJWA 1YXDA 2ISSA 4JTJA 4ZQNA 3HGRA 2ZA1A 3EX3A 4HU4A 2HPIA 1W0MA 4AW7A 3A5VA 3BC9A 1OF6A 2I56A 3KBVA 2OSYA 2OKTA 4H1ZA 4C1NA 2HDJA 3ZVHA 3BLDA 2O56A 2PCQA 3DHPA 5FEXA 2R6OA 2EHHA 3HU7A 2DQXA 1E6RA 1FA2A 1IIGA 1ONWA 4GYFA 3NYZA 4C7FA 2EAWA 2ZUSA 3EA2A 1VPQA 2OSWA 1MW2A 4EPDC 4LCQA 4GBDA 3LTPA 1FCQA 2H3DA 4U10A 4IL0A 5A8OA 4NZFA 1W3HA 2PDPA 8TIMA 4LF2A 4KH2A 4O0KA 3MY9A 3GAYA 1IE7C 1E6PA 3Q37A 5EMMA 3QY7A 4TV6A 5CJMA 3M47A 9CGTA 2C8NA 3DZ1A 4NT0A 1WDRA 4RCXA 3R94A 3KHDA 2J9XA 3AHTA 3VC5A 1TQJA 1KTNA 3HQPA 5DMLA 4UWMA 2EGZA 1GPWA 1PPIA 1PIFA 4IQDA 3N29A 2A3BA 4S1FA 1NY1A 3C4UA 4EX4A 4US5A 1M01A 1MVYA 1TRIA 2EPOA 3W25A 4G1NA 1XLJA 5HNUA 3UU0A 4HNUA 4MB1A 1MEIA 3DI1A 1JCXA 2CLMA 4C65A 1GVRA 1J2WA 2YCLB 2ZVIA 4AD5A 1OYBA 4D8AA 3CUJA 2RDTA 4CU8A 1EOMA 2W61A 4GA8A 3UW6A 1V08A 4TOQA 2GJRA 1V0NA 3T6CA 2W9MA 3G3MA 5CLTA 1JCJA 3JVAA 1F3XA 1JIBA 1UOZA 1E0WA 1VQTA 4CNSA 3C0LA 4Y9AA 3NZPA 3AUOA 2DSVA 2JE8A 1XBYA 1EPVA 4B16A 3AIBA 3S1UA 2J47A 2V67A 1B2YA 4DVOA 1VEPA 4XZ9A 2DORA 3THAA 2IPGA 3GHTA 5D2XA 3N6HA 3A4JA 4YVPA 3RLUA 4CUCA 1CLKA 1JJKA 2XFWA 3W1AA 1RP8A 4NJIA 4NYUA 4Z2HA 2OGYA 1IHIA 3TQKA 1V77A 1QHPA 7XIMA 3Q2DA 4BHYA 1V8EA 2J27A 3UGRA 3AU2A 1NVMA 4A4AA 2JQXA 3GW3A 2Z6JA 3L0GA 4RV8A 4IOTA 4YCOA 5KITA 1G01A 1EEXA 1PIGA 2ZDRA 1W1B1 2GQ9A 3VILA 1P5BA 1EF3A 4JTKA 2BVYA 1G69A 3S5SA 1A5MC 4RK8A 4CD6A 1ADSA 5IM51 1ZCOA 1NFGA 4ADUA 3WQ6A 1OT2A 4RKAA 4RZ4A 1YPFA 1JUEA 3TNOA 4M56A 1GJWA 1I4NA 2YKKA 4P7NA 4XUYA 1QI5A 2YR1A 3EDDA 3SAZA 4N9DA 4QJ3B 4DZAA 1R7AA 3T55A 4Y90A 3VXGA 4RZ5A 2NWSA 3W38A 2DT1A 3VKAA 2VCBA 1WQ5A 2C15A 3P74A 2FZMA 2PWUA 4C7DA 4K36A 4ZXLA 1NJJA 3USZA 1OX5A 2HCVA 4PH6A 1WDWA 1NDYA 3PHAA 3WYZA 5LA0A 1QW8A 2WVVB 1KBJA 3TK7A 1B3OA 3M5ZA 3LU2A 5DT7A 2J7DA 2CCRA 1E6QM 1CGYA 4FOUA 4O28A 3PZMA 4RDYA 1K02A 3HOJA 2QJHA 3WLNA 1B30A 2IPFA 2CBJA 1VFTA 2WMKA 1Q8JA 3SCTA 2WXDM 4UFMA 3AMCA 1B5TA 4FK9A 1IV8A 2ZX8A 2Y8KA 3NDYA 3VKKA 4QSHA 4KWVA 4MDOA 1GVEA 3IAPA 4MJZA 1DJZA 5AC7A 3CUZA 1DJIA 1W5NA 2YXOA 3PSWA 1QNQA 3WX7A 1VCVA 3W37A 4NUWA 2IW0A 1IZKA 1ECEA 4AEEA 3SADA 1WAWA 3MCOA 3E02A 4EWJA 4UTJA 2B7PA 1REQA 3KVMA 4YU1A 3KBJA 1Q63A 1S5TA 3IUDA 4JICA 2HE8A 1RQEA 3H26A 2OEMA 1NOWA 4AHOA 2GOKA 2PC8A 3E5PA 4UB9A 1V6YA 5CZ0A 1V0MA 3N34A 3TNBA 4FMVA 3VKBA 2PWDA 5D4YA 1GORA 2X0SA 1P0DA 2UZ9A 3RRXA 1IZCA 1XICA 1L6YA 1EHNA 1CBGA 3TDFA 3KRUA 2Y6ZA 3ONBA 1JZ3A 2VDIA 4ROQA 4OOUA 5D02A 1UD3A 1YXYA 3IRDA 2PDXA 1LT8A 3AMKA 4UFIA 1CXFA 3VDBA 3QTGA 2RDWA 2V2DA 3QRHA 2PDKA 4TMBA 3MKCA 2YSWA 4GRSA 4I6KA 2ZIDA 2GJLA 2C1IA 5AC4A 4NZ3A 2WJFA 4MUZA 8XIAA 1UKQA 3PNUA 3W76A 4PCPA 2X1TA 3KZPA 4I9TA 5SWUA 4HN4A 3VE7A 3W0KA 1QWGA 4HOWA 5CPOA 1A4MA 3AAMA 2INEA 3R25A 5JIWA 4FZIA 2W66A 4AWTA 4YVXA 3GHUA 1YNPA 2YFNA 3CPRA 3DEQA 3W1XA 1KNWA 3TC6A 3WQ8A 4F0MA 1JPMA 4UMAA 4UNLA 5HQEA 3WLOA 4PUUA 6ALDA 2C71A 3IS4A 4HKPA 2WQPA 1B4KA 4FALA 4UZSA 3F2BA 1UIPA 1YNYA 3W6LA 2HZGA 1XP3A 4FB7A 2XGIA 2OLAA 1BF2A 1MNZA 1W91A 4HHMA 3KL5A 1TJ0A 1R9ZA 2TMDA 4ACYA 4OVXA 5T9BG 2F6UA 4XSMA 1FVPA 4YCPA 2X0YA 3WUGA 1OHLA 3UPMA 3EB4A 1B3YA 4QE4A 3WK1A 2OPJA 1W5QA 2HPMA 4J3XA 4MJ2A 1YPXA 2BS9A 5H2ZA 3FX4A 3BXWA 2WNWA 1KLYA 1EWEA 3H55A 1X98A 2V2HA 2WKGA 5AZ0A 1OX4B 1PX3A 4J7RA 3A4XA 1B31A 4D6JA 4AD3A 4HOXA 3LX9A 3NWRA 3F2CA 3CM4A 1L6GA 1HL9A 4GYPA 1UQYA 2I9UA 3W88A 3HQNA 3L5MA 1H0GA 1EYWA 1O5XA 4C5YA 4UQ9A 3C2EA 3QTPA 1L6SA 4O53A 2E7FA 4RLIA 1K8XA 5T9CE 1E0UA 1L0PA 3S6DA 3GWQA 2CLHA 2ZUWA 4ZO8A 3UG3A 2ACRA 4C6IA 2FTYA 3KAOA 1W9VA 1PDYA 1ONXA 2HXUA 3VNIA 2XINA 3SCPA 2QDGA 4PTMA 3TTYA 3BARA 3H7VA 5AOUA 1SR0A 5CPMA 3NOYA 3SUUA 3B04A 3HQOA 2YDRA 1KCZA 1E1CA 4TTUA 3ZSSA 5ABTA 1K9FA 4NXKA 2A85A 3GAKA 3K30A 1EWDA 1EGVA 4AZGA 1KGXA 1DJGA 3PBMA 4TIMA 3GRIA 4CU6A 3NQBA 4HK7A 1UD5A 3E2QA 3BSHA 5BNKA 4NRSA 2D0HA 3A47A 4K3ZA 1TPUA 2Z7GA 1YBQB 2R1NA 4NAEA 2D2JA 3SUWA 4UQAA 4JQ3A 5HATA 4JFSA 4HU8A 3AS1A 4QSFA 2C91A 3APGA 3IGHX 1HL8A 3DFNA 1YTDA 2YCLA 1VB9A 4MAZA 4GC3A 4K37A 2WLZA 2YXXA 3VIJA 4ORMA 3W72A 1G94A 4H9TA 3URAA 1KBKA 1TV4A 2ALRA 4QGCA 4PMRA 3LNMA 3WBEA 4EACA 3BSMA 1W8SA 3AIUA 3GVRA 2QR6A 3H2MA 1DWJM 4AWUA 3MUAA 1W9BM 3WQCA 3W86A 2E1DA 2WANA 2PDFA 1Q13A 1XUUA 3U4FA 4AF0A 2DIJA 4ZFMA 5A94A 5LIWX 3PPHA 5XIMA 2HRWA 1CIUA 2H6RA 5DFAA 1W1IE 5REQB 2V81A 4E3VA 1QWKA 1PHQA 4U5KA 4CQAA 2XFFA 1QMLA 1W3IA 1TVNA 3P2VA 1L8PA 5GNZA 3B9AA 5GNYA 4QIUA 3GW0A 3VABA 3HGSA 3S2MA 1GTEA 1QHZA 4LAMA 1Z7AA 3D6NA 2IS7A 2QUUA 4BJHA 1IQ8A 3GVVA 5FIPA 2QJMA 1WA3A 4H7CA 2WWCA 1I75A 1WDSA 2W63A 4CNTA 2E09A 3PTQA 1V6TA 3RM9A 1QAPA 3WNOA 1D3GA 1OSEA 2RGMA 3S1XA 1JRCA 4K68A 2WMGA 5CZJA 1A50A 2QQ6A 1BVZA 2OOGA 4V33A 3QPEA 2XWEA 2YL5A 2O9OA 2J88A 5M1TA 4JNYA 2DH3A 3STEA 3FW6A 4FXRA 4EIVA 3KRZA 2OZ8A 3RU6A 4AAJA 3DGBA 1XW8A 1K7XA 3M44A 4WIWA 4M0XA 1TUFA 1BKHA 3EXRA 4AMCA 3DERA 3NZ1A 5AHLA 4IIBA 4WY0F 2MANA 2DT2A 3QOMA 4X9YA 2P76A 4DI8A 2ZUTA 5EU9A 2QCDA 3UCQA 4G56A 1X6NA 3QN3A 4DO6A 1IXOA 1WDQA 4LC8A 2QVNA 4XWUA 3BLFA 1QATA 3NG3A 4LRTA 4MUPA 1BLIA 1TA3B 4GIAA 7CGTA 4S38A 2QHAA 4UOQA 3LHWA 2BDQA 2VFFA 2FKPA 1RJQA 3TR9A 4R9XA 5E0CA 4W88A 4WKAA 3WY1A 1ZQ5A 4UUIA 2OELA 1XUZA 2YJQA 4M80A 5E09A 3ARZA 2QPXA 1JAEA 2VQUA 2XTKA 3O7UA 2CZ5A 3CLWA 2BY0A 1BG9A 2ZVRA 3WG6A 3OQ8A 4WGHA 1Q6CA 1OFEA 3SSJA 2WK2A 2ZRVA 2NQZA 3QZ6A 3BJFA 5CSSA 2ZZ6A 1NFPA 3B4YA 3B03A 2ZZ4A 3MANA 1CLXA 1H51A 1DORA 3PPGA 3WIJA 3WNNA 3UVIA 4Z2LA 1MI3A 2UWFA 2RHGA 2VT0A 2VGIA 4H41A 3EDKA 4QG8A 1C3FA 4R33A 4WCJA 3GU9A 1V6VA 5C5YA 4F4RA 1SU5A 5T91A 5J8LA 4GQ0A 1A4LA 3GIYA 4DPQA 4QJ1A 3LHVA 1AG1O 4IQJA 2PTYA 5D2TA 4RNHA 2FH6A 2BHZA 1KR1A 2QULA 3LN3A 3OLIA 1VIZA 4MWAB 2QJNA 1FXQA 4TV5A 4YS1A 3OODA 2XH7A 3C52A 4QS5A 1I45A 4X2PA 1H1ZA 3R13A 4ZXOA 1BYBA 1A80A 3ES7A 4PMNA 4DM1A 3DC8A 3NQFA 4HNLA 3R1ZA 3RJYA 3LZ3A 2WCSA 3QEZA 4C6LA 2V68A 4J9JA 5G2IA 4IIEA 3CHEA 4Y2WA 1BXBA 2V38A 2CLIA 3W7OA 1EXBA 1K8YA 4DBDA 5A3HA 3AFBA 4N6EA 4ZODA 4DYEA 3OQEA 1LWJA 1UUQA 1ZTVA 3P6LA 3PZUA 2FDSA 3MJYA 2QT3A 3C8NA 4ACZA 1S39A 4W7VA 4W84A 3A9IA 2HK0A 2R8WA 4ORIA 3ITXA 5BXTA 3UESA 3WO8A 4YHEA 1YRRA 3SY5A 1IGWA 1HKIA 3CBWA 4IICA 2OQYA 3CTLA 3TV8A 4J27A 5EBUA 4F0HA 3E2RA 5HUPA 2W67A 3V0SA 4B5NA 3TFCA 3B0PA 3WJWA 3EKGA 1FOBA 3VNDA 5DMYA 2XIMA 2F84A 4KRTA 3SW6A 1TJPA 3CB3A 4RL3A 3LZ5A 1T41A 3GNOA 1XLEA 4LVGA 2Z2AA 1JUBA 2E5BA 2ASHA 3UWEA 4W8LA 1LQAA 3W1PA 5CGMA 3QW3A 1EX1A 4DZHA 1N2VA 3R6IA 3ZXWA 5HOSA 6ENLA 1J10A 2XSBA 3OZYA 3W01A 1TFVA 4RNIA 4JIHA 4RV3A 4PB3A 4MY9A 5HULA 3M0ZA 1E9YB 1M3UA 4LY4A 4GISA 3UR7A 1J0HA 4JTHA 1EP2A 2J13A 1XFCA 4PUMA 4D9PA 1CI1A 4FX7A 3VUSA 5CBIA 1EJUC 3MMUA 1JDFA 1FDJA 4GNKB 2QF7A 1DL3A 2J7FA 3VTRA 4CVWA 3S3GA 1TMHA 5AFDA 5HBFA 5FKYA 3MHFA 2Y62A 3EOLA 4KWOA 1WZLA 5C9XA 3DXIA 4U28A 4F0RA 2EJAA 3B3DA 4L4PA 3MV01 4N0RA 4YVVA 1XM3A 1OYCA 2XIJA 4LUSA 1BXCA 1HKKA 1T40A 1U1JA 1LLZA 2EPMX 2VFDA 3OBKA 5AYIA 4L9YA 5C0QA 3KX6A 2VUNA 3SQSA 4W9TA 2PDUA 3W07A 3EYPA 4UTWA 2REQB 5HR6A 1LOSA 5D32A 1JVNA 4BQ4A 3C3UA 6XIMA 3UJEA 3TWBA 3WBXA 2ZWYA 1LWIA 2G5WA 3GUGA 1VKFA 3SQMA 3NUKA 1TR9A 3QLDA 3HJEA 3CWNA 2WVTA 1Q6OA 1A47A 1WZMA 2FMOA 4FOJA 1PZ0A 1P0EA 1ZBKA 1FWNA 3E0LA 2PBGA 3QSTA 1WO2A 4UBPC 2DY3A 3RK8A 3NL3A 2H3BA 2J24A 3EOSA 2Q02A 3KCJA 3F4WA 4OE7A 3CO8A 3ORWA 1UUMA 3FHQA 4R7WA 2JALA 1Y0EA 3RCNA 3AIWA 3WMCA 4TX8A 4ZMGA 4IG2A 1XS2A 1UJPA 1FHVA 3A24A 4QP0A 4J3SA 4PODA 3MMDA 2DT3A 5JBDA 2YIHA 5GVJA 4GBUA 4HA4A 3W85A 4FNSA 2P3ZA 4BK9A 2E40A 1B3ZA 1MW3A 4NVTA 5M5DA 1G5AA 1H63A 1TVLA 1VBGA 1H60A 3PG9A 1L8NA 4GQGA 3B8DA 4LFYA 2C18A 2AQOA 3OHIA 2A1YA 3CZGA 2F6KA 4RE0A 4QROA 2WLYA 1Q6QA 3RAOA 4PEKA 2CW6A 4J3WA 2P50A 4A29A 4R7OA 1PKLA 1XISA 1XLFA 2CEQA 1V6UA 3G1SA 3SIMA 4D71A 1K3UA 2XVKA 3SUSA 2NQ5A 5H8UA 3ABRA 5U4NA 3DFYA 1AMKA 5CCZA 1ZJHA 1R2RA 5I0DA 1XH1A 4LXFA 4BI5A 3TN5A 4UOJA 2HVMA 3IJQA 2D0FA 4POCA 3AU6A 3EBVA 3GDTA 1TTIA 3W1MA 3VX1A 1P7TB 1XBVA 2NXIA 5DY3A 1V79A 2G50A 1KM0A 1XYMA 1SZRA 3SB0A 3V36A 1S46A 1I2PA 3QM3A 4AU0A 2WVVA 1IXQA 1F2JA 1ZUAX 2ZE0A 3GR4A 2BX7A 1AD4A 4BQ5A 4B91A 1XSKA 4G7EB 4WEVX 3MUIA 3T0TA 1YDVA 1AL7A 3H6OA 3XIMA 5DRIA 1QBAA 1UBPC 1NARA 2PDYA 5AVNA 1ZAJA 5BXPA 3RX4A 4CQCA 3CU2A 3URBA 1MW1A 2DSWA 2YYUA 5AHIA 3NL2A 4GYPC 3ZJ7A 3PBUA 5C2GA 3ZJ6A 2BWGA 2PODA 3U0HA 3CT7A 3LV5A 2XSXA 5HR7A 4C1LA 1D7FA 2RAGA 4LYRA 4ATWA 3RILA 1QO5A 1NDVA 3WLTA 3EPMA 2X16A 2WHJA 1E51A 3VPLA 1PL9A 4BR1A 4J3TA 4IJRA 3ITTA 2PA6A 3ISIX 2TYSA 1SUXA 3CK5A 4DAIA 4RXGA 3DENA 3P62A 4WDXA 5BOOA 1W32A 3FAXA 5G4EA 3NGFA 3D47A 1TV7A 1OX6A 3S47A 2FQIA 1S1PA 1ZENA 4QE5A 2Q09A 2WM1A 1UWTA 3NPVA 4PUWA 3N6JA 4GZIA 1UWAA 2YPIA 5AECA 2J79A 1V02E 2OWXA 2ZRUA 4DHGA 3RLHA 1XINA 4XZNX 2WC7A 1NFBA 4OUEA 3CPGA 2VC9A 1V3LA 4JKLA 3ALFA 4JTDA