4RJEA

Aerococcus viridans l-lactate oxidase mutant
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
369
structure length
367
Chain Sequence
IEYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIGAHGLAHATKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKGDGATAIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLTAEGMSLNNIYGASKQKISPRDIEEIAAHSGLPVFVKGIQHPEDADMAIKAGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ala95-to-Gly substitution in Aerococcus viridans l-lactate oxidase revisited - structural consequences at the catalytic site and effect on reactivity with O2 and other electron acceptors.
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
molecule keywords Lactate oxidase
total genus 136
structure length 367
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rjeA00
1KFLA 3TU9A 4H3DA 1LDCA 1VHCA 2BLEA 1E51A 5LHEA 5LSMA 4LRSA 4YL2A 2YSWA 5F4XA 3S1WA 3BGGA 3W7DA 3NQFA 4UXDA 2JGYA 3NR0A 4QITA 3W84A 3LOTA 4ZL1A 3FEMA 4NX0A 2CW6A 3W3OA 2RDTA 1N7KA 4MLRA 2A4AA 3MP4A 1ZFJA 2ZRXA 2H8ZA 1NSJA 1J2WA 4X3ZA 4LUJA 5L9FA 4JX6A 5DCEA 3QMTA 1WDWA 5D09A 3QW4B 1G4SA 3W6YA 4CQ8A 1H7XA 4AWSA 2PC4A 5LNSA 3RLUA 1OK4A 3OBKA 3EXRA 3P5ZA 1TPB1 3G1VA 3GDMA 3P62A 1LLWA 4IXHA 3UZ5A 2QDGA 3QPYA 4TU1A 4ALDA 1RQBA 2ATSA 3IRDA 1OFQA 4AMAA 3W7GA 3L0GA 1ZY9A 2PE4A 4GRSA 1ML1A 1FCUA 1WBJA 3W1NA 2ALDA 5CKSA 3NQMA 2J27A 4HHPA 3W1TA 2C15A 3RLVA 3F03K 3QH2A 3OG3A 4N6EA 1QWGA 3STCA 2TMDA 2NX3A 1X1OA 2IQTA 4NZFA 3UY7A 3O06A 2CLMA 2V5BA 4GUHA 4K7VA 3RNDA 2DJLA 4UFIA 1LOLA 1B9BA 4JS3A 3VI2A 5FEZA 1JR1A 4XQ6A 3A5VA 3LB0A 4X22A 1FXPA 3S0CA 1KM6A 4B5NA 4GBUA 4L4MA 5HQEA 3U2OA 3BG3A 1K7FA 2VC6A 3TUUA 1ZAJA 4LV9A 3H54A 4Z1DA 1BEUA 4IJBA 1VZWA 5H2ZA 3LI0A 4IUOA 1OYBA 4M7SA 1G6CA 1G7UA 5D02A 1KFCA 1U5JA 3P60A 5TBOA 3W1LA 5C2XA 4JTTA 4DPPA 4LNYA 4WUIA 1VGAA 1T8XA 2ZBTA 1TPC1 3LDVA 1V7YA 4JDBA 5AYXA 3WJWA 3TE9A 3W2JA 4S2BA 3W87A 2A21A 1S5VA 2W6RA 5MHBA 2ZZ3A 1XBVA 3OVQA 2X1SA 3MHFA 3NQ7A 4JTHA 1GVFA 3NQ6A 1CI1A 4XBSA 3QSRA 1G69A 1XDMA 4K6AA 4MZ1A 3TC6A 2HTMA 1HO4A 3ABQA 4X2RA 3EWUA 2QCDA 2Z1BA 1FBAA 4I9AA 5D38A 4UTWC 2VEIA 3TJXA 3WK1A 5AC6A 4H6KA 3PBVA 3UXAA 2DORA 1DVJA 3R12A 2TSYA 5HUOA 1LYXA 5D2TA 3TSBA 4Y8FA 3SIZA 2A7PA 2WPBA 3SGUA 1QAPA 3G8EA 3ANYA 1T0OA 4K7YA 1H50A 3C4UA 2QAFA 2J6XA 3MP5A 2ZRWA 4ORIA 1W3TA 1UBSA 4QIUA 4ZQRA 1WOAA 2TYSA 1OFPA 4YMZA 3QC3A 4JDYA 2NV1A 1WX0A 2C16A 1XL9A 2VFIA 1KFBA 4RJEA 1O94A 3DFNA 4JY8A 8TIMA 3STGA 1TTQA 4IPJA 1N8FA 1KM1A 5T26A 5KZMA 1A53A 4MLJA 4JIQA 2EF9A 1FWTA 4ZVJA 3Q94A 5HULA 3HG4A 1TCDA 3L66A 2GVLA 1Z42A 4RKAA 5I3GA 3T40A 2QJIA 4ZQOA 4PTNA 3LERA 5KSWA 5G4EA 2WV8A 1CW2A 2R91A 4UFMA 4O16A 4A3UA 1GG1A 5H91A 3B0PA 3VE9A 2AAMA 3B03A 1JCXA 4P2VA 3LHVA 1VR6A 2WJZA 2C1HA 3TK7A 3NL2A 3TCEA 2HS8A 3M5ZA 2QUUA 5AYYA 3TIMA 1R30A 2OZ0A 5KTLA 1OX4B 4QSHA 3GR7A 5DELA 4IMEA 5AHFA 3P80A 5TIMA 4JTSA 1WAUA 1BWKA 1QPOA 1D9EA 1LLZA 2B7NA 2ZZ7A 2C6QA 1VQTA 1OF8A 2H3BA 4QNWA 4Z1AA 5G1YA 1AW2A 2FFCA 4DF0A 3W1MA 4DO6A 3NL5A 1F73A 1EP1A 2YPIA 5CPLA 3MUXA 2Q3RA 4OE7A 3C2FA 4CLMA 1CX9A 1OX6A 2EKCA 2QCHA 3N9SA 4NJJA 1A5AA 3NEVA 3IVTA 1ALDA 3UXDA 2RH9A 1XXXA 3W75A 1DHPA 4XBKA 3MYPA 2Y6ZA 3SSJA 3CWNA 3M47A 2WQPA 4JTKA 2BTMA 3R8RA 2AGKA 3INPA 2GQ8A 3VE7A 1YDNA 4QISA 4NUWA 3KFTA 3NPVA 2ZRYA 4TMBA 1W8SA 3L67A 3GLCA 2GJNA 1Q6RA 4LVGA 4Y9AA 3V1PA 1JCJA 2WNNA 1SU5A 1DJQA 3GKAA 4O11A 5HMSA 3UWQA 4MJMA 4UTHA 3BLEA 1LZOA 2XFWA 3GK0A 1P1XA 4RXFA 3RU6A 2CLEA 1FWSA 5CSRA 3BARA 4U28A 3LCWA 1KFEA 1FXQA 2JBMA 3TAOA 4W9TA 1QFEA 2YCEA 5F4WA 4GJ1A 2GVJA 1SW0A 2V82A 1L6WA 2DZUA 3NDOA 4BR1A 3ZWTA 3GXNA 4LS2A 5HJLA 1PIIA 1PCKA 5FESA 2C19A 4R7JA 3BG9A 5KITA 1X7FA 3BPWA 2FLIA 3FYPA 3NM3A 3P8IA 3GIYA 3UPBA 3W1XA 3R13A 4O4VA 2BXVA 1LM1A 3FKRA 3L5AA 4MUZA 3HPXA 2XN0A 1W3IA 4M6QA 5DN1A 1O5XA 1OF6A 4N9DA 4ZQMA 5FF0A 1S5WA 6TIMA 4JIPA 1AMKA 2VFHA 3CQ0A 2W0UA 3E02A 4S1FA 3TQKA 4MIMA 1SO5A 4UC5A 2E1DA 3L5MA 2V30A 3UWYA 5EL1A 1OFEA 3OIXA 1TQXA 5L6UA 2QF7A 1KBIA 3LBMA 4O28A 3HIJA 2J24A 1F74A 3CEPA 2FPYA 2E5BA 3DKLA 1TJPA 1PE1A 3W7MA 3USBA 2QJHA 1JCYA 4N4PA 3UPWA 3BV4A 1ME7A 1OHLA 3BGJA 3W2UA 2G97A 3LHTA 1EEPA 4MFDA 4RV8A 1THFD 3S9YA 3LRKA 1KA9F 1TV8A 2ZCGA 2CZEA 1EIXA 1JCNA 2V8ZA 2P0OA 1KTCA 3EWXA 3W85A 5I3KA 3DKJA 1KTBA 3W1AA 3T78A 4RCXA 1MO0A 3PS7A 3CIXA 1H7PA 1ICPA 4O0KA 3KOFA 3FJLA 5E1QA 4IX0A 3W70A 4CNNA 3G18A 3TX9A 1ZAHA 2VKZG 4RK8A 3E0IA 2A5HA 1GG0A 1VRDA 4BI7A 4JTGA 4LV4A 2QR6A 1YYAA 3THAA 2Y63A 1ZAIA 3HPZA 2YYTA 2ZRVA 5CG7A 3I7SA 2RDWA 3E9AA 1YADA 4O4WA 4N6FA 5BOOA 1W5NA 1L9WA 2ZZ2A 3C3NA 2ABBA 4C1LA 1O95A 5I3IA 3PY2A 3G0XA 3B0UX 4LC6A 4MZ8A 4UCGA 4WJEA 4UR8A 3WK2A 3LCFA 2A7RA 1TB3A 5AHEA 3PBYA 1SW7A 1VLWA 3RK8A 2NXHA 2Y7DA 3HGOA 4N4QA 4IXXA 3PULA 4FNQA 2FDSA 4ML9A 3O05A 4A22A 3UNDA 1RZMA 1OYAA 2JGQA 1Z48A 1UASA 1SO3A 4OT7A 3L0KA 4C1KA 1OX4A 4LT9A 3W22A 3QJAA 1XFBA 1DV7A 3PF3A 3MI6A 3TC7A 5HWJA 4AH7A 3F4WA 4YXGA 1AL8A 2VEMA 4O52A 3NXFA 3TV8A 2H3DA 2ZRUA 4GFSA 3SI9A 1KM3A 5K9XA 4UFLA 5EBUA 4GUFA 2NUYA 1H7OA 4ONVA 3TQVA 5D2XA 1ONRA 3MO7A 5HINA 5E93A 1R2SA 3E96A 3RF9A 5CGQA 1ICQA 3FOKA 2B7PA 4O15A 4JR5A 4BK9A 1XUUA 1OFRA 2JKPA 1SUXA 3D0CA 3C61A 1L6YA 1OFDA 1ZENA 3KRSA 3ATZA 3GXTA 3LXCA 4QQ3A 3EWZA 1QPNA 1YTDA 3HF3A 3CHVA 3TW6A 4ADSA 1IGSA 1YTKA 2R14A 4FHAA 3PBUA 3MP3A 3LCXA 4M19A 1WA3A 4DEFA 2DZVA 3BVJA 3LHYA 3G24A 3S5YA 3Q58A 3EEGA 4TIMA 3DFSA 3Q2DA 4MVAA 1TSIA 1OVDA 4G1KA 3UYCA 3NPWA 4HN4A 2C0AA 4RZ5A 1ME9A 2J9XA 3A5FA 5DCDA 1DKWA 1YXDA 1W5OA 4LVBA 1FX6A 1XM3A 4YLWA 1DBTA 2EPHA 2ZFAA 3PR2A 2BSLA 4N02A 1H63A 3M0ZA 4O1CA 3WK3A 1KV5A 1H7NA 3GXPA 3HGSA 4M6VA 1QPQA 1FWRA 3QMSA 4JTLA 5FF4A 2A0NA 2ZZ4A 4UUIA 3FKKA 2EAWA 5BW6A 3A23A 4N9EA 3M5YA 5AHMA 3P5YA 3A9IA 4UMBA 1GEQA 3TSDA 1GVSA 3UWVA 6ALDA 2FIQA 4PFMA 4BF9A 1W5PA 4EF8A 3W7QA 4CNPA 4TX9A 1KV8A 3O16A 4JTEA 4NVTA 1X1ZA 3IIXA 3DI0A 2ZZ6A 1YXCA 2Z6JA 1OYCA 3KRUA 3LV6A 2R8WA 3ZWSA 4JN6A 4EF9A 3S1XA 3I7RA 1LP6A 2B7OA 3O1NA 3TMQA 5DBTA 1BKSA 1OG0A 1SFLA 1QOPA 4CNOA 3TR2A 4OBTA 3CB8A 1OK6A 5HR7A 1TYGA 4PC8A 4UTIA 3LLDA 3NNTA 1TO3A 4Y6GA 5EA9A 3T55A 4UTUA 1SZFA 4HIBA 3IIZA 5EY5A 3FYOA 2GJLA 2E6DA 4Y96A 2X2GA 1SW3A 4LVAA 5FEXA 3BW3A 5A5WA 4JTJA 2YW4A 5C5YA 1G7VA 4FIRA 3M16A 4KWVA 1GOXA 1KFJA 1TV7A 3DBPA 1A5BA 1LTDA 1QO5A 1JCMP 4NJKA 5BMXA 2Z0IA 3SGZA 2VEKA 5DLCA 1T96A 5D2YA 2E5CA 1DL3A 1I2QA 1RD5A 2NUWA 2NUXA 5FEPA 2PRMA 3C2VA 4FNSA 4LOCA 1PHWA 4N9BA 3LM7A 1TPFA 4UFJA 4IMCA 3EWBX 1VYRA 3W1PA 3LTYA 2QKFA 3R5EA 2EGZA 5F1VA 5EYWA 1W0MA 5G2WA 5CSSA 2B0MA 3DFPA 5K4ZA 3GNNA 5KINA 4TO8A 4KWWA 4D2JA 3PUDA 4RZ4A 3W2MA 4FX7A 4JY9A 3NOEA 3IVSA 4NX5A 2E68A 3W1UA 3HG3A 1EUNA 1H61A 2G96A 3M44A 3T4CA 1X8FA 2H90A 3KVLA 2OCZA 4DF2A 1TPVA 1LRNA 2YDAA 3S5OA 1F5ZA 1UUOA 3HG5A 1AW1A 2A1YA 3NYZA 4IOTA 1SZNA 1R47A 2Y7GA 4UTJA 1QDSA 3NQGA 5HWNA 3C8FA 1I45A 4KFOA 2JK2A 1NF7A 3LHUA 2YXGA 2I14A 4FX8A 5J5RA 2OX1A 4O57A 1H7WA 4LRTA 1F05A 4JGDA 3BG5A 3TFXA 3NQAA 1P0NA 4AHOA 3HMJG 2J9YA 4YCOA 4GUIA 3EX6A 4TR9A 1H5YA 2Y85A 3BW4A 4O12A 1MSSA 3EKLA 5D03A 3PG9A 3LXBA 2CLHA 3GDTA 5D05A 2YYUA 3LTPA 5G2IA 3QFEA 3FIGA 3CIWA 3S1VA 2YZRA 3DGRA 1K02A 2X1TA 3C0JA 4EVZA 2J9ZA 1QOQA 2JKEA 3G1FA 3KRZA 3SW6A 1GJPA 3S1UA 4HNNA 1FWWA 4PL1A 2G5WA 2QCEA 3P82A 4ORMA 4RX0A 4K37A 1EUAA 1HTIA 1G67A 2QDHA 2E6YA 1RQEA 2GPTA 3WFAA 2FPVA 5EMUA 1H1ZA 4IPIA 4JICA 3TH6A 1XKYA 2RDUA 3NQ2A 5KZDA 3QM3A 1DORA 2RFGA 4LS0A 2NXIA 4QM1A 2P1FA 3NZ1A 1LORA 4XWUA 1XUZA 1IXOA 3P8JA 1WYIA 4UFHA 4OV9A 3G1AA 2J88A 2WSYA 1NVMA 5LHFA 2E09A 1Y0EA 4QNEA 4Q4KA 1SFJA 1XDLA 3QEZA 3GKFA 2VEPA 4DO5A 3VFLA 1DQWA 1GYNA 1G4TA 3EX3A 2WSRA 3DHFA 1YTEA 3NZRA 2GQAA 2OJPA 2YW3A 3NL3A 3P74A 2ZA1A 4M7TA 1VCVA 3LHZA 3QMRA 2QCFA 3CC1A 1ZNNA 1J5TA 3TDFA 1AK5A 4DBDA 3OVRA 3W7HA 3NAVA 5SWUA 1F7BA 2WOQA 4ICNA 2AQWA 3M6YA 3L0NA 2DP3A 5AOUA 1ICSA 1MEIA 1X6UA 1JUEA 2FPTA 1B57A 3PM6A 4JD4A 4MPQA 2GOUA 3FLUA 2QUTA 5K7JA 1MEWA 4MY1A 5F2IA 3LBCA 3NG3A 1OJXA 3EKZA 1LROA 1EPXA 3O6CA 3QQ1A 3IV3A 3LHWA 3LXAA 3PC0A 1LOQA 1G4PA 1TPH1 1FDZA 4XTIA 5AHNA 1GYLA 3STEA 2F7FA 4WD0A 2DZXA 5K3VA 2Y70A 3TW7A 4FNRA 5AYZA 2VFFA 1D3GA 1ZCOA 2OMAA 3W88A 1W5QA 5LNWA 4O50A 1IXPA 3F1QA 1RPXA 5F2MA 2CLFA 1VLIA 4O1DA 1JQXA 2Y7EA 3M43A 3C2OA 1W1ZA 3DZ1A 5C54A 5LGXA 3CLMA 4IQLA 2PCQA 4LC8A 1SSGA 4XTDA 1WQ5A 4AWTA 5LGZA 1JUKA 4FXRA 1JULA 4O0ZA 4JNMA 3KVKA 1Z41A 1T99A 3SZ8A 3W7RA 3GX9A 3B4UA 3GYEA 2HSAA 2XN1A 2CLIA 4PEKA 5D2WA 5AFDA 2FB2A 3ZS4A 2RHGA 5LKYA 4OV4A 4R33A 5AC8A 1K8YA 4O19A 4MYXA 4NJHA 5GVJA 4HT3A 3MHGA 3EXTA 3FA5A 3W83A 4DPQA 3B0VC 3NM1A 1VCGA 1XI3A 3E49A 1LBFA 4BWLC 2I9EA 2D73A 3GDRA 3M41A 4YCPA 1F6PA 3NGJA 3W7PA 3GVGA 4ZQNA 3CPRA 1UB3A 2VFDA 1TV5A 2Y62A 4Z08A 1W54A 1BTMA 4JX5A 2ATMA 3EX4A 3UQNA 3TXZA 4LTSA 4HPXA 3W7CA 3G1YA 3QSTA 3H53A 2YX0A 1JRBA 2ZZ5A 3L2IA 4FXSA 3PBWA 1SO6A 4IWWA 3P81A 1NAL1 3W73A 4NXSA 1FCQA 4K39A 2V2DA 5D30A 1AW5A 5CZJA 4O13A 5EKYA 5D32A 3EB2A 3M5VA 1EP3A 1I8JA 1JQVA 4AXKA 3M1ZA 2Q8ZA 4K8HA 2TPSA 1P5BA 3M9YA 2Y61A 1HG3A 3GAYA 1SZGA 1DQXA 2CZFA 3TKFA 1SZEA 1M6JA 3CT7A 2NXGA 2CLKA 4DF1A 1NF0A 1F76A 5BRBA 2ZTJA 5AHLA 4TMCA 4BFAA 2O7QA 3LI1A 3DFQA 3GAKA 4M6PA 3NA8A 1UJPA 5ABTA 2QAPA 2KZHA 4LUIA 2A2IA 4P61A 3SY5A 1P4CA 4UR7A 2E5DA 3S6DA 2Y7FA 4NT0A 4FNUA 4NQ1A 1SR9A 3W7IA 2HMCA 3G0SA 1K7XA 4Q33A 3DHDA 3M7WA 2E6FA 1W56A 5C55A 5D2VA 4MJZA 3MJYA 4XKYB 1SSDA 3JS3A 3S8HA 3LCIA 2CFFA 5FF2A 3N73A 4A2RA 5IM51 4FNTA 4IGHA 1JUBA 4GWEA 4GUGA 3H55A 3SR7A 3ATYA 2PRLA 3S42A 3S5ZA 3BLIA 5CZ0A 3MBDA 3ABSA 3AO0A 4MZYA 4Z1CA 4O14A 4WY0F 2FB3A 4I7VA 1FDJA 4GXMA 4UTWA 3I6RA 2FJKA 1VYPX 3L68A 4E0CA 3G3DA 4UMCA 3NO5A 3OA3A 2NLIA 3DI1A 5DXXA 4JYDA 2DZWA 2ISWA 2O7SA 2QJGA 1RVGA 5K9CA 4Q32A 3CM4A 1JVNA 4BWLA 4WX2A 1TPWA 3VKJA 3KVMA 5DXYA 5IBXC 3NPXA 4DO4A 4LW7A 3UY8A 4A21A 2C3ZA 4OWGA 2Q8LA 2ISSA 3UWUA 1LCOA 1QMLA 3T44A 1GT8A 2V81A 3LTSA 1QNVA 4Z0SA 3W9ZA 2GQ9A 3GR8A 4HPJA 3EWYA 4N9CA 1OX5A 3C52A 2X16A 3EX1A 4KFNA 1TTPA 1ZJIA 5CPMA 2BX7A 3ELFA 5K4XA 1FUYA 3E12A 3NQDA 5CPOA 3P7YA 4ZZ9A 1IXNA 2CZ5A 3A24A 4FNPA 1PVNA 3MYOA 4WY0A 2ZDRA 3L21A 3GB6A 1EP2A 2E77A 4Z1BA 1ME8A 2H8XA 5I3JA 3EXSA 1TTIA 1WOBA 4FB7A 4EWND 5G1TA 1GWJA 1W37A 1FWNA 1PS9A 3IVUA 3BLFA 4UTTA 1GZGA 4GNJA 5HNRA 4AHQA 1VS1A 3P84A 3GZ3A 1PL9A 1S3HA 3W7JA 1QCWA 4POCA 1RR2A 3G0UA 1IIHA 3EX2A 4AWUA 5U4NA 1MEHA 3ABRA 1H62A 5HUPA 4WXZA 3WJXA 2X1RA 1SO4A 4IX2A 2DZTA 2WO5A 1C8VA 5DY2A 1K3UA 4RXGA 5I3FA 4QAIA 5FF3A 1VC4A 1G4EA 3LGEA 3W23A 4CCEA 3DH7A 4JTFA 1F2JA 1A5CA 3C2RA 3UZJA 2F84A 3RMJA 5IBXA 3MBFA 1TJRA 3U6WA 4UTLA 1Z44A 3IIPA 1R46A 4DBEA 1W3NA 4HNVA 1WBHA 1KBJA 1TIMA 3MHUA 4O10A 1I2OA 1TPDA 1Q45A 3W7EA 3TQ0A 2NX9A 3MI2A 4E2DA 1GTHA 2CWNA 1W5MA 2ABAA 3W07A 5G4WA 3PB2A 4NJIA 1TMHA 3T7VA 5LNRA 4M5PA 2Q3OA 4HNUA 2QCNA 2E6AA 2RKXA 4AAJA 1OFBA 1PV8A 2W79A 4K38A 3B8DA 4IMGA 3C6CA 3MI3A 3I65A 1F6KA 3DENA 1HUVA 3W1RA 3LLFA 3W7OA 2QCLA 3C56A 3PSVA 5D37A 2QUVA 5I3HA 3WJYA 3IGUA 3FJ6A 7TIMA 4BI6A 3FS2A 3HPSA 4E38A 2TRSA 4CCDA 1LRQA 4JYFA 3G1XA 2P10A 2WSQA 5TQLA 4FF7A 1K03A 1OFAA 4CCCA 3TNOA 2X30A 2VFEA 2WNQA 3HG2A 5KZEA 3HGRA 1IF2A 3IIVA 3TA6A 2R94A 4FIQA 3UD6A 5K2ZA 4IMFA 1JRCA 3DAQA 1IIGA 2ZYFA 4LU0A 3W74A 3JR2A 4DXVA 3CU2A 5E0KA 4MKNA 4EIVA 4K8EA 3W7KA 1H1YA 1L2UA 1XBYA 3G1SA 4HSOA 2CLOA 3AJXA 1KLYA 1PHQA 4WY0B 3GNDA 4GE8A 3SECA 3TAKA 3A21A 2QCDB 1HO1A 3O63A 3QW3A 3W7NA 3GDKA 4O1BA 4N2YA 5AN7A 1HL2A 1I4NA 2V2CA 2YR1A 3M5XA 4LS1A 3I7QA 1TTJA 2OT1A 5FEWA 4Z0JA 4AB4A 3G22A 1GQNA 3BO9A 3O15A 4O8RA 3O07A 2V9DA 3B05A 1TRDA 4JTUA 1P0KA 3TMLA 3NQVA 4O54A 4PH6A 4RZ6A 2OT0A 3V75A 4O17A 1LBLA 3LRLA 4FO4A 2NWSA 4NNBA 3ZFHA 3BW2A 5F2GA 1L6SA 3B04A 3W76A 3STFA 1ZALA 2G95A 2WKJA 3L5LA 3R89A 3RFAA 1R2TA 1TRIA 3HOJA 2C18A 3MMTA 1VYSX 1DOSA 1MZHA 1I2NA 3I68A 1JJKA 4R34A 3L65A 4YWIA 2QEZA 1J4EA 1A50A 3DFTA 4KKXA 1EA0A 4MOZA 4CQAA 1A5SA 4LVFA 2NX1A 1TREA 2CU0A 1NFBA 4MY8A 1OABA 5BNKA 2QCCA 5KMYA 1KM5A 2A6NA 3OHIA 5HWMA 5HR6A 3NL6A 5C6MA 4NNCA 4O53A 3JRKA 3G3MA 4NU7A 2V2HA 4XZ9A 1HFBA 4XUGA 2ZRZA 2B7QA 3PUOA 4XKYA 4UTTC 3HJZA 2GVGA 4OQVA 4OU1A 4A29A 1K8ZA 3SJ3A 1WXJA 5EPDA 4CQ9A 2A6LA 1O4UA 1UUMA 2QCGA 1K8XA 2YGYA 3TROA 3OVPA 1Q3NA 1TPEA 1NEYA 1KW1A 4GC4A 1D3HA 3W2KA 1I2PA 5DCBA 3CTLA 4KFPA 3NQ8A 5AB3A 4NZJA 1KTNA 4WQ6A 1GPWA 2DZPA 5F2LA 3LX9A 3ZR4A 4LWWA 2NZLA 1AG1O 1OFOA 3B06A 3FFSA 3PG8A 2ZZ1A 5AHIA 1V5XA 3IGXA 3S5NA 2Y88A 4RR4A 4K36A 1M5WA 2V0TA 4I7WA 5CPNA 1FDYA 4NXKA 3F4NA 2Z2UA 3LV5A 1GVOA 1FCBA 4UIOA 1QO2A 3DU0A 1M7OA 1IXQA 1LOSA 2V5LA 5FI8A 1H51A 5G5IA 3WJZA 2VXNA 1S5TA 1K7EA 4HSNA 4S2CA 4UTKA 3DXIA 1XC4A 3KX6A 4HNTA 5DBUA 2BZNA 3NQEA 1LRTA 3N3MA 5D04C 4DQWA 3PWAA 4AHPA 2JKAA 2BWGA 4U4MA 1KM2A 5CZSA 2PRHA 1LBMA 3Q37A 1R2RA 4L4LA 3TXVA 3IIOA 1UCWA 5BMWA 3N9RA 3EWWA 2FQIA 3W2LA 1EB3A 4JEQA 2GUUA 2YFOA 3THQA 1XBZA 1ZHAA 4WZHA 4PODA 2QCMA 1U83A 4ADTA 4AF0B 3TSMA 5LNVA 1QR7A 4UNLA 4BI5A 1RV8A 3PB0A 1KM0A 1XBXA 3YPIA 5A8GA 3O6DA 3LCLA 4IMDA 3K30A 3G1DA 1TPUA 1O5KA 3HO8A 1ADOA 1MXSA 5J5DA 3W2NA 1Q6QA 4Y90A 1VHNA 3N14A 3W72A 4JXCA 3NQCA 5LNUA 1C9DA 3PUEA 1FQ0A 3VNDA 2DJXA 3P61A 3G1HA 1VH7A 2NWRA 4AVFA 3P67A 1Q6LA 5U7SA 1QPRA 4JX4A 3N2XA 4LVDA 1KM4A 3WK0A 2HS6A 4NJGA 1W31A 3MW7A 4WOZA 4ADUA 3QRHA 3U8GA 2FTPA 4JTIA 1EWEA 3IEBA 1Q6OA 2EHHA 4FX6M 2B4GA 5K9DA 4O18A 3VCRA 3QF0A 3W7LA 2ISVA 4X9SA 1YPFA 4H4IA 4PL2A 4FEZA 3W71A 3WJSA 2C13A 3QPZA 5CZTA 2H6RA 2X1UA 1GVRA 2DU2A 4O1AA 3W1QA 4MY9A 3N2MA 4MYAA 3TJLA 1RQHA 3KAOA 4RLIA 1BWLA 3O6YX 3L9CA 4HKPA 3MWAA 2CLLA 3CWOX 4I7UA 3OEXA 3PSWA 2VOMA 3ABOA 1WV2A 4OHQA 3SFKA 2A85A 3DFOA 1PCWA 3PAJA 3IGSA 3KXQA 1H7RA 1FY6A 5F1UA 2I1OA 1YDOA 3KVJA 4ZMGA 4PCFA 2Z6IA 4NNAA 1EX5A 1H60A 4EOUA 1AL7A 3CEUA 1EWDA 5FF7A 3W86A 4AEOA 4UFKA 1FCVA 5D33A 3HQ1A 2VELA 3N19B 3PVFA 5G2HA 3G8RA 1KLZA 4WOQA 3HBLA 4R53A 1I2RA 3BK0A 3HGJA 1KFKA 1VJIA 1B4EA 5AC7A 3QQ0A 3UWZA 3C2EA 4UTMA 2ZQ0A 4OGZA 2A7NA 3R2GA 2PURA 3QYQA 1YDVA 2UV8G 4ZQPA 3LCGA 2VFGA 3KHJA 3LCHA 1GVQA 1GTEA 3UWWA 1SPQA 1XCFA 4UNKA 1N55A 4JYEA 4E2BA 3NPUA 2C14A 4PA8A 2NV2A 4LY8A 2VENA 4UMAA 1JCLA 4WXYA 1YLVA 1O60A 3TFCA 4DELA 2CZDA 2WNZA 5DY3A 3O8AA 4A2SA 1B4KA 3N34A 5LZLA 4J9JA 3LRMA 1TQJA 3NVTA 2DZSA 2YFNA 2ZTKA 5F4SA 2ZA2A 2Y89A 3A22A 1SQ7A 3QZEA 1DJNA 1VPXA 1C29A 2LLEA 4ZQCA 1M7PA 4QJ1A 4MFEA 3GDLA 1YPIA 1VCFA 4AF0A 1B3OA 2XN2A 2ZA3A 3HB9A 4GUJA 1YXYA
chains in the Genus database with same CATH superfamily
1KFLA 2ADAA 2HPIA 4NAFB 2FZDA 4H3DA 2ISDA 1QPKA 1VHCA 1HL9A 1QI3A 4K1WA 4H01A 3KUMA 3GG8A 5F4XA 3S1WA 3BGGA 3NQFA 2VDGA 3VD5A 1TVLA 3A3HA 4ZL1A 3WH9A 1OD8A 2CW6A 3W3OA 2RDTA 4MLRA 1H3GA 2R1MA 4LEFA 1ADDA 2ZRXA 3H6OA 1NSJA 1J2WA 3VPLA 4C65A 1UH4A 2WAGA 3E1F1 3S1GA 3QMTA 2NQJA 1EC8A 4F4RA 5D09A 4W5UA 1Q65A 4DN1A 4CQ8A 1H7XA 3UXLA 4S3KA 4AX7A 1VJSA 2PC4A 4LPCA 1Q7QA 1JDFA 4AIBA 2VQTA 1SJDA 8A3HA 3G1VA 2QLYA 3GDMA 4Q6JA 3QPYA 4AZCA 1A5NC 2QW5A 3W7GA 1ONWA 1ZY9A 2PE4A 1L8NA 1JDDA 4IJRA 2ISFA 1FWBC 1KKOA 4JBRA 3NQMA 2XGBA 3EPMA 4DNMA 3W1TA 4AD1A 3B8VA 4IIGA 2C15A 3RLVA 1LWJA 1KRBC 4RE2A 4Z17A 1QWGA 4PUKA 3STCA 2YLLA 3BE7A 3WMSA 5CBBA 4UFIA 4JS3A 1OT1A 4INFA 5FEZA 4N0RA 2ASHA 3M0XA 4KRZA 4GBUA 4IFKB 4L4MA 4Q4MA 3BG3A 3QY7A 4LV9A 1VZWA 4D6EA 4M7SA 1G7UA 1ZJBA 1KFCA 3P60A 3T07A 7A3HA 1LT8A 4JTTA 4A05A 5H1WA 1R9XA 2XH7A 2EG8A 3LGDA 5HNUA 2JF6A 3KHDA 1T8XA 3NYDA 1VEMA 1TPC1 1V7YA 1NJJA 3WJWA 3TE9A 1A3XA 2A21A 4QHRA 4TX6A 3CGTA 3WNKA 1GHSA 3NQ6A 1BYAA 2OKTA 2YDSA 1HO4A 1GUVA 1VENA 1RCXB 1VP5A 3ABQA 2YCLB 1VKFA 1FBAA 5D38A 1XCWA 1V6UA 2RJGA 3UXAA 3RPMA 2TSYA 1XW8A 2YKKA 3SGUA 3G8EA 3MV11 1H50A 3C4UA 3EOUA 1GKQA 4ORIA 1CZ1A 1W3TA 1Q63A 3TJ4A 2ZXQA 4E8GA 4V2XA 4ZQRA 2TYSA 1OFPA 4YMZA 2VZUA 1JDAA 1XL9A 2VFIA 4CNSA 5I79A 3DFNA 3A3WA 2XIBA 1TWIA 3ITYA 4MLJA 2Y4SA 3ARUA 1P7TA 4IF2A 1UR1A 1Z42A 4BA0A 3T40A 4ZQOA 3VD4A 3AIBA 4PTNA 3VIFA 3LERA 4A35A 5G4EA 2ACSA 2HBXA 4OOZA 2OTDA 1GG1A 4H9TA 4XSLA 3AXHA 4WEVX 1JCXA 2XM1A 5FIPA 3UGRA 1MFUA 3ARYA 3TK7A 3NL2A 3RR1A 4D1IA 3OIHA 2QUUA 4DUWA 1HVXA 1R30A 4D6DA 2DIJA 1UROA 4IMEA 2QJJA 4HMEA 5TIMA 1FWEC 1EKOA 2DGAA 1D9EA 1CXHA 2ZZ7A 4GVFA 3TR9A 3N25A 1OF8A 3GH5A 1GNXA 1XYMA 4LY4A 2FFCA 4DF0A 2HJPA 1WZMA 3EDKA 4K8GA 3JZEA 1RHCA 4J2MA 4BHYA 3ARSA 1VF8A 1KCZA 4H9UA 3W01A 4WDUA 2FKPA 3IVTA 1W1YA 2V63A 1ALDA 2RH9A 4M3PA 3LM3A 1DHPA 3AJ7A 1BKHA 3LQLA 2WQPA 3UERA 2AGKA 3MKCA 3WBEA 1K9EA 3NPVA 2ZRYA 1W8SA 2X09A 4CQDA 4Y9AA 4LVGA 1FKXA 1Y7VA 3RX3A 3GKAA 3QV8A 3WQVA 1V08A 1P1XA 2I56A 4RXFA 3RU6A 3H2CA 3GXMA 3S2JA 3BARA 4U28A 3LCWA 1FXQA 4UQ9A 1QFEA 4XX6A 1DYSA 2OYMA 1F3WA 4BR1A 2OFJA 5HJLA 1PCKA 4XKMA 5FESA 2W4XA 1X7FA 2XSAA 3G6LA 3FYPA 3CYJA 3P8IA 3CTTA 3A6OA 5I03A 1M04A 3FKRA 1FWGC 3M0VA 3NO1A 4HCHA 1O5XA 1OF6A 2QS8A 1DJXA 5FF0A 3ANVA 3E02A 1RCOB 4UC5A 2V30A 3UWYA 5IDZA 4I5RA 3NDYA 2UY2A 4HK6A 1OFEA 3OIXA 4LUSB 3SUSA 1TQXA 2QF7A 1KBIA 2Z24A 3HIJA 3S2MA 1HJWA 4AWEA 3XIMA 3W7MA 4HP5A 4JOMA 1IWAA 2QJHA 1JCYA 4N4PA 1RD6A 1BYDA 1X38A 4GQBA 1OHLA 3VNMA 3BGJA 3W2UA 1XH1A 2FHBA 5XIAA 3LHTA 1EEPA 1F8MA 1CGUA 3KEHA 2EPOA 1JCNA 2W91A 3TC3A 3VNZA 3DKJA 3VOHA 4QEHA 4RCXA 1MO0A 4GO9A 4HOZA 1HN1A 2VRQA 3GE7A 3AXKA 1S2CA 3E0FA 1O12A 3DFHA 4XD3A 3EAUA 5GQBA 4CNNA 4AC1X 4A8IA 2GGGA 3E0IA 3O0KA 2QR6A 4XZBA 1KXQA 3TONA 4CN1A 4UWMA 5CG7A 1IHIA 2CZVA 2RDWA 4O4WA 4V1XA 3S6TA 4QE5A 1ISXA 4DI9A 1RPKA 4KMQA 4LNCA 4MB3A 3PY2A 4LANA 4LC6A 3CUIA 1SW7A 4XAFA 2NXHA 2Y7DA 3HGOA 2GDUA 4HZMA 4CU8A 4ML9A 3O05A 2Z1KA 4OT7A 1OX4A 4LT9A 1TVNA 1ADSA 3PF3A 2FZNA 4KF1A 2HQAA 1V6TA 5FJUA 3HZ3A 3THDA 4YXGA 1AL8A 4L9YA 2IS7A 4HJFA 4W87A 2J8FA 1UD4A 3R58A 3IUHA 4JAWA 3EOSA 3W27A 4GUFA 2PDBA 3SCSA 2NUYA 3TQVA 5HINA 2PAJA 3ARTA 3T81A 1B0IA 1BGGA 3EYPA 1TE1A 4DY1A 4O15A 1P7TB 2UBPC 4PBGA 4CD8A 2JKPA 3C61A 2Q71A 3VIKA 1SJAA 6REQA 1XIFA 1WAWA 4YVXA 1YTDA 3AYSA 3CHVA 5HOSA 1IGSA 3CO8A 4FHAA 4JEJA 3MP3A 3LCXA 4W8LA 2DZVA 3UG8A 3BVJA 4B5WA 2Q09A 2W92A 3WDPP 4MJ2A 2CYGA 2PP1A 3Q58A 2PDUA 2C0HA 4LCSA 3KWSA 4L5ZA 4MVAA 1BLIA 3L4YA 3BLDA 1FHVA 3B40A 4H04A 3PPCA 1UWRA 1EO7A 3U7BA 1US3A 4ZODA 4JTLA 4JKLA 5FF4A 2A0NA 2ZZ4A 4UUIA 4C90A 4H7ZA 2VX5A 4MKVA 1HL8A 4N9EA 1XIJA 3DG6A 3M5YA 5AHMA 2ZX7A 3P5YA 3AIVA 2Q02A 3KDOA 4V15A 1CB7B 1GVSA 3UJFA 1K6WA 3N04A 2QHAA 1XYFA 4ZE5A 4BF9A 1DJIA 5GNZA 4H2HA 3O16A 4NVTA 3DI0A 3IK2A 3LSBA 1YXCA 2Z6JA 1UD8A 2WCSA 1IR1A 3I7RA 3CB3A 3TMQA 1J2BA 2FHFA 5DBTA 1BKSA 1LQAA 1V6YA 1TWWA 2DY3A 1SFLA 1QOPA 4CNOA 4HN8A 1KFWA 4OBTA 2WWDA 3B8UA 3TYUA 5HR7A 2XIJA 1TO3A 1CLVA 3BCDA 3LNPA 2W62A 5EY5A 2J4GA 4IIEA 4S3FA 5REQA 3FV9A 2X2GA 3UZYA 3B8SA 3WQGA 4LCQA 1WZLA 3WDHA 6ENLA 1G7VA 3W0KA 3M16A 3E2VA 1KFJA 1TV7A 1JZ2A 1SJCA 3DBPA 1LTDA 3MJMA 4O0QA 1TWSA 2XVPA 1MZRA 2Z0IA 4U10A 1OSEA 2VEKA 2VDIA 1UHVA 4Q8QA 1I2QA 1ONXA 2NUXA 5FEPA 2YIHA 1XD1A 2PRMA 1PHWA 4N9BA 1TPFA 3NVDA 2PEVA 5F1VA 2EJ1A 5EYWA 4GACA 5CSSA 2XVLA 2B0MA 3HQOA 5K4ZA 3UW6A 4Q8NA 4Y9NA 3GIQA 4TO8A 2O4MA 3W2MA 2VZSA 4FX7A 2GWGA 3GNPA 2E68A 1CXFA 1X8FA 2H90A 1PBGA 3KVLA 4Z2LA 1TPVA 1LRNA 3S5OA 5BXSA 3RDKA 4Z1YA 1L2QA 3SURA 4IOTA 3U4FA 1FA2A 1X6NA 3NQGA 2ZXBA 4KFOA 1NF7A 4NAFA 3LHUA 3RR4A 3MMUA 2CEQA 3AHYA 4IP4A 3BG5A 1P0NA 4GO8A 2X2YA 3CASA 4LUTB 1FH8A 4F40A 4GUIA 3EX6A 2OEJA 3GG0A 3ONBA 1H5YA 1RP9A 4O12A 1EJVC 4DXKA 3LTPA 3FIGA 2ZUMA 2Z1VA 2VUNA 3S1VA 3APYA 3DGRA 2CWXA 4B3KA 1CLXA 2HXTA 3GVVA 2J9ZA 1US2A 3SW6A 4I9MA 4RX0A 4JQ2A 3D47A 4GCXA 1TWDA 1O1ZA 3WLNA 2GPTA 1Y5WA 1B30A 3CUZA 3TH6A 2RDUA 3G1RA 2F2KA 3NJ3A 4HYRA 4C6PA 1I6NA 1UMYA 4WSKA 2QQ6A 3NZ1A 1E9ZB 4LALA 3P8JA 1WYIA 4RV3A 3H7RA 1EYEA 2OR2A 1SMDA 2WSYA 1NH6A 1NVMA 1U5HA 4YVVA 3SN4A 1Y0EA 3MUCA 4Q4KA 3GKFA 4AD3A 4FOKA 4QJ3B 2WSRA 4GYKA 4W8BA 3NZRA 1UR0A 1QI2A 3NL3A 3P74A 3XISA 2BASA 4TX8A 3LHZA 1TR9A 4YHEA 3RCNA 1PZ1A 3NAVA 1KBBA 2HVMA 3ITXA 4O8AA 2WOQA 3HM7A 4JIHA 4P8WA 4PMXA 3L0NA 3F2BA 5AOUA 1TE6A 2QPXA 4P5UA 4E3VA 1XG3A 2VGFA 4MPQA 5B7YA 4JCLA 3PZNA 4GI4A 5CG0A 3AHTA 4Y7EA 4B5XA 3NG3A 1Z89A 3IAQA 3EKZA 4DUOA 1LROA 2WZIA 2WQDA 4LAMA 3CWHA 4NIRA 3LHWA 3PZTA 1NOWA 3OU8A 4FMVA 1TPH1 4C6DA 1XLCA 3F5JA 1QU4A 2OMAA 2D3LA 4O50A 1IXPA 1Z32X 4QP0A 2R24A 4ZB2A 4OBRA 3WY1A 3DZ1A 3EEZA 2QPSA 1UJQA 4IQLA 5FA5A 5HJXA 1UA3A 3LMYA 3MUIA 4JNMA 2GFTA 3SZ8A 5DX7A 4PEKA 5D2WA 2RHGA 1IQ8A 2CPUA 3RU8X 3KCLA 1K8YA 1AQ0A 2O9OA 4HT3A 3MHGA 1Z6KA 3EXTA 3W83A 5HDRA 5JXQA 4WDXA 1E0WA 1KGWA 2R82A 4IH3A 4QROA 1XI3A 2D73A 3M41A 5EMKA 3NGJA 1DWIM 3WFLA 1WNOA 4ZQNA 1JAKA 3CPRA 1TV5A 1BTMA 2ATMA 3UQNA 3C8NA 3CZGA 3H53A 2G3MA 3PBWA 2I17A 3P81A 3RAOA 4B4HA 1R7OA 1DHKA 2G3NA 5CZJA 2O92A 4O13A 3A3XA 3M5VA 2ZVRA 2PS2A 4CN4A 1JQVA 3E0LA 4AXKA 1EGVA 2ZUSA 5HNNA 1C7SA 2C1IA 5HQLA 3PZIA 1XRTA 3V4BA 1HG3A 3FJNA 3GAYA 5CSYA 1DQXA 3T4WA 1X98A 2P88A 4B16A 4BS0A 3I10A 4K2SA 1OB0A 3PUGA 1UZDA 4KWSA 1NF0A 1KQZA 2FTWA 1TELA 1ELSA 2PWFA 2OO6A 4BFAA 3U2ZA 3W29A 3WD3A 2PP3A 2O7QA 3R0DA 4F9JA 2PDKA 4GFIA 2VD9A 1TJ2A 2AKMA 3GW3A 1VPQA 1P4CA 3S6DA 2Y7FA 3W4RA 4P7OA 3NO3A 4PRRA 1ZUAX 1Q6GA 2NLYA 3UR5A 4Q33A 6XIMA 3DHDA 4ZXOA 4GABA 3GG7A 2CLPA 5D2VA 4MJZA 3MJYA 2DDXA 1UD3A 3N73A 2GSJA 4QDMA 3K13A 5C9WA 3ATYA 3UWEA 3B97A 3VINA 4MZYA 4O14A 2FB3A 3I6RA 3BICA 2FJKA 1HP4A 1MQQA 3MU7A 3OA3A 2NLIA 1KCLA 5DXXA 3DI1A 4L4PA 5AC4A 4GHRA 2DZWA 2O7SA 3N13A 5K9CA 4JTCA 1UP3A 3WLQA 1RA0A 4LGXA 2UWFA 1GJUA 4BQ4A 3VKJA 2OYLA 3WD1A 5IBXC 1M41A 3GNOA 4LW7A 3T8QA 4A21A 3TN6A 3MUAA 1LCOA 3GXIA 1GT8A 1BXNA 3SIMA 4MWAB 3E6EA 3AISA 4P7NA 3OYZA 1NWTA 1TTPA 2HEJA 4D9PA 5K4XA 5CPOA 3CLWA 3NQDA 4H00A 3CV7A 2PLCA 2Z4GA 3WH6A 3NZQA 4FNPA 2PF8A 3GB6A 1JI1A 3H23A 3AYTA 3FY1A 3HPFA 1ME8A 4XB3A 3EXSA 3WF1A 4HHLA 1TTIA 4FB7A 2HVNA 3TN3A 3VABA 3MCNA 1JD9A 1U2YA 1W1PA 5G1TA 4AVOA 1FWNA 3BLFA 1VFTA 1RXOB 2WPGA 3ZM8A 1GZGA 4AHQA 3KL3A 3GZ3A 1RR2A 1JGIA 1IIHA 1B3XA 3ZT7A 3L4ZA 3ABRA 1IEWA 4HU4A 3LGGA 2I5GA 4OKDA 1SO4A 3MSDA 2DZTA 4I6VA 4N7QA 1PZ3A 3TCSA 3EKGA 1MXGA 4D8AA 1K3UA 1ECEA 5A8OA 1G4EA 3LGEA 4CCEA 1E6QM 1A5CA 3RMJA 4UTLA 3IIPA 3KZSA 3U5UA 2ZOXA 4DBEA 4HNVA 3HV8A 4A8NA 3MHUA 4O10A 3M46A 3N2CA 3OJGA 3WUBA 3REQA 3RRAA 2ABAA 4PFHA 5JMUA 2DT2A 5G4WA 3T7VA 2DUAA 4M5PA 3GC5A 4XVEA 2E6AA 4EACA 2QT3A 1E0XA 3L2LA 2WMIA 4XZNX 2W79A 4K38A 3CUGA 2ZUVA 3BJSA 3DENA 1IYXA 3NURA 1V0NA 4YTQA 4WRHA 5CC6A 3C56A 3PSVA 5D37A 3VNKA 3WJYA 3RJYA 3FS2A 5FSEC 3HPSA 2TRSA 4Y9OA 1MW2A 3TNOA 3MA8A 5KZEA 3WLKX 3HGRA 1IF2A 3IIVA 4IZGA 5K2ZA 4IMFA 1F3TA 1JRCA 3DAQA 2ZYFA 3VNIA 3H2MA 3OHMB 4AX6A 4QJ4B 2YZ5A 5HK4A 1PTDA 2FTYA 1OM0A 4HSOA 3AJXA 1CGTA 3N18A 2VURA 4WY0B 3ABXA 1PXGA 4AG0A 4GE8A 2WZTA 3GDKA 4N2YA 1WDRA 1IV8A 2V2CA 4DJFA 3M5XA 4ZBCA 3I7QA 4JHMA 4AD2A 2E8YA 3IUIA 3SUWA 3O15A 2HK0A 3O07A 2V9DA 1X39A 3B05A 1TRDA 2FH8A 8CGTA 4O54A 3WNOA 4PH6A 1LBLA 3LRLA 4NNBA 2OQYA 5F2GA 3BW2A 1UC5A 4KT2A 3FN9A 3EWDA 4B5UA 3LZ3A 3W38A 2WKJA 3FA3A 5CXPA 3R89A 1TRIA 3MMTA 4DBSA 2GGIA 3CZKA 2D2HA 4JFVA 1P0BA 2PGWA 3SCPA 1NFBA 4LCRA 4MY8A 5PTDA 1OABA 2QCCA 1J9YA 4Q6XA 1KM5A 2A6NA 3UBPC 2WVVA 3QOMA 1GZJA 3JRKA 4NU7A 4KERA 4XUGA 2ZRZA 3QOKA 3MDWA 4GQQA 4F0RA 1LLOA 4DWDA 2GVGA 2JFEX 3V3WA 2OU4A 3UR8A 3LPOA 3OLEA 5IRPA 4L6DA 2Z26A 1UUMA 3QR0A 5BRPA 4HNLA 4IGMA 4ROPA 1Q3NA 3ARPA 2QMKA 1D3HA 1XLFA 4XZWA 5TAOA 2DSZA 1EZWA 4NZ1A 1JPHA 2J79A 3W2KA 5DCBA 3CTLA 1EF3A 4GMEA 1GPWA 3LX9A 3T6CA 1H4PA 3GSMA 3MANA 3FFSA 2ZZ1A 3MUY1 4IP5A 4KGLA 3IGXA 4RR4A 1H11A 1VFMA 3F4NA 3K46A 3LV5A 1GVOA 1FCBA 2ODOA 1JNDA 2DW6A 2FMOA 2IQ0A 2V5LA 4REQB 1R7AA 3WJZA 4OOUA 1K7EA 2XDFA 2DQWA 4S2CA 1XIBA 4GVGA 3U4AA 2BZNA 3M0IA 3NQEA 5D04C 4AHPA 4CD6A 1B3YA 4U4MA 2PRHA 2EPNA 2CBVA 1POKA 1XH2A 3SM0A 1AH0A 1R2RA 4PTVA 4WKAA 4WKHA 5BMWA 4UZSA 2QGHA 1QATA 4QBXA 3VOIA 2YFOA 3E2QA 2JEQA 1XBZA 4G9PA 2D3NA 1U83A 4AF0B 3B9OA 4WK9A 3TSMA 1XLGA 5LNVA 2AL1A 1IZJA 4ACZA 4UNLA 3ORWA 1C8XA 1RV8A 3WKZA 1BGAA 1E6ZA 4HA3A 3O6DA 2CKRA 3K30A 1P6CA 1MXDA 4M29A 3HO8A 4NAEB 1VHNA 4B2DD 3N14A 4JXCA 1C9DA 1FQ0A 3AICA 3G1HA 4GA8A 3P67A 1E3XA 3AUJA 5U7SA 4LVDA 2WKLA 1P6WA 2PCEA 2AL2A 2Y2WA 4CNUA 3WQFA 1DP0A 2HS6A 1UR8A 4NJGA 1W31A 2HISA 2XFFA 3WUFA 1L8PA 4MB4A 4CEXC 4FX6M 3CZEA 2H9AA 1DJYA 3GU9A 3IV8A 5K9DA 4O18A 1S5NA 1E6PA 3GNRA 3AXMA 3WQ5A 1PSCA 3MMDA 3GUWA 4FSAA 1UOZA 3UPMA 1AA1B 1DIKA 4PMJA 2DU2A 1RQHA 5C2GA 3KAOA 1GQKA 2I57A 3CL7A 3H2OA 1BWLA 3O6YX 1V79A 4NKCA 2CLLA 2VC9A 5B80A 2Z2AA 4ZO7A 1A5OC 3BXWA 1WV2A 1PCWA 3KXQA 4GVHA 4WR3A 4MNLA 4NNAA 1JFXA 2NQ5A 4EOUA 2J47A 5FF7A 3W86A 1FWJC 2WANA 2NT1A 4HA1A 3HQ1A 3IJLA 3U57A 3OW1A 2P53A 2VELA 3N19B 4QXIA 4WSJA 5C71A 4AZ7A 4KCWA 4ZOBA 2WSPA 4WOQA 3HBLA 4G5DA 4ZGYA 3R1ZA 1MYRA 1VBRA 1CDGA 3BK0A 3HGJA 1KFKA 5C7VA 1B4EA 1F4HA 5AC7A 3QQ0A 4Z2JA 2J8TA 2MNRA 1E1EA 1EZ2A 4CU7A 3QYQA 4JL1A 1JDCA 1GTEA 2PD5A 4KIRA 4M1RA 2IPWA 1Q4WA 4PA8A 1A5UA 1B54A 2VENA 3UCQA 1TA3A 3M0YA 3ZT5A 5CLTA 3FCPA 1ITXA 3UR2A 2CBUA 2DUZA 4OUEA 3O8AA 5LZLA 4HCDA 4J9JA 3FAWA 3LRMA 1QW9A 2IKJA 3NVTA 3PJUA 1MQRA 4D6IA 2JQXA 2OYKA 3B4YA 5F4SA 2ZA2A 1S3TC 2Y89A 1VPXA 2WC4A 1JF5A 1C29A 3ITGA 1GZ1A 3WUEA 1D7KA 2PGRA 3TN5A 1VCFA 4KEVA 1H09A 1KB3A 2XN2A 1Y65A 1OCNA 1MUWA 4GVIA 1W2PA 2EBNA 2HVOA 4HVXA 4CD5A 1LDCA 4OFCA 2I5QA 1DWGM 1BXCA 2RGLA 1E51A 5LSMA 5DO8A 3R10A 2PWHA 2W63A 4LRSA 4GYPA 2OZ8A 3GTHA 3NR0A 5I23A 3W84A 3TNBA 3T42A 2CIPA 4NX0A 2GSEA 5C9RA 5CEWA 4IP7A 1ITQA 4X3ZA 3ZMRA 1XIDA 5L9FA 2J8GA 1UWIA 1WDWA 3VDGA 2E3ZA 1MUCA 3W6YA 2GOKA 4A3RA 3WLOA 3RLUA 1OK4A 3EXRA 1CGXA 1EJRC 1LLWA 1F07A 1QK0A 5AYBA 3QQWA 5CGMA 3IRDA 2V5JA 4PGLA 4AMAA 2PU1A 4GRSA 1FCUA 3W1NA 3PZUA 4GNKB 3GRIA 4EAMA 2INFA 1R3SA 4KRUA 1OIMA 4HHPA 2CCRA 2PD9A 3ENLA 2CESA 2DFAA 3BMWA 3OG3A 4N6EA 3WL0A 1UPPA 4PMYA 1PX4A 4XUYA 2NX3A 1X1OA 3VGHA 2ZE3A 4GUHA 3RNDA 2DJLA 1LOLA 1B9BA 1PAMA 4Z2GA 1GONA 1NM9A 1EBGA 1JR1A 4X22A 3TTQA 3CUXA 4L61A 5CPSA 4IM4A 3SCWA 2DIEA 4B5NA 5A95A 3VFCA 3H26A 3ZLFA 5BOFA 5HQEA 3U2OA 3IJIA 5BU6A 2AGTA 3L2MA 3TUUA 1ZAJA 1JZ4A 4H6EA 3H54A 4Z1DA 1BEUA 4IJBA 5H2ZA 1OYBA 3VD9A 3JW7A 2GVYA 3CHFA 4B9ZA 4DPPA 5C9UA 4LNYA 3UT0A 1VB9A 3IANA 2ZBTA 4EPDC 4DUXA 3LDVA 3AHXA 5I77A 4XZIA 4EXAA 3EDDA 1GOKA 3VNLA 1XWYA 2VX4A 1JXKA 1AQHA 1S5VA 1XBVA 3OVQA 1CIUA 5B7ZA 3NQ7A 4JTHA 1P6BA 1XDMA 4MZ1A 4J3VA 4X2RA 5EB8A 2QCDA 2Z1BA 3N15A 4H2CA 3TJXA 3SEPA 2G41A 3VXGA 2DORA 1DVJA 4R3UA 1LL7A 4XISA 3R12A 1HT6A 4H9ZA 1RJQA 5HUOA 1K1DA 1IZKA 4D8ZA 3UETA 5JU6A 4US6A 1MVYA 2QAFA 2J6XA 1CECA 1SM9A 1VFFA 3AIQA 4PUJA 1QUMA 1M01A 1UBSA 3ZOAA 4CQCA 2XYLA 3W81A 4QIUA 1Y5XA 3WQ4A 4DWSB 1AD4A 4RJEA 3E0VA 3STGA 1TTQA 1KM1A 2WBGA 1V77A 1A53A 3GU2A 5A2AA 4GIYA 3HG4A 4EPBC 3L66A 2GVLA 3KP1A 4DM2A 3MSRA 4OUIA 3TWBA 2OZTA 3CAWA 4GJJA 1CW2A 3E74A 1K4GA 2J7HA 2WJZA 1KWGA 2V67A 2C1HA 1LWIA 3TCEA 3M5ZA 2FZBA 5AYYA 4RDZA 1AQMA 5KTLA 2Q8XA 2BNJA 4HZ6A 2V68A 3P80A 4D6JA 4JTSA 1WAUA 1BWKA 1XIIA 3KP0A 2XGIA 2JF7A 3OYXA 4S3AA 2H3BA 4BF7A 2HRWA 3BJTA 4OTKA 4PCSA 4AEFA 5G1YA 1AW2A 1EXPA 3L4XA 1Q2RA 4GJIA 3MSGA 2P50A 4HTBA 5BCAA 5HMFA 3KM8A 4DO6A 3NL5A 3DERA 1EP1A 5XINA 3D3AA 3MUXA 4CVUA 4OE7A 3W6MA 2EKCA 2QCHA 1A5AA 1RJRA 2L5HA 3KCJA 3LS9A 3WQ8A 4EPKA 1XXXA 1PIGA 2Y6ZA 3SSJA 3M47A 4F66A 5ABFB 3S46A 1XGZA 3OZMA 1FH9A 4QISA 1EC9A 3KFTA 3LQGA 2O9TA 3GFXA 4UZUA 4AIOA 2CHRA 3GLCA 2OOGA 3A4AA 3L67A 3N12A 3CPGA 3S2CA 2VR4A 3CAKA 1OCQA 1PWMA 3R43A 4GLEA 1AD1A 3DYOA 1DJQA 1EX1A 4IQJA 2ZUNA 5HMSA 3UWQA 4MJMA 3EDFA 3BLEA 2WBKA 4G6CA 1ISYA 2PLJA 2PWUA 3QKZA 4R9XA 2ZVIA 1KFEA 3TAOA 3WO8A 4GJ1A 1OG6A 1SW0A 1OZQA 1L6WA 3LLXA 5T91A 1JFHA 3GXNA 7REQB 2A3EA 2PTDA 1DWJM 4OZOA 1CPUA 4R7JA 3BG9A 3E5PA 2FLIA 3LU2A 1NFPA 2BXZA 3GIYA 4AY8A 3LSCA 1LM1A 4M6QA 1DWHM 3WDRA 5DN1A 1BD0A 3MPGA 1RLDA 1W91A 2I7GA 1S5WA 6TIMA 3KTXA 4JIPA 1AMKA 3CQ0A 1YQ2A 3EB4A 2FVMA 1SO5A 3VGFA 4NZ4A 1M3UA 4C6FA 4CUCA 4FZIA 2IW0A 4PTMA 2PLKA 3FW6A 2REQA 2DH2A 4O28A 3EMZA 2J24A 1F74A 1ZQ5A 3CEPA 3WBWA 1PE1A 3R0KA 4CD4A 4PB5A 1W17A 2BGSA 2PC8A 4NHVA 3GH7A 1A3WA 1NOFA 1MW3A 3UPWA 2V3DA 2DVXA 1F9CA 3QPEA 4RV8A 4MFDA 1Q6CA 3S9YA 3LRKA 1KA9F 2VMFA 4I8YA 1E73M 2ZCGA 1QHZA 5LXXA 3OZYA 1UKQA 1PTAA 2BODX 2P0OA 1KTCA 4DJEA 3VM7A 3EWXA 1VBGA 3W85A 5I3KA 2ZX6A 1XICA 2YB1A 4Q4QA 4A8RA 1KTBA 1CGYA 3AZTA 3GNXA 2O55A 2YXOA 3MDUA 4U3CA 3OGVA 1XV8A 1WZAA 1H7PA 1ICPA 4NY2A 3KOFA 1XDJA 3CL8A 3M0MA 5GJNA 3W70A 3K8MA 2DZBA 3G18A 5JH2A 1DXIA 3WFZA 3QR3A 1RLCL 4RK8A 4DWSC 4P7RA 4JTGA 3THAA 2TAAA 3WQWA 1QI5A 4BJHA 1YADA 5BOOA 1DE6A 4LXFA 4IFOA 4JCMA 4C1LA 3TTOA 1O95A 5I3IA 4WJEA 2GUBA 1OY0A 1TB3A 5AHEA 1E5NA 3PBYA 3URNA 1OBAA 1VLWA 5LIYX 3GTNA 5D9OA 4N4QA 2NT0A 1CENA 1O6IA 1UUQA 4A22A 3UNDA 3GXDA 1ZBVA 2JGQA 1Z48A 1V02A 1SO3A 5E0CA 3L0KA 4C1KA 4JIEA 1DV7A 2CBIA 3DCPA 3TC7A 5HWJA 3OP2A 5CAHA 2VEMA 4O52A 2X1IA 1VBUA 5ABHA 2OGJA 4ML4A 1HJQA 1GHRA 1K8CA 2CC0A 2OQHA 1B31A 5D2XA 2OSWA 4L64A 3F4CA 1EJXC 4F8XA 3GDBA 3VILA 1CWYA 4S3BA 1FVPA 2J7GA 2OWXA 4G1NA 3H4XA 4HJWA 4BK9A 1OFRA 1SUXA 3D0CA 1S5MA 5BROA 2C8NA 1HGYA 4QQ3A 3EWZA 1QPNA 2IMRA 1PYFA 5FL1A 1E1CB 2FVLA 2ACQA 3PNUA 4F9DA 2PDGA 2R14A 4C7GA 1UA7A 3CJPA 4M19A 1WA3A 4JN8A 3LHYA 4TIMA 4LQ1A 3DFSA 2VQUA 1X7IA 5D9NA 1FWAC 4G1KA 3NPWA 4RW3A 3LA4A 1QXLA 2P3ZA 4FS9A 4RZ5A 1ME9A 4EE9A 5DCDA 4R27A 1QW7A 1F3EA 3FJ4A 2BOFX 2EPHA 4O1CA 5LIUX 1KV5A 3GXPA 5I24A 2CXEA 1J0YA 4NZ5A 3CIVA 4CVWA 1LL4A 3EA3A 1UW9A 5BW6A 5MKGB 4XO6A 1XLLA 1UP0A 4UMBA 1KRCC 3TSDA 4YJ5A 3WLRA 6ALDA 2R1PA 3SGGA 1A5MC 4ZOAA 1W5PA 3W7QA 1E1FA 4TX9A 3V36A 1KV8A 3VIGA 1SVDA 1BRLA 5T8GA 2FZ9A 1HQTA 1OYCA 3KRUA 3MO4A 2VHLA 1Z8AA 3MS8A 4JN6A 4QGCA 1XIMA 2B7OA 5T9CE 4BKNA 2YCJA 4LEQA 1G9HA 3CB8A 4LUYA 1V3JA 4KIEA 3JU2A 4LB3A 3SQMA 1SZFA 4S23A 1NOUA 4W86A 4GXWA 4Y96A 1SW3A 5FEXA 1KWKA 2VCCA 1S38A 3BW3A 2ZX8A 2YW4A 3GVWA 3HU7A 3ANUA 3NSNA 2F38A 3N2OA 3PWGA 3J7HA 1UG6A 1A5BA 1IEIA 2OLSA 3VX0A 5BMXA 4MGGA 2WM0A 1UZ1A 4GNVA 5EMLA 1T96A 5D2YA 3I3DA 2GZXA 1DL3A 1EJWC 1RAKA 1V51A 2JALA 4LOCA 1IWPA 3LM7A 3R25A 4IMCA 3EWBX 4G7EB 1UKPA 4IQDA 4KQNA 4Q4PA 1XLMA 1RA5A 4G8TA 4W7UA 2BP1A 4JN7A 4D2JA 4RZ4A 4W84A 1R8LA 1QI0A 4H7CA 1FHUA 4ZOEA 3HG3A 2PWGA 4MHBA 3PPHA 3T4CA 1LJYA 2UY5A 2OCZA 4GK8A 1YKWA 3VK5A 4HZ7A 1AW1A 2E9MA 1JPIA 1SZNA 3VO0A 4UTJA 4D71A 4PN2A 2YXGA 4G7EA 2I14A 2XJ7A 2FYMA 4AYSA 2OO0A 3FYYA 3FNDA 2OVLA 3PTKA 1A47A 1EJ7L 4LRTA 1EHNA 4AHOA 4IFRA 3DBNA 3HMJG 2J9YA 1OD0A 5LIWX 3U2CA 3BW4A 1MW1A 5D05A 4BEQA 2YYUA 5G2IA 2YZRA 4Q4SA 3QHMA 5DANA 4CEUC 1K77A 2X1TA 4NI8A 1QOQA 2ZKMX 3S1UA 4HNNA 1FWWA 2QCEA 4ORMA 1VAHA 1AMYA 1QNQA 1G67A 1DPMA 5BXPA 3LK6A 3CHEA 2QVNA 2BVYA 3QGVA 5EMMA 1R85A 4AC7C 1GK8A 2FPVA 4DJFC 1H1ZA 1N8WA 3L4VA 4JICA 5KZDA 3QM3A 5BRQA 2E4TA 2RFGA 3PTDA 3VMNA 4JPGA 1HJXA 3SCVA 1XUZA 4US5A 3GHRA 2VZVA 4E4FA 2E09A 4QNEA 3VNYA 4HBKA 1SFJA 1XDLA 3IAPA 3QEZA 4IIDA 4FK9A 3VFLA 2ZUUA 1GYNA 1G4TA 3EX3A 5DFAA 1XGDA 3DHFA 2BHUA 2DUXA 1TIWA 2YA0A 2YW3A 1VCVA 3CC1A 3OVRA 2D2JA 1KCKA 1TKKA 5SWUA 1F7BA 2F6XA 2A3BA 3ZSSA 2FDMA 3TZNA 4G7FA 4HPHA 3LNMA 2FPTA 4JD4A 4HK5A 1G01A 3CPUA 5K7JA 3LBCA 3NTYA 5BZAA 1Q4NX 4UTFA 4KEMA 3O6CA 3QQ1A 5AY7A 4DJDC 4RPQA 3RLGA 5DT5A 5I3DA 4PYSA 1NIUA 4JKKA 3VC6A 1VFUA 1LOQA 3AI0A 1G4PA 3DDMA 2DQXA 1FDZA 3STEA 2F7FA 4JFSA 1TV3A 3TW7A 4FNRA 4M1BA 4G56A 3UEQA 1XIHA 1W5QA 1IR2A 1E9IA 1F6YA 2I16A 1RPXA 4B92A 1E1CA 1B3ZA 2Y7EA 1BSIA 5JBDA 5JH1A 4DHGA 3WLIA 1V3MA 5LGXA 4QAWA 5FAGA 4DJEC 1YE4A 3IPWA 2PCQA 4H8NA 1WQ5A 2PDYA 4AWTA 5LGZA 2RGMA 4MJ4A 1Z41A 1T99A 2DSVA 3QTGA 3GYEA 2HSAA 2CLIA 3GFYA 2PMQA 2R1NA 3ZS4A 5AC8A 3EA2A 3FK4A 4F79A 4O19A 2HK1A 4IGSA 4NJHA 5GVJA 2VJXA 3VVGA 1KRMA 3UP8A 1ZJHA 4K68A 3V1HA 1VCGA 3E49A 1LBFA 3OA5A 3GDRA 3SSZA 1F6PA 3U0HA 3WEOA 1BXBA 1E4LA 1OIFA 1M53A 3W7PA 1V6XA 3GVGA 3CQJA 1TJ1A 1E3ZA 1UB3A 3QHNA 2Y62A 4Z08A 1M65A 5DMLA 4JX5A 3TXZA 2W3ZA 4LF2A 3D46A 2RUSA 4HU8A 1JRBA 2ZZ5A 3L2IA 1NAL1 1OCJA 5AYIA 1AW5A 2NVAA 5EKYA 1YEYA 1JPMA 2ZICA 1E71M 4YTUA 4MWAD 2PODA 4RUBA 2DSWA 2RJHA 1GW1A 3M1ZA 4C60A 4MDPA 4ES4A 1TX2A 1P5BA 2TPSA 2IUZA 5LIXX 1CCWB 1VD6A 1MWOA 5CC7A 4PUEA 1HKJA 4PE8A 2Y5EA 4AZIA 1SZEA 1M6JA 1EBHA 4J3XA 5BRBA 4P7QA 2ZTJA 3PZ9A 4V28A 3TN4A 2IKIA 3LI1A 5DQPA 4AUBA 2ICSA 2D24A 3DC8A 2QAPA 5ABTA 1PKYA 2KZHA 4P61A 4UR7A 4FNUA 1SR9A 3W7IA 2WMKA 1K7XA 2QVHA 1VFSA 2J25A 1Z3NA 1YNQA 2RAGA 4DZIA 2WVSA 5C2CA 2OSYA 1SSDA 3S8HA 2O9RA 4NYUA 3FXGA 1LWHA 1E0UA 2GVEA 4FP1A 1G94A 2CETA 3BOXA 3ICJA 1JUBA 3SY1A 3H55A 4B4FA 2EKGA 3HQNA 3W37A 5FL0A 5CZ0A 4M81A 3KZPA 3ABSA 3AO0A 2VDHA 4Z1CA 4I7VA 3TW9A 1VYPX 1QI4A 1S2TA 3G3DA 3WLSA 2VVNA 4JYDA 1Q8JA 2ISWA 4W85A 4Q32A 3AZSA 1PKMA 2V3GA 3CM4A 3CUHA 4ZOCA 5JBEA 1MQPA 4DO4A 3SBFA 3OLIA 5C9XA 4PSPA 2Q8LA 3VCNA 3UWUA 3LTSA 4Z0SA 5FAJA 3W9ZA 3GR8A 1ZU8A 1OCBA 4N9CA 3C52A 2AMXA 2WJEA 4NZ3A 4AD0A 3A12A 4KFNA 3ISIX 1W9UA 2WLZA 1GVIA 4WDTA 2BX7A 3T0TA 4YYFA 4QCFA 3NDZA 4IICA 3ITVA 4XO7A 4LAZA 3L21A 2G4FA 5A6AA 4GX9A 1EP2A 2E77A 1TR1A 1C93A 2EG7A 1XSJA 3UR7A 4EWND 4MG4A 5A6MA 4GI6A 1PS9A 3IVUA 3T0DA 4MADA 1XIGA 1QCWA 2Z1SA 5M2FX 2EO7A 3VIOA 3WCZA 3G0UA 5U4NA 4B2DA 3OLGA 5EGRA 3WH5A 4WXZA 3WJXA 2X1RA 4IX2A 5A8QA 2NSOA 4RXGA 3N9KA 4WKFA 3A9BA 2FGBA 1V0KA 1I60A 1MNZA 5GNYA 1VC4A 1TX0A 5E5CA 7PTDA 3C2RA 3TYZA 2PDQA 2ON3A 2P8BA 1W3NA 1WBHA 3N4AA 1TIMA 1ZP4A 2EQDA 3CHDA 4IPNB 1EGZA 3NZPA 3MI2A 1GTHA 2CWNA 1EJSC 5FJIA 1W5MA 4FPSA 5HXMA 2BVTA 4NJIA 3APGA 2KAUC 3EOOA 4HNUA 5BWAA 3LPPA 1OFBA 1J5SA 3PWIA 4IMGA 3RYSA 1JYXA 4GIEA 2WJFA 3IJ7A 2QV4A 4BZYA 1UR2A 4EWJA 3S2LA 4IJCA 2QCLA 1YW1A 5I3HA 3LENA 3IGUA 3FJ6A 2QF8A 1BYBA 4E38A 2PDNA 4CCDA 1LRQA 1ITCA 3G1XA 4YVPA 4WGXA 5HA7A 2WSQA 1K03A 4DWSA 2VFEA 2WNQA 2CHOA 3TOYA 6TAAA 5AVHA 2ZWYA 3RXZA 1TMQA 3TA6A 1NELA 5BXTA 1UR4A 1PYMA 3T2QA 4C6EA 3H12A 4LU0A 3JR2A 3CU2A 3F7JA 5E0KA 1BQGA 3WLJA 3MMWA 3I4KA 3BURA 1REQB 4PMQA 3G1SA 2G3FA 3GHUA 2CLOA 1BPLB 4IG2A 3IUDA 1RSCA 3U48A 1SMAA 3A21A 4J1OA 2EG6A 3WMBA 1I4NA 3VOGA 2YR1A 2BDQA 1TTJA 2OT1A 2OOFA 5FEWA 3DN5A 4J35A 5A6LA 1KNWA 1AVAA 1P0EA 4XZHA 4JTUA 4S3JA 3A47A 2XINA 4O17A 4FO4A 1PO9A 1L6SA 1KR1A 3W76A 2G95A 1ENUA 1FOBA 3VKBA 3RFAA 3GC2A 2C18A 5C0QA 1W3LA 4QCEA 1VBJA 1VYSX 1MZHA 2YA1A 4RDWA 1JJKA 4R34A 3L65A 2QEZA 1GOIA 1A50A 4PSRA 3SCQA 4KKXA 1NQ6A 4F0MA 3DEQA 1EA0A 4CQAA 1A5SA 4Y9PA 2NX1A 2CU0A 4BEUA 3OHIA 3NL6A 2D23A 4LYKA 4NNCA 2VEFA 3KTSA 4O53A 1FWIC 3U2EA 3VMOA 2B7QA 3A4JA 2PDJA 4E3TA 4XKYA 3LMZA 1SFTA 3PZOA 4A29A 4EANA 4F0LA 1WXJA 5EPDA 4JHZA 2QCGA 2NQ9A 3NCOA 5GNXA 2PB1A 1TPEA 1NEYA 1KW1A 2Z1WA 2YBTA 1LF1A 4J40A 4C5ZA 1I2PA 4ZXLA 1KTNA 2X40A 3F4VA 5F2LA 3VOCA 3AMCA 2NZLA 2XWDA 4LAUA 1OFOA 3UFYA 4DJDD 4Q8PA 3ZVIA 4DJDA 2Y88A 1H49A 9CGTA 1HP5A 3E3HA 4I7WA 4XSMA 1FDYA 4NXKA 4B5SA 1T6MA 4ZO6A 4B3LA 5FACA 2VX7A 1E43A 1X1NA 1QO2A 3R4IA 2D20A 4X0NA 1IXQA 3MC5A 3PFRA 5FI8A 1H51A 5G5IA 3KE0A 3LY0A 2VXNA 4FA3A 1K70A 1UPMB 1XC4A 4I3GA 1AJ2A 4HNTA 5H6HA 4MB1A 2JKAA 3GUGA 4DBWA 1LBMA 2PLMA 2A3LA 1A0CA 5LXEA 3UYIA 1UCWA 4RPPA 3N9RA 3EWWA 2FQIA 4H8VA 2YCKX 5ABEA 2GUUA 1GJWA 2NVDA 4MDOA 4XZLX 1UR9A 1RVKA 5LA1A 3SUVA 3BAXA 1NWSA 3ZT6A 1VEOA 2QCMA 3KL5A 4AD4A 1TZ7A 1XH0A 3HURA 1HKIA 5FOOA 1QR7A 4ASTA 3ABZA 4XD5A 3CMJA 4Z42C 1NWUA 4XAGA 1XBXA 3NFUA 3YPIA 4MWAC 1XGEA 3G1DA 1WXZA 2WWCA 3SB0A 2CHNA 5TD4A 5I6SA 1TPUA 1T40A 3W2NA 6XIAA 4Y90A 3PUEA 3BAYA 2WSKA 4XVDA 3UZZA 3URAA 1VH7A 2NWRA 3RUBL 3CV6A 4AVFA 1Q6LA 1ITUA 2F2HA 2XSXA 3N2XA 2VP8A 3UZXA 1KM4A 5J8LA 2XPKA 3WK0A 1K9DA 3MW7A 4WOZA 3N4FA 4H9YA 4XAPA 2GJXA 1EL3A 2FTPA 3BSHA 1Q6OA 2EHHA 1DTNA 4L9XA 1UKTA 2HWGA 3RITA 3QF0A 4H4IA 4AZ6A 1KKRA 2C13A 4U3AA 1W2VA 1EOKA 2QXWA 2UY4A 2J75A 2PP0A 4OIFA 2ACRA 2VRKA 2GJRA 1B1YA 1B90A 4KBXA 5A6BD 4HA0A 1G1YA 2NQHA 3MWAA 4I7UA 1H5VA 4RL3A 3LG3A 3EDJA 4TV5A 2VOMA 4DZ5A 3VDBA 3DFOA 3JUGA 8RUCA 3IGSA 3QXBA 1H7RA 4L65A 3WX7A 1YDOA 4PCFA 3DGBA 3ITLA 1N2VA 1FHDA 4EP8C 1AL7A 2WVUA 1EWDA 1RK5A 2C91A 5D33A 3WQ6A 2GUYA 1Q66A 4GZ7A 4EX4A 3G8RA 1YBQA 1KLZA 3CK5A 2ZXDA 5TNVA 1IT7A 1MMFA 5FJJA 1VJIA 3GQYA 2ZQ0A 4FLSA 4UTMA 1YDVA 2VFGA 2XU2A 3KHJA 1SPQA 1N55A 4JYEA 3TEVA 4XZMX 4QLLA 4E2BA 1HJVA 2J66A 4LY8A 4UMAA 3HMCA 1L0PA 4DELA 2CZDA 4PB4A 1DIEA 5DY3A 5BXRA 4ZSTA 2OODA 1TQJA 4W88A 2ZTKA 1SQ7A 4YIWA 4K1GA 3C0LA 1YHTA 3SRKA 1YPIA 3CAVA 4DIAA 1B3OA 3VOJA 4HK7A 4YS1A 1XCXA 1KD0A 1DIDA 4F0KA 4XIMA 4HNCA 1Q6DA 2BLEA 5LHEA 1QT1A 1FP8A 1X97A 1GOWA 2NQLA 5CLWA 3W7DA 4GXPA 4UXDA 4AIEA 4QITA 3R94A 4HNOA 3LOTA 3PAOA 4AU0A 1RY0A 4RNFA 1N7KA 1PDZA 4IL2A 2A4AA 3TZFA 1E4MM 2VVSA 1ZFJA 4UQEA 4MNMA 3NOYA 5A6SA 1BAGA 3O9NA 4JX6A 3SN0A 4E2OA 4QX4A 1FP9A 3VGBA 5JUVA 4S3GA 3QW4B 1J79A 4M80A 8XIAA 2E7FA 3W6LA 5LNSA 3W25A 3P5ZA 3B3DA 3ZVHB 4QG6A 3UZ5A 2QDGA 3UCCA 3UVIA 1AODA 4ALDA 1X8CA 1PTGA 2QNEA 1OFQA 2NSXA 1AZ2A 4C1NA 1ML1A 1WBJA 2WMGA 1B5TA 2ALDA 2J27A 3BCFA 1U1JA 2XUCA 3WNPA 1R86A 2VNCA 5M17A 3APTA 4HU0A 2PGEA 2RDXA 1FWCC 2DSKA 1E6RA 1EC7A 4NZFA 3RO6A 1XLKA 1R0MA 3DYPA 2J74A 3HTWA 2Q6ZA 2WVVB 5CC5A 3IARA 4MSSA 2ZX9A 1FXPA 3S0CA 1KM6A 5E0FA 4C7FA 4LJ3A 1JCTA 3QC0A 1UKSA 1K7FA 1XLEA 3VKDA 1ZBWA 1O7AA 3LI0A 4IUOA 3WEZA 1G6CA 3VUSA 3GTXA 5C2XA 5I7GA 4QS5A 3TP4A 3F5KA 4WUIA 1Q2SA 2ESCA 2IPJA 1PKLA 1JD7A 4JDBA 1LG2A 5AYXA 3W2JA 4EKJA 5MKGA 2BOGX 1XR2A 3ARXA 1W3KA 4PMUA 1FFQA 3VOFA 3KW3A 1UH2A 1CI1A 5I09A 2X8RA 1G69A 4J3TA 1CGVA 5A8PA 3EWUA 1GGOA 1NU5A 2QZRA 4UTWC 1WKDA 1SJBA 4IG2B 3PBVA 2YB4A 3U5YA 3VZXA 4GQ0A 2QMJA 2V3EA 4Y8FA 3KS5A 3P14A 3VIHA 4CU6A 3LPGA 3SIZA 2A7PA 1T0OA 4K7YA 3QVQA 4LH8A 3MP5A 1KXHA 3Q4DA 4ZSUA 1JPDX 3WN6A 3BLOA 4JDYA 4TOQA 1WX0A 1ZJAA 3N2BA 8TIMA 3VIIA 3HN3A 1HXJA 5T26A 1GCYA 3BDKA 3CO4A 1W6TA 4JZ5A 2EF9A 1FWTA 3Q94A 3FVDA 4D6HA 3V35A 1B9ZA 3WF4A 5I3GA 4PBFA 2GDVA 4QG8A 2WV8A 2XHYA 1H2JA 5H91A 3VE9A 4QS6A 3SUUA 1VRXA 3B03A 1QNSA 5CBIA 3RM4A 3QKEA 3W26A 1YE6A 4JIIX 1XYLA 3TIMA 2BVDA 3Q45A 1FRBA 2OZ0A 4ZCWA 5DELA 2E67A 4WSHA 3AS2A 1LLZA 2B7NA 3ZJ7A 1VQTA 4DJFD 4Z1AA 1E6SM 3SFWA 3UXKA 4XD6A 2Q3RA 2PDMA 4CLMA 1CX9A 4CKQA 1J01A 3W82A 3B9EA 3NEVA 3FHAA 1UR3M 3XINA 4HHHA 3UXDA 4FI4A 9XIAA 3QV6A 3CV1A 4XBKA 4L9ZA 2X0SA 3R8RA 1W9VA 3AIUA 1E70M 3VE7A 1YDNA 3C0SA 4NUWA 1DIOA 1V4YA 1S1RA 3V1PA 3ITTA 2XIMA 4D1JA 1JCJA 4EXQA 3AIRA 3AROA 4UTHA 3TYCA 1QBAA 1WUEA 5LA0A 1X96A 3OZPA 1JZ8A 2WK2A 3GK0A 5C70A 1E40A 1A80A 4ZENA 4W9TA 3LUTA 4FR6A 6A3HA 2YCEA 2Z28A 2CERA 1JEZA 4QSFA 5F4WA 2GVJA 2R6OA 2V82A 4LX4A 2DZUA 2HDJA 4LS2A 1AQFA 2C19A 3MZ2A 3BPWA 4W89A 4PMZA 3VD7A 3BV7A 2HCVA 3W1XA 3R13A 2BXVA 1RJPA 2XSBA 3L5AA 4MUZA 3HPXA 2XN0A 5HQMA 2GGHA 1W3IA 2JEPA 1CT5A 2OEKA 2PZ0A 3RILA 4NSBA 2IKHA 4S1FA 2VFHA 2W0UA 3TQKA 2VWTA 4MIMA 2I5IA 4I9JA 4AZGA 2W66A 2E1DA 4KPLA 1TG7A 3CUJA 5DEZA 5L6UA 3LBMA 4GC3A 1A5KC 2BB0A 2E5BA 1Y8BA 1B3WA 3GFZA 2VTFA 3MVTA 7REQA 4UOJA 1Q7MA 1E15A 1PJ9A 3TTSA 3PBMA 1KO0A 3T9PA 2DPEA 2V5CA 2G97A 2C1GA 1Q13A 2V8ZA 1ECQA 4ZFMA 4QDWA 2XISA 3W1AA 3HV9A 1Z7AA 3T78A 2D69A 4PB3A 3B9AA 3CIXA 5E6YA 4O0KA 3WNNA 3QTPA 4IX0A 4H1ZA 1EQPA 3TX9A 3CQKA 1ZAHA 4RNJA 4WDWA 5ABFA 1GG0A 3K8LA 4CNTA 1VRDA 4Z2KA 4LV4A 3L4WA 1YYAA 3KBWA 2Y63A 3AMLA 5I2UA 2YYTA 2ZRVA 5XIMA 3VCCA 1A5LC 3I7SA 3E9AA 9XIMA 4N6FA 2BXYA 1W5NA 4XIAA 4H8UA 2ZZ2A 3NGFA 1U1HA 2ABBA 3G0XA 4FLRA 4UCGA 3EDEA 3UESA 4UR8A 1DE5A 4GQGA 3O0FA 4HSHA 1XP3A 4RE4A 4IXXA 4FNQA 2FDSA 4GGHA 3UG4A 1PDYA 3H2FA 4U33A 5C7HA 2ZC8A 3S9IA 3V5FA 2DW7A 4MUPA 1UASA 1RALA 1M68A 4BF5A 3AUOA 1SR0A 4OBSA 1XFBA 3MI6A 1U1UA 1T8QA 3F4WA 1M03A 2PBGA 3TV8A 4DZHA 5I78A 3R8HA 5K9XA 4UFLA 4C7DA 4FLOA 5C9ZA 5CCZA 1NTHA 1H7OA 4PCTA 4C6KA 1ONRA 1R2SA 4UNIA 3ZR6A 4XG1A 1DWAM 1ICQA 3FOKA 2WJDA 1ZLPA 4R9OA 4JQ3A 1SFSA 4WGHA 3DECA 3KRSA 3ATZA 2HE8A 3GXTA 4KCVA 4HMNA 3S2NA 3AMGA 5AZ1A 2HV5A 1EDGA 1A49A 1TUXA 3HF3A 2QJNA 4D8LA 3BLPX 1CBGA 1LG1A 2HE5A 2XFYA 3TW6A 4JL2A 1YTKA 3PBUA 2EPMX 3VTRA 4GIRA 1JZ3A 3G24A 3S5YA 4ZB0A 3QY6A 3EEGA 3Q2DA 3NUKA 4Q7BA 1TSIA 3LEPA 1OVDA 3CHCA 3GM8A 3UYCA 3UCDA 4AZ5A 5I06A 4HN4A 2C0AA 5AC5A 3DC0A 1DKWA 3OGRA 2INEA 1W5OA 2DVTA 3E5BA 4LVBA 1IWBA 3OZOA 4ROQA 2ZFAA 3WBAA 2BSLA 1H63A 3WK3A 1H7NA 3HGSA 1GYMA 1FWRA 3B9DA 1GQLA 2G50A 2WCGA 2HBVA 4X63A 3BAWA 1MFVA 4PTXA 3CNYA 4TTGA 2EAWA 3RJXA 4YU1A 2CBJA 1A0DA 3AOFA 4GD0A 4GPNA 2VGBA 3BGAA 3P0XA 2VYOA 4YTRA 2ZX5A 3ALFA 3M0KA 3UWVA 2FIQA 3WL1A 4PFMA 3RRXA 4WCJA 4EF8A 4CGTA 4DAIA 4C5YA 4GQRA 1X1ZA 1SYTA 5D9MA 2FFIA 5DMNA 3H2AA 2FHCA 4C6QA 2NW0A 1VIZA 2VR2A 3K1GA 2R8WA 1XSKA 3ZWSA 1DTUA 3TOPA 4EF9A 3HQPA 5H8UA 3Q67A 3TR2A 1V02E 1JIBA 1OK6A 3M7SA 3A13A 3CQHA 1V8EA 3RIKA 3PBGA 3NNTA 3PTMA 2QUNA 1E4NA 4UTUA 3IIZA 3FYOA 2QULA 2E6DA 1GOOA 4LVAA 4S3CA 4NP7A 5C5YA 4KWVA 4FIRA 4ZO8A 5D9PA 4C1NB 2HXUA 4NJKA 3K5XA 3SGZA 3O7UA 5CGTA 1RD5A 4QLJA 2NUWA 2AAAA 3V18A 4I90A 3C2VA 4FNSA 3WG6A 4C6IA 3ZVHA 1P43A 1VYRA 2J6VA 2PDXA 3R5EA 2EGZA 3OQ8A 2WMFA 2F61A 5A2CA 4F48A 1W0MA 3ONCA 4Q7IA 2QPUA 3DFPA 1J96A 3L23A 3GNNA 5KINA 4KWWA 3PUDA 4DZAA 4JTDA 4JY9A 1JGMA 4AISA 3CQIA 2VC5A 4NX5A 3CH0A 3W1UA 3FSUA 4PTDA 4DF2A 2YDAA 1F5ZA 3HG5A 4ZEPA 2XIQA 1ZS2A 3L12A 3MCOA 4HZ8A 3ZZ1A 5HWNA 3C8FA 3A4XA 4MF4A 4FX8A 3H8AA 1B2YA 2OX1A 3SCNA 3AU6A 3V16A 1H7WA 3GIPA 3FX4A 2D0FA 3TYAA 4JGDA 3NQAA 1YNYA 1JDEA 1I9CB 4MMWA 3OG2A 4JQ1A 2D2OA 3SCUA 4TR9A 5EBAA 4J3SA 2Y85A 1MSSA 4GH3A 5D03A 1I0BA 3LXBA 3PG9A 3FEQA 3QFEA 3C0QA 3PZQA 1HNYA 1CXIA 2X41A 5D4YA 3H2NA 3JVAA 4EVZA 2J13A 3KRZA 1TA3B 5REQB 4A3HA 5A1AA 5HANA 1ZCCA 3P82A 2A3AA 1EJUC 4K37A 2GJPA 4LAKA 3TTYA 2QDHA 1O66A 2E6YA 4ERGA 4S39A 4IPIA 4Q8MA 5FJOA 3QR1A 3H7VA 2PF0A 3NQ2A 4M8UA 4LYQA 1DORA