4RJLA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdpcp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of gamma subunit of the translation initiation factor 2 from Sulfolobus solfataricus in complex with GDPCP at 1.64A resolution
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 112
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rjlA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rjlA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rjlA01
2JLRA 2JIZA 2N1BA 4Q1BA 1JR3E 2X19A 1VQ4B 3NXSA 2BIFA 1W4AA 4Y9UA 1RJ9B 1R0XA 1KO5A 2GCOA 1DE0A 3H0KA 3E2IA 1EP2B 2FEOA 3K0AA 4QNMA 3CF2A 4OK3A 1Z0DA 1BYIA 1F5NA 1OIWA 3QFSA 2AL7A 3QF7A 2RGCA 1FX0B 1GNQA 5DIFA 1H8EA 3R20A 1FNNA 3OE7D 1TQDA 3ONWA 3L43A 3QUSA 4Q4HA 3MAAC 3CCVB 2H16A 1NVWQ 1W2HA 3IUYA 4L5BA 5CLLA 4CGZA 3GJ3A 1UKVY 3WHLA 5AWFC 3UMRA 3PCRB 1G64A 4YMWA 2Z0MA 1U99A 2EVWX 1M1KD 3C7KA 2OV2A 2DCUA 2ZRHA 2BM0A 1U0HC 1P9RA 1G16A 2GZDA 2YINC 2IUUA 5FOTA 2W58A 4JVSB 1Z0JA 4NHOA 4HB4A 3GCGA 3GFTA 1AJEA 2QM7A 2NMVA 2AWNA 4LY6A 2QEQA 4QNRA 1L8QA 1DAMA 1MOZA 1AZSC 4NL4H 2FFAA 5CIQA 1WXQA 2FA9A 4PZLA 3L0IB 1US8B 1BS1A 4QXAA 1XD8A 1GL9B 1SXJD 3QFRA 1E9RA 3M1IA 4YDSA 1CR0A 4BLTA 5DSZA 1KI7A 4B74A 3QKRB 2OILA 4MDFA 1P61B 5LB2A 3FJOA 1E0JA 3U6BA 1RRPA 4M9SA 4QHYA 3P4XA 4C2TA 4I81A 1EP3B 4LV5B 4R98A 4TL6A 5F98A 5E7MA 1JI0A 5GADl 1BMFD 1W2GA 3AF4A 4LHYA 4M1WA 4O3MA 2WWIA 1W46A 4NP6A 3PIRA 1FOEB 1X6VA 3I55B 3EIQA 4JKYA 1NMYA 3G82C 3AVOA 5DH9A 4JJKA 2VF8A 1XJ0A 3QOFA 5D3MB 5JMTA 2G3YA 1ZNXA 1XD2B 4UKDA 1L4UA 4DT1B 5FTMA 5FPTA 2O52A 2F1IA 1JXOA 1WA5A 2R44A 4OQLA 1ODFA 3H86A 3QKTA 3U5ZB 4DCNA 1UKEA 5CDFE 1XEXB 1XMSA 3V9PA 1VPLA 8OHMA 2O8DA 1GTVA 4Q1AA 3MWKA 4OI2A 3AP1A 3MGCA 4LX0A 1Z6AA 3OE7A 2WMNB 3AP3A 3AF0A 1XCMA 2CMKA 2C9CA 2PZEA 2ZEJA 1N6RA 2MSDB 1FRQA 1SM4A 2BMDA 4YAFA 3AF3A 2ERYA 2XJ4A 2IX3A 2ZM5A 1ZNZA 1NBMD 1H42A 1X1RA 3SJZA 2GXUA 3RWOA 3L0SA 3DM9B 1TAGA 2QENA 1RW4A 2IL1A 1T8UA 4RD4A 2CNWA 3CRZA 4HUQB 5CJPA 3RLFA 3ZIAD 2DETA 1DG3A 3KFXA 1TMKA 1YR7A 3CPEA 4R9UC 1Q1ZA 4M21A 4YALA 1ONBA 5E7IA 2JLUA 4A0HA 4MYCA 3FFBA 4BUJA 4B34A 1GKYA 1VQ7B 2ZANA 4BFTA 3U3RA 2LKCA 1G8GA 1E2QA 1SXJA 3L82B 1G6HA 1TUIA 1W4BA 3W2HA 4HATA 4M1YA 4MKIA 5F9HA 1VQMB 3NIBA 1JQLB 3CC7B 3VMFA 2P0EA 5JJKA 3BK7A 3LW8A 3GLFE 1S8FA 3K53A 2ZQ5A 3PUYA 4V0LA 1QG2A 4CEIB 3UG7A 4JLKA 2CLSA 2B92A 1Q44A 5KDLA 2V55B 4P4TA 4UXHA 4MUAA 4Q19A 1YJWB 4WZAE 4RVCA 2WKRA 2XNJA 1S1CA 4RD2A 1QZXA 4P3YA 1AMOA 1KO8A 3BJIC 3F8TA 2VHTA 5FTJA 4D2IA 2ZS7A 4TLCA 2OFOA 2XNDD 3CXCB 2OXCA 4GZMA 4PZYA 1OIVA 1CRQA 1R7RA 2DHRA 3N2IA 3CZPA 3MJRA 1GAJA 2NTYC 4JJZA 4C0SA 2LKDA 3AB3A 1TTTA 4LJ6A 3VQTA 3CX6A 3Q3JB 1T3LA 2WWFA 3AQ4A 2JAQA 1Y63A 1ZCAA 1Z3IX 2N42A 1T0HB 2J7PD 2JCSA 2OCBA 4LI0A 1X8JA 4XTCS 4BRWA 3H4MA 2MSEB 2B5OA 4RCYA 2QTHA 5J47A 3EIHA 4M2LA 4B32A 2GZAA 2IYLD 5EQTA 4B48A 2YC2C 2ZRDA 1HT2E 3JVVA 2QNRA 3KJIA 5SZJA 1FNBA 1KJWA 4V0NA 2YKGA 2ZPTX 1MO6A 4ARZB 1P9WA 1FUKA 1BJKA 4NYMQ 1E2LA 4HAVA 5FI1B 2BEJA 1NVVQ 1QHSA 2B7BA 4LYAA 3WP0A 2GA8A 1VQ5B 3KKQA 5FBRB 4C3ZA 2WOOA 4R7ZA 2GCOB 1NBMA 1G3QA 2HJGA 4DCTA 4DJTA 2F55A 2PLFA 1G6OA 3Q7PA 2FMXA 1XJQA 3VHXA 4JLVA 3ZIAA 4A0FA 4LJ9A 4HDOB 4BFXA 4DSNA 3E70C 3SYKA 2QP9X 3Q5DA 2CE7A 5IRCD 2F1JA 3THWA 1W36D 1Z63A 4HAYA 3SYLA 4KSCA 4KHZA 4XSGA 2C95A 3LX5A 3QEOA 2W6ID 3SI7A 4RD0A 1GIAA 4MGYR 3RC8A 2QAGA 5FL3A 1N5JA 3VKWA 3OJWA 1MRSA 3A1SA 4JLDA 4LUCA 3TUIC 3TGPA 1SULA 4JLOA 3D6TB 3DL0A 1ZAKA 3QXCA 1KO7A 2OLJA 2QL6A 1VQPB 2ZRGA 5EXPA 5EXXA 2OT3B 1Q86D 1R0ZA 1TNDA 2YYZA 1A5TA 3CCUB 1GG2A 1T5IA 3WXMA 3CCRB 3NTUA 1CULC 5HXBA 4B2PA 5BN5A 4M9XA 5FBLB 1SVMA 1II8A 2KI5A 1RRGA 2GJKA 1Q81D 2UZ3A 3U7FB 1FQJA 3W5HA 3VR6A 3GLIB 5K8IA 3I56B 3BE4A 4GPTA 3WBJA 3PUZA 3PENA 5LD2C 4KBFA 2W6JA 3CC2B 3W5VA 2XX3A 3W2GA 3IHLA 4LHVA 221PA 3EZFA 1U8AA 1IN8A 4TMWA 3DVLA 1XCGB 3GD7A 4O2LA 4D4JA 2JLXA 2QE7A 5UKDA 3TSWA 3A4LA 2FH5B 5TVKA 4LJ5A 1I7PA 3ZS8A 4GT1A 1KD1D 4D0LB 1UM8A 1KNQA 1XF9A 3AKDA 1B0UA 3I61A 1GKUB 4FMCF 3BFXA 4UXIA 3BFVA 3MLEA 4PAOA 4IDPA 2X2FA 4W5WA 3KQUA 3MHPA 1MRNA 4PANA 2GZHA 3PG5A 4A0GA 1P5ZB 3RRNA 3HR7A 1F60A 4NYIR 1QX4A 4URYR 1NJGA 4Q48A 3UXMA 1CXZA 3AVYA 1MH1A 3BH0A 1CR4A 3GJ8A 3AVQA 4OHXA 4RFSA 1AS2A 1UMKA 2OO7A 5DHFA 4MGZR 2XGJA 2H18A 2FSGA 3VO1A 2OTJB 1D1NA 3BB1A 3BWDD 2QTZA 3PQCA 4Q03A 1OH8A 2WIBA 4AF7A 2C03A 5KSPA 3WMEA 4U5XA 3FMPB 4F92B 5DISB 1UBEA 4AC9A 2VP2A 1SQ5A 4KCGA 3EZ7A 4D4LA 4D82A 2W6IA 2AN9A 4JSYA 2CHGA 3TR5A 5CK4A 1T8TA 3QE0A 1XB2A 4IKEA 1KSGA 3WHKA 2RKOA 4A2QA 1S9HA 1E9BA 1ZM9A 2VLIA 3EPJA 1ANKA 2ZYVX 1DG1G 2ZRMA 2CJWA 4KI0A 4Q66C 4WZBE 2J5XA 4I1SA 1W87A 2FGJA 2ORIA 4V02A 3TAUA 3SQXA 4EPRA 1AQYA 1XU4A 2DBYA 1GAWA 4XIGS 3QPWA 1TPZA 1EWQA 2ORWA 4HSEA 2DFLA 5KSOA 2AFIE 2GEVA 1GM5A 1TVCA 2FDCA 2FFHA 3ND9A 2DPXA 1OYYA 1COWA 5K8UA 4CZ2A 2WJYA 4PC2A 3QSYA 2ZUDA 2HXSA 1PLJA 4P31A 2R6AA 4EH1A 1M1YE 3OHMA 1NKSA 1TL7C 2PCLA 4LBWA 5BW8A 3I5XA 1VG8A 4QG7A 1SVWA 2HF9A 3AVPA 1IY1A 2C98A 3VAAA 3EPHA 4I4LA 1R5NA 5B64A 3V00A 2OBMA 1N0UA 2AHOA 4FMDF 4NZYA 1GR1A 2W0SA 1JAHA 2FU5C 5KYKA 4V0KA 2DY1A 2QMEA 4CF7A 3NWJA 2KBEA 3KKNA 4Q7MB 4GP7A 2IYXA 5FL7D 2VHJA 2ZSEA 4YAUA 4URZR 5JRZA 2RAPA 3KUCA 3JQQA 5C18A 3X1ZA 2QQEA 3EW9A 3IHWA 4PZZA 2C99A 1VDZA 5FPHA 1GDDA 2ZSFA 3LFUA 5B58C 4JKIA 1OFUX 2ODBA 1IB0A 3JQPA 1KY3A 5GVRA 3R7WA 4B73A 1WB9A 4W5HA 1SHZA 2ZYUX 5LD2B 4JLNA 4Q21A 3RRZA 3W6NA 1P3JA 4M22A 3QFTA 4Q9IA 3CCMB 1Z5ZA 5DNYB 1VQ6B 3KX2A 3O8RA 1XMIA 1OIXA 4EQ6A 1DEKA 3O8CA 4G5OA 4XVQA 2WBLC 4DCUA 1ZM7A 1E2FA 1E2KA 1OLOA 3V76A 3B6EA 1M2OB 3OFND 3SYNA 4AI6A 3CCJB 2HDNB 4LGMA 5FBQB 5IK2D 1BX0A 3D7MA 4JS0A 2A78A 1E1RD 5EUMA 2F3RA 5EP4A 4P4SA 4NCHA 2G9NA 4QBFA 3E5HA 3THWB 4Z8XA 3MSXA 1CU1A 3K70D 1W2BB 2DWOA 2VYQA 4PAQA 2R6DA 1QVRA 2RC5A 2H8KA 1KDPA 2QAGB 1YZTA 1Q1BA 1P2TA 3JZAA 2GESA 4AK9A 5A5GA 4LHWA 2FNAA 5L3RA 1MKYA 1IN5A 5L3SB 3EWAA 5CYPA 3KKMA 1CR1A 2O0JA 1KY2A 1VG9B 2C96A 3CCQB 3CCLB 1BO6A 4GRAA 3TK1A 4YMTA 1AK2A 2FZLA 1D2MA 4M4SA 1PUIA 5AN9A 1YVDA 2F43A 1II8B 2G88A 4N1AA 3ZDQA 3KJHA 2R2AA 1KI3A 2NO0A 1S72B 1D9XA 4MRRA 2ZR0A 2DFTA 1TQ4A 1E2JA 4Y7CA 5TXGA 4IHQA 3SDZA 4GL2A 2E9SA 5DO9A 2HEIA 3QG1A 3RDPA 3ZZUA 3CKLA 5FL7A 4LV6A 4BWYA 4C4PA 5JS7A 3K0CA 1G7SA 5K8LA 1K5DA 1E63A 2ZI3A 1QGZA 3V4FA 3PJRA 4LBVA 5AR1A 1BYUA 1IJEA 4EJSC 1HE8B 3GLGE 2GDJA 2NQ2C 2REBA 2P6RA 2G0TA 4ACAA 4NYJQ 1QG4A 1U90A 1Q7YD 3MWLA 4YONB 2CCJA 2YWFA 3NBYC 1MT0A 1J9ZA 1IBRA 2PT5A 4I1UA 2X8AA 5G53C 2G83A 1Q1EA 3PEVA 3SBEA 1DO0A 2QPAA 3M0EA 1UDXA 3UATA 1IONA 1G41A 1ZUIA 4UNNA 4YXWD 5FPKA 1YHNA 2CHVA 1FZQA 2VO1A 1ZM3A 2ZRJA 3W2EA 3NBZC 2QG6A 4B6EA 4RFSB 1XTRA 1OT3A 5AUOB 5BN4A 2JLYA 2W00A 2WICA 4PC3A 1K8RA 1T3SA 4AYTA 4HE6A 1E1RA 1A2KC 1OFIA 4PO8A 3X1XA 1M8PA 3TSZA 2AFHE 2RHDA 3C14C 1OJLA 2VA8A 4F7DA 4K46A 3VR1A 1NG1A 2A2ZA 2FFBA 5M04A 3W3ZB 3HR8A 3DO6A 3SOPA 1XFAA 3VX4A 4BFSA 4Q4AA 5KTYA 2IYRA 3VR2A 5H68A 1YZKA 2CJWB 3EPLA 3MRSA 3SU8A 4A36A 4MKFA 3G6EB 4LYJA 4UJ5A 2IHYA 5B30A 2AXNA 2D62A 3FMOB 2J45A 1WCV1 5BYKA 5H8WA 2R6CA 1YZUA 4PPQA 2J9RA 1IY0A 1T9HA 1VECA 5DE3A 4HUTA 1VQLB 1KYIA 4ZO4A 2YWGA 1EFRA 3HJNA 4L9SA 4B3CA 4BGDA 4TZ6A 2VPPA 2P65A 1HYQA 2ZS9A 3A1VA 4C2UA 3I92A 1MO4A 1SKYE 2UVQA 3RS4A 1C4OA 3QBVA 2YWEA 3EPKA 5CIWA 4UNSA 4RZ3A 4EDHA 1S96A 2JASA 3T1OA 2WVJA 4A9AA 4OBEA 4JT2A 2XB4A 3TVDA 1SKQA 2REXB 2DFNA 3GLIE 4B2LA 1A2BA 5C46F 1ZINA 4WIAA 1R8SA 2BBSA 2RGBA 4TMXA 2WSMA 621PA 2GF0A 3QE2A 2C9YA 2V1UA 2F9MA 2IEZA 4OKSA 1I2MA 4IW3B 4DDTA 1RFLA 3K9GA 2QROA 2XITA 3KTAA 1P2SA 5DI9A 4QL3A 3SC3A 4DDWA 2YWHA 1OXVA 1Q0UA 3IEUA 2ZJBA 1GSIA 1HUQA 4LPKA 4NH0A 3ZLJA 2ZREA 1E0AA 3CCSB 2F7SA 1VHLA 3AVTA 4CT4B 4YXWA 2MMCA 1G3RA 3SFZA 2ZSBA 2A7QA 4UNQA 3U4QA 5A0FA 3BOSA 4DHEA 1JJVA 5DN6A 4JBXA 1E9FA 2IYUA 2Q3HA 3KB2A 1KRHA 3JQRA 4TLDA 4LJAA 1KGDA 2NOAA 2ZRPA 4KO8A 4JLPA 5FOXA 5SZIA 1E2IA 3C16C 2WWXA 3R7WB 4BASA 3FHTA 2ZETA 1GFIA 1U9IA 1RC8A 1VTKA 5JHGB 3QBTA 2ZE8A 4X8LA 3BRWD 1Z47A 4B3XA 2V1XA 2GKSA 4CDGA 2O8EA 3F3YA 4AIIA 1W1WA 1Z6YA 2QPTA 2ZRIA 1Q3HA 3W5IA 4EQ6B 1AM4D 1X86B 2HMAA 5JSZB 4OI4A 4W5JA 4EJSB 4CEJB 3QFCA 1NN0A 4WXPA 3AM1A 5TDHA 2GBLA 2WMOB 2W0MA 1ELOA 4Q02A 1G8FA 2LWIA 4URUR 3BC1A 1DPFA 4EIWA 3THYA 4JVMA 3T5GA 2ZE5A 2NZ8A 2ZUBA 4M53A 1MV5A 1QHIA 3K09A 4RY2A 4ZKDA 1KSFX 1JA1A 3G71B 3ZVLA 4A6PA 3VKGA 2Q9BA 1NLYA 1E4VA 2KWIA 2J0UA 4LK2A 2DR3A 2B7CA 3PITA 2A5YB 4MYTA 3GQBA 4HLUA 4PC7A 4JL8A 2EW1A 5JCZA 2NIPA 1JALA 3IBYA 3W8RA 1Z28A 1EFUA 1F20A 3FHOA 4KFSA 4BLPA 1N6KA 1ZP6A 2GJ9A 4BLSA 4F4IA 1CNFA 2V7QA 4Q4JA 4WA7A 3TUJC 4C7OB 1XXHA 1E1QD 4AYWA 1Z0AA 1SGWA 2G77B 1X8KA 4YDHB 3BIFA 2BKEA 3BERA 4QRHA 1ZNYA 2G6BA 2V8OA 2D2EA 2GETA 2I1QA 1IXZA 1FQKA 1XEWY 2AKYA 4BZQA 3NBFA 1EWRA 1HV8A 2IBMA 2WPDD 3K0EA 3OAAD 3OF5A 4KVGA 1RYHA 4OHVA 1NVUQ 1U9IC 4TQ9A 4C0QC 3W90A 2XZPA 2ZVPX 1FNDA 1HE1C 1R0WA 4AG6A 5IT5A 2ZSDA 1K8AD 4B35A 3OJXA 1YI2B 4RFVA 2OE2A 2OTLB 1Z07A 2IYZA 3DM5A 2XTMA 1DBSA 1GRNA 3I72A 4HAWA 4PX9A 3AVUA 1ZNWA 1EP1B 3KXLA 4M8NE 3T15A 1KAOA 3CW2A 5G41A 1E0KA 1GZSA 3THOA 1S4QA 1E79D 5KPDA 3UWKA 3U7GA 2YC4C 3O8BA 1GILA 5G3ZA 4ESVA 1WDTA 1A82A 4DLTA 1E9DA 3GEEA 2ZSAA 3SHFA 3K09C 1E9CA 2NG1A 2QN6A 2BJWA 4KVAA 2VNIA 4KXFB 3RANA 3B85A 1JR3D 2ZVQX 4M1MA 3MWJA 1X3SA 3UIEA 4HLUC 4MA4A 4PFSA 1EWYA 1PLKA 1XZQA 3KDSE 4NPHA 3K9HA 4C30A 1AQUA 5SZKB 4M9QA 4B47A 2QT1A 4PGOA 1NP6A 1MABA 4ZDWA 3KQNA 1SVLA 4OYHA 4B3FX 4OI1A 4G1UC 4YMUA 3QI2A 2ZJOA 1WBBA 2HLDD 3R9IA 3I8SA 4TYWA 1LY1A 5HCIA 2WZQA 2D74A 4TTRA 4A92A 2IA5A 3CCEB 521PA 4KFTA 3TVTA 3IPXA 1D6JA 1VQNB 1KAGA 3CUEF 3I1FA 2PL3A 4PPGA 3TLXA 2ZXUA 1P62B 4Q4AB 1IN4A 1E2GA 1Z6GA 4MRPA 3J81k 4Q4LA 5AUNB 3L2OB 4QM7A 2QMUA 2IT1A 1XPUA 1R4AA 4EPWA 1I4DD 2OESA 2ZI4A 1S0UA 4HEJA 4JMPA 1KI2A 1E1QA 2H17A 2ONKA 4QBGB 3LNCA 5C4MA 4LJ4A 3ZQJA 2EFDB 4Z1MD 4NCIA 1IY2A 4KAXA 5FR2A 5AUPB 4MDEA 2J0SA 3L0OA 4A8JA 1F2UA 2AXPA 2ZRLA 3I5YA 6Q21A 3QKSA 4Q5IA 4O2RA 3RRYA 2WPDA 5J4KA 4AURA 4DSUA 3EASA 1U2RA 3GJXC 3TNFA 1KDRA 2IYYA 3ZD6A 1AGRA 3FE2A 4W7SA 4XD7D 2GF9A 2IYWA 3D8BA 4ASUD 1ETUA 1FL9A 5TMPA 4TYPA 4DB4A 2NGRA 4GZLA 4LBYA 4G5GA 1U0LA 1ZD8A 4B71A 1N6PA 4M1OA 1PV4A 2EQBA 2IC5A 2A30A 2WSSD 1OXTA 1NJID 3A37A 721PA 1J90A 1E79A 2QU8A 1XTKA 5EE3A 3ZJYA 4A15A 4BZXA 1N6NA 4ZPXA 2DYKA 1IXSB 1YR6A 4MGKR 4NKRA 4BFYA 1W49A 2XTNA 1BX1A 2EFCB 2YVUA 1GO2A 1P2UA 2QUZA 4TSFD 4GDFA 2ATVA 3KTAB 5KO2A 3VHLB 2E87A 3B8HA 1GAQA 3TQFA 1D2NA 2VNHA 1Z8FA 2GPJA 2GEDA 2QBYA 2Q9CA 3TJZA 2AKAB 4GMXA 1G7TA 4QHSA 3U4QB 3PEUA 2CL0X 1GVNB 1NSFA 3FFAA 4AYXA 4DUGD 4MKGA 1W7AA 1WF3A 2CCKA 2ZRNA 3SR0A 2ZRBA 1U8YA 2ECKA 2ZR7A 3NVAA 3LBHA 4ACBA 1BMFA 1KDOA 1KI8A 3AEZA 3CX8A 4PQFA 4YMVA 1QFZA 2HLDA 4FN5A 4TQAA 3AH8A 5ANRB 2IF0A 1N8RD 3KJGA 2O8EB 4QBHA 2HUPA 1CF4A 1AKEA 4LOAA 4IXNA 5BN3A 1QHGA 4XWAA 4A8JC 2Z6VA 3UK6A 2EU8A 4C9BA 4OQFA 2JLZA 5AJYA 3HYTA 5CB8A 2IF2A 4EUNA 4OHYA 1ZMXA 4XWOA 4G5RA 3U44A 1CNEA 5H70A 2WWHA 1X1SA 3FKSD 1KI6A 3THYB 1VHTA 3V4RA 3OZUA 4FWIB 1YR8A 4Q9HA 4Z1MA 4B3GA 2FWRA 3CR8A 3NEYA 1OB2A 4RCZA 821PA 1CQXA 2J0UB 2RGNA 3X1DA 1TEXA 3CLVA 4BLOA 1R6BX 3I4LA 3AUXA 5C1BA 3KB1A 1FTNA 3NH6A 4KODA 1QRAA 1AS0A 2P6NA 2ZE6A 4JLMA 1HQYE 3RS0A 4PQRA 5GJBA 2P5TB 2F3TA 4XD7A 1LFDB 1G4UR 3U3KA 3QXSA 4ASUA 1SXJC 1Y3AA 4Q4JB 3DMNA 3K0AB 2FSIA 4HAZA 4UNRA 1NMZA 5B2ZA 3QEJA 2JEOA 3CPHA 4JLBA 4WZ6A 1OXUA 1G5TA 3W34A 3LVBA 1OFHA 5JECA 1E2NA 2AWOA 2OCYC 1IJFA 2ODEA 2XJ9A 4DLUA 1XPOA 4GSYA 4BQSA 4Q4HB 2ONJA 2C77A 5JWHA 1S1MA 5H1YA 1CJUC 1S2MA 3U7HB 4TSFA 5JEEA 1HY3A 4TLBA 2O0HA 3DKVA 5AUQA 1JPNA 2EIXA 3R9XA 2XB2A 3T34A 4C0KA 4BE7B 4NE2A 4AG5A 3QIAA 1PLLA 2PIAA 1GVHA 2VSFA 1E96A 2RGEA 1WRBA 1XTJA 3QQ5A 2AD1A 5J4LA 2VP4A 2QTVB 4HB2A 4IOKA 4ZCMA 3WY9A 1OGIA 3FMIA 4IDNA 2F1RA 3NKVA 1I4TD 1OHHD 3GJ0A 1OH6A 3WYAA 4C43A 5BXQC 5EXTA 3TW8B 2FE4A 2WWGA 4OL0A 3VR3A 1WE2A 1E6CA 2D3WA 2VP9A 2XNDA 4Q47A 2EWWA 4IOMA 5FOUA 3CNLA 1N5LA 3DZDA 1KI9A 1E4YA 1Q20A 3FWYA 2CXXA 4FCTA 4L15A 4WW0A 3KQHA 4I1OA 1KTVA 5TY0A 3Q5EA 5TARA 3DDCA 3LDAA 1DO2A 1GKIA 1QHXA 2J7PA 1K5GA 4ZDKA 2IS4A 3EZ9A 2VH5R 4QM6A 3X1WA 3RS7A 4ESHA 4OQMA 4JVLA 1NNEA 1YJNB 2CE2X 3ZVNA 5KSYA 1XPRA 3SQWA 4DQKA 2QMHA 1YJ9B 4Q1EA 2FF7A 2XZOA 4US1R 2VSOA 1WP9A 1OFTA 2PMDA 2V4ZA 5FUVA 3RVBA 2JLWA 3B2EA 2QAGC 4G3XA 2IWRA 2ZRCA 3NDPA 2XZLA 4V0ME 1W4CA 3CF6R 3PR1A 1VQKB 2HV8A 1ZYUA 1ZC3A 4B44A 4LHXA 3UWOA 1CP2A 4ZCLA 4DQLA 1DAKA 1XP8A 1AA9A 1ZD9A 3F0TA 3NG1A 2O8DB 3BBPA 2ZJAA 3LO5A 5KUTA 2I4IA 2JDID 4PXAA 4IVPA 4AD8A 4CEHA 121PA 1F2UB 4QJ4A 4HI0E 1XMVA 4NONA 3TIFA 5FUXA 4A8JB 4ZI3A 5HZKA 5JZVA 1Z0FA 3QKSB 3VX3A 4N3NA 5EMNA 4M1KA 3WMGA 4D4KA 1VKJA 3LQRA 3QJYA 1YHQB 1JEEA 2CEAA 4DSTA 5H59A 1CEEA 1DAIA 1IN7A 4QGFA 3KKOA 3NHBA 1Z0IA 4DXAA 4GI7A 4Q9JA 2XXAA 1QFJA 2IS1A 1E64A 1ZM2A 1T4GA 4E5UA 3ZZTA 1II9A 1NL3A 2BMFA 3U3JA 2BDTA 4GFDA 2BEKA 3CRQA 4YQFA 3MFYA 4DDUA 3LY5A 2EFEB 1OHHA 1VCIA 3E20A 1KOFA 1ZBDA 3HPQA 2Q6TA 3VR5A 3K0SA 4M0LA 3CX7A 1UDWA 2AX4A 2FEMA 4EFMA 5FPSA 4N3GA 3B1WA 4MUBA 1HTWA 2JLQA 3W3AA 4PSKA 5HPYB 1SXJB 3EIEA 3QKUA 1I2DA 4MRVA 4TL7A 4QKQA 2QBYB 3AP2A 2WJJA 1Z22A 2KBFA 4KLNA 3SS8A 3QPUA 5EE5B 1QVGB 1W0JD 3X1YA 2BBTA 1OKKD 3B9PA 2IYQA 3GJ5A 2FX3A 4MKHA 1VIAA 3I3SR 1UJ2A 2O0KA 3DHWC 1NN1A 3OEED 1ZM4A 1VIYA 3EWSA 4BPBA 3PXGA 3A1WA 1T91A 4A82A 2BKUA 5CITA 3P26A 1NRJB 3ZBTA 3CH5A 3BB4A 421PA 1UEJA 1DAFA 3RWMB 1W36C 1II0A 1CIPA 4ZGQB 1AKYA 3WP1B 3SJCA 4B76A 4Q00A 2QPOA 3ZC3A 4MH0R 1TX4B 1ZUNB 4Q7JB 5FOSA 3IQXA 3LWNA 3EZ6A 2R6HA 3U44B 4EPYA 4FIDA 3SHWA 3MG9A 3CRW1 1KC8D 3TR0A 2ZAOA 1NY5A 1QHHA 1CJVC 3IIJA 3UMFA 4NDZA 2OBNA 1BQEA 3GFOA 1U81A 2F6RA 2JDIA 4ON9A 4OK6A 2O8BA 1G8HA 1IN6A 3K9NA 3IKJA 2VHQA 1E2PA 3B60A 4ITRC 1KO1A 1BKDR 1GL6A 1HT1E 2QY9A 5BYJA 1TEVA 1E9AA 2VF7A 2YNMA 3T61A 3ETLA 3U7EB 1L4YA 4TLEA 3ZBUA 4ZV4A 1K9MD 2J3EA 4DLRA 1XWIA 1GWNA 2ZJYA 4LWZA 5FH9A 4YAWA 3FYHA 2G0NA 3HWSA 2I1VB 1CKEA 1FP6A 1M7BA 2OK7A 2OAQ1 2QORA 2BGIA 3PVSA 4XOIA 3VR4A 4B33A 1U98A 2NO6A 5HKKD 4C0BA 1ZD1A 2AK2A 3ZS9A 4FXPA 2GJSA 1HURA 2Q3MA 3BAFA 1GL7A 3ND8A 2A9KA 4DB2A 1KKMA 3AVVA 2JLSA 1G17A 1EX7A 3FMFA 4AKIA 2CVHA 1OH7A 4EPXA 4GOJA 3N2EA 2OFWA 2J0VA 3BD9A 5TR9A 1ZU4A 2NPIA 3KUDA 4ERNA 1W0JA 2CK3D 4UAJA 1OKKA 3B1YA 4A6XA 3AGPA 2RGXA 4D80A 1IXRC 2BV3A 2QGZA 3OEEA 2WJVA 1P72A 2GAOA 3IQWA 1A7JA 1D8TA 1G8YA 1VQ9B 4A0RA 4D4MA 3ZZ0A 3BH7A 2GK7A 4TL8A 1O87A 4NBSA 5J5CA 4HZIA 1KKLA 4IRUB 2ZYTX 2J59A 2VTKA 5JJIA 4CT5A 4Y0AA 1C9KA 1C1YA 4L16A 4ZIRA 4O0MA 1KZGB 4BRUA 1PZNA 2B21A 2BBWA 2GTPA 2R6FA 4LC1A 3DZ8A 2D2FA 1AGPA 4DEYA 3I8XA 1GRQA 2A5DA 4HYYA 3FVQA 4V03A 2SHKA 1ESNA 1KNXA 4CVNA 1RYFA 2WJGA 2HYDA 4PHFA 1FNMA 2J87A 4L4UA 1QVFB 1DVRA 4K8OA 4PTLA 2BM1A 3TRFA 1MO5A 4FMBB 4PC1A 4EPVA 2XSZD 4GOXA 2C8VA 1G7CA 5FTNA 4GNKA 3U61B 3EARA 3NHAA 4KSBA 3LW7A 1XX6A 1RZ3A 5EE0A 5L3QA 3OFNA 4IEEA 4PC6A 4DLVA 5IK2A 2IXGA 3FPAA 2Q9AA 1RPZA 3LRPA 3JZMA 4AKEA 2IEYA 4NYIQ 4H1UA 1Z6TA 4KYUA 1NMXA 1S9DA 1W36B 1YU9A 1TQ2A 5FBVB 5DLQC 1M34E 4NCNA 4JLJA 5C2JB 1ZVQA 1R5OA 4R71A 2IWHA 2ZR9A 1QFYA 1P7CA 5HE8A 3ICEA 4DLZA 1TF7A 1KJYA 1BOFA 4TQUS 1R2QA 4XJXA 2XXAB 2BBOA 2NZJA 5EUQB 4TTQA 3SJAA 4BFVA 2H57A 3K0CC 2TMKA 2B8TA 3BH6A 3EG5A 3KQKA 5EP2A 2QA5A 3EXAA 4ZDJA 1CJTC 3TW4A 2RGAA 3Q8XB 3ZVMA 1G1MA 5KHOC 2CRVA 4FCWA 2WWWA 1DDIA 3CRRA 4GP6A 1UKZA 3CB4A 2OHFA 1VQ8B 5D3MA 1W47A 1Q82D 3H84A 2J1LA 2E1RA 4PPNA 4S2EA 1G5PA 4D6PA 2JJ1D 4TT3D 4DRZA 4QJ5A 1ZJ6A 4AWXA 2LCFA 1JR6A 2PZGA 2Q21A 3MD0A 1G20E 1KDTA 2JJ8A 1LF5A 3BORA 4L8GA 1YITB 1T6NA 3O47A 3THXA 5GVSA 1FTSA 1UAAA 1AS3A 2ZYWX 2QQ0A 3LQQA 5EZ5A 5B57C 2JIZD 5EE9A 3E1SA 1KK0A 2ZAMA 1KI4A 1XTSA 1CLUA 2VNJA 1M7HA 4JZKA 3Q85A 2GWHA 1XJCA 1OXSC 3K70C 5AJVB 3OIUA 1QBKC 1NLFA 1SVKA 4P0TA 4ABYA 1YZQA 4BECA 4DLYA 3ADBA 3CM0A 2ASEA 4RJLA 5KOYA 2B6HA 1KZ7B 5E3HA 3TSOA 5BWMA 1H8ED 2QZ4A 3IILA 4HAUA 1G18A 4E03A 4AY2A 5AK0A 5EZ6B 2IXEA 2GJ8A 2KB0A 2WOJA 3K8YA 3QENA 4Q1FA 2R62A 1NIPA 1QHHB 1W48A 2W83A 3AV0B 1KSHA 2V6JA 3BFKA 2D7DA 5K8TA 2O8BB 1RVDA 3BGWA 2WKQA 3RAPR 4C0HA 3UMSA 2NO9A 3A36A 1TF2A 1A8PA 3RYTC 2ANCA 1KIMA 4HB0A 1Z2CA 1WMSA 3WMFA 5JI2E 1GNRA 1ZIOA 2HF8A 3S1AA 4G01B 1NF3A 1G19A 2CL7X 5CM8B 2VP6A 3QNUA 1EK0A 2IW3A 2QTFA 4XVRA 1M7GA 2GXQA 4B43A 4P4SB 4DZZA 2CL6X 4MRSA 2G1KA 4F91B 4B3DA 2QRNA 4AKGA 3CPJB 3GLHA 4LC0A 4KLZA 2OLKA 1AZTA 2WAXA 2YOGA 1F6BA 2VSXA 3F5FA 4RD1A 1YRAA 1T5LA 3C8UA 4MYUA 2EYUA 3ADKA 4KBGA 3REGA 2N46A 1OF1A 2JJ1A 5EE1A 4TT3A 4Y0VA 1GRRA 3IPYA 4Y9RA 1NIJA 3OESA 4Q9KA 2CVFA 1VQOB 3WYFA 1GITA 4NYMR 4LV8B 4D25A 1NVVR 1Z83A 2F1HA 2HXYA 3T1VA 1UEIA 4BPRA 2F9LA 2BMJA 4IOJA 5GJWC 4ARZA 1JA0A 3W2FA 2F43B 3P1JA 3Q9LA 1NN3A 1N3BA 2PX3A 3LBNA 3LV8A 1QUEA 3R8FA 2D06A 4QGHA 1LTQA 1SXJE 3NH9A 3AVWA 2PH1A 1MR3F 1FMLA 3CO5A 4P4UA 2ZI7A 4F4JA 4I1VA 2UZIR 1PUJA 1UFQA 1VCOA 2GCPA 5SZHB 4UQOA 3GLGA 5JRJA 1KJZA 1QGAA 5IDVA 2ODWA 4ZIRB 3B1XA 1GUAA 5THXA 4S35A 3CH4B 2DWQA 3QY0A 3ZYCA 2GBLC 1FMJA 2IXFA 3CF0A 3HU1A 2FZ4A 3TUZC 4U7DA 2HT6A 2IUSA 5J4YA 3KJEA 2ORVA 1GOTA 4LJYA 4Z51A 4MGIR 1ZC4A 1F2TA 2P5SA 1P4SA 1W5TA 3GEHA 2PMKA 2OBLA 1UF9A 3QXXA 1KI1A 3DOFA 4TYQA 3SFVA 2VHUA 2ZROA 3GPLA 3P4YA 1I4LD 4ILEA 2PZFA 2X1VA 2BOVA 2CNWD 3RS3A 2CNDA 2P67A 4ZDIA 1YRBA 1QH0A 1NKTA 5CB6A 5L3QB 4JLAA 4LDJA 4PHTA 3DPUA 3KXKA 4DSOA 2HT1A 1YKSA 3UKDA 5IHPA 1LS6A 4JT4A 3MWYW 5DYIA 3GLIA 2QRZA 2OZEA 2ZI5A 1WQ1R 2R6GA 1UKYA 1BH2A 2H1LA 3EAQA 3IIKA 3K9LA 4IFEA 2VZLA 1MO3A 2OEPA 4DWJA 1T3HA 3K70B 1W34A 3SN6A 3CR7A 4XWKA 4IOLA 5KDDA 1OH5A 3WNDA 4BFWA 1NBME 2RH5A 3FOZA 2VL7A 1FFHA 1UBGA 3Q7QA 4PHGA 1YZGA 1N2CE 5FTLA 1Z29A 1N0WA 4TMTA 3A1UA 3I73A 4BFZA 1GNPA 1Z6XA 2PJRA 1PJRA 2ZTSA 1QG0A 2ZU0C 4TMKA 1R8QA 3NC0C 4V0OA 4DLWA 5E95A 3LAWA 3LBIA 1LW7A 4Q7LA 2QA4B 4NMMA 3FHCB 1UPTA 2VHCA 5HR5A 1NN5A 3L8ZA 3PEWA 4F4CA 3A58B 2VP5A 1F48A 2OXRA 1Z06A 2MMGA 2ZJZA 3QF4A 3R9WA 1D2EA 3OAAA 5FI0B 2BSAA 2OFXA 1JAIA 4Q1DA 2J41A 4PO9A 1KK3A 3P27A 2FV8A 5GJVC 2G1JA 3ZH9B 1IOZA 1D9ZA 2ERXA 3CPWB 1ZW6A 2IYVA 3A1TA 3B9QA 4OQXA 2PEYA 3W8NA 1YZNA 5AJWA 2KSQA 1OSNA 1TU4A 4HLDA 4DBLC 3SJBA 4FI3C 2W2XA 3X2SA 2Q0HA 5JCPA 5KNDA 2XNCA 3THXB 2XTZA 2ZUCA 4PHHA 3U2QA 2QDXA 5FBWB 3WBKA 4E22A 1JJ7A 3T5DA 4OK5A 4A4DA 4IVRA 1JJ2B 3ES9A 1Z0KA 3M6AA 3LA6A 4TWZA 4YAOA 1IQPA 5EP1A 4AKHA 3RS5A 1AIPA 1E2EA 4NCKA 1KQSB 1JR3A 2CCGA 4UJ3A 3CNNA 2Y8EA 3HP1A 5CLQA 2W2TA 1LVGA 2P6UA 3GJ6A 4PAMA 4R2IA 4EFNA 3O8DA 2J0QA 3B78A 2V54A 1E94E 5KNBA 1DTSA 4QOSA 1OB5A 2FFQA 4DLSA 3ZVRA 1XTIA 5J40A 2V3CC 2YHSA 4RD3A 4IFBA 3LLMA 3CWZA 4LHZA 2X2EA 1EG7A 3REFA 3B5JA 1P73A 2YOFA 3M4YA 4WXRA 1S3SA 1IHUA 3PV0A 4DDVA 4PSVA 4P6VF 1OXXK 1Z08A 5C4GB 3EC2A 5DYGA 4ZI2A 4HB3A 5IF9A 3IGFA 1IAQA 4Z54A 3N70A 1YJ5A 2WJIA 1HEIA 4YC7A 1E99A 5KSZA 2O5VA 3K0FA 2QGNA 1JEDA 2GK6A 4JL5A 3S1AB 1W4RA 3W2IA 2VRWA 3CMAB 2XOKD 4OJKA 2GQFA 3C4JA 2BF4A 4US2R 5AJZA 1UBFA 3KFVA 4TYYA 2H7VA 4RZUA 1N0VC 3U3MA 1VG0B 2WJHA 1M90D 4HDQB 1JECA 2W6JD 3DKPA 3RNLA 3NC1C 3LO8A 4LBZA 1RE0A 3GLHB 3KQLA 4ZGNB 3FKQA 3VO2A 4POAA 3TKLA 2WWYA 4MITA 1RRFA 1LNZA 2CBZA 1W5SA 2QE7D 2R8RA 3QXJA 4MYHA 4DCVA 1EGAA 4TN1A 1DOAA 2FPKA 3ZD7A 1DADA 3VU9A 1E0SA 5FR1A 1XXHB 4OI0A 4M9ZA 1E2HA 1G5RA 1OW3B 5HTKA 5BQ5A 3VTKA 3IO5A 1TUEA 3CBQA 2WSSA 2R9VA 2H5EA 3TMKA 3WYGA 2ODNA 5P21A 2BMWA 1N5IA 1ESMA 1M74A 4EKDA 1P75A 4LSGA 3SE0A 1V43A 3U3OA 1XE1A 2K5UA 3RSLA 5KSWB 4HAXA 1XRJA 4KU4A 4PQYA 4QGGA 5FA6A 2A5FA 4B75A 2ANBA 2DEUA 3EX7C 1EFHA 2ATXA 4YMSA 3ADDA 1PVOA 5JEDA 4M1TA 1DARA 2A3RA 4BLRA 1DAGA 2ZI6A 2QP4A 1XEWX 3GLGB 4IEIA 2QM8A 3KXIA 1DELA 2BC9A 4DUGA 1CBUA 4D26A 2FPLA 2O8FA 2VBCA 2AK3A 4K1XA 5TV2A 3LLUA 5CDFA 1ZIPA 1E32A 4RZ2A 2AD5A 2RGGA 3T35A 1G7RA 1XEFA 2WHXA 2ZRAA 1OYWA 3DEFA 4URWR 1T0JB 3FGNA 1QF9A 2EFHB 4G5SA 1NDHA 1LF0A 2NPFA 2GJAA 1LV7A 2JGNA 1F2TB 1G9XA 3AKCA 3ASYA 1D5CA 1CR2A 4G5QA 4L9WA 5FOWA 5JBQA 2IK8A 2WAYA 4JBYA 4TTPA 2PX0A 1OE0A 4BZPA 5L3SA 2HYIC 2WM9B 4CYMA 3BS4A 2RGNC 1P9NA 2A5JA 3B1VA 5DHAA 4US0R 1SKYB 2OCAA 1LS1A 3UG6A 4B3BA 1DAHA 1E2DA 3A4NA 3VNUA 1FUUA 5J4VA 1Q3TA 1G291 3MUFA 1FW6A 2BN4A 2XOKA 4FD2A 2FSFA 3FKSA 4CIDA 1MABB 4D0NA 4DCSA 3L0PA 3FTQA 1J99A 3C15C 4IDOA 4LYHA 4BLQA 3OEHD 5CK5A 3ASZA 4GOKA 5G40A 1COWD 3W5JA 4Q7KA 4TL9A 5E4FA 4CRWB 2GNOA 2QMOA 1W44A 2JA1A 4NYJR 5EJEA 5KPJA 1EXMA 2ZE7A 4Q01A 1E69A 2OG2A 2EFGA 3LVQE 1DAEA 3OZXA 2RC6A 3EA5A 2FN4A 2GVDC 3G5UA 5J4HA 3LXXA 2FSHA 5D3QA 1VYTA 3GLFA 1W0KD 4XTRA 4GMDA 4G1BA 2C78A 2W2VA 2ZS8A 1TQ6A 1P6XA 4WOPA 1YIJB 1NLZA 5F2EA 3T12A 4QGAA 4QFMA 3G4SB 1XZPA 2I3BA 2Z5FA 2C9OA 2GRJA 1VG1A 3D3QA 1Q22A 4N0DA 3G0HA 1TU3A 4F7WA 1FNCA 1YQTA 3CIOA 4X8MA 2BGJA 2ZI9A 1NJFA 3QF4B 3P32A 3AF2A 3VKHA 3WNBA 4E09A 3RABA 3OIWA 3HU2A 4FMCB 1Q12A 3DOEA 2RCNA 2IS6A 2OSBA 4RKFA 4WQMA 2C5LA 2R65A 3GEIA 1G3UA 3QVUA 4EPTA 5JWOA 2BMEA 1QUFA 2WTUA 4H9GA 3TQCA 4R2HA 2H92A 1P60A 4RKEA 2YV5A 1B23P 4KV9A 2BCGY 1ZRHA 2L0XA 1CTQA 2QSYA 3TAHA 4FWTA 2J46A 5JWRA 1NY6A 1BIFA 4OJQA 4O25A 3W9YA 2IUTA 3T1QA 4KJZA 4BEBA 3LD9A 2C2HA 2ZRFA 2ZU6A 1YZLA 3PEYA 3C41J 2D7CA 4PSAA 3A8TA 2OK8A 1HA3A 1L7VC 1N25A 3QVVA 5FTKA 4ZKEA 1KMHA 1QHNA 4JSTA 3MMPA 1RRCA 2MSCB 2Q3FA 2YZ2A 2FOLA 5CJ2A 3ZGXA 1AN0A 1NG9A 4UXJA 5FFMA 3OEHA 3RC3A 5KU1A 4EAQA 2VIIA 5GV7A 1XD9A 1KHTA 2XAUA 1JNYA 4U00A 2EYQA 1L2TA 3B1ZA 3D31A 3I32A 3VFDA 3QPVA 3U60B 4D0GA 3T1TA 2FGKA 4LYFA 4UNPA 5LPNA 2IS2A 2QI9C 5DI3A 1XNJA 1VCNA 2UKDA 4CW7A 1P2VA 5LBIA 1SVIA 3K0FB 1VCMA 4MQBA 1Q21A 1W0KA 4QC2A 2C04A 3SNHA 1KI6B 2ZJ2A 1M6NA 5HE9A 4HZUA 4KITB 3L8YA 3PFIA 1N6OA 2WIAA 2GHIA 4E07A 4JBWA 4TZ0A 3AUYA 3RHFA 5A4JA 2ZJ5A 2BHRA 1EESA 2QAJA 3T06B 3IEVA 1RKBA 3A6PC 1R5BA 1Z2AA 1FPMA 1WBDA 4II7A 1G3MA 1ZU5A 3JVUA 3GJ7A 4LJ8A 2HJVA 4C0LA 4FMDB 2O8CA 1KK1A 3HYRA 5GJCA 3W5UA 1O3YA 1HQCA 5TB5A 4RZXA 2BCJQ 2PT7A 3WRYC 2B8WA 1EFTA 3VU9B 5L8VA 3EC1A 5CM9C 5H5JA 1E3MA 1U0JA 5FUYA 4B2IA 4BFUA 3BXZA 3FPKA 1CS4C 1Q57A 5JLJA 2PCJA 4XVUA 3IO3A 1XTQA 2GVZC 2DFKB 1J70A 1KK2A 4KFUA 1YE8A 4RD6A 4PR0A 4DIDA 3ADCA 1J8YF 4IXMA 1A4RA 3GJ4A 3U6KA 3PUXA 4M1SA 1N6LA 5JSZA 3GFPA 4A2PA 4EJSA 4WAUA 4CEJA 2YOHA 2D4HA 3CRVA 4U02A 5E7JA 1E62A 2GEUA 5JHHB 4C0AC 1QGYA 2QTLA 4FW9A 4G0NA 4GBMA 2QT0A 5ELXA 3KZ1E 3MJHA 3I62A 4ZCIA 4V0MA 4LPSA 1E9SA 2O8FB 1TLLA 2BWJA 5FPYA 1EFCA 1J2JA 4QBIA 3BB3A 3OZVA 4BEJA 2OUKA 1ZUHA 1JQJC 2DERA 1G4AE 2OCPA 3NDBB 1SVOA 4JYCA 4JYBA 1CJMA 1RJ9A 1YR9A 3GMTA 5HCNA 1GJRA 2OAP1 5CYOA 4EFLA 3UPUA 1ZCBA 4DIEA 4C7OA 2JJ2D 1KMQA 2Z43A 5EP3A 3B7GA 4I99A 1G21E 4TLAA 5F9FA 1F3OA 2A5GA 5G3YA 2RB4A 3LX8A 1FX0A 1JPJA 1EX6A 3AKEA 4PPFA 1EFRD 3C5CA 2VP0A 1CJKC 3PUVA 2JLVA 4Q1CA 4WVFA 2PBRA 3EZ2A 4C0JA 1K6MA 4NCJA 2P2LA 3AGQA 4B6FA 1R0YA 3NBXX 5AJXA 1JB9A 4G1VA 3H2YA 1FRNA 2CDNA 2IYTA 3P20A 2IHBA 4X8OA 3RS2A 4JIMA 2WKPA 1TF5A 3TE6A 1H8HD 2RGDA 3KL4A 1RIFA 4HE5A 1E2MA 4XH9B 4P32A 2X77A 4FINA 4IDHA 3SEAA 2BJVA 1R10A 1HH4A 2X3UA 3EA0A 1LB1B 3GLFB 3R8CA 4FK8A 3H1TA 5L3VA 1VYUA 3GLHE 4Q9LA 4HDCA 2RMKA 1KSJA 3AF1A 2QEXB 4LZZA 3OZWA 1US8A 5HKKA 4B4DA 3OIYA 4CEHB 1W35A 1K73D 4IVQA 4JVNA 4DEXA 1E9EA 1VYVA 3QKRA 5DN6D 3K1JA 1QHYA 1DS6A 1XXHE 2HCBA 5FUWA 4QJ3A 3B82A 4FCVA 4XSHA 1JBKA 1CRPA 1NI3A 3FB4A 5FOVA 4KFRA 1SHKA 4HLQB 3ICQB 2Z83A 4KYIB 2CK3A 2P3SA 2Z4RA 4LRWA 1XBTA 4RSGA 3UANA 3QG5A 5JFGA 3AVXA 1GP2A 2VQSA 2V6IA 1JB1A 2PLRA 2QP3A 2OM2A 3ECCA 3QXHA 1G8PA 2CHQA 3RSOA 3W6OA 3FDIA 1XD2A 3N5CA 3NEJA 2GCNA 4DT1A 3HU3A 2NO1A 5LDDC 1SZPA 1U8ZA 4NTZA 5F3WB 1N5KA 3A4MA 1U94A 2GAAA 2KJQA 3IBGA 1NVXQ 1S3GA 2JJ2A 4Z8YA 2IYSA 2BPOA 4X8HA 4OHZA 1XEXA 2FJUA 4TYNA 1H85A 2WV9A 3WRXC 4W9MC 4PO1A 1OGJA 1KMHB 4P33A 5LB4A 4YHBA 1IM2A 5EXSA 2RHMA 4Q18A 3GP8A 1QDEA 4TMVA 4URXR 1G3IA 1X8LA 3CNOA 3C5HA 4DLXA 1N6HA 2V9PA 3IDQA 3CONA 2VEDA 1A1VA 4HLCA 4AF6A 2GXSA 1E98A 5DGXA 1JXMA 2HCJB 2XSZA 2PEZA 3OIVA 3SBDA 4U9UA 3MCAA 2V7QD 4OQNA 4A2WA 4HUQA 4D81A 1H8HA 1QVAA 3CWQA 3TBKA 5KNCA 5DI3B 3DMDA 4IDQA 1KO4A 3OW2B 3HPRA 2QSZA 1FDRA 1H65A 1XDBA 2DB3A 4QHTA 2FPMA 3CC4B 3AKYA 3LXRA 1FP7A 4TMZA 2JATA 2ZJ8A 3HDTA 4HZUB 3CMEB 4DVGA 1VMAA 1OV4A 4NU0A 2VYFA 2XNSA 5JI3E 3VNVA 2Z4SA 3CRMA 2GILA 4F93B 2KE5A 4LJ7A 2YJTD 5HZHA 4LCBA 2GXAA 3CZQA 2ZRKA 3KKPA 3Q72A 1TADA 4CEIA 2O8CB 5JJLA 4JL6A 5JS8A 2BVNA 3RRMA 2ZIAA 4IJMA 1UBCA 1UADA 4WBSA 1J7KA 3IIMA 4DKXA 4N0EA 4OHWA 3CD6B 1N6IA 4K81B 1Q1QA 2DWPA 3PUWA 2XEXA 2VNKA 1B2RA 1OPXA 1J8MF 3WNCA 1XMJA 4H1VA 3W6PA 3ZQ6A 5GV8A 1V5WA 5KDOA 2CLCX 3B13B 2REOA 3SZRA 4A1FA 2PJZA 1SVSA 2AR7A 2FG5A 2J7KA 4J0QA 3LVRE 4YLGA 3TH5A 4F38A 1XCPA 1DDGA 4MRNA 4URVR 1NSTA 4DC9A 2CLDX 2NO7A 3LH5A 2ZITA 3E1YE 2EWVA
chains in the Genus database with same CATH superfamily
5DWQA 3UFXB 1V8PA 2ZBEA 1ULHA 5FRDA 4YV0A 1VQ4B 3P9ZA 4R68A 2BIFA 4XCVA 2CEKA 4DDKA 2BM8A 1M34A 1QFSA 1XRPA 3DNFA 1KO5A 3FPLA 2GCOA 3L6CA 1OAOC 2XVMA 1K92A 4UC0A 4DSZA 3ODPA 3E2IA 4GPAA 3K0AA 2FEOA 4RIHA 1N2HA 4BP1A 4LYEA 5D51S 3DAGA 4OK3A 2FY8A 4J16A 4O5OA 1TW3A 5EFOA 2VT3A 4J4BA 2YZNA 2RGCA 4TTJA 3BX1A 1GNQA 3K5HA 3ET4A 3QUCA 4LS3A 1H8EA 3D7RA 3IP8A 3COZA 2ZIXA 5IJWA 1PNVA 3G5AA 5B4TA 1SOAA 1EG2A 4GXRA 1NVWQ 1ZGGA 4PGFA 3R0QA 3BCHA 5AWFC 2FR8C 5IAKA 1G64A 3JQ8B 4YMWA 1R1DA 1ZZGA 3LCRA 3RVJA 2YUTA 4RDIA 3ZDEA 4BO8A 1PZHA 5HS4A 4PRLA 1QK4A 4E7PA 3UICA 3MHTA 1H5QA 4RUKA 2ZWAA 2OV2A 3T9DA 2ZRHA 2BM0A 1U0HC 1P9RA 1UXJA 1COZA 2JGDA 3TKAA 3EVZA 1TUBA 5FOTA 4N3CA 3FPGA 3CLTC 4KP7A 2Y1GA 3WWEA 2H7YA 3O0TA 3AF5A 2VJDA 1H4SA 4R1OA 1WSRA 2NUBA 4HWTA 4LY6A 1OWOA 3CF4A 1PYOA 1QPGA 1U1EA 3DNMA 4QNRA 1L8QA 3JYQA 2HRBA 4YJFB 5DHSA 3B1FA 1CUVA 1M54A 1MX3A 2F17A 5AVJA 3U9LA 2FFAA 2FN9A 4UASA 4UW9A 4BMCA 2ONYA 1TIKA 2FA9A 1DUVG 3B3QA 3MINA 3ETDA 4DE5A 1RAAA 4DR5B 1YONA 2JBAB 2IJGX 1NYLA 1SXJD 3TIVA 3QFRA 1EUZA 2PUVA 2Q5CA 4L75A 4OQEA 2J6IA 4YDSA 4CR7A 5FO0A 5IM4F 3V6LA 5DSZA 5I4BA 3DLAA 1PD1A 2SCUA 4CL2A 2AYYA 3DQQA 5ALIA 4RVNA 2PUAA 3U6BA 3R74A 4RTJA 4CV3A 1P0CA 4M9SA 1U7XA 2A0FA 4UPVA 1KFJB 4R98A 5ADUS 3ZGVA 3JR3A 4B1FA 2C7OA 4C2TA 4PICA 5E7MA 3RGGA 3P2YA 3ZZNA 1XAHA 3AF4A 4JB8A 4O3MA 1JDVA 1ECCA 1VA5A 2V58A 2Y27A 3FR8A 3ZHOA 3GYBA 1FOEB 3T6KA 2CFSA 3C1OA 1KVRA 2OO5A 2XQVA 3CCCA 4ZZ1A 3JQ7B 1WOSA 4M7RA 5K0ZA 3LWBA 1OZAA 1MEEA 4RVHA 5BSHA 4C5BA 4JJKA 2OWDA 3RYHB 2Q2VA 3QOFA 1A9PA 1TD1A 3H5OA 5K3EA 3JX9A 2IOQA 2EX0A 2WD7B 1PJ6A 1EHIA 1ENPA 1JXOA 1JHOA 1WA5A 4L0DA 5TT1A 5JARA 1UKEA 1MVNA 1ZCZA 3KIPA 1VLVA 4OP2A 4CTOA 4HHEA 3HEMA 1J0AA 4Y1RA 5LDHA 3DR3A 2YS7A 1A9SA 1GTVA 3PQ5A 4Q1AA 2ZAIA 1DO8A 3MGCA 4LX0A 2O5EA 2D0OB 4H7DA 3CTAA 3D8NA 3QFFA 1SO8A 2HX1A 2ZJ6A 4JI1B 2DFDA 1N6RA 1XCBA 4P7KA 3DBLA 5T6MA 3EMKA 3UNXA 3M6XA 3ZE8A 5BVGB 5F7JA 4JLSA 4QVJA 2ZBDA 4CRWB 4MVJA 3C6BA 5CHEA 3UV6A 3VO8A 1VJCA 3Q15C 4RORA 2GXUA 1V5VA 1WDKA 2WWTA 1TAGA 1X7WB 1ODLA 2IL1A 1T8UA 2RAFA 4HUQB 3CRZA 4EX7A 5JASA 2DETA 1XYGA 3OTWA 3E5RA 3ZDZB 2V7TA 2REQA 1DG3A 3N9IA 4AJEA 1J25A 3C3CA 5E7IA 3GT7A 3M3PA 1YZ3A 4LZOA 4MYCA 4BC1A 2FWJA 3FFBA 4D8VA 5JNUA 3EZLA 1GKYA 1VQ7B 3KSUA 2X76A 4E1BA 1A95A 2FW7A 3K7EA 4RVSA 1J21A 5C32A 3SC2B 4K1LA 2PY6A 1SXJA 2V0GA 5D5QA 1W4BA 4HATA 1TM1E 3WYEA 3AONB 1VQMB 3MOGA 1JQLB 3R0IA 5AHWA 1L9XA 4MW1A 3PUYA 4V0LA 2PU7A 5IYWA 2IODA 1WVMA 3S2GA 5KKAA 3ZV6A 3TEFA 4A1OA 2ET6A 1U3FA 1Q44A 3WICA 4L74A 3H5RA 3G2LA 2ZZEA 2O1WA 4MUAA 4YMIA 3FNIA 2XNJA 4RD2A 1QZXA 3BJIC 3QK7A 5CT9A 4HNAA 5FD8A 1H6DA 2HRQA 1SBZA 2UZ1B 3OPVA 3NPMA 3UA3A 3ORRA 1OASA 4B5LA 3CXCB 4Z9XA 4GZMA 3TZ6A 1CRQA 2FXIA 1PT8A 1FXWF 1SQSA 2DHRA 2IHJA 3A9CA 3I09A 3N2IA 1ORRA 4NZ9A 3UC9A 1GAJA 5BUZA 3T1YB 4C0SA 2LKDA 7ADHA 3AB3A 4N0DA 1RQXA 4BQPA 3OQJA 4QTYA 4D56A 5K09A 2IE8A 2B4QA 3NRJA 2B9VA 5HGXA 1BVHA 1FDOA 1T0HB 2J7PD 2OCBA 4TUYA 1A9YA 1X8JA 2PS0A 4NC9A 4BRWA 2G07A 5ENDA 4RCYA 2YN2A 3EIHA 4F56A 4B32A 1MQ8B 1ZXXA 3PUHA 4I1YA 5B3KA 1NATA 5SZJA 1Y7IA 3I9JA 3JVVA 4QRDA 1FNBA 3OOYA 4AM8A 1G5QA 1F6DA 2EXXA 1NWCA 5EZYB 4S1PA 2B1GA 1FUKA 1PYGA 1BJKA 2VATA 3KWJA 4EWLA 3A3NA 2BEJA 1MOSA 1NVVQ 4GWKA 4KPUB 1N78A 4AX8A 4LYAA 1E3EA 4X65B 3GGJA 4L27A 4OXKA 3AR8A 3T7IA 1ZOSA 4NPCA 2GD1O 3EUWA 3KKQA 5FBRB 2LIPA 3IXMA 4REQA 2WOOA 3NIDB 4MUJA 1M2OA 1IQUA 4MXDA 1T4MA 1YNSA 3LYHA 4DJTA 1G6OA 1N7JA 1LWNA 1ZH6A 2IVZA 2NXEA 3G9ZA 1HORA 4IEFB 4XEUA 2MOKA 1F8XA 3OT5A 4HDOB 3SS9X 4BP9A 1J6UA 4DSNA 4JXZA 1RQ2A 2FK7A 4DL9A 4EHDA 4YRDA 1NXVA 3U0BA 2CE7A 3E7FA 1AKVA 2B4YA 5JS2A 1M0TA 5F2KA 1ADBA 3QHAA 4MGYR 1SXQA 1F3LA 5FL3A 2VCEA 3VKWA 4LQDA 3OJWA 4JLDA 2AG6A 5HIKA 4MYDA 1SULA 3L8FA 1ZN7A 5ITWA 1UDRA 4GLBA 1KO7A 1EK6A 3WK6A 1BAPA 1VQPB 2QL6A 4PLYA 2VDRB 5EXXA 3JD4A 1ADCA 1JH8A 1TNDA 3OETA 4Y9DA 2OCLA 4R05A 1I13A 3C4VA 5LIRA 3TLGB 2OB2A 5KJEA 1CULC 1J09A 4N01A 3A0UA 5HXBA 4QU8A 3D9QX 3SK0A 4B2PA 1I2ZA 1E6KA 1O89A 4GWLA 3ZD8A 4CHTA 1C30A 2KI5A 4UTXA 2IVFA 3Q6QA 1Q81D 2UZ3A 4XIIA 5FNVB 5GONF 4N76A 1Y4UA 2ZZKA 4X93A 1P77A 3HJUA 3V8VA 4CG2A 4H18A 3AETB 3I56B 5K8IA 1WIWA 5DGHA 4LISA 3OJLA 3PENA 5LD2C 2P8JA 3T94A 4CMEC 3CC2B 2NZUG 2QVZX 4LHVA 3ZY3A 5HF8A 3ZYZA 2QE6A 2XWBF 1AN9A 4BTEA 4DN6A 5HK9A 3EZFA 4RGQA 3WISA 2AW5A 3KT6A 4D4JA 2CT8A 3NHJA 2QE7A 3CZ4A 4NU6A 1C7JA 3ABRB 2B61A 2JVKA 1I7PA 3EQZA 4NLLA 5F1YA 3V48A 3PGXA 5KTOA 5IJ0A 1BCRA 2VBGA 3F47A 3BSYA 2XPCA 4AZTA 1KNQA 1X7ZA 4TWIA 4Y2XA 5HMMA 4YCMA 3BZBA 2E18A 4P80A 2PSEA 3BFXA 3RY8A 3MLEA 2IGBA 3PHHA 2ERCA 4I9HA 1DRWA 4JBIA 3EXIA 2B78A 5JDIC 9LDTA 5IVKA 3QEMA 3HABA 2H8GA 2PS3A 2AR0A 3T3PB 2AOXA 3X44A 3K71B 5T41A 1HR0B 4NYIR 1TJYA 3H7AA 1WUIS 3KTFA 5IYZA 1A4XA 1CXZA 1MH1A 5BW5A 4EEKA 4AICA 5JALA 5K0NA 3J7AC 3AVQA 1CCWA 1E6MA 1AS2A 2ZRQA 4UVIA 3V80A 5JD6A 2XGJA 2XYHA 3I6IA 4RV9A 3FKJA 5AICA 1SN7A 2QTZA 4AF7A 4Y7DA 2C03A 2QN2A 3SYMA 1ZJ4A 1VMIA 4E94A 2IXAA 3Q39A 1GEEA 2GVNA 4RH0A 1D1PA 4UHDA 4KCGA 5IC4A 4F04A 2BGWA 3C8MA 3TR5A 3TB6A 3WA7A 1R4MA 1T8TA 2F1OA 3FYDA 5GMOA 5H16A 1CVRA 1BWPA 4A2QA 1S9HA 1ZM9A 1YUBA 1LRLA 1MF7A 2XHEA 2ZYVX 5KEIA 1DG1G 2HK9A 4Z4IA 2CJWA 3ZLVA 1EUCA 4Y1FA 1V8FA 1C1HA 3DEYX 2J9FA 2J5XA 4LXYA 4L0MA 2QV7A 2ORIA 1KR2A 4QWWA 4HNRA 1V5EA 2HR1A 1A98A 3AEXA 4H1HA 3JZIA 4HSEA 3MJTA 1VL6A 1TB4A 4K3UA 4ZQBA 4PPYA 3RIHA 3M81A 1RVV1 4YJKA 1MX5A 4L4XA 5K8UA 3P0EA 5J58A 4UBMA 2WJYA 3QSYA 3GCXA 2HXSA 2J3KA 1I4OA 2GN4A 4QXMA 2R6AA 1MJGA 2YV2A 1TL7C 5DCLA 2PCLA 5BW8A 5MFZA 1U02A 4QG7A 2HF9A 3IALA 1IY1A 3I04A 2N75A 1T5TA 4YQEA 5CBPB 4DRYA 3C3XA 3JASB 3F7OA 3EGDA 3L6EA 1CJSA 4UQPA 5C7YA 4EENA 1SA0A 3UJ8A 1RWNA 4DLKA 1N0UA 5JAUA 1YV9A 2QVXX 4G86A 4JYZA 1R0SA 4WKGA 3EE6A 3KRTA 2AQ8A 5EVCA 2ZZQA 2EDCA 3V1KA 1GN9A 1JLHA 2ZXFA 2DY1A 2V7XA 2XUAA 1B73A 1I6KA 3NWJA 4CF7A 3PUNA 3WLLA 2KBEA 4PX3A 3HBAA 3FJ1A 2IV7A 4ZHQB 2IYXA 3C3MA 2IX9A 5JOQA 4H17A 3ZWCA 1IY8A 1DBIA 5LA6A 2XMGA 4TGLA 4YAUA 3VRHA 2RAPA 5EKUA 1C1DA 1WU8A 3EHEA 4HWPA 2H4XA 4NH4A 3X1ZA 3EW9A 4KKSA 1AQIA 4DTIA 1VDZA 2FETA 4Q93A 2QW0X 4UM5A 3RT7A 1F9AA 2H5LA 1Q1AA 2ODBA 2BZ0A 4QBKA 3JQPA 1KY3A 5CVCA 3GROA 2NU8B 1EDOA 4JSRA 4W6QA 3ITEA 3R7WA 3TM4A 3WWDA 1BEUB 1TA0A 4F11A 1H69A 5LD2B 1H2HA 1SHTX 2HNKA 1ML3A 4W4TA 4Q21A 4YT4A 5IULC 4XDZA 4Y6SA 3W6NA 4M22A 5T5QA 4HWOA 1Z7EA 5G1NA 4Q9IA 3CCMB 4KQKA 4CMCA 2V7UA 4HCJA 4OUKX 4AZ0A 3O8RA 1DTWB 1XMIA 3A1EA 4EQ6A 4CNBA 4RLQA 3HNRA 1UZAA 1CY8A 2YL2A 4XUEA 4UARA 4BQNA 4DCUA 1E2FA 2UAGA 1E2KA 1OLOA 1RZUA 3G68A 4K9PA 4EMTA 3OFND 2VJBA 1YR3A 3CCJB 1IHYA 5JPCA 4XQ9A 1NXPA 5HKBA 1L3CA 2FPGA 4U2GA 2LXNA 3IOEA 1W93A 3IELA 5KIAA 1HEYA 1DKPA 1R9GA 2G9NA 2XRFA 3THWB 1ABEA 1GR0A 1V2HE 2I7CA 4WOCA 3ZCRA 4PAQA 2P3OA 4FEYA 2UVPA 3GFFA 2A7XA 2QAGB 3IV6A 1YZTA 3IBSA 1P2TA 3JZAA 1RYYA 2GESA 1LVHA 4Y9TA 5ERYA 3UW3A 2FNAA 1XYYA 3VDRA 3DHVA 3GZJA 5L3RA 4EELA 1KF0A 3ENZA 1CZHA 3LC2O 5C4IA 1RP7A 1IN5A 4UNIA 5L3SB 3EWAA 1N1GA 5F3DA 4FZ3A 5BSEA 1CR1A 4OXNA 1LVUA 3AILA 1HX7A 1LQ2A 1V8ZA 3CCQB 3IP3A 1L4BA 5BN5B 2WP0A 1AXRA 3KKLA 1PR0A 4TXLA 2VZ8A 1PUIA 5AN9A 2F43A 2G88A 3ANNA 3KOXA 5HA5A 1DMSA 4KTTE 5A7GA 2OAEA 2X1LA 4GYKA 5SY4A 5K0GA 1RC0A 4CL0A 5LQMA 1OMOA 1TEZA 1NXTA 1NMQA 3GDGA 2QJRA 3KT8A 1P7VA 2ZR0A 2J9XB 1TQ4A 4Y7CA 5EYPB 4IHQA 4ME6A 3OZ7A 2JVJA 3QG1A 2QD2A 5IUJC 1T5SA 4D9KA 4C4PA 1KPIA 1A4UA 1QHEA 4NMXB 1G7SA 2JB9A 4YCJA 1K08A 1DWUA 1K5DA 3FI9A 4XFKA 1L4NA 1HE8B 4U7TB 5B2FA 1V8DA 2EGUA 3WHIA 4QXRA 4OQDA 4Q4CA 2VHYA 4QPPA 1N7GA 2QVBA 2P6RA 2G0TA 4LAFA 4NYJQ 3ZLTA 4PYRA 4BTLA 5CRIA 1V26A 1KYQA 4YONB 3VPFA 2B82A 1ZK4A 4G4GA 3K8OE 3LHIA 1PFGA 2P79A 2PT5A 3MGKA 4I1UA 4LYGA 1BS9A 4W7IA 2JFVA 3PEVA 4YP1A 4E31A 5E6SA 4X62B 2LZJA 1JFVA 2IHKA 2Q4OA 3M0EA 3PT9A 1OJ7A 1UDXA 2WUVA 2WUGA 1CQIA 3OPNA 4AP6A 5AVTA 3RR2A 2HA0A 3PC2A 5FV4A 3IJ5A 4INJA 2VT6A 3LLSA 1HEUA 1ZSNA 2DG2A 1EXWA 2G8LA 2ZRJA 4TS1A 5CTJA 5HFAA 1I1QB 2QTTA 4NU8X 3TLZA 4B6EA 6LDHA 2HSEA 2PD4A 2DBQA 3TTSA 4XE5A 3GAMA 1CV2A 2QX6A 3TO5A 3LQ6A 4HG2A 2A94A 3X1XA 1PWHA 5BOSA 7MDHA 5IASA 1XZJA 4JROA 4CIVA 3C14C 4JJGA 1OJLA 2ZBFA 4BO0A 1P5FA 3O4HA 2VNAA 4HQ6A 4KQ6A 3H13A 2A2ZA 4KXQA 2FFBA 3EXHA 3TPCA 1XFAA 2YIVX 4BFSA 2HWKA 4UOQA 4DR1B 2IYRA 1TC1A 4NZZA 3ILVA 1YZKA 4KQGA 3KTOA 4BFCA 2RHCA 3EPLA 2VQFB 3EEIA 1UODA 1WM1A 4MINA 3KVYA 4RWEA 2C88A 1SNYA 3P2KA 4MKFA 4CF6A 5JRDS 5H9VA 2J45A 3KB8A 1JW9B 3DLPX 1XEAA 3HNPA 1I30A 2I6FA 1IU9A 2AYZA 5IJAA 1M1UA 4DJAA 1X19A 2CLLB 4L9SA 1A8HA 1QQBA 3T7RA 5L4NA 4B3CA 1VBKA 5JYDA 4WZTA 4JAVC 4ZOLB 4R83A 3WL4A 1UQRA 3ZEAA 3ZWBA 3DCYA 2UZ0A 1SKYE 4I9FA 5TQJA 3RS4A 4RESA 2YWEA 3EPKA 4R41A 1F0PA 1MA0A 3N59A 1HM5A 2JASA 1G5HA 1TA9A 4UCWA 3T1OA 5EHXA 5KTKA 4P3PA 4Z4UA 4X3CA 2OZPA 1SKQA 2EP8A 3PNYA 4HX9A 3KZVA 2DFNA 4B09A 5JXIA 5LOVF 3UJNA 1Q11A 4EI2A 4IXDA 2GZ2A 1ZINA 2XEDA 1INLA 1UJBA 2YMQA 3L1VA 4Y2UA 1N9ZA 1JN0A 4MAFA 5D84A 1ZJWA 4X24A 3ML1A 2F9MA 2IEZA 3KQQA 3D26A 4OXXA 3FNEA 3FSEA 5AM2A 1RAEA 2C3PA 5A3SA 4JYAB 1H66A 2CZCA 2I1WA 5EPEA 4BDSA 4EGFA 1TYCA 4DDTA 2XUFA 4X05A 2QROA 1S4MA 3DFFA 2OHGA 1Z5OA 1P2SA 3A27A 3PUKA 4QL3A 4TXNA 4WY2A 3O73A 4YWJA 5KYUA 3VAZA 1NYQA 2RGUA 2ZQYA 3IEUA 4KIFA 3E8SA 5G4KB 5LBUA 2Y93A 2BTEA 3CCSB 4O8CA 2FR1A 4MR7B 1G3RA 3OD1A 1KIFA 3E3OA 2JL1A 3KC2A 2Z3VA 1P31A 2IYUA 3JYLA 2Q3HA 4FOTA 1RI2A 1KRHA 4TLDA 4PY2A 3MCZA 1G21A 4Z7QB 3NV9A 4OKIA 1Q0ZA 5CXSA 3T3DA 4QICA 5GOZA 4CL3A 4Z4TA 2ZSJA 5AIBA 2I2CA 5FBZA 3EHDA 2ZT5A 3HVUA 5JHGB 4HGZA 5F23A 4X8LA 4B3XA 1UCFA 4RA6A 4TS9A 5ILGA 3HA5A 3IEPA 2XKJE 3OPYI 5B3AA 2OAGA 4AX4A 3I23A 5KX5B 2JFHA 2D3NA 1JS1X 1OAAA 1Q6ZA 1Z6YA 2B25A 2I8AA 2HPAA 4MWGA 3PL1A 3SFTA 5BVHA 3RU2A 1THTA 5JSZB 2O7NA 4W5JA 3MWEA 4BWVA 1UQUA 3QSGA 2WMOB 5ABPA 4H08A 4MRMB 4REOA 4GM1A 4GX5A 2ZE5A 1MV5A 4H77A 4ZKDA 4OMUA 1JA1A 3G71B 2V59A 2BT4A 2HA7A 1VZ2A 3TEJA 2ZWIA 2Q9BA 1TLTA 3B6JA 3H42B 2CUZA 4O1IA 2Q6VA 2KWIA 3AW9A 3UWDA 3PITA 3QV2A 3DXFA 4YP0A 2DULA 4OAOA 2ZUWA 3UW1A 3R7SA 1OR8A 5JCZA 4X94A 3E7WA 5HJ2A 5KOJB 1JHZA 3VZRA 2O3RA 4DUPA 3HJRA 1Z28A 3V1YA 4KJXA 1UXOA 1F8YA 1H1TA 3GPCA 3FROA 2Z04A 4AY3A 1ZP6A 1WKVA 3OU6A 1N08A 4BLSA 4BQIA 4CXMA 4C7OB 4DFDA 1LLDA 1E1QD 5I7HA 5ECDA 1Z0AA 1HE4A 4D99A 1OYOA 1YL5A 3R40A 2BKEA 2KM1A 3BERA 1VM6A 1E7MA 1ZNYA 2G6BA 2V8OA 1FVFA 1V1MB 4GX1A 5EHNA 4U63A 4D46A 4MWZA 3PPWA 3RBAA 2AKYA 3FA2A 2ISQA 1EWRA 1HV8A 4LTDA 1B4DA 1M2VA 4OLHA 4BQQA 1U9IC 2XRMA 4UAUA 2Q50A 1W25A 2FEAA 2XMSA 2BHTA 3PQ3A 3TQSA 2YJ3A 2HPVA 4IMPA 1FNDA 1RMYA 1W1IA 4I36A 4U6NA 4V39A 4BO5A 3MCUA 5CLJA 1BTOA 1G6KA 1IEVA 4HLNA 1YI2B 4K0KB 3RC1A 1Z07A 2XTMA 1GRNA 3PC3A 3AEYA 1BWRA 4RABA 4TTVA 3W6ZA 2DQYA 4M8NE 1KAOA 4N0MA 1GZSA 3VKFA 1U4OA 2JCBA 2PANA 1E79D 1PWEA 1I0LA 1VMKA 1YFKA 1HQKA 1R66A 2UZAA 4P3NA 3ZW7A 3O8BA 4B3TB 4MUGA 5EFZA 5C81A 5DRTA 5CX1A 4HS4A 4GR5A 1SUPA 2A4KA 3ENKA 3GEEA 2ZSAA 2WUWE 3DO5A 3RO7A 3ZXYA 4GM4A 1WP6A 1BG6A 1U0SY 2EKPA 3MRXA 2QN6A 2BJWA 1UMBB 2AX3A 2XDQB 2WVGA 2GPTA 4WECA 5HCUA 5LSAA 4MS3B 2PUTA 4YRSA 1QPZA 2TMGA 2C2OA 3JWIA 3MWJA 3U4HA 2FYTA 1WSAA 1ZI8A 4PRYA 4HLUC 1CUEA 2PBZA 3ZHZA 1IZ8A 4PFSA 1EWYA 3CLSC 4Z5XA 4ZRDA 3DCNA 1FJ2A 5GY7A 4MI9A 1IAVA 3PGVA 1CRZA 1J2RA 1NP6A 2H65A 3L7BA 3Q0TA 4GBED 5ENZA 4ZDWA 1C3OB 3AY3A 3HKEA 4G1UC 1SRRA 2GFQA 3KQMA 3QI2A 4J4TA 1BFDA 3W5CA 4NOKA 4EGCB 4Y18A 2PKEA 2WZQA 1KQPA 1KJIA 1P44A 1NBIA 1XDWA 3N6XA 4M0UA 5JVDA 1C8LA 2P30A 1D6JA 2L2QA 3LT2A 3VJLA 1U7WA 4C6TA 3TDNA 2PL3A 4PPGA 1EFPB 1XZFA 4ZQIA 3ICCA 3TLXA 1L7NA 4Q4AB 4QUDA 4IKPA 1HLGA 3SXPA 1IULA 1CUWA 4B6QA 2X1MA 3JYOA 1RXSA 2OZVA 1YOBA 3HR4A 3RB8A 3WQSB 5LNK1 4QM7A 4KR7A 2Q8QA 1XPUA 1I4DD 2O5RA 3DDOA 2ZI4A 3SZMA 4HEJA 1RI4A 2FEKA 4D0RA 1E1QA 2H0RA 5DTMA 2H17A 2ONKA 3QVOA 1E92A 3GV0A 2IV3A 1GG5A 1O94A 4WTOA 4XDYA 4Z1MD 4KV7A 4NCIA 4X84A 3R7BA 1OA0A 4J3FA 5AUPB 2N1MA 3CUSA 4MDEA 2O05A 2H3HA 3FVTA 3JQGA 2PZ8A 3N2YA 3PKIA 1A7KA 4XQGA 1E5TA 2ZRLA 1D8AA 4A8JA 2PFKA 4N8SA 6Q21A 2HMWA 2PYIA 5JMWA 3IAM6 2RD2A 4O6VA 1QGOA 4AURA 2SICE 4O29A 3OH8A 3EASA 8MHTA 1YZFA 1OZGA 1REQB 2FXVA 4PLWA 4PFQA 3CURA 4W7SA 4XD7D 2I4RA 4KN9S 3H65A 2I33A 3KYCA 4GPBA 3IAEA 4TYPA 3SLNA 4AMVA 4I2NA 4TMYA 5DEOA 4LBYA 3O91A 5ALSA 5H02A 4EYSA 5AM0A 2WSSD 5L7WA 5C8VA 1E79A 1AA6A 2L82A 4TROA 1YDFA 2QU8A 3ZJYA 2HLPA 4GAEA 3FUCA 2FTKE 4D9JA 1CPYA 1EBFA 2WVHA 4Q3CA 2XQKA 4BFYA 1DJOA 4TSFD 3IT2A 3ENNA 2NVWA 3AL2A 4GDFA 5EZSA 3ZQUA 1CY0A 4CKYA 4XIYA 3PTLA 4CLRB 3AFMA 4G2NA 4DYVA 4Z3KA 1MENA 3SDBA 3U56A 2VNHA 2GEDA 3C3YA 4KX3A 1JEYA 2B69A 1C7EA 2AKAB 2VUIB 4QHSA 3U4QB 1YFJA 4M49A 1YSCA 2CL0X 4DUGD 1ZXLA 5AM5A 3OCWA 4MKGA 3K6RA 4QVKA 1DAOA 1GTJ1 2ZRNA 3BDIA 3MQFA 4AQYB 2ZR7A 3IAS1 3MB5A 4K5QA 3MT8A 4NENB 4ACBA 4H15A 1KDOA 1KI8A 3CX8A 3E53A 4UUNA 1QVWA 1WCYA 3LDUA 1DT5A 1PFYA 4RULA 4FN5A 4TQAA 4C4XA 3RRFA 4RHCA 4X90A 2IF0A 2FP4B 5ANRB 2O8EB 4QBHA 1CF4A 4LOAA 2QTBA 3GLKA 1QHGA 4CN9A 1WHTA 4H2DA 2Z6VA 1VE5A 4PIPA 3UK6A 2WD9A 1E1MA 1VGVA 4K40A 3O82A 1QH8B 2BFAA 4F85A 4C9BA 2MU1A 4OQFA 1FFAA 1NSYA 2PS1A 4N0PA 3PDJA 5JUWA 3BT7A 5AJYA 1GUZA 1D03A 4EUNA 1N2GA 3KQVA 4P38A 2RGWA 1CNEA 1NB9A 2C92A 2FUNB 1X1SA 3KQTA 4BO9A 3THYB 3GMIA 3AR2A 2W2NA 3S2ZA 1C3VA 2O1XA 5KC9A 3BXFA 1BFUA 1HDOA 4Z1MA 3PC6A 3RVSA 3TL3A 1VHOA 1JV2B 3IS3A 2RARA 1ODSA 4HDAA 3FYUC 3TXAA 1OB2A 4RCZA 2D5BA 3R3XA 2HLNA 1I24A 1C3EA 3GK3A 4B46A 4BKOA 1VKOA 5HZMA 3LY8A 2XGOA 5BSXA 3GGOA 2FFJA 5C1BA 5ALPA 1IEQA 3ND6A 2BGMA 2IU6A 4JLMA 3RS0A 1HQYE 4NS4A 4PQRA 2EZTA 2P5TB 2F3TA 4XD7A 3A2NA 1LFDB 3VSDA 2YH2A 3U3KA 1U7OA 1N1EA 5I9BA 2J3IA 5AW0A 3HJFA 3DMNA 3ZD9A 4UNRA 4K28A 2GHQA 2NZWA 4KQXA 1E3LA 4L07A 2FPSA 5ALUA 4ZT4A 2PBLA 1USGA 5AVXA 4R7GA 1OFHA 5JECA 1Z15A 3HO1A 1PN3A 4XWGA 5IJZA 2FE1A 4DMHA 4OJMX 3HM2A 4JODA 1EHYA 4GSYA 2OD7A 4Q4HB 2ONJA 4E4RA 5JWHA 5JY6A 4MWBA 2K87A 4RDHA 1JGTA 1R12A 5H1YA 4TSFA 1PJCA 5DP1A 1SK9A 3HBNA 1PS9A 3UENA 3U7HB 3O2JA 2W6NA 3R6DA 5AUQA 2JIBA 5GWXA 4PIVA 3R9XA 3NYIA 4EW6A 1ZQ1A 3IUPA 5BSMA 1TD9A 2H2FA 3DGEC 4QECA 3S3TA 1SIUA 5EHIA 4FLFA 4Z4ZA 2I2FA 4E30A 1CC1S 8LDHA 5EWLB 2PSFA 2HOQA 1L1RA 3B3AA 1Z9BA 3ZPXA 2C31A 1K28D 1MCZA 4ZCMA 3WY9A 4MTLA 1OGIA 4NDAA 3FMIA 2F1RA 4JHXA 1Q0SA 1OHHD 4RHEA 1QP4A 5BXQC 3TW8B 2FE4A 4J2OA 4OL0A 1R50A 4WK0B 1P2GA 2BGKA 2M32A 2BEVB 3WAKA 1BQ4A 4BUCA 2XUHA 4WZEA 3W3AD 3NYQA 5AI5A 2LD4A 5ES4B 1Q20A 4WW0A 3GIDA 1QQAA 5K8JB 3G49A 4OHRA 4ZVTA 1KU6A 1PJ2A 3M5PA 3OA0A 3LDAA 1GKIA 1ORWA 4YRCA 3MEQA 4AJHA 2H1CA 4QDOA 3TD2A 2WLSA 3ACBA 3EZ9A 1O6GA 4FYHA 3WBFA 4BVHA 4Z2AA 4OQMA 4B7AA 3AEUB 3B7WA 3FJYA 4JVLA 1YJNB 4HDRA 3N2KA 1QKIA 4CFZA 3SQWA 3VXKA 1W9MA 2FF7A 1WQ3A 4UEQA 2XZOA 4FZRA 2L19A 5AVRA 4G84A 1TAHA 1OFTA 1WOPA 2PMDA 4MWTA 2VJCA 3EVNA 3EBOA 3UO8B 3B2EA 2QTCA 1ZHHA 2QRJA 5EMLA 3WGJA 1IBKB 4RH3A 3I4CA 2R1VA 4UEKA 5J3JA 2Z6AA 2YZGA 2A86A 3BHJA 5F1KA 1WORA 3IDZA 1B26A 3PR1A 1B2LA 1ICEA 2GDZA 1ZYUA 4TV8A 2VFAA 5DYNA 5TJHA 3UWOA 5C8DA 5K3BA 4YHHB 4IGFA 1U5BA 1WB4A 1AA9A 1MB9A 3F0TA 4ALMA 4Z3OA 4KRFA 2PIDA 3INGA 4ZREA 4CKZA 3LO5A 1Z4JA 3QRWA 1CHDA 3T3NA 1BRTA 3EAFA 4PXAA 5IZ4A 3TIFA 3WJ7A 1NHGA 4ENWA 1DG9A 1UJMA 5FUXA 1Z39A 4ZT7A 3KR0A 5M5BA 2Y1LA 4D6XA 4N3NA 3WMGA 4D80A 1JSZA 4EB6A 5TF4A 3ROXA 5H59A 2GFIA 3V4RA 2P6OA 3R24A 3OMXA 2WU0A 4QGFA 4IIUA 4Q9JA 5DF1A 3VH2A 3ZZTA 1J97A 1II9A 1NL3A 2JGIA 1PE0A 3WQZA 2BEKA 2H1IA 2LPMA 4W9RA 4XM0A 3FYUB 3FY4A 5TQ2B 2H0QA 2CY0A 1Z18A 3LUKA 4HJRA 2C4MA 3MFYA 2WD8A 3HU5A 3OCZA 1OHHA 1LC3A 1T9DA 1VCIA 4BCDA 1KOFA 1ZBDA 2E5FA 4QNNA 2HAEA 3UXHA 2Z2ZA 3VR5A 5FWXB 4M0LA 3CX7A 4IQGA 5EWMB 4EFMA 1C9DB 2Y6VA 4XPIA 4OFZA 4RK0A 4MUBA 1CB0A 1U2DC 1HTWA 2LNDA 2JLQA 3W3AA 4NZMA 2B4KA 4E6EA 4M9RA 4NOJA 1I2DA 4JX8A 1MG0A 4TVBA 4X6YA 2P68A 4DIFA 4QKQA 4W82A 3CE9A 2QBYB 2KBFA 1O96A 3GEMA 1J8QA 3QPUA 5K4GA 4HBGA 1QVGB 1IPFA 1W0JD 3G13A 4FFSA 2IYQA 3HXTA 2VR1A 2BGGA 5AESA 2NU7A 3ZV3A 2J33A 2X86A 4YYZA 4FS3A 3ER6A 1UK8A 1H2WA 3PXGA 2P9EA 5F64A 3KSMA 4ECAA 3IDAA 1CX9B 5CITA 1AD2A 4WKCA 5CX4A 1Z5NA 4I50B 3JWHA 1U0GA 3ONYA 4NBWA 2V7PA 421PA 1F1JA 5EVJA 1II0A 1T1RA 2Z1MA 1W36C 3L4SO 4MUKA 4KMRA 3WP1B 2XADA 4G36A 3SJCA 3BK1A 3N05A 1R0RE 1YCHA 4WCFC 4AO8A 3KLNA 3WK5A 3G79A 1ZUNB 3WGGA 3SXUA 3H3FA 1ZD5A 1T2DA 4XLCA 3EZ6A 2R6HA 1X94A 3H2GA 4KKVA 5EN4A 1Z56C 4OJYA 3V8RA 4G0XA 5A9SB 3TGLA 3GRKA 1HDZA 1PQ4A 2Y66A 4LI3X 5JVDB 3ZBPA