4RJLA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdpcp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of gamma subunit of the translation initiation factor 2 from Sulfolobus solfataricus in complex with GDPCP at 1.64A resolution
rcsb
molecule keywords Translation initiation factor 2 subunit gamma
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 112
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rjlA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rjlA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rjlA01
4CF7A 2HF8A 3GLHB 4FMBB 2GZHA 2WWIA 3REFA 5HCIA 3HR7A 2IYLD 1P72A 3B1XA 1D9ZA 1AKEA 2CL0X 2H1LA 3IUYA 3RYTC 4DVGA 2ZVQX 4RSGA 4HAVA 3R9WA 1VECA 3TK1A 4BLTA 2GJ9A 1RJ9B 5J4HA 1ZC3A 1FRNA 1QHHA 1UJ2A 2WZQA 4IDHA 3MWYW 1QHYA 5DI3B 1COWD 1KK3A 2D74A 3I4LA 2WMNB 4YC7A 4PO9A 1PLKA 3MJRA 4A4DA 1EFRA 3LFUA 4GPTA 4NU0A 2O8FB 1YRAA 3THWA 5EXTA 4V02A 1QHIA 4Q9JA 2ZJ8A 3VX4A 2QG6A 2D62A 3GP8A 1ZCBA 2ATXA 2ZJYA 5CITA 2RCNA 1E2PA 1CU1A 1NBMD 2A2ZA 2GESA 3IIKA 4JLAA 4LV6A 1S3SA 1PUJA 2IBMA 1JJ2B 1HA3A 4G5OA 3I5YA 2DPXA 4MUAA 4KFRA 3SBDA 2NGRA 2B8TA 4A2PA 1E2IA 3LVBA 3T5DA 4WVFA 2D2EA 3MCAA 1F5NA 3GJ0A 4LPKA 3AVQA 4OHVA 3LV8A 4D26A 1F3OA 2BJVA 3P4YA 3OFNA 2GCPA 4LYHA 1OB5A 1Z6TA 2QL6A 2P67A 1Z0IA 2PMKA 1D8TA 2C9YA 1GVNB 3TBKA 4MYHA 4XTCS 3A4LA 3AKYA 4WBSA 4OHWA 4Q18A 1RZ3A 1BQEA 1JPNA 3ASYA 5LB4A 4JS0A 4GSYA 4IKEA 2ORIA 1KMHA 1FNDA 1M7HA 4C9BA 4PAMA 4OJQA 1I7PA 1T4GA 2DCUA 4URZR 1W4BA 4LJ8A 5FPSA 3HWSA 3V76A 1ZD9A 2EQBA 3UG6A 1KO5A 2B7BA 2QP3A 1M8PA 2J0VA 2QEXB 3QVUA 2JGNA 1KZGB 1WRBA 3ND9A 2XZLA 1J7KA 2J45A 4GP7A 3BD9A 3GD7A 3QPUA 2G9NA 4PC3A 2FGKA 4QHTA 3B1YA 4MITA 2QA5A 1S9HA 1DTSA 3CCSB 2DFTA 3KKOA 3AVXA 2O8BB 1E64A 1KDOA 1JA1A 1QGZA 3TVTA 1P73A 5E4FA 1W0JD 4AF6A 4JKYA 4QBGB 5FTNA 2C96A 4HB3A 5JI2E 1YI2B 3K0FB 4AKHA 1EFUA 2C03A 5AJZA 1HT1E 3T15A 3SYLA 3LX5A 1TX4B 3VTKA 2RGXA 4JBWA 1G19A 2CNWD 5LBIA 4TL8A 2VP6A 4DDTA 1XPRA 3EARA 2ZANA 3L0OA 3ECCA 1Q82D 1V5WA 5KSZA 1U98A 2BM0A 5CIWA 2BBTA 4QG7A 4ZV4A 2ZYWX 1AGRA 3UMRA 2R65A 1KY2A 2OK7A 3U7FB 3KQUA 3EPHA 3U3MA 1GTVA 4Q9IA 1TUIA 5DYIA 4HDOB 5JSZB 1KNXA 2Z4SA 2EFGA 4IRUB 4ASUA 1I2MA 4D4JA 4BFUA 2GJKA 4B2IA 4TQUS 5HZKA 4LPSA 2QT0A 1N8RD 4GMDA 1R6BX 1XMVA 2L0XA 1FQJA 1GZSA 1IY1A 1SKYE 3SFZA 4D2IA 3FKSD 5KNBA 4IXMA 4TMWA 2AWOA 2VNHA 4OHYA 4HAYA 1X86B 5GVSA 2PZGA 2GQFA 3EZFA 3QXSA 3ZS9A 3EXAA 4TN1A 5AUPB 2OESA 1BIFA 5TXGA 4MYUA 3HU1A 4DT1B 3EPLA 4R98A 1YHQB 3OIUA 1Z2CA 3BC1A 2X8AA 1BKDR 2O52A 1OXTA 1PV4A 2RC5A 5HTKA 4KYUA 3KZ1E 3K0AB 4P3YA 3FMFA 4CEJB 1T0HB 5HE8A 1NSFA 1MABB 1OT3A 1US8A 2ZS9A 2EYQA 2W58A 1BYUA 4GBMA 5CM8B 2D7DA 1NN5A 3G6EB 1IXZA 3AH8A 2KBFA 3QF4A 2HJVA 4Y0AA 4AIIA 4Q4AB 3ZIAD 2O0JA 3PJRA 4FINA 1U99A 3CC4B 2BEJA 2PT5A 2JIZA 2IK8A 4Q21A 4FCVA 1XMJA 1UKYA 3FMPB 2RGNC 121PA 4DEXA 4NONA 3EA5A 3KL4A 4YMVA 1OFIA 3RABA 3SNHA 4EPYA 2V3CC 1LNZA 2H16A 2VHUA 2NPFA 4YALA 2GK6A 3OF5A 3UK6A 2QNRA 3UKDA 3K9GA 2BF4A 1ETUA 1S8FA 2GVDC 2QY9A 4QGGA 2NMVA 1YIJB 2F7SA 3V00A 3JVVA 2ZAOA 4Y7CA 2AKYA 2FJUA 2WSMA 3WP0A 1AA9A 4CT5A 1ZM2A 1G8HA 1VQMB 1KOFA 3OAAD 1Z06A 4EPXA 4B33A 3GLGB 1DADA 2HEIA 2OXCA 1KI4A 4M1OA 4GOJA 2GJ8A 4C7OB 2REOA 4AKIA 1Q7YD 1XD9A 1BOFA 1YJ5A 1ODFA 4V0KA 2ERXA 1YZUA 4ACAA 2B7CA 3I8SA 3O8DA 4O25A 2N1BA 3GEIA 4GMXA 4RZ3A 2H57A 1XP8A 2IL1A 1D5CA 2OT3B 4LJAA 3TW4A 1A8PA 4DCTA 4V03A 2ONJA 4FIDA 3ADBA 2DY1A 3RHFA 3ZQ6A 5L3SA 1YZGA 3GFTA 3RVBA 2ZRCA 1NL3A 2HXYA 2CVFA 1ANKA 4MYCA 1XJQA 4C0BA 5L8VA 4QBFA 5KPDA 5E7IA 4DZZA 3BBPA 1QG2A 3ZZUA 1H8HD 1ZJ6A 2WVJA 2GZAA 4IOLA 2CHQA 4A15A 4R2IA 3KFVA 2YWFA 5TV2A 4LV5B 3TSZA 4BWYA 1IJEA 4Q4HB 4WZAE 4RD1A 1AM4D 1S4QA 4XWAA 1CNEA 2V1UA 1T3SA 3Q7QA 2A3RA 4XVRA 3VR1A 5CK5A 3W34A 3U44A 2B5OA 1NLZA 3L0SA 1E0AA 4FMCB 2AL7A 2RMKA 4LHXA 4X8OA 2QM7A 3WNDA 4A36A 4UAJA 1CULC 5JJLA 4DHEA 3LD9A 3Q5EA 1YQTA 1HT2E 3EIHA 1F48A 1Q1ZA 1HE8B 2IYTA 4QOSA 2WJGA 1G8YA 4YAWA 3Q7PA 5BYKA 1KHTA 1RVDA 1QHSA 4ZDIA 2JASA 2QMHA 2G83A 2ZU6A 1H8ED 3PEWA 2YKGA 3W5VA 1E0KA 4M2LA 5KDLA 3I56B 3WRYC 3GLHE 3VKGA 3T1QA 3L0PA 3R7WA 3ZS8A 1NVVQ 2PEZA 5G53C 4DDVA 1I4TD 1U81A 1ZAKA 1T6NA 5IDVA 1T8UA 2W6ID 4CDGA 3OJXA 1OF1A 2YOGA 1SVOA 3QE0A 2PLFA 1CJTC 1Y3AA 3CF0A 1E2KA 3DEFA 3IQWA 1ZNWA 3KXLA 3QG5A 4JVMA 5DLQC 4YXWA 4MYTA 2ASEA 4KVGA 4RD4A 2V54A 4YHBA 3SJAA 4C2UA 1DO0A 2GBLA 3JQPA 2YHSA 4RFSB 3QF7A 3ZDQA 3PR1A 2FH5B 4DLRA 3W6NA 2ZSBA 3CX6A 3U60B 2W2VA 1X1RA 2TMKA 1NMYA 1DELA 5FOUA 1XEXA 3ICEA 2QE7A 1SVLA 4D0NA 4Q7LA 4LYFA 1E6CA 2IXEA 2WPDD 1NNEA 4KI0A 4DKXA 3U5ZB 1JQJC 2A5YB 1QZXA 4DSNA 2QAGB 2Z4RA 4DEYA 3I1FA 4HAUA 2F9LA 1NVUQ 2P5TB 3RWOA 1E3MA 3CPHA 1KI9A 3PCRB 1COWA 2WM9B 4LBWA 5KSPA 2ODBA 3I32A 3CD6B 1DE0A 4NBSA 3T1VA 2VQSA 1VYTA 2RHDA 3THXB 1NP6A 3TUIC 4GDFA 1VQLB 4CGZA 3CZQA 4DLXA 2VNIA 2ZI6A 4HB2A 3ZVNA 5HCNA 1Q22A 3WBJA 2ZPTX 3EASA 4BZXA 4BLSA 4EPWA 3F5FA 2OEPA 4OQLA 1NBMA 3MAAC 3QKSA 4MDEA 1NJGA 4F4IA 3O8CA 2GEDA 3T06B 3ICQB 2O8CA 2GILA 1ZBDA 1R10A 3G4SB 2ZSAA 4GT1A 5L3RA 3TAUA 4Q4LA 4XD7D 3SOPA 3CR7A 1R0YA 3C7KA 3PUXA 2F1RA 4PC6A 1GWNA 1Z3IX 1Z0JA 3AF2A 4FMCF 4MRRA 3CRMA 3AP1A 2BOVA 2JLYA 1KK2A 1E9BA 5J4LA 2AX4A 3BB4A 1NLFA 3EC2A 1OW3B 4EJSC 5FOTA 3K0CC 2B6HA 1II8B 4PC1A 1W2HA 1XEFA 4HLCA 2V9PA 2ANCA 1G18A 2FFHA 1N0VC 2IYWA 2ZJOA 3NBZC 2VO1A 1W5SA 3WBKA 4JLVA 4D0LB 1E79D 3Q9LA 2GCOA 3KKMA 3LY5A 3DMDA 3Q85A 4M1SA 2J59A 4CW7A 3CIOA 1E9EA 1GKYA 4C0JA 1KYIA 3ZVLA 3AVPA 4Q03A 2RGBA 4A8JA 4XWOA 4UXIA 1G3MA 1U90A 5ANRB 1E1RD 3EA0A 4V0NA 1YJWB 3H2YA 1KI6A 1GOTA 1GSIA 1P9WA 1UKEA 1Z08A 2C95A 3PV0A 4LY6A 4NYIQ 4P31A 1W0JA 5FR2A 4CYMA 1E9RA 2PX3A 2ZRJA 3AKCA 3QJYA 3W9YA 1KSGA 4BFYA 1G7TA 3QI2A 2NG1A 3MJHA 2B21A 2RAPA 4B2LA 2J3EA 1G3QA 3W6OA 1RYHA 2CNWA 2IA5A 1KO7A 1FMLA 4U02A 4CEHB 1M1YE 4G5RA 1BO6A 4RZUA 5J47A 4EFMA 4DSTA 4OK6A 5FA6A 4PQYA 1N5JA 2F9MA 3FGNA 1MO4A 3VR4A 2FDCA 1QRAA 4LHZA 2ODNA 1VCMA 1OIVA 1FRQA 2IEZA 1BX0A 3FHOA 4TTPA 1I2DA 3TSWA 4U7DA 1XD8A 3DMNA 2O8DB 5JBQA 5KO2A 3O8BA 1KI2A 1M90D 4PHHA 2VZLA 3OIVA 1K5DA 4I81A 1J8MF 4P4UA 1CR0A 1QUFA 4U9UA 5A0FA 3LA6A 4Q00A 1XPUA 1VQKB 1JPJA 4CVNA 3FKQA 4Q9KA 2IF0A 3ZYCA 2WWGA 5K8LA 3FKSA 2C77A 5K8IA 2ZSEA 4JL5A 1G8FA 1R4AA 3FDIA 3VQTA 3FFBA 2P3SA 2OBLA 3CH5A 3SDZA 3EAQA 1RYFA 3PG5A 3K0EA 4NHOA 4CZ2A 2P6RA 3IGFA 3IQXA 4IDOA 1GIAA 4DCUA 5HZHA 1NN3A 1U9IC 2QTVB 3CWZA 1NRJB 3LBHA 4IVQA 1JALA 1E2MA 2WWFA 4JKIA 1TTTA 5JWOA 4IDPA 4UJ5A 2ZRHA 3CO5A 2WKQA 5A4JA 2XNCA 5JHHB 3GLGE 2QTHA 4P32A 2CHVA 2XOKA 4EPVA 1EX7A 3GLFA 2DEUA 4US1R 3CRVA 3CCMB 1W5TA 1E1QD 3ZIAA 2R8RA 3BIFA 1G7RA 1IN7A 1ZD1A 4GP6A 4R9UC 3CRRA 4LV8B 2E1RA 2A5DA 2IYXA 3OEHA 4DLUA 4M1KA 4A6PA 4GRAA 1QVAA 4AYWA 4C2TA 1YZKA 4HSEA 1UEJA 3WHLA 2BCGY 1XX6A 1TUEA 3N5CA 3QXXA 1ZRHA 5FTMA 2H17A 4KBFA 2ZETA 3GEEA 1GAWA 3G0HA 2VP4A 3CNLA 3K0SA 1BJKA 2IWHA 4BLOA 4I1OA 3CCQB 1D1NA 1CXZA 3LRPA 2R44A 4L8GA 2ZYTX 3IHLA 4JLJA 2BPOA 1XD2B 3OIYA 4K81B 2XAUA 3I72A 2JLQA 5B58C 1DAMA 3OAAA 2JJ1A 2IT1A 3RDPA 2IS2A 1E9CA 2EYUA 3EG5A 2CLSA 4MGKR 1MKYA 4F91B 2GJAA 2WBLC 2D2FA 4YDSA 2J1LA 5CJPA 2VTKA 1GDDA 1AKYA 4WZBE 1CIPA 4A0HA 1BH2A 5LDDC 1W4AA 2C98A 4JL6A 5GJBA 5F9FA 5K8TA 4EPRA 2H8KA 1CKEA 5AUQA 1JAIA 1O3YA 2FOLA 2OCYC 1KK1A 1OB2A 1XEWX 3NBXX 1KAGA 2RC6A 1YR7A 4I99A 1VHTA 3H1TA 3OESA 1CQXA 2FFBA 1R5BA 4PQRA 4X8LA 3NDPA 1E2QA 3NHBA 1H8HA 3QOFA 1VCIA 1J70A 3AP2A 4OQMA 1TQDA 5GV7A 1LS1A 2NO9A 2R6GA 1QG0A 1JB9A 4HAWA 4ITRC 4ESHA 1NG1A 4BECA 3FHCB 4M0LA 4RY2A 4LYAA 1F2UA 3RAPR 3RS3A 2VP5A 3QFCA 4ZIRB 3U4QB 1Q3HA 2JDIA 4Z1MD 4Q01A 3AVVA 1WBDA 3W6PA 4DQLA 4M9SA 2PL3A 4NE2A 1N6OA 4KLNA 4GL2A 1HQYE 4WOPA 1W48A 3BB3A 4JIMA 1NY6A 4TYQA 2QP9X 4A9AA 1OV4A 2OK8A 3SJBA 3HP1A 2QU8A 2OBMA 2YINC 1H8EA 2RGCA 3GFOA 1S1MA 4F7WA 1IN5A 1KAOA 2VRWA 3L0IB 4D0GA 3MWLA 1KSFX 2GEUA 2GZDA 2A5JA 3AKDA 2X77A 4JLNA 4Q9HA 4D4MA 1FP6A 2W6IA 1VG9B 4RZ2A 4E07A 3LO5A 4B34A 2FWRA 1DBSA 4RKFA 4QL3A 4DUGD 3QPVA 4N1AA 5JECA 3I92A 4QGFA 1JNYA 2G88A 4TMTA 1TEXA 2V7QD 3QEJA 1EP3B 2FA9A 2QGZA 4MGYR 1UADA 1FFHA 1K8RA 1XNJA 4EKDA 1Z07A 3QKRA 5LD2B 3A6PC 3C4JA 1GFIA 4ZGQB 1FNCA 2WIBA 5AJYA 3PUVA 1GL6A 4IJMA 1E9AA 1UPTA 3M4YA 4OBEA 3A1WA 5B57C 2GK7A 2AD5A 3E1SA 2JLUA 3E20A 4BPRA 1Q0UA 2ZRBA 4LHYA 3S1AB 1W36C 2WPDA 1EWQA 4C4PA 4IOJA 8OHMA 2NO1A 3WYFA 1E2LA 4DSUA 3VR2A 5KSYA 2QSZA 1SHKA 2XXAB 1RIFA 2P0EA 1KI8A 2VA8A 2C9CA 3A1SA 2RH5A 4LHVA 1WXQA 5JHGB 3EIQA 1GM5A 2QMUA 1P7CA 5EE3A 1WBBA 1N5LA 2ODEA 3DL0A 3GFPA 4HUQA 4M9XA 4OHZA 1DG1G 3DM9B 4LYJA 4IDQA 4FWTA 3B6EA 4P33A 5EQTA 3DOFA 1QG4A 3ZC3A 2HCBA 5DO9A 2P6UA 3RANA 3A1VA 4HDQB 4NL4H 2EWWA 2OLKA 2J9RA 1A82A 4GOXA 1Q20A 2CXXA 3K09C 1YZQA 4URWR 3BJIC 4IFEA 3CW2A 2ZRFA 3BK7A 4B4DA 3U6KA 4F4JA 3FWYA 3BB1A 2CHGA 2FSGA 4XD7A 2IUUA 4HZUA 2PT7A 2VYFA 4A82A 5EE1A 3CX7A 2XSZA 3JVUA 4FWIB 3EZ9A 5FH9A 3CMAB 3TSOA 5GADl 3RC3A 1SKQA 2AD1A 2XX3A 1GNPA 2W2XA 3SFVA 1L8QA 2ZRGA 4JMPA 5KHOC 3CKLA 4KFSA 3UIEA 2LCFA 5B30A 3RLFA 2QN6A 3CCJB 1IY0A 1KKMA 1XRJA 2FPKA 4HYYA 1IN4A 2GVZC 2PLRA 5IT5A 3PITA 5L3VA 3W2FA 1G1MA 1OPXA 4FCTA 4KITB 1Z63A 1NN0A 4PZLA 1EGAA 3ZQJA 5LPNA 2ZVPX 4LGMA 1E79A 3SC3A 4BPBA 3HYRA 4HAXA 3X1XA 2JLRA 1XWIA 4QBHA 3B82A 1JR3E 1DAIA 1N0UA 3FYHA 2CCJA 1C1YA 1LF5A 1JB1A 2O5VA 4QGHA 5DISB 1E1RA 2I1VB 2GEVA 5TMPA 4WA7A 3O47A 1ZMXA 1S3GA 2EFEB 2QTFA 4BEBA 1ZINA 4TYNA 1A1VA 1W46A 521PA 4X8MA 5H5JA 1TL7C 5EE9A 3KTAB 2VL7A 2X1VA 4POAA 1R7RA 4I1UA 1TU4A 2PEYA 1N6LA 4LJ5A 2WHXA 4QRHA 3V9PA 3L2OB 3R7WB 4JVSB 2IHBA 2DB3A 3W5HA 3HDTA 1LTQA 2HLDD 3AF0A 1XXHB 2HCJB 4EJSB 3AP3A 1SULA 2RGGA 2FV8A 4UNNA 3ZVMA 5HPYB 4Y9RA 1LW7A 2AHOA 5KDOA 4IW3B 2IYUA 3MWKA 1QHGA 2QUZA 1EX6A 1DARA 2H18A 3B78A 5C18A 4M1WA 3D3QA 2CLDX 4D82A 4E09A 2YYZA 1P75A 3RS2A 4CIDA 5BN3A 4B3GA 1Q3TA 2Z0MA 4EQ6A 1M2OB 2EFCB 1KI3A 1ZU4A 1TF7A 2ZRPA 3LLUA 3V4FA 2IYYA 1IQPA 3ETLA 3LVQE 2OUKA 3BWDD 4KBGA 3UMFA 3KQLA 3IPYA 4NMMA 3VU9A 1JEDA 1XEXB 5DHFA 4CRWB 4JJZA 5H8WA 1X6VA 2HF9A 5FUYA 1VKJA 2ZITA 3IILA 4XIGS 5EP3A 1UBGA 4N0DA 2CNDA 3VNUA 1KDTA 2ZRDA 1CTQA 1Z0FA 2KWIA 3IO3A 4XVQA 1B2RA 4KSCA 3CH4B 3THYA 1DAKA 1CR1A 3DKPA 3EIEA 3P32A 4XJXA 4QHYA 4TTQA 2D4HA 4DDUA 3RS7A 4QM6A 4HLUA 3QG1A 1MOZA 3EZ6A 5L3QB 1YR9A 2NO7A 2ZJ2A 1R2QA 3SS8A 421PA 4LZZA 1G4AE 1E1QA 4Q19A 3UWOA 2ZJAA 5IK2D 5JJIA 4JYCA 5AUOB 2NO0A 3TE6A 1QHNA 2WWXA 3B7GA 3PFIA 1T9HA 1AZTA 2ATVA 4CEIB 3SR0A 4E5UA 5FPTA 1IXRC 4Q66C 2BBSA 2BBOA 2IW3A 4HI0E 1WA5A 1FPMA 2XOKD 2Z5FA 2R6CA 1Z6XA 2OG2A 5JCPA 1TADA 2O0KA 3AEZA 4BFZA 4PGOA 1VQ7B 1HURA 1Q1EA 3RRZA 2ZS8A 2OCAA 3NG1A 1XF9A 5FOXA 2WV9A 4B3DA 2JLWA 1KO1A 2GAAA 3EZ7A 2BVNA 4BGDA 3OEHD 2B92A 5KU1A 3CCUB 3QIAA 2ZR7A 2ZI4A 1OYWA 3CRW1 5CM9C 1XBTA 3BFXA 2BMWA 2CK3D 5HE9A 2NO6A 3LWNA 5EP2A 5EMNA 1HYQA 4M9ZA 3FMOB 2V8OA 2VSOA 1KDRA 3V4RA 2J0UB 3VO1A 2V6IA 3IBGA 1S96A 1E69A 5JJKA 1WQ1R 1NJFA 2CJWB 2DHRA 3CB4A 1KSJA 1ZM4A 4P4TA 5FR1A 3UATA 3RRYA 2LKCA 1R5NA 2KSQA 2JJ1D 5E3HA 3T61A 3GLHA 2VNKA 1SZPA 2RHMA 2ZR0A 5BW8A 4RKEA 1U8AA 1CP2A 4PFSA 1VQNB 1ZC4A 2ZJ5A 5FBRB 5SZHB 2ZAMA 5HKKA 1CJKC 1RJ9A 4JLMA 3B85A 5DI3A 3K70B 4S35A 3VKWA 3PEYA 3T1TA 2YC2C 4MA4A 5TARA 4TYPA 1UEIA 4LOAA 1CJUC 2ERYA 1WCV1 2Q21A 3BERA 3FPKA 3U2QA 2A5FA 2F43B 4IDNA 1U8YA 5FFMA 4Z1MA 3CF2A 3CONA 2C5LA 4UKDA 5KPJA 3KB1A 5BXQC 1E9FA 2ZUDA 1OSNA 2C04A 4QFMA 221PA 5CYOA 1M6NA 2OFXA 2XZOA 2QQ0A 1FOEB 4MRNA 5LD2C 3U6BA 3FE2A 1RRCA 5F9HA 3IKJA 3DZ8A 4BZPA 1QH0A 1TLLA 3QKUA 2RKOA 1CLUA 1X8KA 3M0EA 4PTLA 2HT6A 4UJ3A 1TQ2A 4US0R 4D80A 3B1VA 1FW6A 3M1IA 4JSYA 1PLJA 2JDID 2OXRA 3WMGA 4M22A 3LXRA 4M9QA 2BMDA 4QM7A 2ZSFA 2QMOA 4JZKA 1KI7A 4AURA 3VAAA 1ZD8A 1G3IA 4Z8YA 4JT4A 1Z22A 2J7KA 2VP9A 1FX0B 2ZI7A 3QY0A 2WTUA 3LH5A 3CC2B 1P5ZB 1IXSB 2FEMA 3BH0A 4JLDA 2BIFA 2REXB 2WICA 4LWZA 1G6OA 4Z54A 4LJ4A 4DUGA 1T5IA 2FEOA 1Q1BA 4JJKA 5BN4A 4L4UA 1GRQA 5IF9A 4GOKA 4PC2A 3H84A 4Q5IA 3A4MA 3QQ5A 3OZUA 2V7QA 1MO3A 4ARZB 5EJEA 5D3MB 2BKUA 3KJIA 5DYGA 1M7GA 2PZEA 3IIJA 1W4CA 1JAHA 1QGYA 3H4MA 3U3KA 4Q47A 1YJNB 2PZFA 3SEAA 4W5HA 2JLVA 4UNRA 4NCNA 3RS4A 4NZYA 2DFKB 3KKPA 1EXMA 4RD3A 1X8LA 2IYRA 1IN6A 4B73A 3SJZA 4OL0A 2O8BA 4PC7A 1D2MA 1AZSC 2ZTSA 4QKQA 4PPQA 1XMSA 1M34E 3TW8B 3WRXC 5J4YA 1QVGB 1HH4A 1Z6GA 2CL6X 3MG9A 3GLFB 4O0MA 3KFXA 1JEEA 3K0CA 3NHAA 3K0FA 4W9MC 3PEUA 2F55A 1EFCA 1XB2A 1HUQA 1UM8A 2KJQA 4A92A 3AUYA 2J41A 1ESNA 3E2IA 1OKKA 1E2EA 1T0JB 4P4SB 4XWKA 821PA 3WP1B 3LDAA 3MWJA 3T5GA 5F2EA 1KIMA 2F1JA 3UMSA 1E94E 4C0QC 3R8FA 4G1VA 4B32A 1GKUB 1P61B 1G17A 4F38A 3TMKA 3IEVA 2V6JA 2MMCA 5DHAA 3G71B 2ZYVX 1JR3D 4P6VF 1NMZA 3RWMB 5GJWC 1EWYA 1K73D 4TZ0A 2IS1A 4JLPA 5JSZA 3P26A 3ZBUA 1N0WA 1YE8A 4LJ6A 4F92B 4IVRA 2EIXA 3WYAA 2A7QA 1TAGA 3FMIA 3CRQA 3DO6A 2UZ3A 1Z0DA 3SYNA 1W36B 1JA0A 1W2GA 2QTZA 4TLDA 1AJEA 4PSKA 3U3RA 1M74A 2BMEA 3KKNA 2EFHB 5SZIA 4Y0VA 3GJ7A 4NP6A 1P2TA 3T35A 1YR6A 4B76A 2DFNA 2CCGA 4DT1A 4M21A 4MRVA 5M04A 3TGPA 3ZD7A 3I61A 4BRUA 1BX1A 1XCPA 4PANA 5EXPA 2XSZD 3AM1A 3LBNA 5DSZA 2CCKA 1F6BA 1OGIA 1AN0A 1UKZA 2BJWA 2FSHA 1EP1B 4WW0A 4TQ9A 4TMVA 3RNLA 1W35A 2XTMA 1SVIA 2FE4A 4JT2A 1M1KD 5FBQB 2IX3A 3ES9A 1GKIA 3K0AA 4PR0A 5EZ6B 3R9XA 1XXHE 2HXSA 3QFRA 2FG5A 2XJ4A 721PA 3T1OA 5J40A 4JBXA 2ANBA 1MABA 4BFXA 1Z28A 5FBWB 1D9XA 3N70A 2ZYUX 1JR6A 2W83A 4KU4A 2XNSA 1OJLA 4F4CA 3K9LA 4Q4AA 3VO2A 2OSBA 1AK2A 1KRHA 2P6NA 3U61B 4W5WA 1SXJB 2E87A 1J99A 4IVPA 1ZU5A 5KOYA 1KO8A 2REBA 4BUJA 4HUTA 2JCSA 4HAZA 4PZZA 4EUNA 3X1WA 4HB0A 2GBLC 3ZLJA 4LBZA 3BFVA 2UZIR 1ELOA 5FOWA 4GFDA 2ZS7A 1P9NA 2BN4A 1P2UA 4Q02A 2WMOB 1RRGA 1GNRA 2ZRNA 1H85A 1ZVQA 2CDNA 2OBNA 1DAEA 4IEEA 4B71A 3ONWA 1AS0A 1C4OA 3VKHA 2FU5C 1MH1A 3FHTA 2O8EB 1QDEA 1FQKA 2HLDA 3HPQA 1R5OA 5KSWB 3BXZA 4Q4JB 3GLGA 1YITB 3QXHA 4JLBA 4G5QA 4DQKA 1OFHA 3KXIA 4C7OA 4JBYA 3ASZA 1OHHD 4M1TA 2FF7A 3FJOA 2QBYB 2A9KA 1LY1A 1XTRA 4OKSA 5BYJA 4B3CA 2R6AA 2AN9A 2RB4A 2RGDA 1ONBA 4QGAA 2G0TA 2N46A 4A2QA 2ZQ5A 3TR0A 1XCMA 3X1ZA 2CEAA 4DRZA 1IN8A 3LXXA 4N0EA 3QSYA 2W00A 4R7ZA 2IEYA 4RD2A 3OEED 1TQ6A 3F3YA 2PJZA 3GLIB 1QGAA 2B8WA 2ZI3A 3L8YA 2UVQA 2VHCA 1U8ZA 3ZJYA 1NIPA 1WMSA 4B47A 1BMFD 2NIPA 2OFOA 2JLXA 1F2TB 1HV8A 4Q4HA 4EFNA 3KB2A 2YWGA 5JS7A 4F7DA 1P6XA 4O2RA 2OAQ1 3W8NA 3KJEA 1T91A 1CRPA 1CJVC 4WIAA 3AF1A 3GJ8A 1IJFA 2X19A 4OJKA 1DG3A 1KJWA 3MUFA 1ZM7A 2GA8A 1F60A 1IB0A 3P20A 1Z6YA 1NKSA 4XSHA 2PMDA 3KQKA 2QEQA 4LBVA 4RD6A 1U94A 2GDJA 4QJ5A 5G3YA 4DLSA 5CB6A 5J4KA 2VNJA 4C0SA 3OE7D 5IK2A 3B1WA 1GP2A 2DETA 1QHHB 1T3HA 3QXJA 2G77B 2IXGA 2YOFA 3U7GA 3A58B 4NCIA 3CCEB 3BS4A 2QI9C 5JEDA 3B8HA 3SQXA 3W2HA 3ADDA 4M8NE 4AC9A 3RSOA 3THWB 4W7SA 1AS2A 2Z83A 2OE2A 5K8UA 3IEUA 1W47A 4EIWA 1TU3A 3T12A 3IHWA 1PLLA 2VYQA 1SM4A 4NYMQ 4ZCIA 1NY5A 3I8XA 2XTNA 1VYUA 3QXCA 4MRPA 5H1YA 1UAAA 4TQAA 2NZJA 5AUNB 2QENA 4D25A 5FUWA 3UG7A 3K70C 1B0UA 2CK3A 1E98A 2IYSA 2ZE6A 4Z51A 3QUSA 2EFDB 3K9HA 1CR4A 1N6KA 4FK8A 4B35A 4RFSA 3CWQA 4M1MA 1UFQA 4URXR 4BFWA 4NYMR 4KXFB 4II7A 1OH6A 1E9DA 3C5HA 1OIWA 2OM2A 4WXPA 2JLZA 3AQ4A 1UBFA 4NH0A 4D81A 1E99A 3C41J 3MLEA 1ESMA 4HB4A 4MQBA 2EVWX 5AWFC 2WOJA 4DIEA 4L9SA 2QAGA 2HDNB 1N5KA 4HATA 3U3JA 4K1XA 1EWRA 3MMPA 1P9RA 3R20A 1DPFA 1KMHB 3IBYA 2KB0A 1SVSA 2R9VA 4PHFA 2QQEA 3ZH9B 3NC1C 1HEIA 2F1IA 2ZJBA 2WKPA 2DWQA 4QNMA 3THXA 3WMEA 1OXXK 3TKLA 4OI4A 5FBLB 2E9SA 4ERNA 1GRNA 3TUZC 2FMXA 1KJYA 3EC1A 4URUR 5HKKD 5KDDA 2GCNA 4EFLA 3VR6A 1LV7A 4NCKA 2KBEA 5IRCD 1GRRA 1VQ9B 1LF0A 3J81k 2YWHA 1ZIPA 2J7PA 3NBYC 4KFUA 1N2CE 4K46A 3RS0A 4BASA 5ELXA 4AY2A 4DC9A 4OI2A 1JXOA 3BGWA 1Z29A 2ZRMA 1D2EA 1NIJA 1QVRA 4LC0A 3DOEA 1KK0A 2W2TA 4KO8A 4DCSA 4AWXA 2IWRA 2VF7A 3DHWC 2FSIA 4RJLA 2WJIA 2YJTD 3OJWA 2RGEA 4Q7KA 4TL9A 3QFTA 1GL9B 3L8ZA 5CJ2A 2BDTA 4TMKA 5BQ5A 2J87A 3NBFA 4G1UC 1EFTA 1Q1QA 1VCOA 1P2SA 2AK2A 2Q9CA 2OV2A 2DWOA 1VMAA 1WF3A 2FPMA 3A37A 2VH5R 2ZROA 5GJCA 1CEEA 1N5IA 4WXRA 5DNYB 4TYYA 1II8A 3CNNA 3MGCA 4PHGA 3EWAA 5SZKB 4QJ4A 4W5JA 3VU9B 4GI7A 1KO4A 4C30A 2QA4B 2XNDD 4RD0A 3K09A 3NDBB 2HT1A 3MSXA 2WJYA 2JEOA 3SU8A 2VEDA 3WHKA 1DDGA 1KJZA 1ZW6A 2XB4A 1YJ9B 1QFJA 1TVCA 4GZMA 3EPKA 2PBRA 3H86A 1XTJA 2QMEA 5FUVA 2VSFA 4ZKEA 1KNQA 4IOKA 1D6JA 3SZRA 1QVFB 4OQFA 5CDFE 4GZLA 5D3QA 3RSLA 4PSAA 1Z0KA 4LDJA 5A5GA 4LRWA 2GJSA 2ZIAA 4FN5A 1XE1A 1M7BA 4V0ME 1UDWA 1OH8A 1E2FA 1X8JA 1KI1A 2G1KA 4FCWA 2ZSDA 2GF9A 2JAQA 4YLGA 1E2HA 1Z5ZA 2P2LA 1CR2A 3C14C 1NLYA 2A78A 1OXUA 1MV5A 3ZGXA 1RE0A 1J2JA 1ZUHA 3W3AA 3OW2B 3LX8A 1SHZA 5GVRA 3BE4A 5IHPA 2VLIA 4FI3C 4ZCLA 4V0OA 3CPEA 3QNUA 3TRFA 2FPLA 2Z43A 4L9WA 1NSTA 1Q21A 1YU9A 1TF5A 3NEYA 1US8B 4CEHA 3KUCA 2IYQA 1G8GA 1XFAA 1BS1A 3QF4B 4Q1FA 1FTNA 4AKGA 3NXSA 3W5UA 3VHXA 2OO7A 5FL3A 4YQFA 3I62A 2DBYA 3SHFA 1JR3A 1OKKD 3W5JA 5TVKA 3GJ4A 5FOSA 1ZCAA 2VP2A 4Q1CA 1KY3A 2O8DA 2QPTA 4TTRA 3RRNA 4YAUA 3MHPA 1W2BB 5DE3A 1ZNZA 1SXJE 1VHLA 4UNPA 3LBIA 4Q1EA 1WE2A 2QORA 1VG0B 1SXJC 5HR5A 5EP4A 3TLXA 1RPZA 4AF7A 5C4MA 4B6FA 5E7JA 3CLVA 4PAOA 4YAFA 1MRNA 4U00A 1GAQA 4LC1A 1TMKA 1DVRA 5DI9A 2G0NA 1OYYA 3KQNA 2VPPA 4S2EA 4DCVA 4BFTA 1RC8A 5CYPA 2BSAA 3QFSA 2AFHE 3M6AA 4FD2A 4NYJQ 5EE5B 1E62A 3BORA 4AG5A 2F3RA 1OFTA 4H1VA 1S1CA 2ZU0C 4DLWA 2O0HA 2AK3A 2CLCX 1GO2A 4MKFA 1RRPA 4RVCA 1OH5A 4ZDWA 1G5RA 4MKHA 5L3SB 1N6PA 3TR5A 1L2TA 3W2EA 4HLQB 3BAFA 4RCZA 1S9DA 3QEOA 4NYJR 4OQXA 1YR8A 3LO8A 3FB4A 1VCNA 2WJVA 3QVVA 3A8TA 4ZGNB 4LUCA 1FMJA 3SYKA 3U7HB 1XTSA 4PO1A 2Q0HA 3C15C 1W7AA 2ZM5A 5CLLA 3GLIE 1DS6A 3U44B 1E9SA 4DB4A 1G7SA 3WY9A 4BZQA 2ONKA 4G5SA 1XPOA 1XD2A 4MH0R 5FTLA 1RRFA 2A30A 3JQQA 3D6TB 2C78A 3DPUA 5DGXA 4C3ZA 1P3JA 5JMTA 1UF9A 2WWHA 4BLRA 4PHTA 4QNRA 4C0LA 4LK2A 4D4KA 4J0QA 3A4NA 2ZREA 5KNDA 3W8RA 5TB5A 4H9GA 1RFLA 1OHHA 5J4VA 1HTWA 2NOAA 2WWWA 1GVHA 2V4ZA 4KLZA 3R8CA 2GETA 3ZZTA 1VQPB 1Q81D 1A7JA 3K8YA 2BCJQ 1AS3A 1W49A 3CNOA 3CPJB 2EU8A 4MGZR 1P4SA 2NTYC 4QBIA 1NI3A 2QROA 3PENA 3KUDA 3EPJA 1KMQA 4BFSA 1E2JA 2YV5A 1N6RA 2BKEA 5KSOA 1ZUIA 3OEEA 1XJ0A 1G291 4URVR 2RGNA 4LJ7A 3VHLB 3K70D 2MMGA 1QFZA 3MRSA 1J9ZA 4KAXA 1GITA 3A36A 1OGJA 1XTQA 3SJCA 5JCZA 1BMFA 3CZPA 4NCHA 4DLVA 1XTIA 2ZRAA 4DIDA 2LKDA 1N25A 2H92A 1W0KD 3F0TA 3PUWA 4A0FA 1OH7A 3PEVA 3BH6A 3U4QA 4ZIRA 3K9NA 1XMIA 2H5EA 3LVRE 2PIAA 3U3OA 4WQMA 3KX2A 2WSSD 4JL8A 1MRSA 4B3FX 4B43A 1GG2A 1QFYA 1JQLB 2GNOA 1TNDA 4HE5A 2VP0A 1UKVY 1SVWA 1HE1C 1YRBA 2MSCB 2C99A 3OE7A 4NKRA 4RFVA 1AQUA 3B2EA 4TLAA 3KQHA 3FTQA 1E4VA 4IHQA 3GQBA 4WZ6A 1JECA 4PPNA 4QC2A 4ZO4A 2ZRIA 4YDHB 2CL7X 2JATA 2HMAA 2ZJZA 3A1UA 2XNJA 3B9QA 1CJMA 3DM5A 4ILEA 1VQ6B 5F98A 1JJ7A 4R71A 4Y9UA 2OILA 1AGPA 3CPWB 5BN5A 2AXPA 3QENA 4DJTA 1FDRA 2QPAA 1VQOB 3OZXA 3CBQA 5FI1B 4G1BA 4E03A 3GPLA 2HYIC 1G9XA 3QKSB 4WAUA 4ESVA 1IHUA 3OZVA 1ZUNB 1NJID 2DFLA 2O8CB 4YMSA 4PX9A 2JA1A 3LW8A 4OQNA 4B48A 2JJ2D 4B75A 3BH7A 3MD0A 1IBRA 1G6HA 1KD1D 1JI0A 1TEVA 3T34A 1FP7A 2C9OA 1B23P 1RW4A 1WP9A 5C46F 3ZD6A 3KDSE 1VTKA 4TMZA 1TQ4A 3QE2A 1G3RA 2Q3FA 2QSYA 3FOZA 4Q1DA 1OIXA 2WKRA 2HJGA 2ZI9A 3S1AA 4TZ6A 5C1BA 1X3SA 2IUSA 1VQ5B 2GRJA 5JFGA 2XXAA 5FL7D 3QBVA 4BFVA 4B2PA 1ZM3A 4MKIA 3AF3A 1LFDB 3P27A 4EDHA 1OLOA 1V43A 2ZE5A 4MDFA 1LB1B 1J90A 4ZI2A 1FL9A 1OE0A 2GAOA 2OCBA 3HYTA 3MFYA 4OHXA 4B3XA 4LJ9A 5P21A 4IXNA 1Z6AA 2ODWA 3B5JA 2GCOB 1W87A 3E5HA 1GNQA 3X1DA 3VNVA 2XGJA 4FMDF 4TT3D 2QRZA 4AD8A 1MR3F 4RCYA 1IONA 2EW1A 2QT1A 3GEHA 4FW9A 3AGPA 4JYBA 2IS6A 3NEJA 2BBWA 4D6PA 2QTLA 2J0SA 4A8JB 5GV8A 1XEWY 1VG1A 4KHZA 4RZXA 1G5PA 3L43A 3OHMA 4XVUA 4DB2A 1QUEA 1N6HA 3VFDA 4B74A 1KI6B 2KE5A 4GNKA 3EWSA 4HE6A 2O8FA 4L5BA 1U2RA 5AJVB 4G3XA 3NWJA 2IUTA 5EXXA 1VIAA 1DAFA 3Q8XB 1T3LA 4OK3A 1EFHA 3LLMA 4O3MA 5C4GB 3TVDA 3DZDA 3SE0A 2WAXA 2J7PD 1K8AD 1NF3A 5DN6D 1W36D 4B3BA 2R62A 4XTRA 4YMUA 3DVLA 4TMXA 4LSGA 1NN1A 2F3TA 3B9PA 2W6JA 4HLUC 1E0SA 4TWZA 5KYKA 2BGIA 2FFAA 1N6NA 5FOVA 2A5GA 1ZM9A 5UKDA 3ZBTA 2EWVA 4BQSA 1SQ5A 1VQ4B 4DCNA 2SHKA 1IOZA 2OTJB 2VHQA 4MGIR 1A2BA 2IHYA 4B6EA 1W4RA 1K5GA 3AB3A 2XNDA 3I73A 2VHJA 1FZQA 4E22A 2ZUBA 2XB2A 2AR7A 3B60A 6Q21A 4HZIA 1G7CA 1E2NA 2ZR9A 3HJNA 1YHNA 1E2DA 4QHSA 4A1FA 4AYXA 1P62B 5JWRA 4C43A 1SXJD 3EX7C 5C2JB 2GXQA 3EZ2A 1VPLA 2IYVA 3P1JA 2WJJA 3R9IA 3WMFA 4DDWA 5FTKA 2YC4C 4ZDKA 1O87A 4KVAA 3TUJC 2BHRA 3KTAA 3GJ5A 3AVUA 4BLPA 2XEXA 3UANA 2BC9A 2GTPA 2AWNA 3HPRA 5JZVA 3KKQA 1EK0A 3I55B 3PIRA 2GPJA 3TQFA 1BYIA 3FVQA 1FNNA 2G1JA 2I4IA 2ORWA 2GXAA 5AK0A 2OHFA 3RS5A 3AVWA 1XXHA 2BWJA 5JEEA 4EJSA 2Q3MA 5DH9A 1G4UR 4YONB 1S72B 1UBCA 621PA 4DXAA 2CVHA 2Q9BA 4TSFD 3GJ3A 4XSGA 3AF4A 4C0HA 4N3GA 3THOA 4TYWA 3D31A 4OI1A 2FN4A 4Q7MB 4P0TA 4EPTA 1OXSC 1NVVR 1SVKA 2CMKA 3GJ6A 3KXKA 4PPFA 5EZ5A 2WIAA 2QGNA 4NTZA 1NDHA 4URYR 3E1YE 3W90A 5FBVB 4HDCA 2DERA 2XTZA 4KODA 5DIFA 3UWKA 5JWHA 3SQWA 2NZ8A 1R0ZA 1QBKC 3SN6A 1N6IA 5DN6A 3BRWD 5FPKA 3AVYA 3ADKA 3A1TA 1VG8A 4N3NA 5G3ZA 1CNFA 1AQYA 1U0LA 5H59A 1A5TA 3CM0A 4KYIB 1GR1A 4L15A 2PCLA 3Q72A 5L3QA 2H7VA 4A2WA 1YVDA 1JJVA 3UPUA 3CUEF 1NMXA 1EESA 1U0JA 5GJVC 2V55B 4ZPXA 2QP4A 4QJ3A 2DR3A 4ON9A 1Z0AA 1ZIOA 5HXBA 2QRNA 5AJWA 4ABYA 1XZPA 4LX0A 4CEIA 4CEJA 2QZ4A 4JVLA 4KJZA 4Q48A 2HYDA 5FPYA 2OCPA 2BM1A 3DDCA 4KV9A 5AR1A 3QBTA 1DOAA 1EFRD 5KNCA 2OZEA 3VMFA 4Q7JB 4LJYA 1F2UB 4UNSA 4US2R 4K8OA 3AVOA 4BEJA 1NVWQ 3CX8A 3L82B 5H68A 1Y63A 1KQSB 1UBEA 1VIYA 4G0NA 3H0KA 1ZNXA 3PVSA 1FTSA 1W44A 2GWHA 3AVTA 1NVXQ 2J0UA 1U9IA 2QAJA 3AV0B 3B1ZA 2IYZA 4G01B 4TLEA 4TL6A 5BWMA 2PX0A 4IFBA 4JVNA 4EH1A 2WAYA 2I3BA 2G6BA 4TLCA 5FI0B 2R6HA 5EUQB 3WXMA 5F3WB 3OFND 4I1SA 1E32A 2CJWA 1N3BA 3N2IA 1OFUX 2J5XA 1G41A 3I5XA 3KJHA 1S2MA 5H70A 1G5TA 1FNMA 1YZLA 5TDHA 5JI3E 5JLJA 1XCGB 5B64A 3GJXC 2XZPA 4A0GA 3GCGA 4R2HA 1CF4A 4PZYA 4UXJA 3N2EA 4X8HA 2IC5A 2X2FA 5CB8A 1KTVA 1PJRA 1DDIA 1E63A 2DYKA 2FZLA 3CCRB 4F93B 2BGJA 5FTJA 2DWPA 5TY0A 2ZE8A 4V0LA 2ZUCA 3QKRB 1K9MD 3B13B 1K6MA 3QPWA 1G3UA 1SVMA 1W0KA 3IIMA 3FFAA 4Z8XA 2Z6VA 2MSEB 1NBME 1GILA 3NC0C 3F8TA 4OK5A 4ZKDA 2X2EA 1Q57A 2F43A 2IS4A 1U0HC 1Q86D 1R0WA 1W34A 2GHIA 1XZQA 2WSSA 4YMWA 2Q6TA 2Q3HA 1VYVA 2ORVA 4QXAA 3I3SR 4BLQA 1E2GA 4NYIR 5AN9A 3JQRA 3E70C 2JJ8A 1C9KA 2CE2X 3HR8A 5EE0A 1VQ8B 3LW7A 4ZI3A 1AIPA 2ZE7A 4TLBA 1Z2AA 4HUQB 2GXUA 2F1HA 1II0A 4FMDB 3C16C 4LBYA 1DO2A 2FFQA 4DWJA 2BV3A 1XJCA 3BFKA 1FX0A 3G5UA 2ZRLA 5TR9A 1KGDA 3WNCA 2FZ4A 1E0JA 1XDBA 2AXNA 3P4XA 1GL7A 2V1XA 2YOHA 1KSHA 4NDZA 3JZAA 3TQCA 5JRZA 4OYHA 3TAHA 5CLQA 3K53A 4AKEA 3G82C 1FNBA 5FPHA 3W3ZB 2WJHA 2RGAA 2YNMA 1G16A 1SGWA 2ZEJA 2JJ2A 3VR5A 4ASUD 4ARZA 5D3MA 2P65A 4HZUB 1UMKA 2KI5A 3CF6R 4AK9A 3O8RA 1R8QA 2QPOA 3VR3A 4UQOA 1T8TA 2PH1A 3HU3A 3NH9A 3CMEB 4A8JC 3JZMA 2FGJA 1AMOA 1L4YA 1PUIA 4U5XA 3AKEA 4MUBA 1E96A 3PUZA 2ZI5A 4PQFA 3ZVRA 4MKGA 2PCJA 2F6RA 4PXAA 1YZNA 1DAHA 5KUTA 1HQCA 4FXPA 3ADCA 2VF8A 4M4SA 4JSTA 2WWYA 5FL7A 2J0QA 2CBZA 1I4LD 2BEKA 2R2AA 5CIQA 5KTYA 3LQQA 3EW9A 3Q5DA 4DLTA 2OAP1 1L4UA 2XJ9A 3DKVA 3KJGA 3WYGA 4LCBA 4HEJA 4P4SA 1UDXA 2P5SA 4HLDA 1CS4C 3QKTA 4KSBA 4TT3A 4Q1AA 4Q9LA 5EP1A 1F20A 2QM8A 1JBKA 3FPAA 2JLSA 3PQCA 1A2KC 1KKLA 5THXA 2JIZD 5CDFA 1CBUA 2R6FA 1SKYB 2G3YA 2HUPA 2ECKA 4XH9B 4C0AC 1P2VA 3OIWA 2W0SA 2D3WA 3CC7B 1LVGA 4V0MA 1WDTA 4A0RA 1FUUA 3IO5A 3ND8A 2BMFA 3REGA 3CXCB 3IDQA 2GXSA 3LQRA 2W0MA 3OZWA 2NQ2C 4C0KA 3NIBA 2Y8EA 5JRJA 3Q3JB 4AI6A 2GF0A 4O2LA 4A6XA 1XU4A 3VX3A 4M53A 4M1YA 5G41A 3AGQA 1DAGA 2QDXA 4H1UA 2VBCA 2WOOA 4NCJA 4BRWA 2IF2A 1NG9A 4MRSA 1YZTA 1S0UA 4UXHA 1FUKA 3SHWA 4PAQA 1KDPA 4ACBA 1GJRA 2D7CA 4CT4B 1G8PA 3TIFA 3AUXA 4UNQA 1PVOA 4AYTA 2OFWA 5CK4A 4JLOA 2W6JD 2J46A 1D2NA 2YVUA 2FX3A 2UKDA 1J8YF 3GLFE 3C8UA 2CE7A 5E95A 3SI7A 3X2SA 1H42A 2X3UA 1TPZA 3D8BA 3C5CA 4I4LA 4D4LA 1TF2A 4EQ6B 3TNFA 4PPGA 3TJZA 1QF9A 1ZP6A 1ZYUA 2FSFA 3U7EB 2PJRA 1R0XA 4EAQA 2YWEA 3PXGA 3LNCA 4IOMA 1Z8FA 1LS6A 2OTLB 1SXJA 4TL7A 1II9A 3TH5A 3PUYA 1G64A 2NPIA 1R8SA 1IAQA 1GUAA 1A4RA 1QX4A 2BMJA 3W2IA 1L7VC 1MO6A 2VIIA 5FUXA 3K1JA 1ZNYA 4DBLC 1PZNA 1G21E 2MSDB 5JS8A 5E7MA 3THYB 3CR8A 4PO8A 4DSOA 3SBEA 2R6DA 2C2HA 3GMTA 1KC8D 1JXMA 1P60A 4KCGA 1MO5A 3CCVB 4ZCMA 1Z83A 4DLYA 3RC8A 2FNAA 2AKAB 3BOSA 1Q12A 1IM2A 4AG6A 4IEIA 4JLKA 4LHWA 2O8EA 1G20E 5B2ZA 3D7MA 3W5IA 2QAGC 2CRVA 1CRQA 1H65A 2YZ2A 4Q4JA 2VSXA 1NKTA 3NH6A 3NTUA 5G40A 2OLJA 5EUMA 4L16A 3X1YA 4TSFA 1WB9A 1VDZA 1EP2B 3HU2A 1QHXA 1I4DD 4YMTA 3LAWA 2K5UA 1IY2A 2C8VA 4LI0A 2QBYA 1DEKA 3NKVA 3UXMA 5SZJA 1XTKA 5LB2A 1RKBA 3CCLB 2VHTA 1OXVA 2Q9AA 1MT0A 4I1VA 2N42A 4Q1BA 1YKSA 3W2GA 4DLZA 5J5CA 1T5LA 4XOIA 3NVAA 4OI0A 3IPXA 2XITA 2IXFA 1Q44A 3GLIA 4YXWD 1E4YA 4PSVA 2GKSA 1W1WA 1KZ7B 3WNBA 4G5GA 2ZRKA 4BE7B 1EG7A 1GAJA 1Z47A 5EXSA 4YAOA 1F2TA 4KFTA 5AJXA 3RRMA 1X1SA 2LWIA 2HV8A 2ZXUA 3CRZA 2QE7D 2D06A 2I1QA 4B44A 3ZZ0A 1HY3A 4NPHA 4ZDJA 2AFIE
chains in the Genus database with same CATH superfamily
1IVNA 3K9FC 4FMBB 3N3AC 4XPZA 2WWIA 2DR2A 4XX1A 2O3TA 2PRYA 3HR7A 3VOSA 4K7JA 2BFCA 1D9ZA 3RE1A 3F5DA 3RYTC 9GPBA 5JC8A 4N47A 2X1LA 5TS3A 4D43A 3G8CA 1XU7A 4I7EA 5COBA 5KCMA 3I37X 1QHHA 5DXFA 1IFXA 2FR8C 3EK2A 1MJHA 3OZSA 3I4LA 1RAFA 4GKBA 4YC7A 1KEEB 1NJ6A 4J6EA 4QTYA 5EHZA 1QYVA 4Y2SA 4AY5A 4GPTA 3PX2A 5AESA 5ER6A 4WWVA 4G84A 3THWA 2DZDA 3F7OA 1H0RA 1VXRA 3RROA 1X7ZA 2BFAA 3U4IA 3F6PA 3H5OA 1QHEA 2ZKLA 3ADOA 4CL3A 1NQXA 1Q1NA 3VX4A 3Q3GE 2XGMA 1IXKA 4BZZA 4DA9A 3R7BA 3GPIA 5K3SA 1E5LA 5FFFA 5EJ7A 1WDMA 2IXBA 1E2PA 2VBUA 4X45A 1NBMD 2A2ZA 2FX5A 1U7DA 2BTQA 2IZZA 4GBGA 4LV6A 3RC2A 1X8XA 2IBMA 4I9FA 5CFPA 1CY2A 3FB1A 1JJ2B 1HA3A 3B3QA 1ESZA 4MUAA 4P92A 1XZJA 4MMYB 4Y6QA 3ICWA 4LAFA 4G1FA 3EZLA 2EQAA 1KEWA 1ZGZA 2A1TR 3V97A 1P31A 2EEPA 3AVQA 3HFRA 3LV8A 4OHVA 3WYBA 1J0DA 1N2BA 5DTQA 4X92A 3OFNA 2PE3A 2V65A 2XWPA 1RXSA 5K6AC 1X77A 1IHMA 2QL6A 3OZBA 1JFSA 1E4EB 2C9YA 3G02A 5AJUA 4KPFC 3K0BA 5KU7A 4XTCS 2WE7A 5ADVA 1XQXA 4ZVLA 2GK3A 5B4VA 4Q18A 5J1TB 4RESA 4Z0TA 4RGYA 1AXEA 4CMIA 4CUZA 5IJWA 3V4LA 2BGWA 2LIPA 3KZNA 3LLSA 4GSYA 4EF5A 4F56A 1KMHA 4IZHA 1YS9A 1D4ZA 4OJQA 2C9DA 3K4HA 1MXHA 4JSRA 2GSWA 3QVSA 2DCUA 4ZHSA 1JSCA 2EKPA 1DCMA 2H08A 3X1KA 4A10A 2AEFA 2RHLA 1BHQ1 3HCCA 4Q3BA 2DWUA 1RWVA 1YDFA 2XZLA 4F5ZA 2RAFA 2ERCA 3AW9A 3OZDA 3QVUA 1PTJC 2IX9A 1HOXA 5DNDA 5DWVA 1Q7GA 4RLFA 3DE5X 3GJQA 2A9QA 2Y1DA 3GD7A 5DCWA 3MTGA 4J1NA 3QPUA 3OLYA 1UBNA 2B30A 2G9NA 4Q3OA 4XW2A 1XZBA 2GYYA 3RYIB 3C85A 2DFTA 4M8IA 3ZE2B 2PUJA 5IVIA 3GVHA 1QGZA 3ZDAA 1SKMA 4LJLA 2MYUA 2PL1A 4AJ1A 1U1DA 4XB1A 1WTCA 1XROA 2C96A 4HB3A 4JHLA 4EL0A 2RD2A 1PQWA 1UZMA 1O6GA 3NTQA 4NK4A 4BNFA 4AKHA 2MYTA 3PGVA 3T1NA 1EFUA 2H63A 3FYUA 1E1YA 3PNOA 2XUIA 2YMPA 4JBWA 3KHKA 4C08A 2RGUA 3VSCA 3FDXA 1D1QA 1MOQA 4PLWA 1B93A 3S40A 2MR5A 2VP6A 5EWJB 5FWDA 3B51X 1XPRA 1P7ZA 3HN2A 3ECCA 2GERA 1ISGA 4HGRA 3TW6A 1PWYE 5JATA 3RB8A 3LXMA 4EYKA 3CLKA 4QG7A 4EBBA 1V7QA 1H1DA 1J6UA 1XZAA 2R65A 1MJ5A 1ICIA 3KQUA 4HIZA 2HK6A 1Y9EA 3AFIA 4FZ5A 1G2OA 4HQRA 3UWDA 4UHDA 1TUIA 3EUFA 3MTBA 5FBZA 5IX8A 4Z4EA 2XLBA 2Z4SA 3O3MB 3R0JA 1LQ2A 4XDYA 4ASUA 1TZMA 3ENZA 4D4JA 3BAZA 3G0DA 2GJKA 3PC8A 5HZKA 1NXXA 2QX9A 2V5AA 5HQ3B 2QT0A 2VBFA 2XIJA 5LC1A 2HUNA 3UT5A 2LW7A 1XMVA 1LXCA 1SKYE 1V8DA 3JQ9C 3SFZA 4D2IA 2NADA 1RMTA 1Z2DA 2AWOA 4HAYA 2PZGA 2GQFA 1XN4A 2W11A 3EZFA 3ZS9A 1K68A 3WFJA 3VR5D 1FFSA 2FOIA 4TN1A 2X5KO 4AZ3B 5AUPB 2DKFA 1BIFA 5TXGA 3PHGA 4AWAA 1EQ2A 4DT1B 3QW4B 4EJMA 2JD0A 3KV1A 5A9SB 1YHQB 5J2UA 1PIWA 2P2SA 3PQ2A 5F33A 3V4VB 2X8AA 5FXMA 3VR0A 4OGWA 3O83A 5GAJA 1DIOB 5B1HA 3UBMA 2CLOB 5JNLA 3F3KA 3WLAA 4E2ZA 1OXTA 1NWHA 4EK9A 3OX3A 4EG8A 4Y2YA 4KDCA 4F9FA 2JKYA 2R751 3R9XB 3CZMA 4XVHA 2HTEA 3ZHQA 4ND2A 1KZ4A 1L7XA 3QY9A 4MARA 1FDOA 1IXZA 1W52X 2CDBA 3HZRA 4HWKA 4Q4AB 3ZIAD 5KYUA 3NGLA 1U99A 3CC4B 1U3WA 2BEJA 2GN4A 2PT5A 2JIZA 2ZT7A 4DAOA 5IFKA 3N75A 2WD9A 4FBMA 1ENYA 3NP9A 1Z39A 4L07A 4AICA 2GX6A 4NONA 1P0MA 1WB6A 1EFVB 5HKKD 5IJXA 1MAWA 2M2IA 2UZAA 3VTFA 4KW7A 5AKYA 3UGQA 2V3CC 5AW6A 5B2FA 2VHUA 5JRDS 3K6SB 1QWSA 3OF5A 5DHRA 3UWSA 5AW8A 3PFWO 2CXQA 3WMWA 3UKDA 1YS7A 2ENWA 1MX5A 4FHGA 2EIHA 3E82A 1EVEA 2OR3A 3FYSA 2BMAA 1J1IA 1DAPA 1MAAA 1TW2A 2GVDC 2QY9A 2VRCD 3D43A 3GEPA 3NRJA 3FTNA 5AM5A 4EB0A 1K92A 1LFAA 1P77A 2Z04A 3EZGA 2QIOA 3JVVA 3ROMA 4PU0A 2AKYA 2FJUA 1NQVA 3E3MA 3E5NA 3SICE 1URPA 1PD1A 3PC2A 1ZM2A 2BGTA 2Q2NA 3WP0A 4Z9BA 4DC1A 1YASA 4GPEA 3RFCA 1U0BB 3HLYA 4B33A 3EF3A 3L8FA 4J2OA 5KOHB 3HBFA 3O90A 1P7VA 4NZZA 3A70A 5B53A 1Q7YD 1XD9A 1WXHA 1YJ5A 1ODFA 4FEYA 2ERXA 3ONNA 4RQUA 4ALIA 2VBSA 2IYOA 4L7VA 4F5EA 1SELA 2B7CA 1IZ7A 3PTZA 4O25A 1V95A 3II6X 3GEIA 3PGLA 4QTXA 5EG5A 4DR5B 3MPOA 4RE6A 4RZ3A 1D5CA 2GJRA 1DJPA 3R5TA 3JZFA 4LJAA 1ADBA 3WNVA 5BP7A 5DM1A 3A9TA 2GUWA 2XKJE 3RHFA 1KEUA 5L3SA 2SKDA 3RVBA 2HMSA 3L41A 1ETHA 4MYCA 3AONB 2XD4A 5ESRA 1Z5VA 2H65A 4KUEA 5E7IA 1LX7A 1TAUA 1QG2A 2O1EA 3ZZUA 3DE4X 2WVJA 2GZAA 5T5QA 3UFBA 4E31A 4A15A 5GMOA 4R2IA 4LV5B 2YWFA 1IJEA 4Q4HB 1AM4D 1S4QA 5TEVA 4BNDA 4C7KA 1T3SA 3N74A 1A9OA 5DP2A 3VR1A 4YAJA 3O26A 3W34A 2O9JA 5CK5A 3EVBA 1NP7A 3LRTA 4IL5A 1V4BA 1YAHA 1V5VA 2EP8A 4PZ9A 4YRTA 3ZWVA 1QV9A 1EJ0A 3CUYA 1BQ4A 4GUDA 1VLLA 2QLLA 2EAUA 1HT2E 1YQTA 2Q1UA 1HE8B 2F64A 2B6NA 1MV8A 2WLSA 3F46A 3IBTA 4PGMA 4MPDA 5B1SA 3MJTA 1VYHA 1KHTA 4ZDIA 4XL9A 1AF4A 1IEXA 2X86A 2JASA 2G83A 1JYSA 1H8ED 4MS3A 1R8JA 2VT3A 3CFYA 3K5IA 4TROA 5IDXA 5A7FA 1GAEO 3R7WA 3RUIA 2VCYA 3BIJA 1NVVQ 2W2KB 5G53C 4DDVA 1N2CB 4G81A 4RSRA 3TTYA 1Q0ZA 3L7OA 1GUZA 1T6NA 2YFYA 2NUPB 4E7OA 2W6ID 4LG1A 5JDIA 3OJXA 1OF1A 2IZ0A 2K2QB 3BX1A 3QE0A 4S0ZA 1XQWA 1EFAA 3FRJA 1CJTC 1Y3AA 3KXLA 1E2KA 3ZQUA 3IT2A 3USES 1GA4A 2QY6A 4N8SA 1N7HA 4YXWA 5BSYA 3IPAA 1O5TA 1XZIA 3O8OB 4KVGA 5IPFA 4XLLA 4Z86A 2CY0A 4YHBA 4C2UA 3EISA 4IXTA 4QTTB 4TVBA 1TVMA 3G85A 3QF7A 1WV0A 1I7SB 1JDVA 1KVUA 1UPUA 4ONEA 4EHLA 1EEHA 3CX6A 4INPA 3M5WA 1X1RA 3DEIA 3UAWA 1DHRA 5FOUA 2X0NA 4HFRA 1XEXA 1P2FA 3GUUA 3ZEAA 3BGSA 7REQA 1FS5A 4D0NA 3D6UA 4N65A 3MTQA 4DV6B 1E6CA 2IXEA 1H6DA 2H1HA 2PGNA 3RR2A 1IEWA 1QOQB 1DFGA 5FTWA 3ERCA 2A5YB 1OWNA 1TYAE 3GOQA 3A4TA 4I4CA 4U1RA 3VR2D 2QAGB 4UUQA 1PZMA 2Z2ZA 2KQUA 3I1FA 4HAUA 1DT5A 3W04A 4YQZA 2P5TB 3OQ6A 5AXBA 4AZ3A 2ONYA 5U1PA 4D56A 6GPBA 1E3MA 2JRLA 3OTWA 5H16A 4A8PA 2PL5A 3DAOA 4MQMA 1XDWA 1G5FA 2AB0A 2CLIB 4LBWA 2ODBA 2SKCA 4OQEA 1ABFA 3CD6B 1A9PA 1X1EA 5LLSA 3S1AB 4GVPA 4GDFA 4CGZA 5JTTA 3S6JA 2V7TA 1C3VA 3HABA 2ZI6A 2A59A 2FMIA 2HSGA 3Q3EA 5GZ1A 4RS4A 2BDEA 4H7JA 4IWYA 5CFQA 4IRXA 3WBJA 2H9IA 1E6LA 1FSSA 2DOGA 4JMQA 1MJGM 3OM1A 4QU9A 5D2CA 4HFJA 5LBUA 3HB0A 2OEPA 3G2QA 4OQLA 4DA4A 1NBMA 3Q8MA 2C0QA 3FY4A 3QKSA 4AZWA 4A6EA 4AF8A 4F4IA 1XQYA 5SYMA 3UYKA 1IULA 1IZ0A 2C42A 2GHRA 1ZBDA 4AW9A 4QULA 4RLHA 3TAUA 4Q4LA 3DFIA 4Q24A 3KSRA 5J5VA 3SOPA 4FUQA 3CR7A 4WXEA 3IPLA 1J23A 1NJ1A 5JU6A 1NA5A 1IZ8A 3N2GA 1Z3IX 1PUXA 1QRDA 2GEKA 2VWHA 4F5DA 4DM4A 3CH6A 1ND5A 4UVEA 2XKKA 3MUNA 1KVQA 1Y8AA 1IRXA 3NRCA 2Y6UA 4O4JF 4R1SA 5FV4A 3BC9A 1NLFA 5F73A 3HA7A 4TXNA 3A2LA 2B6HA 1XCLA 4PC1A 2WHRA 3PRHA 2HSDA 4E6PA 1HE4A 2OQVA 1SCQA 1G18A 4LQDA 3M82A 5AI8A 1UM9A 5JROA 5ITSA 2F17A 4PTYA 5F2NA 4I36A 1E79D 4RVOA 4WNYA 3Q9LA 4P3XA 3M3DA 2GCOA 1LEHA 1L9XA 2VWQA 3DMDA 4IF4A 4BFCA 5FYQA 2L18A 4D99A 4NXMB 4M1SA 2EZTA 4UOEA 2PUFA 1UMCA 1J56A 2H07A 1E9EA 1FUIA 1GKYA 1HFKA 1IE3A 2WVAA 3KOZA 1M0TA 4IG9A 4BU1A 3AVPA 2HHJA 4FJ0A 4ZZ1A 3RSZA 1AUOA 1M1NA 4UXIA 1JGTA 1G3MA 1U90A 1U9YA 3AFMA 2GDZA 1GZ6A 3BXGA 3WLLA 1YJWB 2WP0A 4LNAA 2C54A 2C95A 4M9RA 1M6VB 1TXGA 2D8MA 2EJBA 3DMPA 4P31A 1SD1A 3MOSA 2AXQA 5DSTA 3ZXUB 1LBTA 1JU3A 4V3BA 4AS1A 2ZRJA 5KKAA 3IDOA 5JDCA 5LKAA 2B8JA 1YVPA 4K9NA 1AB5A 1VE3A 3A1EA 4HGQA 4MSUA 4ZCPA 2EDCA 3ZJVA 1A2QA 4Z0PA 1G3QA 1ZK2A 1UR5A 3DAGA 1LA2A 1XDUA 3ABSB 3TRDA 4CEHB 1R6TA 3H5LA 5J47A 3O75A 4ZFNA 4MWSA 4DRXB 3DCJA 3TJMA 4AO6A 3VHXB 1N5JA 1TJPB 3C4QA 5A9TA 1GZVA 1A5AB 1MO4A 2J67A 2XA2A 4IJVA 5KYWA 2P2ZA 1GPDG 4DPKA 1UPCA 1UOOA 3QVOA 2E4VA 2JIOA 1Z5GA 2XA9A 3EVEA 4HQ6A 3FHOA 1OIVA 2IEZA 3L1VA 4RHEA 4TTPA 4X71A 3TSWA 4U7DA 1XD8A 1O97C 4DNXA 1N4DA 3ANYB 3O8BA 3REQB 5DGHA 5CYFA 1MBZA 4RL4A 5ILGA 1VB3A 1NTRA 5A0FA 1SCJA 1JPJA 2CLFB 1TEZA 3FKQA 4JC4A 2FUKA 3CNBA 1E6UA 1QTRA 3EEIA 3OPYI 3QYFA 4L0CA 2C77A 2AOWA 1V2GA 3FNHA 1G0NA 4F5WA 1NW6A 3AR3A 2HU7A 3M3PA 2W93A 3VPCA 5K8IA 4YCBA 1R4AA 1F8FA 1L3IA 1J7JA 4GMGA 1MT3A 4LF6B 3VQTA 2P3SA 2YH2A 1YDMA 1Q7TA 3HRKA 5ALIA 1QIEA 1SBIA 3PG5A 3ZGLA 4I19A 5EKUA 2F00A 1C8VB 2A8YA 3DHEA 3INYA 4HQFA 4IDOA 4I50F 5LSAA 3QFHA 1XLTA 2JH3A 1E5DA 1MX1A 2R5FA 3QX9A 2QL9A 1EVQA 3EFEA 1SU7A 3GLUA 3LBHA 3QIVA 3CG4A 1FRFS 4IVQA 4L3VA 4LDNA 4WTOA 4MKXA 3DV0A 4JKIA 4B3RB 1TECE 4U6QA 3CO5A 4UJ5A 4Z99A 5ALMA 3RTCA 5CNMA 4CNBA 2ZVJA 2P9JA 5H9VA 2QTHA 1VKHA 4HDAA 2VTBA 4EPVA 1RD4A 2Y6VA 2E3JA 3FWKA 4US1R 4ZAZA 1W5TA 4G8DA 3ZIAA 1E1QD 2R8RA 2QQ5A 2ZDQA 1B6TA 2BSXA 2ZUUA 1IN7A 1ZD1A 4GOND 3CRRA 2WFMA 4DLUA 1DKNA 3ANTA 2E1PA 4HSEA 3NPMA 5I9LA 4YWHA 3WHLA 2XOEA 2BCGY 3E48A 1TUEA 1UC9A 1V5GA 1VL5A 1QCCA 4Y9DA 1LLDA 3GJZA 2P2GA 5G0UA 3WK9A 3CNLA 1VDMA 1PL0A 4NECA 2UUOA 2ZJFA 1BJKA 3WRVA 4BLOA 1Y6GA 5EJ9A 2HCRA 4JB2A 4MQLA 1D1NA 1CXZA 3LRPA 1NR1A 1M2VA 1Z38A 1PKVA 2VRCA 2VPYA 2QRVA 2WDZA 1J0EA 3OCWA 3S5UA 1AA6A 1PT6A 4R1QA 1CF9A 5D85A 5JBNA 4K81B 1M6HA 4NFLA 1QM5A 2B35A 4YCAA 3I72A 5AW4A 3VVLA 1MD9A 1DAMA 3GNSA 3WYNA 2VLBA 3RKUA 3L7NA 1EXNA 4OBBA 3IQIX 1KBZA 8ATCA 4U2EA 1E9CA 3VTAA 4RVGA 3EG5A 5M29A 2XE4A 2CLSA 1FXWF 1NPDA 1RPAA 3LZ6A 1M83A 1VJTA 1NQOA 3ZUGA 2J1LA 2GM5A 2XKBA 3IDAA 3VZQA 3K20A 3QMWA 3I28A 2ZWVA 1GDDA 3QVMA 4E1BA 3PTAA 1CIPA 2FEAA 3ZK9A 3IULA 5HS6A 3KEWA 4WRRA 1SZDA 1W4AA 2A4MA 1WS6A 2Q3BA 3PJEA 4JFAA 4JL6A 4P25A 4D9FA 5F9FA 1QWOA 5AUQA 1SUIA 3OQOA 4A91A 3EOBI 3ON5A 4YUZA 5IKMA 2JGMA 4I99A 1VHTA 1TIBA 3NHYA 1CQXA 2FFBA 3OESA 3EFBA 1BVYF 5HILA 3EYAA 5JSUA 3KOXA 4PSDA 3NDPA 3NYWA 1E2QA 3NHBA 3QOFA 4R1PA 4RVUA 2P7IA 1WDKA 4MWBA 1ZOSA 3G89A 5C5CA 2I4RA 2R6GA 2NNWB 4Q34A 1E18A 5HF8A 2HJSA 1JU9A 3RT7A 3H8WA 1FFGA 4RY2A 2Z09A 4M54A 3KHSA 2XCSB 2XVYA 2IKSA 3RQSA 1R5JA 1U8CB 4MAAA 2EBUA 1HETA 2R87A 3W6PA 4M9SA 1V26A 4NE2A 4KLNA 3GJRA 4CFZA 1W48A 4UUNA 1NY6A 2QP9X 1IMJA 3GEGA 3MT9A 5IABA 4WNCA 2WT9A 4ZO9A 1OUMA 1PS0A 2F3QA 4H0CA 2ID9A 2QU8A 4KXUA 4P81A 4XIIA 1H8EA 3GFOA 3P5SA 3N28A 1WP6A 4CIWA 1B4DA 4QX6A 2H85A 3GT4A 1FFWA 1IN5A 1R8YA 4HO1X 3EXFB 5I6DA 3R09A 3LUFA 2QI9F 5B4TA 1LPNA 2ZPAA 1KSFX 3EA4A 3NT5A 5H3HA 5CA0F 7ABPA 4ZOLA 4JLNA 2XYHA 4D4MA 4GSKA 2I99A 5BN5B 4D74A 2W6IA 1PX2A 1ZFNA 1LDGA 2OCGA 2RHJA 2Z5GA 2ZWPA 2DPMA 2ILVA 2FWRA 1C80A 3ABRB 1DBSA 3CJTA 4QELA 1WSVA 4RKFA 3IP7A 2W6PA 4ENUA 4LVUA 3UAZA 2EERA 5JECA 2UYGA 1X1TA 3N07A 1PAUA 1H2WA 1YXMA 4K3VA 2CMDA 4PRKA 4B2IA 1TEXA 4OFWA 4Z7QB 2FA9A 2LNDA 4NH4A 3T0FA 4HMQA 3HUDA 2CD9A 2GZ3A 3RIMA 2OYCA 4TT8A 1ZWLA 2W2MA 3RSFA 1P19A 1WPGA 1OY1A 3JZDA 3PUVA 3FCSB 3M4YA 1UPTA 3PNMA 4QBKA 3EMVA 3UYLA 3A1WA 3NM5A 5B57C 2ZM6B 1A5ZA 4BPRA 1EGQA 1Q0UA 2RI6A 3E9ZA 3HEMA 3O8LA 4NFYA 4WLUA 2X5XA 3WA6A 8OHMA 4O4JB 1E2LA 4YR9A 1RCUA 5E2IA 3VOAA 1XXLA 2DX7A 3VR2A 2VAWA 1ULUA 3P9QA 1ISSA 2R7NA 5LFAA 2BFDA 2I6TA 4A27A 5JHGB 4RTNA 3EIQA 5J3JA 2A0WA 1P7CA 3R2JA 4LZPA 1E8NA 1N5LA 3GFPA 1H1TA 4OHZA 1QQBA 2GASA 4GIBA 4HX5A 4KQFA 2A0KA 2XCLA 3HVUA 4IDQA 2H2IA 3SJPA 1GZUA 2D3TA 1GQYA 2R8BA 3IXMA 3BTSA 4TVOA 2R5NA 4WHMA 5EQTA 2WHPB 3ZC3A 4JXXA 3TVYA 3N2ZB 3EGDA 1FP4A 4HDQB 5LMNB 1U1FA 4DWVA 3HSKA 1A82A 1U0SY 3WFZA 3ENWA 4CM7A 1WUJS 1Y6JA 3TSYA 4EF6A 4URWR 3BJIC 3MFQA 4L5YA 3DOIA 3TZ6A 4FFVA 4HWSA 4BO1A 1XLUA 4IUBS 4MP3A 5EQDA 4JI4B 3ID6C 2CHGA 1SA0B 1JSLA 1QF6A 2UV8A 2VYFA 4KWTA 3L1KA 5ALLA 3TDMA 5C37A 5GIOE 2F9FA 2WM2A 3JVUA 3BQNB 4FWIB 3B6JA 3M9XA 2XE7A 1KFKB 2ZTMA 1RQ7A 4S1TA 5IRCD 3G0OA 1P74A 4NEGA 1C3OA 4RA6B 2QB5A 5JQWA 2IEIA 4EVRA 5KHOC 3UIEA 3V4PB 2LCFA 1YBMA 3AZPA 4YMGA 4HYYA 1YUMA 2GVZC 2PLRA 2Q7DA 4MWGA 4Y7DA 1G1MA 2X0JA 4F4HA 3Q7IA 3FXAA 3AJRA 4B7CA 1MFZA 3WGUA 1EGAA 3B12A 5CEFA 4B4OA 1MOPA 3TIIA 3PI6A 5LVAA 1OYVA 2ZVPX 1KZ9A 1QO0D 3ZXIA 3TGLA 3JAWB 1E79A 4I6JA 3GFVA 3SC3A 3FTFA 4ESOA 3VZPA 3HYRA 2W4IA 1N2GA 2OV6A 4CLHA 4EAAA 1WOOA 4QBHA 5CG1A 5LBTA 1PFVA 2Q49A 3AHFA 2OD7A 1RAEA 1S8OA 4OSEA 1ZCFA 2CCJA 4U0JA 2IY8A 5D8DA 4WFQA 3RSQA 4DFDA 3VH4A 2ZBQA 1O4VA 4L95C 4OGLA 1O2DA 3O47A 1DEXA 3N9IA 1IG3A 4I50B 1VPEA 2XQIA 3TOVA 1XEAA 2P77A 4TYNA 4IHAA 1W46A 4CCWA 5FNVA 521PA 1VGRA 4WERA 5I7FA 1OV6A 2Q4RA 4L27A 2GM4A 1MZVA 2Z2IA 3BL8A 4I1UA 1TU4A 4GAEA 4F3TA 1NUSA 2NU9B 1SB9A 1N6LA 1X0VA 3IEIA 4LJ5A 2I1LA 1Q91A 1DXYA 3JR3A 1A9ZA 3ZJUA 4JU9A 3HYCA 1HFEL 3E0XA 5JV5A 4KR3A 2DB3A 1LTQA 3QJGA 1XXHB 2HCJB 2O2SA 4LMAA 2WE8A 1EUCA 1IIBA 4MQUA 2VBGA 4Q7QA 4AP6A 5K99A 1SXGA 4Y9RA 1INLA 2EZ8A 2AHOA 2FMFA 1ZMTA 4NESA 4EFDA 4O4HA 5KDOA 5LR6A 3LYHA 3HB9A 3TPFA 2I9KA 2LD4A 3HP4A 1Y3BE 4WBNA 5C18A 4M1WA 2B61A 3TQTA 2CLDX 1O03A 2R7AA 4DNPA 1JPVA 2JVKA 4B3GA 1CE8A 3HKEA 4MVJF 4XAQA 4EQ6A 1MVLA 4XA8A 2Z30A 4MTLA 1TF7A 1UDAA 1ZU4A 5EYPB 5D3ZA 3RIHA 3RVDA 2IYYA 4K05A 3SPXA 3BE5A 2VT2A 4TRNA 5CMLA 3ZBPA 1UAAA 2P6OA 2A6PA 2UXDB 3P2JA 1F0PA 2XHEA 2X6QA 2NZWA 4MQEB 4PZDA 3FX2A 4HS9A 4XM1A 4JJZA 3OKPA 1AZLA 1DP4A 1V6CA 5FUYA 5EMKA 4C1NA 2JLBA 3WKDA 2ZITA 2H29A 4GPZA 4XIGS 2F4VB 3NVDA 1SC9A 2JIBA 4FZRA 2O1XA 4E32A 2ZRDA 1CTQA 1Z0FA 2EX0A 2CJFA 2I2BA 1FYEA 1WZEA 4BKMA 1FC0A 1A8QA 2VQDA 1YS2X 5K4GA 3RVKA 5J43A 3THYA 3P32A 1QZ3A 1UAGA 2Q1WA 3PQ5A 3PLRA 4ZRMA 3T3DA 2HRDA 5JOQA 4F2HA 1FVOA 3Q0TA 1CDEA 3COJA 1WB5A 3SKBA 3ZE6A 1RE1A 5I7OA 4HLUA 1Z37A 3D7KA 4PBTA 1DV1A 1FU8A 1SQSA 5L3QB 1YR9A 3W1EA 2NO7A 1GPMA 2YZ7A 5GM2A 3U37A 1LDEA 3OTIA 5HKLA 2BUBA 1IEVA 2PDAA 3C7TA 2G9UA 2PLAA 2GPWA 1E1QA 4Q19A 4X95A 3KTFA 2ZJAA 1P8JA 4PLPA 3NYQA 4I4NA 3F9RA 2OCKA 2WWXA 4FZ3A 5B5SA 1Y7LA 4E5UA 4Q66C 2WHQA 4BQIA 3CHYA 3L18A 3BXPA 4DSZA 5AK4A 5HBRA 3C3KA 2R6CA 4EB3A 1SVNA 2PS3A 4BFZA 2QLFA 3ZTWA 1A77A 1LWNA 3KSBC 1HURA 1Q1EA 2VBTA 1EFPA 1VXOA 4U7PB 2ZS8A 1COZA 4DM3A 2F1MA 2WV9A 1K6EA 2ZQYA 1YO6A 2BGGA 4WZAA 1UWKA 3NT4A 2B92A 1L4GA 1OWMA 2Z2XA 3H13A 3QIAA 5KU1A 5CX4A 1GEGA 1V8PA 1I24A 4S05A 2Y3IA 2AOUB 4RK4A 3R76A 5EP2A 2CNNA 1Y81A 3EZNA 3T3PB 5MF6A 1YFJA 3V4RA 1RKQA 3M6UA 4NPAA 3UQYS 5L7WA 3DR5A 4HDSA 3IBGA 4YUWA 4HOYA 5LA6F 2EOAA 1BHSA 4YQYA 3R9KA 2ZBGA 3FI9A 1QH8A 5JE8A 1QSGA 3DULA 3HGQA 3RC7A 1Y1KE 3FSJX 1M2NA 4QEDA 5JCOA 5JNVA 3GELA 5CA0B 2J4CA 1SUCA 1AHNA 2CYAA 3GFRA 1AB6A 4P4TA 3WRYA 5LUBA 3RRYA 2LKCA 4DM7A 2IW1A 2HJ9A 1K89A 2EX1A 3U19A 1R4MB 1WR8A 2HA0A 4MUEA 2Z2JA 1G66A 2RHMA 1DC7A 4RKEA 1UMDA 2YXNA 4A2CA 5SZHB 3ESXA 2ZJ5A 4JUCA 4ZZ0A 2HLNA 2ZAMA 3SZLA 3WLEA 3IEKA 1DZ3A 3AOGA 3TIXB 4F6RA 1TOAA 2GPSA 4OUDB 4S35A 4X54A 3WNZA 3K70B 3ZLUA 4BQEA 1NDUA 1T8YA 1JL3A 2FWJA 3V6LA 1JFFB 4CV1A 3Q6RA 5EJ8A 3S4YA 1J5XA 3UA4A 5I51A 4TKOB 3ZWDA 3RV3A 4KE6A 1HE3A 1Z68A 3FPKA 3U2QA 2A5FA 4IDNA 1KC3A 1GTRA 2OBRA 3HWX1 5FFMA 5LU8A 5KPJA 2ECOA 2ZJ6A 3EPPA 4BBZA 4PZUA 5BXQC 1X7YA 3KR0A 2ZUDA 1HFWA 1OSNA 3GCDA 2MCFA 2Q7XA 2VPQA 5IUJC 2QQ0A 3HKBB 5DP1A 3U6BA 1RRCA 1NBEA 5F9HA 5HQTA 2HWWA 3WLNA 4BZPA 1WULS 4BMOB 1X8KA 4W9NA 1L8AA 2HT6A 4PTLA 4US0R 3GMIA 3S81A 1S8NA 3B1VA 3FBGA 5ALPA 3M1IA 4ZZ2A 4BQFA 2FZCA 2OXRA 1QTIA 3UTDA 3J80A 1L4FA 4MUKA 2BMDA 4QM7A 4JU8A 4YASA 1OILA 1UXOA 3L6RA 2PBZA 3K94A 1QH1B 4JZKA 1PX0A 1KJNA 1ONNA 2O2DA 3C8MA 2F3UA 1Z22A 1OLUA 5A3RA 3UMVA 2VP9A 3HXQA 3GD5A 4CMHA 2ZZEA 1AV7A 3PPWA 3LCCA 4K0RA 3R8XA 3W2TA 3CMMA 3S7ZA 3MTDA 4V3CA 3TGWA 3FGPA 2BFPA 2WICA 5IEJA 3HE3A 1G6OA 1I2BA 2OORA 3JQFC 5C34B 5BN4A 1GRQA 1OAOC 4GOKA 3H84A 4MIYA 4CMGA 5LNK1 4JVOA 1R4NB 1FSPA 3OZUA 1V5FA 2VTDA 3D4BA 4WJKB 4ARZB 2BKUA 4LTMA 4ZAWA 3A6GA 4CKBA 3OCYA 3C3WA 5AHOA 1N8NA 3ZHXA 1LI5A 4E4RA 1C1HA 3BRQA 1UMBA 2Y9MB 3GXBA 3KYCA 4RLQA 3RS4A 3DTNA 4GRDA 3KKPA 1FLDA 3E8XA 5DBIA 1DUVG 1KE2A 2R4UA 1AZSC 3VPGA 1W29A 1XNHA 2AW3A 2Z9BA 1HH4A 2YVLA 3GJYA 3KFXA 3LBYA 3K0CA 4WZZA 4BNGA 3K0FA 3Q3HA 4OAQA 2I3GA 5L9AA 4C87A 4Z4TA 3KWMA 1HUQA 4H7IA 2VPTA 4A92A 3AUYA 1JTFA 4ZAGA 2J07A 3BE8A 4P4SB 1HI9A 5BT9A 3WP1B 1UD2A 1PJBA 1GG8A 1U8EA 1XK7A 4QDKA 3SQOA 4DF3A 1USGA 1K2WA 3OJEA 4Y2UA 2NVUB 1GKUB 4W5RA 1K7XB 4F38A 2J9FB 1YMQA 3QGMA 3CEPB 1U7ZA 2I4NA 3PDIA 4KH0A 3WZ2A 5AH0A 4BNZA 3A6FA 1QXSA 5G0SA 2CUNA 1NMZA 2CNOA 1P4JA 2WG1A 1VHEA 3EUWA 5E6SA 4URFA 1K73D 4KR7A 1PDVA 3RUFA 3P26A 4HNAB 4LJ6A 1FDUA 1YE8A 1ISMA 4F92B 4IFIA 4QYXA 3WYAA 5MGBA 3A8IA 2A7QA 2AQ8A 2I66A 2I4TA 1R0CA 3CRQA 4JH0A 2QTNA 2UZ3A 2XMQA 3ZNNA 5HM8A 1J8QA 4PRYA 4XOUA 2QE6A 3AG5A 4PSKA 3W5AA 4QYMA 3U3RA 2BMEA 2EFHB 3C6BA 3E03A 3VRHA 4C04A 1P2TA 4LDPA 2CV2A 5CXSA 5ULLA 5H80A 2DFNA 4WKOA 1C0IA 1QK3A 4MRVA 1Y3FE 2HC9A 1BX1A 2XSZD 4II2A 4G1EB 4E94A 1TTPB 2GKGA 3RT1A 5C51B 2FSHA 1UKZA 2BJWA 3BMCB 4CDMA 5G1PA 1OBFO 1VHJA 3IQZA 4TMVA 5KYXB 4P34A 3GHYA 5FBQB 2GBGA 1M1KD 3EMDA 1QO0A 2H2GA 5EZ6B 4F4DA 4V1CA 1BVHA 1M8KA 4PV7A 3D02A 3RQIA 1ZPDA 3QFRA 2F8MA 5KWJA 1MC4A 4M8LA 5K3FB 4UHEA 2ANBA 2GJ4A 3QU5A 2V8BA 2Q1TA 3L8CA 4HNGA 5C31A 5LUAA 5K01A 5FWYA 3F7MA 1HMYA 2XNSA 3K9LA 4D8VA 4Y1RB 1AK2A 5AK6A 1SXJB 3LFTA 5DWDA 2DQSA 2R00A 4IVPA 3N3BC 4YAKA 3SSAA 2IHJA 2V6MA 1U2GC 4HAZA 1IWPB 4UBMA 3MJEA 3X1WA 3MWFA 3ZLJA 1Y1QA 1UZLA 4ZU1X 3IUSA 3NM6B 1HKHA 4X90A 2ZS7A 1PDOA 3R6KA 1GNRA 3TLBA 1E66A 1EHIA 2ZRNA