4RJLA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdpcp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of gamma subunit of the translation initiation factor 2 from Sulfolobus solfataricus in complex with GDPCP at 1.64A resolution
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 112
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rjlA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rjlA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rjlA01
4Z1MA 3LNCA 1J8YF 2JJ1D 1S4QA 4N0DA 4XVUA 4QJ3A 1GZSA 3CX6A 2XTMA 4E03A 4NCKA 1EP2B 2D7CA 3VFDA 4HSEA 3W34A 2O8CB 4M53A 5HZKA 3U6BA 2PX0A 1E0SA 4QHSA 3QKUA 2IK8A 2A5FA 1R6BX 2EIXA 4DCVA 2ZE6A 4L16A 4KSCA 4QHTA 4R7ZA 2KSQA 2W0SA 3FPAA 1UF9A 2KE5A 4NTZA 3PR1A 4TL6A 3TKLA 4WXPA 4HLQB 2B21A 1HURA 1QUEA 4C0AC 4AURA 4LBZA 1G7CA 3T06B 4B71A 3QXJA 5HXBA 3HYRA 3IO5A 5FTNA 3W5VA 1G41A 1MT0A 1NN5A 1RRPA 2ZRGA 3OIYA 5B2ZA 4NCIA 1Z6AA 4KFTA 3U7GA 1EK0A 3R7WA 2YHSA 1P2VA 3ZH9B 3H2YA 2IYQA 2RC5A 1QX4A 5AR1A 4DUGA 1NMYA 2AK2A 3QBVA 4L9WA 4A4DA 3PEVA 3EPJA 4XWKA 1FMLA 4QJ4A 4EJSA 2H8KA 2Q9AA 3SBDA 4BFVA 2ZRJA 5IRCD 4IDQA 3H0KA 2BDTA 1UJ2A 1W34A 1M7HA 3CH5A 4CYMA 3ONWA 4P4UA 1WE2A 1ZIPA 5H59A 3C14C 3TR5A 3CPJB 2CL0X 4YMUA 3NTUA 3CD6B 2E87A 4ZI2A 4URYR 1AA9A 1IN4A 3GD7A 5CLQA 4WZ6A 5HE9A 2VBCA 4DQKA 1YR7A 3OJWA 1MABA 2J45A 2O0KA 1ZYUA 3CPWB 2QL6A 2CL6X 1BYIA 4B3FX 2Q9CA 2ZR0A 2Z83A 3CF6R 4ILEA 4QC2A 5KNCA 1JI0A 1ZJ6A 2PZEA 2B8WA 2IYSA 3KTAA 1YVDA 1E1QD 3TVDA 2QTVB 2OXRA 4AYTA 4TSFA 3OIUA 3T15A 4BPBA 2IBMA 3E70C 1DARA 4KXFB 2JCSA 1Q57A 3HU3A 3IIJA 1Q82D 3KKOA 4DUGD 1RE0A 3QF7A 4AG6A 2QNRA 4ARZB 1VQ5B 2WJGA 1W2GA 4C0SA 1L4UA 3E2IA 4G01B 3K0CC 1KDTA 1Q1BA 3EA0A 3NBXX 4DIDA 1KKLA 4EUNA 2BEKA 2EVWX 3FFBA 2JIZA 4KCGA 2ZSFA 1NNEA 2XNCA 1GILA 2WKRA 4IFBA 1D8TA 5FOXA 2IC5A 4OHZA 1JR3E 2WIAA 2JLXA 1CJKC 3WMFA 1JXOA 2RB4A 4Q00A 3R9WA 4M21A 1SVIA 5LB4A 2BPOA 1Z63A 2WJYA 4TYQA 4KLZA 2JJ1A 4DXAA 1HEIA 3TW8B 4HDOB 4WBSA 5L3VA 1V43A 2QRZA 4YAFA 5JLJA 4JS0A 3P4XA 2HLDA 2K5UA 1XRJA 4HLDA 1J8MF 3LVRE 2J0UA 4LJYA 2ZITA 1P2SA 3PITA 3W5IA 2F1HA 1OH6A 1JALA 4WXRA 1U0LA 1SVKA 4BLTA 1L8QA 1OPXA 1E6CA 2ZRIA 1W87A 2ZJ2A 1KI1A 2VP0A 1J99A 1GNRA 3QPUA 5DH9A 4CIDA 1RZ3A 2VRWA 5FFMA 2AR7A 4KBFA 2ZRPA 4M8NE 3MLEA 2YOHA 3A1WA 3ZZ0A 3NBFA 4JBXA 3EIEA 2ZI9A 3ZVNA 3UG7A 1E9EA 2CCGA 4NYJQ 3TBKA 5CDFE 4M22A 1DDGA 1M6NA 2IUSA 4ZDJA 3K0FB 4F7WA 4V0NA 2PIAA 1TF5A 2B5OA 1XBTA 4RFSA 4W5WA 3TR0A 4A2PA 1BMFD 3C8UA 1NG9A 1VCNA 2WWXA 3LY5A 2NOAA 4UXIA 4LC1A 1Z06A 3GLHE 1JPJA 3N2EA 2BSAA 3OZWA 3B9QA 1KAOA 2F9MA 3CZQA 4LV8B 5KPDA 3BERA 1G6HA 2FEOA 4OKSA 3EZ9A 2NZ8A 3I5XA 2I1VB 1T9HA 2AKAB 3EW9A 4YXWA 4QGHA 721PA 2X19A 1GR1A 1W4BA 3L0IB 1OIXA 3DOFA 1Q3TA 3U61B 2A3RA 4V02A 4P33A 3Q7QA 4TLEA 3BB3A 4EJSB 3SZRA 2I4IA 3K70B 2ERYA 1XU4A 1VQ8B 2QRNA 3B82A 4MKIA 4EFNA 3TLXA 2ZRKA 3LD9A 2OXCA 3EG5A 1N5IA 4MRSA 1KK2A 4I4LA 3NEYA 1JQJC 2D2FA 1JAHA 3DM5A 4PAQA 1VHLA 4TT3D 4DLTA 1Z6GA 4FXPA 4DCNA 2XOKA 3C41J 4KLNA 3V9PA 1R0WA 5EXTA 1XCGB 3VO1A 1FTSA 2O8DB 3MWLA 2D74A 1VHTA 2R6HA 3MJHA 4HYYA 2RGDA 1EFRD 3DM9B 4WZAE 4EIWA 1JNYA 4PQFA 4GOKA 5LDDC 4ZDIA 2OEPA 4YMVA 1W5SA 3DO6A 1O3YA 3GEIA 4AF6A 3CCLB 2C9CA 2C78A 1F2TA 1ZD8A 4IXMA 4NE2A 3KJEA 1S9DA 621PA 4G0NA 5L3SA 3KQHA 5AWFC 2WV9A 1ZM9A 4F92B 5DIFA 2EFDB 1XD8A 3KTAB 4XWOA 4Q4JA 2OE2A 1Z83A 5DSZA 3LW8A 1RFLA 4DIEA 3CCVB 2W6IA 5KSPA 3EXAA 2FH5B 1SVLA 1DS6A 1D6JA 2XX3A 1NL3A 5DI9A 3P1JA 1YU9A 3VR1A 4TMVA 2O8BA 4N3NA 1E9BA 1P61B 2QMEA 3TUJC 3CRRA 5JWOA 1DEKA 1G16A 4WIAA 4MRRA 3VMFA 3WRYC 5CJ2A 2GJKA 4NYMR 5TY0A 4EDHA 4QGGA 1T8TA 5CYPA 3AVQA 4DKXA 4K1XA 4HDQB 2ZI4A 5JJKA 4RD2A 1JAIA 2VTKA 5FA6A 1AKEA 3TNFA 4MITA 2RC6A 4G5QA 3KB2A 4AIIA 2ATXA 1XMVA 2R65A 3KQNA 4O3MA 3WMEA 1TU3A 1IONA 1N6OA 1YZGA 5EUMA 4UNNA 1VG0B 1OKKA 1FX0A 2FSFA 1F5NA 1J7KA 3IKJA 1PVOA 2J59A 3G4SB 2OK8A 1GRRA 3GLFA 4GOXA 1E2QA 4I1UA 3LFUA 2QSZA 1OHHA 3LQRA 4C0QC 4L15A 5F9HA 2C99A 3AP2A 4BRUA 2IYYA 4MGZR 1D1NA 2RKOA 1G291 3CH4B 4B4DA 1OXSC 2HV8A 3TW4A 1XEXA 1MO3A 5JJLA 2X1VA 4S2EA 3WY9A 3A8TA 1GIAA 2JLQA 2C95A 2XNDD 3VR3A 1RYHA 3LLMA 4UKDA 3U4QB 1UKEA 4MGYR 1OXXK 3I5YA 1UBCA 3N5CA 4LRWA 3SJZA 2CEAA 1XE1A 2CJWB 3I56B 4YAOA 1TUIA 1W5TA 4BFZA 1AMOA 1JBKA 2ZUCA 1ONBA 3P20A 4X8MA 2ZUBA 1AKYA 4BLSA 2F6RA 4R2IA 5G40A 1CBUA 2VLIA 5AUOB 3AP1A 4JBYA 4HAUA 4OK3A 5JWHA 6Q21A 1OB2A 4IEIA 3OAAD 2ODNA 3AKDA 3SOPA 3NH6A 2EFGA 2ZJZA 3ZIAA 4B73A 5J4KA 1N6NA 4HUTA 3CF2A 1G9XA 1NBME 3NEJA 4FMBB 1AS2A 4EJSC 1D9XA 1SXJD 2JGNA 1R8SA 3AF2A 3U3OA 2SHKA 1BIFA 3BBPA 1W48A 5EZ6B 3I62A 3TE6A 4U02A 3PUZA 1UEIA 4MKHA 2CJWA 4QM7A 5EXSA 4FK8A 4A9AA 4BLQA 1MRSA 5K8UA 1QH0A 1CR0A 3QFTA 4ZPXA 2CVHA 1GAJA 221PA 1E2EA 1XEFA 3FDIA 5JHGB 2MSCB 4JT2A 5KDLA 2KB0A 3SHWA 2F43B 1FOEB 5FUYA 4ARZA 5BW8A 1VIAA 4DSUA 1ELOA 2QSYA 1MKYA 3G82C 4DCUA 4DLRA 3CC2B 2QGZA 1N6IA 4JL8A 3E20A 1F48A 2QA4B 4G5RA 2FX3A 1II8B 1E9RA 2GXSA 4OQFA 1R5NA 3BWDD 4NYMQ 2UZIR 3EPLA 4DVGA 1OYYA 2OCYC 1S8FA 4IEEA 2VO1A 1KIMA 1T5LA 2DETA 2BKUA 2H7VA 3FYHA 5TR9A 1M74A 1W46A 2ZI6A 1G19A 1VQ4B 2ZYVX 2OUKA 1PZNA 2YWGA 1E4YA 4EQ6A 4ZCMA 1OT3A 4M1YA 4G5GA 3RLFA 1VYTA 2BM1A 4JSYA 3PEUA 4BFUA 1SKYB 1R5OA 2QPTA 2V55B 3QKRB 4M4SA 2W2VA 5KSYA 1Z0JA 4MYCA 4TT3A 1GFIA 1ZUHA 3AVXA 3EPKA 3GJ4A 1XTIA 3QE2A 1DO0A 2FU5C 2OV2A 1IM2A 1OHHD 2FV8A 4ZCIA 1P62B 2P5TB 4Q4HA 3W3ZB 5KO2A 3GCGA 1OV4A 1PUJA 2GDJA 1Z6YA 3A58B 4YONB 2BBOA 3MMPA 1LV7A 3RS0A 2ZE7A 4IOMA 1T0HB 1Z47A 3DKVA 3UANA 5LB2A 1TMKA 3LXRA 4KV9A 4F93B 3H84A 2ZE8A 4C2TA 3BK7A 1MH1A 3AQ4A 1LVGA 4KODA 4URVR 4GDFA 2NO1A 3LH5A 4Y9UA 3W2GA 4GOJA 4LYAA 5FBLB 2PBRA 4LJ6A 1OH7A 3AM1A 2YKGA 4CF7A 2EWVA 4G1VA 2W6JD 5D3MA 1JR6A 2FGKA 2CVFA 4Q01A 5F3WB 2QMOA 1JB1A 3ECCA 3H86A 3ES9A 1KZGB 1EGAA 1ZUIA 2HF9A 2OT3B 4DDWA 3RVBA 4DC9A 1COWA 1ZCAA 1W36B 3K9NA 1QHYA 4IOJA 2WIBA 4B32A 3LA6A 4TMKA 1OSNA 1YITB 3NWJA 1Z2CA 2BBWA 5JI2E 3I73A 1ZC4A 1G20E 2VSOA 2XAUA 4BFYA 3N70A 1I7PA 2ZYWX 2AFIE 1JR3D 2AWNA 4KHZA 5AUPB 1Z0FA 4PPGA 3AF1A 3U7EB 1G21E 3BFKA 1Q81D 4AKGA 4QG7A 1GUAA 2JIZD 3KXKA 4D25A 4UNQA 1G7SA 5CK4A 3VX4A 3A4MA 4CW7A 1DVRA 2YOGA 2VYFA 1R7RA 4WAUA 5AJXA 4QXAA 3OZVA 4NYIR 2IHBA 2DEUA 2NG1A 4TMTA 4TSFD 2QMUA 4AKHA 3Q3JB 3U6KA 1QFYA 1YZNA 2AKYA 1LF0A 1W1WA 4B3XA 1KKMA 2YYZA 1YJ9B 4B75A 2XZOA 4ZO4A 5IDVA 1N5LA 2ASEA 3QOFA 2F3RA 1FUUA 1QG4A 3PUWA 4L8GA 1VQKB 1LF5A 4PFSA 3F3YA 3X1ZA 4BLPA 3FHOA 3RDPA 1VQ7B 1NP6A 1W47A 1PLJA 3FTQA 1K8RA 3UIEA 3B13B 1KRHA 3KJHA 4OQXA 3AVPA 2ONKA 4NMMA 4B2IA 3CCUB 2MSEB 2DY1A 2FFHA 2IYZA 2ZEJA 5C4MA 3I8SA 2EYUA 2XJ9A 1M7BA 3RC3A 4CT4B 1OLOA 2ZUDA 5HKKD 2ZM5A 3IEVA 3CZPA 2F1IA 4LJ9A 3K9HA 3CWZA 1FNDA 2FJUA 2O8EA 4UXJA 4JL6A 2ZRNA 1SXJC 2FOLA 3CW2A 3CC7B 1AN0A 2G6BA 5KUTA 2AWOA 3BXZA 2W2TA 4HAVA 1A82A 2BGJA 3MRSA 4NPHA 3GLGE 3A6PC 3GJ5A 3ZVLA 3PUYA 2X8AA 1VKJA 1XEXB 1E96A 2R44A 3QF4A 4CRWB 4LYJA 2VP6A 3AH8A 2IEYA 3B8HA 1AM4D 2AD1A 1E2PA 5CM9C 1T3LA 4BASA 4DSTA 1Z6TA 4X8OA 5SZKB 3GLIA 3SHFA 5TB5A 3I32A 5D3QA 1M8PA 3AVOA 4MDFA 3UWOA 4KFRA 1ZM4A 2QDXA 3RRNA 2R2AA 3ZZUA 1IJFA 2IT1A 3IDQA 3QEOA 4CEJA 2IYVA 2IX3A 4HAWA 2GWHA 5DYGA 4DB2A 2FFBA 2H92A 1NVXQ 5EP4A 1T0JB 4DEYA 4B3CA 2IS6A 1YIJB 1G5RA 2J87A 1KK3A 2YC2C 3IBYA 1QZXA 1KNXA 1GKUB 1HV8A 2OLJA 4AYXA 1P75A 1KGDA 2OFOA 3GFPA 3AGPA 3LX8A 5FUXA 1D2EA 1VYVA 3CCSB 1Q44A 2UZ3A 5EUQB 4C3ZA 2IYTA 1QHIA 4MH0R 4YALA 2GJ9A 5EXPA 1KC8D 3AVVA 3R7WB 4EPYA 2QAGB 1NRJB 4P32A 3U60B 2IXFA 3FPKA 4YAWA 3JZAA 3K0FA 1S0UA 5KDOA 5FR1A 4A1FA 4PC3A 1Z29A 2G77B 5J47A 5TV2A 5KYKA 2QAJA 1IY1A 4JLDA 3OEEA 1HQYE 2BGIA 1KJYA 3DL0A 4Q18A 1G18A 4Q7LA 1H8HD 1QRAA 3KUCA 3MAAC 2OAQ1 2PZFA 2QORA 1QFZA 2CNWD 5FOWA 3B1XA 4PPNA 3CO5A 5FPTA 1QHHB 4D26A 2LKDA 4LPKA 3L2OB 1CJVC 1K73D 1I4DD 5EE1A 1E3MA 1LB1B 2PCJA 1JA1A 4Q03A 4BLOA 3GLFB 2QN6A 2XNSA 2BCJQ 2WWWA 1YZLA 1NKSA 2RGBA 1Z08A 4A0HA 3Q7PA 1NVVR 3TSWA 3NBYC 3WNDA 3VTKA 4LJ4A 3E1SA 1E98A 5JCPA 3BORA 4RSGA 5FL7D 3QXCA 5SZIA 2QZ4A 2ZVQX 4XH9B 3KZ1E 4L9SA 3TUIC 1WBDA 4RD4A 4A8JA 1KI2A 3THYB 2GBLA 3E5HA 3MHPA 2CNWA 1OH8A 1X8JA 1NG1A 1KSGA 5M04A 2VEDA 4DLZA 3CRW1 4HAZA 1Q20A 3L43A 1ZMXA 4OI0A 5K8LA 5H5JA 2Z4RA 1EX6A 4UNSA 4E07A 2WTUA 2YWFA 2ORVA 2RCNA 4QBFA 2EW1A 5GJWC 3PVSA 4B6EA 1XFAA 1F6BA 5E4FA 2HYDA 1BYUA 1L2TA 3VKHA 1OGJA 1E9AA 1HUQA 2JJ2D 3REGA 3B9PA 1G17A 4JLMA 4KYIB 2RMKA 1YJWB 5LBIA 4AI6A 4FMCB 4PC7A 3FKSA 5B30A 2X77A 2R6GA 1OXVA 5FOUA 4X8LA 1NF3A 4MRPA 4OJQA 5JRJA 5CIQA 4BFTA 4NZYA 2EYQA 1Q3HA 2FPMA 2B6HA 4QGFA 2R8RA 3FOZA 2WWYA 4D4LA 1E9DA 5LPNA 3B78A 3GLHB 4NKRA 4ZDWA 1T4GA 2ZRBA 1R0ZA 3TMKA 2FNAA 1WRBA 2I1QA 4NH0A 5A4JA 4IW3B 1TQ4A 3C5HA 4MYUA 2XB4A 3IEUA 4B47A 3ZIAD 4XD7A 1ZD9A 4RD6A 1QVRA 4DQLA 4TLCA 4H1VA 3FMPB 1E94E 1W2BB 1UKVY 5AJWA 2IEZA 1R4AA 3Q5EA 3QNUA 4OHXA 3QVVA 4AK9A 3ADBA 2VNJA 2FPKA 3DOEA 2VIIA 4FWIB 4R98A 5AJZA 5DN6D 2VL7A 4C30A 2HCJB 1H85A 1XXHA 1ZCBA 4LPSA 4LZZA 3SJBA 3UMRA 1Q21A 4FMCF 4EPWA 4TLDA 2JLZA 3O47A 2ZXUA 1TX4B 2GCNA 2A78A 3VX3A 2AN9A 1TF2A 3P32A 1GAQA 1F2UB 2XTNA 5JS7A 4MQBA 4MYTA 4EPXA 3L0PA 1DELA 3A1TA 4OQMA 1KK0A 1U0HC 3VU9A 3MWKA 4OQLA 4KFSA 3TGPA 1Z8FA 2H5EA 2ZRCA 2JLSA 1D2MA 1XB2A 4LHZA 1N0WA 4HZUA 3WBKA 4ZCLA 3SN6A 2HJVA 3LRPA 2F9LA 4BGDA 3AVUA 2CHGA 2ZI7A 3CCEB 4IXNA 1XZQA 1JJVA 2OHFA 5CITA 4DEXA 5FBQB 1IN6A 2IW3A 3R9IA 1IN8A 4C43A 1MO5A 2BKEA 4BUJA 2OILA 5B64A 5AUNB 2R6DA 1FTNA 4M1TA 2QA5A 3GLGB 1FRNA 2EU8A 3I72A 3T1TA 1Q0UA 5F98A 2GQFA 3LVBA 3FMOB 1IB0A 3LW7A 3TVTA 1B0UA 1JJ7A 5IHPA 1I4TD 3VQTA 2V1XA 2QY9A 2CE7A 5FI1B 2ZS7A 4AY2A 1G8HA 1HE1C 1DAIA 4M9QA 3W8RA 4IVRA 1GRNA 1Z0DA 2DWQA 2FEMA 3OZXA 2V4ZA 3WHLA 1N5JA 5AK0A 2ZI5A 3KKNA 3K9GA 4OHWA 3JQQA 1Q1ZA 2WKPA 5GJCA 2ZSEA 5K8IA 4QBGB 3J81k 2L0XA 1KO7A 3MSXA 1KZ7B 1GG2A 2YINC 3CNLA 2P6NA 2N46A 2PZGA 2LCFA 1N25A 3RS2A 3SYNA 2R6FA 5BXQC 4JT4A 5DHFA 2VNHA 2VHUA 2VQSA 1DG1G 1UAAA 3GLFE 4GP6A 2WOOA 1H65A 2NGRA 5L3RA 3VR4A 3OFNA 5B57C 2WJJA 3UWKA 3PV0A 2ODWA 5JBQA 3NXSA 3AV0B 4LBYA 1KI6A 2R9VA 1VCOA 4OI1A 5CYOA 5DI3B 2QTZA 1Z2AA 4W7SA 4TYWA 2H18A 3GJXC 3UMSA 3U44B 1MOZA 2WKQA 2GHIA 1GJRA 3AVYA 2XNJA 4QRHA 4Q1DA 3LQQA 5H70A 2IF2A 3T12A 2GILA 2XSZD 3C16C 2NMVA 3I92A 1F60A 2DFNA 1WDTA 2VSFA 3DEFA 2Q6TA 4DWJA 1NIJA 4PTLA 3S1AA 4Q1CA 2QAGC 3EZFA 4NYJR 5C46F 3CUEF 3GQBA 1N6HA 3WHKA 2REXB 2BBSA 4RCYA 3CX8A 4JVLA 2GCOB 4Q9KA 1HT1E 1SKYE 4A15A 1CNEA 1E4VA 3A36A 1OIVA 1JB9A 2QMHA 1NBMA 4LWZA 4MYHA 1E64A 3BOSA 4RFSB 1B2RA 1S96A 1YKSA 1NLFA 4MGIR 1KO4A 1FUKA 3HWSA 3NC1C 1XX6A 3KX2A 2B7CA 3U3JA 1H42A 2A7QA 1Z6XA 1YZUA 4Q47A 2ZROA 4P4SB 4KO8A 3W6NA 2QBYA 4PC6A 2QROA 4POAA 3LBNA 4GPTA 4XVRA 3CPEA 4O2LA 2GBLC 1X3SA 2P65A 4A8JB 4Q4AA 2D3WA 2FGJA 1IJEA 2I3BA 4XSGA 3WNBA 3BE4A 3IIKA 2J0UB 1XDBA 1JEEA 4RCZA 4S35A 3LLUA 1AQYA 2QU8A 4WW0A 4ZV4A 2ZJOA 3W2IA 3OEHA 4PHHA 1DTSA 2ZS9A 4DDVA 1XPOA 4OJKA 1D9ZA 3ZD6A 4UNPA 1OFTA 5KTYA 3DDCA 5EP1A 3ZBTA 1CR2A 2IHYA 2H17A 1U90A 3H1TA 4LHWA 4ZI3A 3EC2A 3QI2A 4PZLA 3QXXA 1DO2A 1HYQA 3K0CA 5KOYA 4DT1B 1X1RA 2J7PD 2CK3A 3LO5A 1SXJB 4LYHA 1W0KA 4NYIQ 4J0QA 4JLVA 4R2HA 1OYWA 4TTQA 4URWR 4FW9A 1SHKA 2PEYA 3O8BA 5FL3A 1G3MA 1OFUX 1VYUA 3KJIA 4BRWA 4AD8A 3W9YA 5KNDA 1DOAA 5L8VA 3FHTA 1ZAKA 3RS4A 1QGYA 1FQJA 4OI2A 3RS5A 3UXMA 1JPNA 1D2NA 1FL9A 1ZBDA 4B33A 2IS2A 1LY1A 4A0GA 5DISB 1R5BA 4ZGNB 2FG5A 4M9SA 2B7BA 1P4SA 4O2RA 3AF4A 1P9WA 4Y7CA 1E2LA 2GNOA 2JJ8A 3MD0A 3GJ3A 2IWHA 4AG5A 1KMHA 2QM8A 2N42A 4IDHA 5C2JB 1LS1A 5FPYA 2J0VA 1US8B 4URXR 3ICEA 4E22A 2G0TA 3BH7A 4XSHA 3RANA 4DBLC 3LX5A 4R71A 3K1JA 5KSWB 3DPUA 4M1WA 2D4HA 3CLVA 2ZJYA 4Q7JB 3AVTA 2C03A 3HDTA 3B6EA 2VP4A 1X6VA 3THXB 3ZLJA 4YMTA 2QT0A 4AKIA 1IY0A 1AS3A 2C96A 2ZETA 2OFWA 1E1QA 3U5ZB 4I1OA 4JSTA 5L3QB 2GRJA 2XTZA 5HCIA 1E0AA 2RH5A 1KNQA 3VR5A 1KI7A 2W58A 3OF5A 3KQKA 1NJGA 2ZRFA 4D6PA 1IBRA 5JJIA 1XMSA 3A37A 1PLLA 3D31A 2VHJA 1CRPA 1F3OA 4RZUA 1Z3IX 1TL7C 2PT7A 1DAGA 4XIGS 4F4JA 4V0ME 5J4LA 2YC4C 5A0FA 2PCLA 2EFEB 2GXAA 3OHMA 1CS4C 5L3SB 2MMGA 3RWOA 4B48A 1UDXA 1DBSA 1UPTA 2DCUA 4EPRA 2BEJA 4UAJA 2AX4A 2PJZA 2EQBA 5J40A 5IK2D 1E63A 2JASA 2GK7A 3ZYCA 2IS1A 1GVNB 4QBIA 1M34E 1XJ0A 1DDIA 3EIHA 2GEVA 2B92A 1TADA 1ESMA 3BS4A 5JCZA 1NSFA 5LD2B 1OW3B 1X1SA 4LV5B 3X2SA 1QDEA 4YAUA 5CLLA 2YVUA 2N1BA 1G3IA 1G7RA 1E2GA 3QKRA 4A92A 3TH5A 4DLUA 1QVFB 4RD0A 1EFHA 5FUWA 5BYKA 3OIVA 3HP1A 1W4RA 3SJAA 1VCMA 1VG8A 2WMNB 4JLBA 2V54A 1SQ5A 4BZQA 1UEJA 5H8WA 1SKQA 1GITA 2AL7A 3THWB 1QUFA 4BPRA 4G5OA 1QGZA 1E99A 2LKCA 3CC4B 2OO7A 4B44A 4HI0E 4IDNA 3FKQA 4LJAA 1DAKA 2ZIAA 1EWYA 3PUVA 2IS4A 5UKDA 1EFTA 1P6XA 3ZVMA 4GL2A 3MWJA 3MCAA 1G4UR 3R9XA 3PEYA 1U81A 4XTCS 3W5HA 1OGIA 1BS1A 2BCGY 4LC0A 1R8QA 1ZC3A 4CGZA 3C5CA 1E1RD 1NVUQ 5DHAA 3HR8A 3AB3A 1LFDB 3IUYA 2G1JA 4M1MA 4XVQA 1G8FA 3ICQB 4GBMA 1VDZA 4A6XA 5FTLA 3B85A 3EC1A 4HUQA 4B3DA 3W90A 2DWPA 1OKKD 2ZSAA 3KKPA 5HKKA 3ZVRA 2CRVA 1KDOA 4YDSA 1CLUA 2FFQA 4RD1A 1GL9B 2FF7A 2VH5R 1IN5A 1YE8A 2WZQA 2ZPTX 4G5SA 4GFDA 1KOFA 4LJ8A 4DLVA 5JI3E 1G1MA 2ODEA 5JRZA 1W7AA 3GLGA 4YMWA 3RNLA 5KSZA 5BYJA 3QKTA 3ZQJA 1P9RA 2RGNA 5F9FA 3U44A 3W6OA 4Q1BA 2AD5A 4Q9HA 4GRAA 2C9OA 4DLYA 1YZTA 1YJNB 4KVAA 1CTQA 2WSMA 3O8RA 2HXYA 1FP7A 1Z5ZA 4JLAA 3FJOA 2ZSDA 3QJYA 4M9XA 3W2HA 4TTPA 3UMFA 4V0KA 3UK6A 1BJKA 4FMDF 1GWNA 3PQCA 2NO7A 1DPFA 1RYFA 2P0EA 3WNCA 3KFXA 4TYYA 3IGFA 1G3UA 3RS7A 2JLVA 3QKSB 1Q12A 2KBEA 2OCAA 3RSOA 3G5UA 3QPVA 3GLIB 4D80A 4OHVA 4PQRA 1ZM7A 3L82B 4A36A 1EP3B 1CQXA 2BIFA 2NZJA 2W83A 1YHNA 2R62A 1NBMD 4PHTA 1EP1B 3OJXA 1TAGA 2C04A 3PFIA 1W49A 5J4HA 1XTQA 1YZKA 3G6EB 4LGMA 1BQEA 3CRMA 2R6CA 3KB1A 3NBZC 1ZD1A 121PA 5JHHB 3LAWA 3F5FA 1IQPA 1O87A 1A4RA 5J4VA 5H68A 1XEWY 2J1LA 4PPFA 2OTLB 5KPJA 5KNBA 4R9UC 1VMAA 2WWFA 3C7KA 3WYAA 5E7IA 1K5GA 3HU1A 3GEEA 1M1YE 5FTKA 1W4CA 5J4YA 2O8FA 4C0HA 1CNFA 1N6KA 1MRNA 2OAP1 3QFRA 1KSJA 3R8FA 2DPXA 3CR7A 4EQ6B 1KJZA 1VPLA 4JIMA 3DZDA 4JYCA 3T1QA 3OZUA 3T5DA 2GESA 2FFAA 3L0SA 1GNPA 4JLOA 4RD3A 3GJ6A 4ZKDA 1L4YA 3LVQE 4W5JA 1KDRA 1YQTA 3F8TA 1JR3A 2BHRA 3WYFA 1KY3A 4BE7B 1UBFA 4MUAA 4TQAA 2QT1A 4HB4A 4N1AA 3OE7D 2ZAOA 2DB3A 1LS6A 2C9YA 2XNDA 3AKEA 4E5UA 1WP9A 4D0LB 2ZTSA 5CB8A 1U99A 1FP6A 2WICA 5JSZB 3JVVA 5IT5A 5IF9A 3ETLA 3RSLA 3A1UA 1DE0A 4TL8A 2GKSA 3VHXA 4AF7A 3QXSA 2QGNA 4B76A 4Q1AA 2RAPA 4NU0A 1S3SA 4TMWA 2GVDC 5DLQC 3S1AB 4C9BA 3EWAA 4Q9JA 3CF0A 4Q21A 4IVQA 3P27A 1K9MD 1NVVQ 2WVJA 1XD2A 5HTKA 4K46A 4ESHA 2Z6VA 4URZR 1KO5A 1GTVA 2FZLA 4K81B 2BJWA 1TVCA 4G1BA 3EX7C 1E2FA 1W4AA 4TYNA 3EZ6A 4QNRA 4B2LA 4LI0A 1DAMA 4CVNA 4PHFA 4HEJA 3NIBA 1PUIA 5CDFA 1G64A 4M9ZA 3VKWA 2B8TA 1A2KC 2P67A 4JL5A 5HZHA 4U00A 1OB5A 1KI8A 2D06A 2D62A 1J90A 4MKGA 2JATA 2O0JA 2XB2A 3SYKA 4PGOA 3ZBUA 4HB0A 3DKPA 5JWRA 2O0HA 3QSYA 3CBQA 1HH4A 1FNMA 3V00A 1CU1A 1JEDA 3GLHA 3ZDQA 1E69A 3VAAA 1XJCA 2ZRHA 1G8PA 1SZPA 1VTKA 2ZVPX 2GVZC 2IUUA 2ATVA 2OCPA 3CB4A 1BX0A 1HY3A 2H57A 3QVUA 4MA4A 1W44A 1DAFA 1MR3F 1AZTA 4C2UA 1QFJA 1DADA 4AC9A 2GEUA 3QBTA 4MDEA 4TZ6A 3CRZA 2CK3D 2PMDA 4GNKA 2BOVA 4HUQB 2Q3HA 1RIFA 3TUZC 1OXUA 1W2HA 4P3YA 2GZAA 3HR7A 4DZZA 3FE2A 1CF4A 2WSSA 1E2MA 2KJQA 4Q9IA 3HYTA 3ADDA 4BEBA 1NN3A 5EE0A 3SI7A 5JSZA 4HLUC 4B3GA 3X1YA 2YWEA 4Z8YA 4A0RA 1OF1A 4JJKA 1A5TA 1MABB 3L8ZA 3R8CA 2CHQA 2DFKB 3TSOA 5JMTA 2CHVA 2F1RA 1FDRA 5DNYB 1ZNZA 3OFND 1G4AE 1XXHE 5BWMA 2VHCA 1MV5A 5JEDA 2FA9A 4DHEA 1E2NA 5FL7A 1ZP6A 3SFVA 1F20A 1E32A 1SVWA 2V1UA 5B58C 3OW2B 3BIFA 3EPHA 4DT1A 3NH9A 2J7PA 2BVNA 4GZMA 1X8KA 2DERA 4TMXA 3QIAA 3CNNA 2BMEA 4Z54A 2QG6A 1SULA 2BC9A 3IQXA 1AJEA 1J70A 4Y9RA 3UPUA 1FQKA 3V76A 2A30A 4ESVA 3E1YE 3LBIA 2V6JA 1KYIA 2WWGA 1G3RA 1N0VC 4XWAA 5E3HA 1XTSA 2WHXA 3ADKA 1A1VA 4MRVA 2HJGA 1ETUA 4MUBA 1BKDR 2ANBA 2ECKA 4LCBA 3QF4B 4A2QA 4CT5A 4PZYA 4DRZA 4YMSA 1KD1D 2F7SA 1E2KA 2DFTA 2HLDD 2IYWA 4Z1MD 1A8PA 2BMFA 4CEHB 1VQ6B 4UQOA 2ZJ5A 3D3QA 2VA8A 2JLRA 3BC1A 4PO8A 3RRMA 3NHAA 1XTKA 4PANA 3W8NA 4B34A 2O8DA 3QEJA 2OBNA 4NP6A 1TEVA 2W6JA 1U0JA 4BQSA 1FRQA 1ZUNB 3OESA 4KFUA 1VIYA 4LBWA 3OE7A 4LOAA 4EPVA 1X86B 3LDAA 4PAMA 2VPPA 3F0TA 4JVNA 4PHGA 2FSGA 1CR4A 2J9RA 1U9IA 3CIOA 4RZ2A 2TMKA 3O8DA 4GT1A 3CRQA 4HB3A 2H1LA 1Q1EA 3RYTC 3I1FA 4LYFA 2WJHA 2CLCX 5JS8A 3N2IA 3SS8A 3TAHA 3MUFA 4C7OB 4V0OA 2NO6A 2XXAA 2YOFA 1SGWA 2O5VA 1VECA 3K0AB 2Z0MA 1E2IA 2ZR7A 5FUVA 4PAOA 4D82A 2W6ID 3L8YA 5HPYB 3RHFA 1TQDA 1FFHA 5A5GA 1XPUA 2QPAA 3U3KA 3RS3A 4NCHA 5FOTA 3NDBB 2O8FB 4IVPA 3T1OA 1GKIA 1KMHB 4US0R 2Z5FA 4URUR 5TVKA 4CDGA 4DSNA 5CB6A 1VQOB 2GZDA 1C9KA 1TTTA 2RGAA 1EFRA 2ZRDA 5G3ZA 2VNIA 5AJVB 1E62A 1QHHA 5FTJA 1KQSB 1QHXA 1T5IA 5JECA 3D7MA 3SYLA 4LHVA 3IBGA 1ZW6A 3IIMA 2EFCB 4JZKA 1BH2A 3CONA 3UG6A 4I1VA 2OLKA 2GJ8A 1C4OA 4YQFA 5AJYA 3EIQA 4Q66C 5GJBA 2RHMA 4Q48A 1IHUA 2QE7D 3CCQB 4QHYA 5AN9A 2PT5A 2BV3A 2DFLA 3GP8A 2OG2A 3THWA 4NONA 1VQLB 1P2TA 2ZJ8A 4I81A 1SXJA 4LSGA 2JAQA 1AQUA 1CXZA 3MWYW 5EE9A 4MRNA 4DCTA 5KDDA 4A8JC 1ZM3A 1P60A 3CWQA 4JMPA 4A6PA 4CEIB 2WSSD 2UVQA 3X1XA 2QQEA 4A2WA 2CLSA 2HT6A 3MGCA 4RZ3A 1E2DA 4IFEA 4YXWD 1ODFA 4RY2A 1E0JA 2OZEA 2CL7X 4FCTA 1H8EA 4Q19A 3PXGA 4HLCA 2XXAB 1WBBA 5HR5A 1S2MA 2ZJAA 1F2TB 2ZAMA 2GEDA 1TPZA 1IXRC 2QP9X 4LK2A 2OTJB 2CMKA 4M0LA 1VQPB 3TRFA 3PENA 4W9MC 4WQMA 1J2JA 2EFHB 1NMXA 4NL4H 4ZIRA 4Q4LA 4KYUA 4QBHA 1TU4A 4LBVA 1OFIA 1JA0A 4G3XA 3ADCA 4KJZA 4MGKR 3IPXA 4W5HA 3TK1A 5IK2A 5THXA 4DLSA 5FBVB 4HZIA 1ZIOA 3K53A 1R2QA 4EFLA 3Q72A 4Q5IA 2VYQA 1EWQA 3NC0C 4PR0A 1T3HA 2G9NA 3EARA 4AYWA 2JDID 1FX0B 4D0GA 2ZSBA 3K8YA 1QHSA 1NSTA 2GETA 1QG0A 2Q9BA 2H16A 3QE0A 1Q1QA 5FR2A 2A5GA 2WJVA 3KQLA 2KI5A 2CBZA 4BFXA 1WA5A 3ND8A 3K09A 5TMPA 2JEOA 1E2HA 1XXHB 2G88A 1NMZA 2J7KA 3QQ5A 2PLRA 1U8ZA 3KXIA 1EG7A 2C98A 2RHDA 1ESNA 4LDJA 3B60A 4GI7A 1E9SA 3RC8A 3SFZA 1DAHA 5FPSA 3AF0A 1TNDA 3VNVA 3WYGA 1RRFA 1GSIA 1UDWA 2WPDD 1LW7A 3PG5A 1KMQA 4DDTA 4D4JA 1G6OA 5EMNA 3L0OA 3MFYA 2J3EA 2VP2A 5ELXA 3VKGA 2BN4A 3B1WA 4NBSA 3WXMA 2C2HA 4M1OA 5EJEA 5SZJA 5FBRB 4X8HA 3IILA 1KAGA 1XF9A 3CCRB 4PO9A 4P31A 1COWD 2XGJA 3SEAA 1T8UA 2ZQ5A 1IN7A 2V7QD 4P4SA 421PA 5KHOC 1E2JA 1W36D 2NQ2C 1KI4A 1KI3A 2ZYUX 2HF8A 3SC3A 2GCPA 2P5SA 1N5KA 2PLFA 1NY5A 1IY2A 1JECA 1QHGA 5FTMA 1SVMA 1XWIA 2FWRA 3W6PA 1P73A 1RJ9A 4Z51A 3I55B 3EASA 3BGWA 4ACBA 4NDZA 4GZLA 1N6RA 5FOVA 2WAXA 3Q8XB 2VHTA 1DG3A 4GMXA 4Y0AA 1PV4A 5GV7A 1KSHA 2V9PA 4GSYA 3W2EA 4ZKEA 2OESA 3WP0A 4F7DA 1HQCA 3D6TB 1NDHA 3AP3A 5EE5B 4BFSA 4PPQA 3CNOA 3QUSA 1UKZA 3PCRB 5JZVA 3K0AA 3T61A 1HA3A 4K8OA 2IA5A 3SJCA 5EQTA 3C15C 3MJRA 1A2BA 1S3GA 4U5XA 3CXCB 4XJXA 3T5GA 4HZUB 4NCNA 1WMSA 1J9ZA 1Z07A 4AWXA 1EFCA 2JA1A 1LNZA 3AUYA 4JYBA 3M0EA 1ZNWA 4HB2A 2VP5A 4O25A 3GLIE 2E1RA 1YR6A 2V3CC 3UATA 1KI9A 2QUZA 1BOFA 2WWIA 5CIWA 2D7DA 4C0LA 3PJRA 4JLPA 4IOKA 1FPMA 2C77A 1U94A 3KFVA 1TLLA 1IAQA 2CCKA 1N2CE 3P26A 1K6MA 3I8XA 3NKVA 4B74A 1GVHA 1UKYA 2GK6A 2YZ2A 2AHOA 2HT1A 1EX7A 2GF0A 2YWHA 1ZU4A 2FMXA 2QPOA 1BO6A 2DHRA 1G3QA 2ZU6A 2FE4A 3KL4A 4O0MA 1JQLB 3BFVA 3I3SR 2WWHA 3PEWA 3P4YA 3HJNA 3THOA 4QL3A 4EH1A 2AXNA 3Q9LA 4BEJA 4PQYA 3JVUA 2KWIA 3O8CA 1E9FA 4RJLA 2HXSA 1VG9B 2Z4SA 4LJ5A 4FCWA 2CDNA 5C18A 4JKYA 2P3SA 2RGXA 3NDPA 3U2QA 2PMKA 1I2DA 4KAXA 1D5CA 4D2IA 2QP3A 2QENA 5BQ5A 3JQPA 2BF4A 1XTJA 2FSIA 1AIPA 1EFUA 2XEXA 1I2MA 2X3UA 1UBGA 4TLBA 4WVFA 5CK5A 5GVRA 3SR0A 3X1DA 3HPQA 1II9A 3KUDA 4IKEA 1T3SA 1NLZA 5DN6A 3QY0A 5EZ5A 2CLDX 521PA 4D4MA 4F91B 3BAFA 4H1UA 1E0KA 4HE6A 2ORWA 2WBLC 3EA5A 3DHWC 1OXTA 2GA8A 3BJIC 5GV8A 3C4JA 4ERNA 1M7GA 2OCBA 2HEIA 3B1VA 1XCMA 1XMIA 4ABYA 3TJZA 3Q85A 4WZBE 3ZGXA 2X2EA 2GCOA 2XJ4A 8OHMA 2RGCA 1GP2A 3QFCA 1YJ5A 1P3JA 4OYHA 4F4IA 1HE8B 2VNKA 4MKFA 2ZS8A 5E7MA 4NCJA 4OK6A 3QG1A 3G71B 1OJLA 1NLYA 4HATA 2QM7A 4ITRC 4JVSB 4Q9LA 1WCV1 1ZM2A 4DSOA 1CULC 2CXXA 2ZE5A 3NHBA 1AK2A 3NVAA 2AK3A 1OH5A 3ND9A 3T35A 4OI4A 5DE3A 3AGQA 5DGXA 5FOSA 2QTLA 1OE0A 2Q3FA 4DLWA 3RABA 3FVQA 1M2OB 5G53C 3LWNA 2V6IA 2NPIA 3B1YA 2J5XA 1K8AD 1KJWA 1FW6A 1XEWX 3ZS8A 4FN5A 1QVGB 2Y8EA 1ZNXA 2QEQA 3VU9B 1V5WA 2Q0HA 4D81A 4UXHA 4KBGA 1N6LA 3V4RA 1TQ2A 5EP3A 1FMJA 2ZANA 2OM2A 2F55A 2GXUA 2BWJA 1N6PA 2QEXB 1WQ1R 4PSAA 1YR8A 1UBEA 3QENA 3UKDA 1U8AA 1NJID 2BM0A 2F3TA 4XD7D 3KDSE 2A5JA 3CCMB 4ZDKA 2GJAA 3FFAA 3IQWA 3H4MA 2MMCA 3GJ7A 1NI3A 1NN0A 1NN1A 4RVCA 2O8EB 5FPKA 3SE0A 1SVSA 3R20A 1TUEA 2QAGA 5FBWB 1ZRHA 3FGNA 4DCSA 1RKBA 1W0KD 3EAQA 3FB4A 4Q1EA 4TTRA 2QTHA 1RVDA 5BN4A 2DYKA 3RWMB 4V0LA 4EKDA 3AUXA 1YR9A 3EZ2A 3G0HA 5FI0B 5EXXA 1RRGA 5KSOA 3SNHA 1RPZA 4OHYA 2W0MA 2WOJA 3T34A 3FMFA 1QGAA 4ASUA 2F1JA 3OEHD 4PO1A 4YC7A 3CMEB 3PUXA 3VR6A 2WPDA 3MG9A 4PXAA 4OL0A 4IDOA 5G3YA 2GTPA 1NY6A 1AGPA 1E79D 3AF3A 1XCPA 4II7A 4UJ3A 1EXMA 2QTFA 2JJ2A 4LX0A 4BWYA 1ANKA 1NJFA 1G7TA 1HT2E 1U9IC 4L4UA 3LXXA 2QBYB 2W00A 3THXA 2VZLA 3W5UA 1XP8A 1TF7A 3B1ZA 4M1SA 5DO9A 1VQMB 2ZYTX 2BMJA 2RGGA 1P2UA 2ZU0C 4AKEA 4CEJB 2C5LA 3SQXA 1KDPA 2WJIA 2PJRA 1KI6B 2DWOA 4OQNA 3W5JA 821PA 1US8A 4CEIA 1GRQA 2IYXA 4LHXA 4I99A 4IRUB 3QXHA 1KO1A 2ZRMA 2P6UA 4JLJA 3DZ8A 1Z0IA 2HUPA 1UMKA 2VF8A 1CJUC 2JDIA 3M4YA 1GM5A 2F43A 4IOLA 1ZVQA 1ZU5A 3OIWA 4C4PA 1QF9A 3W2FA 3OEED 1WXQA 3PIRA 2ERXA 2AXPA 4IHQA 5CM8B 4ZGQB 5J5CA 1CJTC 2VP9A 2ZR9A 5GADl 1G8YA 2HDNB 3B5JA 3GMTA 1KSFX 1N0UA 3KQUA 4LHYA 2P6RA 1KO8A 1TQ6A 3VNUA 3SU8A 4FWTA 1X8LA 2GPJA 2IXEA 2PEZA 1RW4A 2ZRLA 2JLYA 3M6AA 4P6VF 2KBFA 2UKDA 3BB1A 4QFMA 1H8HA 1CEEA 1U8YA 4KI0A 1TEXA 4BZXA 1QHNA 3GFOA 2NTYC 2XITA 5ANRB 4US2R 2GZHA 1R0YA 3RAPR 3HPRA 3RRZA 4JJZA 4ASUD 4QJ5A 1W36C 1S9HA 1H8ED 4ON9A 4ACAA 4PC1A 1VQ9B 1CKEA 4TL7A 5C1BA 4YHBA 2ODBA 2G3YA 4BECA 1G8GA 5FH9A 4N0EA 3RRYA 2EWWA 2ORIA 3I4LA 4Q4AB 1GKYA 3I61A 2ZREA 3U7HB 2A5YB 4P4TA 4Q02A 5FPHA 4P0TA 4XTRA 1S1MA 1GOTA 2IXGA 3U7FB 3WMGA 1FNNA 1Z22A 1KTVA 2PX3A 2QI9C 4NHOA 1AZSC 3K9LA 3D8BA 2IUTA 4HLUA 4FI3C 4WOPA 2W2XA 4QM6A 1IOZA 3REFA 3GFTA 2OFXA 2QE7A 1II8A 4TWZA 2D2EA 3K0EA 1W35A 4TQ9A 1RRCA 5CJPA 2QP4A 2NIPA 1UFQA 1KHTA 3DVLA 2R6AA 3CM0A 3V4FA 4N3GA 2ZI3A 1FZQA 1XD9A 1KK1A 1JXMA 4JKIA 3SDZA 4QNMA 3KKMA 4CEHA 3M1IA 1NVWQ 3BH6A 1ZINA 1DAEA 5SZHB 2ZJBA 1FNCA 3K0SA 2XZPA 5HCNA 1CR1A 4KSBA 3BD9A 3CCJB 2GXQA 2CE2X 3A1VA 3JQRA 3BB4A 4EAQA 4Z8XA 2JLWA 1Q86D 4US1R 3QPWA 2BBTA 2WAYA 4TQUS 3LO8A 3TSZA 2PL3A 1CJMA 1G5TA 4GMDA 2A2ZA 3OAAA 3QKSA 3WBJA 3EZ7A 4FINA 4B6FA 5DI3A 2V7QA 3TQCA 2J0SA 1P5ZB 2VF7A 2CCJA 1BX1A 4Q4JB 1R0XA 3DMDA 3VO2A 3TIFA 4HE5A 2AFHE 3TAUA 3ZZTA 4B43A 1AGRA 5D3MB 3U3MA 3TQFA 1E1RA 2XOKD 1RJ9B 2GAOA 1Y63A 2IL1A 1WF3A 2WM9B 1M1KD 4QGAA 4TL9A 1Z0KA 1PLKA 2NPFA 1YHQB 4TYPA 2NO9A 1W0JA 3FMIA 2BJVA 2G1KA 4E09A 1E9CA 3IPYA 1OFHA 4RKEA 2ZRAA 4C0BA 4V03A 1GAWA 1HTWA 2IYRA 1XNJA 2OSBA 4UJ5A 4FMDB 2DR3A 1Q7YD 3GJ0A 3K70D 4Q7KA 5E95A 1YZQA 1P72A 1IXSB 4RKFA 5G41A 1GL7A 3CMAB 4JLKA 4BFWA 1EWRA 3X1WA 2MSDB 1K5DA 3W3AA 4FIDA 2XSZA 4Q4HB 2YJTD 4TZ0A 1I4LD 1N3BA 4TLAA 1CIPA 3GJ8A 2C8VA 1UADA 3ZC3A 2FZ4A 1YRBA 1KY2A 3ASYA 3ZQ6A 1EESA 4Q7MB 5DYIA 3A4NA 4HAXA 2BMWA 3A4LA 5BN5A 2IYUA 1VCIA 2Z43A 3CX7A 5L3QA 1YRAA 3AVWA 4JLNA 1QBKC 1T6NA 2OBMA 3KKQA 1XZPA 3CKLA 4LV6A 3CR8A 4U9UA 1MO6A 1XMJA 2ONJA 2HYIC 3A1SA 3K09C 4RZXA 4BZPA 2FPLA 2LWIA 3U4QA 2YNMA 2P2LA 1SXJE 3AEZA 4FD2A 4F4CA 4HDCA 2FN4A 4UNRA 5TXGA 4M2LA 1CRQA 1Y3AA 4C0KA 3NG1A 4LY6A 2O8BB 2VHQA 3AKCA 2G0NA 2OBLA 2O52A 4B35A 3ZD7A 1S72B 1QVAA 2PH1A 3FHCB 4D4KA 5K8TA 2J0QA 2X2FA 1FNBA 5HE8A 3GEHA 2E9SA 3ZS9A 2GJSA 3HU2A 5H1YA 2JLUA 4L5BA 1P7CA 4LJ7A 4PX9A 4WA7A 3GPLA 1XD2B 4EFMA 3SBEA 3QG5A 4YLGA 1YI2B 1GDDA 4A82A 1MO4A 4CZ2A 3B2EA 5AUQA 3CRVA 4LUCA 5LD2C 3FWYA 3EWSA 3WP1B 1M90D 3BH0A 4H9GA 4TMZA 3AKYA 3T1VA 4EPTA 5GVSA 3BRWD 3KJGA 1WB9A 4BLRA 1P9NA 1L7VC 2XZLA 4FCVA 5F2EA 1G5PA 2REOA 2G83A 3Q5DA 1OIWA 4IJMA 5EE3A 1NIPA 3ZJYA 4DB4A 4JVMA 5JEEA 2DBYA 2O8CA 3B7GA 3VHLB 1U98A 3IHLA 4I1SA 4GP7A 4PZZA 4YDHB 4B3BA 4A0FA 4IDPA 5KU1A 1GL6A 2RGNC 3KXLA 1IXZA 2Q21A 1C1YA 1NKTA 2NO0A 3IO3A 3BFXA 3QFSA 4TN1A 2REBA 1AS0A 4PC2A 2A9KA 5E7JA 2IWRA 1ZNYA 5BN3A 1SM4A 1RC8A 2RGEA 1VQNB 2IF0A 3ASZA 2IYLD 1XPRA 1XJQA 1GO2A 4DLXA 3LV8A 1GNQA 5C4GB 4XOIA 5TDHA 4QOSA 4Y0VA 2J41A 1S1CA 5JFGA 2YV5A 4KU4A 5GJVC 2OK7A 1R10A 2HCBA 2J46A 4HAYA 2FDCA 1JJ2B 4RFVA 5P21A 2Q3MA 3CPHA 1Z0AA 4C0JA 4G1UC 3WRXC 2FSHA 1BMFA 1CP2A 4DJTA 2QQ0A 2A5DA 2HMAA 4M1KA 2GF9A 1F2UA 4JBWA 1Q22A 1II0A 3IHWA 1SVOA 1A7JA 1Z28A 2ANCA 4ZIRB 4V0MA 3U3RA 3LBHA 1B23P 1XTRA 1E79A 4OK5A 4PSKA 5TARA 2VSXA 1VG1A 4PSVA 3SQWA 2V8OA 3K70C 1N8RD 1UM8A 1W0JD 4B2PA 3JZMA 4QKQA 4KVGA 5EP2A 4KITB 4C7OA 3FKSD 1SHZA 3DMNA 1PJRA 4Q1FA 4OBEA 2WMOB 4D0NA 4U7DA 2CNDA 2BMDA 3VR2A 4DDUA 1QG2A 1LTQA 2GAAA 3THYA 1T91A 1U2RA 4F38A
chains in the Genus database with same CATH superfamily
4H1TA 2JLBA 4DN6A 4CV0A 1UBHS 4F2DA 4ZHSA 5FYDA 4WT7A 4QJ3A 1GZSA 3FNIA 1M9NA 5DBIA 1SCUB 2VZ0A 3KWLA 3NAGA 3ENKA 5DN9A 2IZOA 3HJAA 2HNAA 4L72A 3U6BA 1EWKA 4EG4A 2C5HA 3QKUA 4FNMA 1Z37A 1H3FA 1Q9SA 4QHSA 4WNCA 2IK8A 3RVMA 4X3OA 3VDRA 1J2EA 2Y1WA 1VBKA 4NBKA 2EIXA 2I67A 4DCVA 1FP4A 1UBSB 1VJGA 2HK7A 2JFFA 4MIKA 3THRA 2XMDA 3CP2A 2KSQA 2W0SA 3DAFA 2UU9B 4FBLA 4NTZA 4XCXA 3TINA 2NZUG 1NJ5A 3GN1A 5A3SA 3BQMB 3PNBA 3O84A 1K2VN 1E8NA 2I2BA 1W85A 4JUFA 2EHJA 3T06B 1FFBA 2JW5A 3HYRA 4WBNA 3IO5A 4YP6A 1ONNA 2JVKA 1MT0A 4KPYA 3CE9A 1GZ7A 4NJMA 2A0XA 3OZAA 1YOVA 2LXNA 3O0DA 1EK0A 3R7WA 3U7GA 3S1LA 4DOMA 5FWNA 2AA3A 5GTDA 3B7PA 3LC0A 1N2CA 4JUDX 1MEOA 4DUGA 3O8OB 3ILVA 2AK2A 1PT7A 2HRCA 3ZGVA 1ARZA 3PEVA 4DRXA 4GKKB 1ISFA 1FSFA 2CXQA 1JHRA 1J23A 4BUCA 3MCZA 1JE1A 4CR8A 3WGGA 2QRQA 3NYIA 4IDQA 3AJ9A 1EJ6A 1XXLA 3H0KA 2C2ZA 3M7IA 3HYLA 2V4DA 2GBFA 3PNMA 3E0QA 1LXCA 2B1IA 4FR5A 1GRCA 5J3OA 4ZOEA 4LFCB 1ZIPA 3C14C 4O4JA 4YJFA 4ZYWA 3Q10A 4DJJA 2X5KO 2AJBA 4CMAA 1AA9A 2GT1A 1AO3A 4O4IA 4UBLA 4WZ6A 4DQKA 4UAGA 4LOHA 1NB0A 3CPWB 3JR3A 2XD4A 4K2HA 1BYIA 1QE3A 3AIOA 1VIMA 2Z83A 4MW5A 2DUWA 3FBWA 4ILEA 4QC2A 1JI0A 1WNTA 1ZJ6A 3JTMA 4LFAB 3TZQA 4FKZA 4Z7NB 3I2KA 4TKZA 3A3YA 1B1CA 1OBFO 1YUBA 4HV4A 3BJEA 3E70C 3H5LA 3HKEA 1IYZA 2ZYGA 3HV2A 2JCSA 5IAJA 4BS9A 1A69A 1XZMA 2ENUA 3T7EA 3QF7A 5CDHA 4I1RA 2QNRA 3PE3A 4U2CA 4QVJA 4ARZB 1W96A 1U2QA 2OZPA 3B9BA 1L4UA 3E2IA 3IS3A 3NDIA 5AVUA 3K0CC 5I7SA 1KDTA 3BWBA 3GNLA 3TTVA 2OECA 2BEKA 2V7WA 2ZB4A 4XQ0A 1GILA 1LDNA 2XHEA 1D8TA 2JLXA 2IC5A 5CA1A 2BLLA 4CKBA 3A6DA 5E4JA 1LBSA 1PNTA 1OZGA 4D98A 3UHOA 4X92A 1SU8A 4M21A 2ZUEA 2Y6UA 4N5MA 4Y18A 3KCNA 1Z63A 1RYEA 2IDZA 2X9GA 3IFSA 4NHEA 2JFPA 3CCBA 1HEIA 4XA8A 3J81A 4WBSA 4XDGA 5L3VA 2IP1A 13PKA 5MGBA 3EVGA 1AX9A 3ABQB 4YRGA 1ACJA 2EJWA 2VPXA 4JS0A 5GPBA 2HLDA 3SCZA 1J8MF 1RQ7A 4F9TA 3IJ5A 3GAMA 1SBCA 1TVMA 1P2SA 1YACA 2H2FA 3N3BC 4YJGB 5I9SA 3W5IA 2BJHA 4C7JA 2QIPA 4COKA 5HUHA 4NS4A 1M2OA 4MLPA 2UUAB 1SVKA 5HZHA 1KI1A 5E3IA 1GNRA 4CIDA 2QX8A 2WTMA 5ITVA 5FFMA 2AR7A 2H2GA 4FHFA 4KBFA 2Q5HA 4HDKB 2PPLA 1RCUA 2I66A 3NBFA 3ANLA 1VKRA 4JBXA 2R1ZA 5F4JA 5MGNA 3PWZA 1E9EA 4PCVA 1RLIA 2CCGA 5CURA 4G6ZA 3I37X 3B1KA 3PGJA 4I5EA 1DDGA 1SELA 5DRYA 5IAOA 3K0FB 2UUCB 1QAQA 4HEA6 2WUDA 2DBQA 1A8HA 2WB2A 4AP6A 4II3A 2PFKA 4H16A 5BMVB 3AL0C 1TF5A 1XBTA 2HX1A 5DX8A 4Z0TA 2PYDA 4YQEA 3TR0A 4A2PA 3C8UA 3PJFA 1FYDA 1NG9A 5WRFA 1FDTA 2NOAA 3GT4A 4TXMA 1DINA 4UXIA 3MXTA 4KKSA 4NMHA 4HL6A 3B9QA 3CZQA 3OICA 4J29A 3L4EA 4J3NA 3NXKA 3I5XA 2I1VB 721PA 5A4MS 2G06A 4KTTE 3IP8A 2I6GA 1LFAA 1W4BA 3L0IB 3DOFA 2XIJA 2A3RA 3DZKA 1ISGA 4P33A 4NMWA 3F6YA 1XRMA 1VC2A 3NYQA 3OTIA 3BB3A 3H9NA 2CVPA 4TLEA 2OBSA 2NV6A 4MLZA 3WE7A 4CODB 4EJSB 5IPFA 2WQ6A 1A9XB 1M5RA 3ANXA 1PR4A 1JHDA 2JI7A 4M0DA 3IUMA 4MKIA 3FNEA 3DD1A 4M98A 5AOCA 2B1GA 2JL1A 3HCNA 3QHQA 3UWMA 3VHQA 3JVEA 3ZD9A 3EG5A 5DYYA 4I4LA 3KZXA 1EXWA 3OOYA 4AZ3B 3H6GA 3LBFA 5A1TA 4IUDS 3X2FA 1ML3A 1JAHA 2BRUA 1Z6GA 4UOQA 1UPFA 3WTCA 3HU5A 2QD4A 3TZEA 4RBNA 4DCNA 4E6PA 3DEHA 5E6TA 5K7SA 2R7KA 4OHBA 3VO1A 2A7XA 4QPNA 3MWLA 5FO0A 4UAVA 4UW9A 1VHTA 3O3NB 2R6HA 3CF4G 3MJHA 4RESA 1EFRD 3T7DA 3OHPA 3DM9B 4CT0A 2YHBA 3WZLA 4EIWA 1KQFA 1NASA 1IU9A 1SKUA 1X77A 3FD8A 3LPAA 1J0BA 1TD1A 4DJDC 1L7PA 1JIVA 2RB5A 3L8EA 2P11A 3DO6A 1OUMA 4LX8A 4QAQA 2J08A 3CCLB 4MB6A 2C9CA 4UPDA 2C78A 4BAGA 5IZCA 4GOOD 3KJEA 1S9DA 3UXYA 3K3PA 4DIKA 1IEQA 3FY4A 4KGZA 5AWFC 1NZFA 3NORA 1ZM9A 1QQ6A 1KA9H 4N5IX 3WYNA 1NQUA 2PA3A 3LCCA 4Y8VA 2EFDB 2V59A 1J2RA 3KTAB 3I09A 4XWOA 2UYHA 3EVNA 1Z83A 2ZAYA 2IOQA 3QELB 3C3DA 3UK1A 3CCVB 2W6IA 4JQSA 4DV4B 4B6JA 2OO5A 1DS6A 1A04A 4RH3A 3IERA 3P1JA 2Q5LA 3OLVA 2O8BA 2DR2A 1SURA 4HPWA 1QIIA 3CRNA 5JWOA 2HWUA 2Q27A 1P7WA 1G16A 4UUQA 2R47A 3E7XA 4MRRA 5ADVA 1DTWA 1DWUA 1SR8A 4CTKA 3OE5A 2XNKA 2WVHA 4RM3A 2CFCA 2OO5C 4DY6A 5TY0A 3QVOA 1LPNA 4F8YA 3AVQA 4K1XA 4AO6A 2PAFA 3OFVA 1NPTO 5JJKA 5EKDA 2VHZA 3QRWA 4YRMA 3DFMA 4G5QA 4ZXFA 3KWJA 3KQNA 3IVAA 1WG8A 4NNPA 3M3DA 2XLBA 3WMEA 1YZGA 1E58A 2VAPA 2WW8A 3I4CA 1VRVA 4OBXA 2HTEA 1F5NA 3KLOA 5GP1A 5I45A 5LYJB 3I30X 3O4RA 4NBRA 4EK9A 5HYVA 4RF4A 3TNYA 2J59A 1T4DA 3QTTA 5ENVA 4C5AA 4RHXA 5CFQA 4CQNA 3KPVA 4EWLA 1QSGA 4Z4TA 1OLXA 4HX5A 2C99A 1G0OA 1UBMS 2MWMA 2HMTA 4W1RA 1G291 3CH4B 1OXSC 3RUFA 3SYRA 2EV9A 3A28A 1A50B 5JJLA 2X1VA 1XCJA 4IIUA 3R5HA 4LE1A 1I3OA 4E3WA 1JKMA 1E5XA 4G1CA 2XT0A 1YDGA 3I5YA 3ZDYB 3PUHA 4LRWA 4XNFA 1ZY2A 3JALB 3SJZA 4PZEA 3OO1A 4YAOA 4GWLA 4QVGA 1TUIA 3A6FA 5EIXA 1Z5GA 4I36A 2FR1A 4RPJA 1JBKA 2ZUCA 1JZTA 3P20A 4X8MA 3VR4D 1MB9A 1Z15A 2AHRA 2AUTA 3LUKA 4Q05A 4CMIB 2BE9A 2ZUVA 4Y2QA 3NLLA 1K6IA 4LKRA 3NE5B 3D8NA 4C4TA 4PY2A 2IEGA 4JBYA 4R8KA 4W8OA 5CAEB 4X6LA 2HSEA 4K9OA 1FFYA 5ALMA 2ODNA 2VBIA 3NH6A 2EFGA 4P12A 3ZIAA 2PN1A 4P5PA 3ZCRA 2IYPA 1U8TA 5D5PA 3THSA 3CF2A 4FYPA 1XQXA 3A6EA 4FMBB 1GR0A 4WINA 3W7AA 1SXJD 4JA2A 1M2WA 2JGNA 4IGFA 3R76A 4Q7QA 5MHTA 4C89A 4EABA 2SHKA 1BIFA 4LOJA 5CPFA 2I1LA 1W48A 3QVSA 2NU7A 3SXJA 4U02A 4D4HA 4ZYLA 3QQPA 5A62A 3NFYA 2CJWA 2BZ1A 1WWKA 2FEWB 5EXSA 3UO8B 2JGDA 3RFVA 1VL6A 1HMPA 4TWBA 2C2MA 4H4EA 4AECA 2C9DA 2XPCA 4MIYA 2ZW9A 1E2EA 1ULSA 3FDIA 2REQA 3ORYA 4RF2A 3WO1A 3RSQA 4F6CA 1UD2A 1PX0A 2MSCB 4JT2A 1D2CA 1NF9A 4GWKA 1SXIA 2AMFA 2F43B 2WDZA 3T3IA 4ARZA 1VIAA 2GPTA 4KEAA 4N41A 4YYZA 1ELOA 3G82C 5A03A 1SRRA 4DLRA 3VR2D 3FJYA 1J42A 3E20A 2B99A 3UV7A 1BC5A 1REQA 2FPUA 1E9RA 5IXJA 5DBEX 3V2IA 2UZIR 2PQ2A 4J9UE 1A95A 1OYYA 2OCYC 4UFOA 1YBHA 5EHZA 2R00A 2HAEA 3GK3A 5E1DA 4OHPA 3I01A 2W11A 4AO7A 1K98A 2Q6KA 4EJFA 1E5VA 1VKHA 4P98A 1OVGA 5F1OA 4BBPA 4JU8A 4ZI7A 2JRCA 3PDUA 1SB8A 3B7WA 4CKXA 1P4RA 5DGHA 3IOMA 3UGQA 5TR9A 1M74A 2IU6A 2EP7A 5BW6B 3MJEA 4CM9A 5BOSB 2ZI6A 2WKSA 4NQZA 5JALA 1T2VA 1PZNA 3GLTA 1PDWA 1NXPA 2OHGA 4C88A 1OT3A 1V8FA 3G2HA 4M1YA 4MWBA 3P9IA 3EE6A 5B1EA 4JSYA 3GBVA 2YWXA 3L7LA 4HDMB 4ZVRA 3I45A 3LZDA 3H9EO 5KSYA 4TT3A 1Z0JA 4MYCA 1GFIA 1TECE 3R3SA 3H7AA 4DR3B 2CN1A 4XQCA 3P7MA 3PKJA 1FFAA 3W3ZB 3BZBA 3DEKA 4U39A 1UD4A 1P62B 1Q14A 1RRKA 3TRDA 3VOBA 2H0AA 2JN9A 1OV4A 4D9IA 2BMVA 3A58B 4WBNB 1Y3BE 1PJCA 3HKCB 3RS0A 2ZE7A 4IOMA 1T1EA 3LVFO 1T0HB 5LDGA 3EGCA 1H69A 3LXRA 2JD0A 4F93B 3H84A 4C2TA 4N0PA 2B1QA 2PYIA 1EFKA 4KODA 3FTDA 4XCVA 1XRSB 2NO1A 5HIIA 1THZA 4ND5A 2IEAA 3MGBA 4CF7A 2EWVA 2FRDC 3EOAI 2R7MA 3IPRA 2W6JD 4XYMA 3TZLA 3NBMA 4H31A 5ITZB 1RPTA 4UTXA 1OAOC 3AX6A 3KCQA 3KOOA 4PTZA 2IKQA 1L5HA 3UAGA 1AGNA 1KZGB 1EGAA 2OT3B 3I6MA 2O14A 5CLJA 3N07A 4DDWA 1HDRA 4JP2A 5JAPA 1COWA 4LYYA 2V03A 1TW2A 3K5IA 3BMCB 1IEXA 1WKVA 4ZVSA 4XOTA 4HJXA 4KRFA 2PWAA 1JLRA 1L6RA 1QHEA 3E9NA 3OQBA 5CBPA 1KXJA 4I9HA 1Y98A 3DNMA 3GY0A 3U9TA 2LUOA 2JKYA 1FQWA 1SCNE 4M55A 1G20E 3Q6QA 1GYQA 2Q5OA 1EK2A 1J1ZA 1PG0A 3BCFA 4KHZA 3IHTA 1NQXA 3AF1A 1GQ2A 3U7EB 3HDJA 4AKGA 3W1WA 1BSVA 3NKLA 4WZLA 4D25A 5F4MA 1CUCA 3PDWA 3O26A 3IYLW 3I04A 3H1BA 1GPH1 3A4MA 3B8EA 3L49A 4PABA 1XJWA 3USES 5TJ9A 4CW7A 2VH2A 1DVRA 2YOGA 3P2OA 1R7RA 4WAUA 3T7TA 3W3AD 3U4IA 2VTBA 5AHRA 4DPKA 1UJCA 2QX6A 2P5YA 1V5IA 2R7NA 2HJSA 4PNZA 4BMYA 5J35A 3RVJA 2CV2A 3MBIA 4L3VA 2ZB8A 2DEUA 2QS9A 4GYWA 3W06A 2QMUA 4QRIA 3ZDXB 1BDHA 3PX7A 4YJDA 1YZNA 3Q5GA 4BY9E 1W1WA 2JIDA 3WKBA 5LMUB 4B3XA 1LRLA 2QJTA 1EXNA 2XUFA 5A4FS 3FZNA 4Q12A 5E6RA 2I4OA 5HF9A 3SR3A 1YJ9B 5MFPA 2I7TA 2XZOA 2X0DA 1Y3CE 4TWIA 5BXYA 5IDVA 1X0XA 4GI3A 5DLPA 1RWQA 3SC2B 1LV8A 2YYAA 2I7DA 4GQAA 3HVRA 3K6KA 1MORA 3C3EA 3H5TA 2F3RA 2F2TA 3PUWA 1EI9A 1NDUA 2HLNA 3N0TA 4MZXA 2MYTA 1EUDA 4PFSA 4IHAA 5ALPA 4PGAA 2DFDA 3FHOA 4ETIA 3HABA 1PGQA 3U4DA 4A16A 3BMNB 4E6EA 1YH3A 3B13B 3E84A 1KRHA 3FCOA 1QDUA 1N2SA 3HC7A 3M4ZA 4NMMA 5H4HA 1B3BA 2FFJA 2AJCA 3V4SA 1M2KA 4PPYA 3BDIA 3KXDA 3OJLA 1IHDA 2BFAA 5B1IA 2ZUDA 5HKKD 2QF7A 3D6UA 3R6LA 3FNGA 3WJ7A 3R6GA 3IQDB 2FJUA 2O8EA 4UXJA 5THKA 2P27A 2ZRNA 2Q62A 1VPVA 3CW2A 3CC7B 2G6BA 2GPAA 2IX9A 1Y1RA 2VBTA 2WZBA 2DH6A 3BXZA 1XTUA 2G9RA 3DC7A 2HBYA 1Q0PA 3FH0A 2OCKA 1A82A 2M6RA 3FCXA 3H5WA 4NPHA 4P34A 3A6PC 2YH2A 3C6ZA 2E85A 4RSHA 4DM4A 5ECYA 1BFDA 1XEXB 3TL3A 1OGYA 4YTEA 2R44A 1UBTS 1XHFA 1NUPA 5KYYA 4LYJA 3WO0A 3LSTA 3AH8A 3V7UA 3NAMA 3Q8WA 4EA9A 2Y9MB 2FMTA 1SUDA 1Q0HA 4WLUA 1ODSA 5IVIA 3C1UA 2J9GA 4FZRA 5F52A 3ROZA 3RT7A 4UZSA 2QJRA 3LU1A 4P7BA 4ZO9A 1Z6TA 1X1QA 2Q5EA 2W43A 4X8OA 4XLZA 5SZKB 3RV3A 3L1UA 5D3QA 1WTAA 3KJZA 3AVOA 3QUTA 3G7UA 2BHNA 3UWOA 3CU5A 3V34A 3WV4A 1JLKA 4LXGA 5IYZA 2GRAA 2I4NA 1ZM4A 3GHYA 2QDXA 3KT8A 3LYAA 1E3QA 1IJFA 1NHGA 1P7PA 4CEJA 3R7SA 1ZGGA 5DYGA 1VB5A 3RS7A 5EP4A 3UAWA 4WZKA 4XONA 1VPEA 3L4JA 4YRIA 4MEJA 1K6XA 1T0JB 4RLFA 3WLIA 3ZWKA 4DEYA 1G5RA 1QQ5A 1QTQA 2AOTA 1KNXA 3ICWA 4PRYA 4BGVA 4LF4B 2OLJA 5B6IA 3IR6A 4ENQA 1QTRA 1G2QA 2PKQP 2ZK7A 3BD7A 5EUQB 4ZFNA 3Q0EA 3Q38A 3H1FA 4MPJA 3WMXA 4AKSA 1QHIA 1WL8A 3F6RA 3UHPA 5JASA 5TQ2B 4V0RA 2I3DA 1OZFA 1U3UA 5EXPA 2HMUA 2QAGB 1NRJB 4P32A 4UEWA 4B9EA 4OX9Y 3FPKA 3KLMX 5FUBA 3U81A 3WJAA 1S0UA 4RZQA 1QOPB 1QIMA 4A1FA 4Y9TA 1RLTA 1V11A 2G77B 5TV2A 1QZZA 4RZHA 5J47A 2BSXA 3TRJA 4PIVA 2QAIA 4RM0A 1MW8X 4Q7LA 1FYXA 2J6HA 4ILKA 3KUCA 1TYCA 3MAAC 2P9ZA 4WK4B 2HO4A 2DPMA 3V46A 1MF7A 3DVRX 4IUCS 1SBZA 2ZVDA 3KKKA 5K3AA 3ZTYA 2AXQA 3CO5A 1IAVA 5KJFA 5FPTA 1Z5PA 1CJVC 5EE1A 2WNSA 1KOLA 4PZ9A 1T0UA 3Q2OA 5J58A 2GM3A 1RACA 1DX9A 5FV4A 4JMQA 2FPRA 3M4NA 4HD8A 4GZ3A 4EKNB 2XNSA 4PLFA 1PJ3A 5BSUA 2Q1XA 2EBHX 4NS1A 5ED0A 4A0HA 5TMDA 3QLTA 1C2TA 1Z08A 3KDAA 1QO9A 4NVRA 3WNDA 1V1MB 2BEUB 1JLMA 4P93A 3WQBA 1GU0A 1E98A 3BORA 3DAHA 1SWVA 4RSGA 3QXCA 1QRUA 5DMHA 5SZIA 4EZEA 4QYMA 3KVRA 2ZVQX 1J09A 1JHZA 4RD4A 4A8JA 3BRQA 1XZDA 5F23A 1MPXA 4KNWA 4J16A 1C30B 4O1MA 5AHKA 1X8JA 1U6IA 5DWQA 5BSVA 1NG1A 3R44A 4LMPA 1KSGA 8GPBA 5JD4A 5EIWA 3CRW1 4DLZA 1RXVA 4G0UA 3G13A 3AO0B 4IQGA 3TIVA 5C8ZA 4OI0A 2Z4RA 4PAWA 5BNFA 3R1IA 2IU0A 2ORVA 4DRXB 2C7QA 3AF5A 1CQIB 3GDHA 1PCXA 2BGLA 2AFIB 1F6BA 3VOSA 2HYDA 1AKNA 2YXDA 3CLUC 4G0ZA 4D56A 1BYUA 3VKHA 4H7IA 4HXFB 4NF2A 3TFWA 1W94A 1NB9A 1T3ZA 3IL2A 1AHPA 1YJWB 1VI6A 4ZAFA 1PFYA 2DX7A 2WSLA 2FWJA 2CSXA 1RC1A 5CEJA 5JNSA 4PC7A 3FKSA 1SBNE 4LRQA 1MB3A 3UTDA 5AXBA 4D96A 4X41A 2HC9A 4HX2A 1WSVA 4OJQA 4X8LA 3NIWA 4MS4B 5CIQA 1PEYA 4RTNA 1U7WA 1Y34E 3KC2A 4F97A 1BEUB 1Y5MA 5K3SA 1H1LB 1UBKS 3ZK8A 1BMDA 2C20A 3I5AA 4O2AA 4X85A 3I0NA 1YQ9A 4BV2A 5CFOA 2CUNA 3QW2A 4Q0MA 3VZRA 5H81A 1KBOA 1JHXA 3CVWA 3WKCA 3L1JA 1J9GA 1T5SA 4QLBA 1ZUD1 2EZTA 5GM2A 5TQ0A 5JBNA 4CL3A 4NSNA 2B6NA 4ALIA 1DKRA 1ZD5A 3AUTA 2JB9A 1EGHA 1R5JA 2ZRBA 3BA6A 1OX4A 3ZXUB 1ZK0A 3MELA 4NH0A 4MW7A 3QNWA 2VNAA 1T43A 3I23A 1PZGA 5LUBA 3ON5A 5I7RA 3S1SA 4HS4A 3SBOA 1HM5A 5JMPA 1K7YA 2WHEA 4FFBA 1ZD9A 4MI3A 1FRVA 1QVRA 1S3FA 2RSLA 3ILSA 4OTZA 4H1VA 3AEXA 4I50A 1BWQA 1P4GA 2Y1EA 2GLUA 4WN3A 3QPAA 1R4AA 1IC6A 1MP0A 3Q5EA 4XKWA 3HO8A 4ITVA 4MWTA 4XIYA 1RYZA 4N3AA 3WGNA 3KZMA 4EW6A 5A1JA 3A0UA 4EHAA 3ZVKA 2VL7A 1C81A 1XXHA 4AJHA 1C9MA 4PLZA 3SJBA 1FLVA 1Q21A 2JLZA 2QTNA 4PBSA 1JVNA 2ZXUA 4AY6A 3MLBA 1X1EA 4YCBA 3VX3A 4K3VA 2G72A 5DNCA 4WNYA 1P91A 5E6RB 3GROA 1QCCA 3P32A 4BO8A 4AS3A 4MEBA 4M89A 3LE8A 4DR4B 1E3IA 4AZ0A 2FWBA 3IP6A 4RV9A 3VU9A 1P5FA 3CCFA 4Z4FA 2Q6IA 1QR6A 2H5EA 4L4RA 3ETDA 2JLSA 2VDOB 4JOSA 2QTAA 1XB2A 4AS2A 2V3VA 4YUWA 1H2BA 5FCDA 3A7EA 3OQOA 4ZCLA 1HSZA 3LRPA 3JQ8B 4BGDA 2HLHA 4LFBB 4HGYA 3X43A 5A7HA 2ZI7A 4LWPA 3KE9A 4WN9B 3WG9A 4ER0A 2YZGA 4YRZA 5CITA 1MJGA 2WABA 5JAMA 3P9YA 3AHCA 4AO8A 1JSRA 5A06A 7REQB 5E9JA 4C43A 1GQOA 4LHEA 5LQUA 1JHQA 4C14A 5AUNB 1FTNA 4MHTA 2FRXA 2EU8A 2VDMB 1HL7A 1K68A 1Q0UA 3GUUA 3LVBA 5K8CA 5F98A 4S1WA 3LW7A 3TVTA 3HXOA 3R3UA 3W5BA 1GZ6A 5B2FA 2QY9A 5FI1B 1DXQA 3ROPA 1AVTA 4KYVA 1HE1C 1DAIA 2C88A 4N54A 3T3HA 4B4OA 2VS1A 1QC5A 1GRNA 2FWMX 4F6RA 1P1RA 2I76A 3ZTWA 4RPDA 2FEMA 2H54A 1GTG1 2QGFA 3OZXA 3TQHA 1WCYA 2V4ZA 1M2HA 1N5JA 3MT8A 5HF5A 1W52X 2XQFA 1TM4E 5AK0A 5NLLA 4EL5A 5IJZA 3KKNA 1OFGA 2CKDA 1KGSA 2CMFA 1N3YA 2V65A 1Q1ZA 4CQMA 4CL2A 2VJOA 4QBGB 3J81k 4Z2YA 5E1BA 4L8LA 2P6NA 3SVZA 1WVGA 3ZX4A 2V8BA 5FDFA 2ZTNA 3SYNA 5BXQC 3T4XA 3H99A 3HKCA 2BRUC 4KPUA 1LLCA 4JT4A 2CDRA 2XGOA 2ZT7A 5T4BA 2FPXA 4DILA 2VNHA 1XYGA 1DG1G 4GS5A 1H9CA 1XSEA 1EZ4A 4EGCB 4GP6A 4GKBA 5TS3A 5JVDF 1UXGA 5L3RA 3DXXA 1GA6A 1JZSA 3VR4A 3TFOA 1PIWA 2WJJA 1SUFA 4D8VA 3PV0A 4J3FA 4YELA 1MIHA 1EA7A 1R4NA 2NU9B 3T54A 1AKVA 4UDNA 1QP0A 2PUBA 3OA2A 1E3ZA 5BYAA 2H3HA 1XLTA 1QB7A 3M81A 4D3YA 4ENSA 2GFIA 5BY2A 1F5SA 1QYIA 4R6XA 2ES4A 4P5DA 3UMSA 4TYWA 2WKQA 1GJRA 2WM8A 3C39A 4B9AA 2Q0XA 1AOXA 2Y0PA 3CKYA 3UKOA 4EB6A 3TXYA 1C1XA 2XSZD 4CBVA 3C16C 1FLNA 1NXSA 1F60A 2KX7A 3E5NA 3I92A 4EYKA 2Q6TA 2AJDA 4DWJA 3S1AA 4UHCA 2CXRA 5H9VA 3P5BA 1T5EA 3ORRA 2C2BA 3ETNA 4LYGA 2XUDA 4YIHA 5C1DA 2REXB 2BBSA 1CV2A 2P1ZA 3CX8A 3PQ6A 4JVLA 4LRTB 5DCYA 1SKYE 3NHMA 1E4VA 1Y82A 4RMGA 1CF9A 4ZAGA 2P91A 1OIVA 3A36A 3ESYA 3OT1B 1T2CA 1WHSB 4LWZA 3WYEA 1NOIA 4FOSA 2FP4B 4MWEA 4RWZA 4Q3CA 1S96A 1YKSA 4WL0A 4FDUA 1O8BA 5ICCA 1J49A 1T2NA 3WSWA 1XLWA 1PK8A 3PUMA 4IRXA 1RRMA 3OOJA 4KK4A 1PTJC 3BBLA 1YZUA 4RA9B 2O5RA 3GGCA 2HJHA 3RQIA 5FNVF 4IX1A 3PC2A 5DMXA 4M8SA 5IT4A 4JDUA 2GBLC 2H59A 3U17A 3YASA 2P65A 2VQ6A 3GIRA 1LA2A 3GVPA 4LECA 4DMMA 2IFTA 2QG9A 3BE4A 4INJA 1DZIA 2B69A 4RVGA 2XKKA 4NK5A 3D59A 3RI3A 3HP7A 2A0FA 5HCUA 2Z5GA 4BP9A 2PH7A 2ZJOA 3W2IA 3NV7A 3A3KA 1DCKA 3BSSA 3WRWA 4AULA 4DDVA 1G5HA 4ZAVA 4B8YA 1S2DA 1NBOA 2CDCA 3DDCA 3UT6A 4C3OB 5IX8A 1R4ZA 1U90A 3H1TA 3GNQA 3LY7A 1AH2A 1K3UB 4ZI3A 1XTTA 4PZLA 4GMHA 1HYQA 4NNJA 3ZX5A 4DT1B 1X1RA 3GVJA 2CK3A 1LX7A 1SXJB 2J7PD 2CZQA 4HXEB 4LYHA 5EYPA 4C0XA 3TDNA 2IBSA 1ZD4A 3I2IA 2FY8A 4MQUA 2A5LA 4RVSA 5CX4A 1V26A 1JDTA 4TTQA 1M2GA 4FW9A 5FL3A 2PEYA 1SVNA 2XIQA 1G3MA 1XQWA 2YVQA 1VPDA 3O8BA 4PG6A 4EHJA 4HS9A 5KTKA 1C7JA 5L8VA 4CDNA 1N2OA 3OPXA 4HWTA 4XFDA 4YT8A 1FQJA 3UXMA 2OORA 2Q2VA 3RS5A 1V8DA 4X44A 4I4IA 1DI0A 2G71A 4M76B 1L0BA 2P41A 3RFCA 2XYVA 4OQQA 5DISB 5IJ9A 3UGJA 1L7AA 1P4SA 1RWKA 1VIVA 4FKMA 3UC9A 4CQLB 5JQGA 5K09A 4O2RA 3CZMA 4Y7CA 1P8AA 4FEAA 1ODJA 5IP5A 5A3JA 2QM8A 3PP8A 1PNVA 1JXQA 1SCIA 3DYVA 5C2JB 1LS1A 3OU2A 3ICEA 1IN1A 2AMYA 1I6KA 4IMIB 4EHBA 5DNDA 2EJVA 4OHOA 4XSHA 3RANA 3LX5A 1KFKB 4M1WA 5F12A 4PIPA 3ROQA 5CB0A 1MOPA 1X19A 2D4HA 3AVTA 3HDTA 2MT9A 3KVOA 3B6EA 2VP4A 4H7KA 4P7KA 1V4NA 3THXB 1OI2A 3VR4H 4HFMA 3NVDA 3OOCA 3A9CA 2O48X 5JAUA 1QVZA 2OQVA 2C7PA 4U7GA 1U4NA 2BFDA 2ZETA 1J8DA 3L9WA 3U5ZB 1MLDA 1JVSA 3DMGA 4X65B 2A9RA 3OJCA 2X23A 3OFJA 2HUNA 1JEQA 3KP1A 3OF5A 3OD5A 3KQKA 4EG6A 2AN3A 4PTYA 1VMKA 5A6SB 3ZGZA 1HYBA 5JJIA 1EMDA 2ISSD 1PLLA 3A37A 3D31A 3LX6A 2HHCA 1BWRA 1KJ8A 1XGKA 3Q2KA 4RZUA 1Z3IX 1TL7C 2J0EA 3UB3A 1Q95A 4R1NA 4FILA 4O4HB 1PEKE 2EFEB 2PCLA 3I34X 1G20A 3QUCA 1P6UA 1Z75A 2IY9A 4QRDA 3CH6A 1Y6GA 1OV6A 1HZEA 4WBNF 3LQ2A 1DBSA 3A14A 3WDKA 3B1JA 4EPRA 1YDHA 3HJBA 4QFCA 3WGJA 1RCFA 3H11A 1BS2A 1ZSYA 2XAAA 2JASA 2GK7A 2OL4A 3AOEA 3G2IA 2GS9A 4V39A 1TJ3A 5HQJA 3ZYCA 4QBIA 2XR1A 3IRUA 4OQZA 1A9TA 1D3AA 1CUYA 1HF3A 1XJ0A 2GEVA 2B92A 3EIHA 1RP1A 4R3WA 2TMDA 4Y2TA 5LD2B 1X1SA 4LV5B 3X2SA 1T3GA 3FVTA 1YQXA 3QIVA 4YAUA 1Z9BA 1QF7A 1Y4UA 2KYRA 3IHKA 4S1TA 3U9LA 5PGMA 4X0EA 5I4BA 5KOHA 3QKRA 2C58A 4OKIA 4DLUA 1IQUA 3LCRA 3Q15C 3R41A 1EFHA 5HFJA 1TYAE 1V5GA 3HP1A 5LZ8A 1VG8A 5AIBA 3BK1A 2O8VA 3E9ZA 1P45A 2V54A 1M5TA 3M4XA 5CNMA 1SQ5A 1ZHOA 4X66B 4Y2XA 4HH3C 4BQOA 3ZBQA 1GITA 4HGNA 4C3VA 4BPRA 1E99A 1EAYA 1I4OA 4DAOA 2LKCA 3C5VA 1CFJA 3FKQA 1VLMA 1JTEA 2B83A 3G8YA 3PDIB 3GI1A 4WKGA 5BN5B 1E7QA 5JSYA 3AOEC 3EDYA 4RAQA 2PRKA 2ZSHA 3ZVMA 2I8CA 2NVUA 4WN9A 4EHHA 2X9VA 5D8DA 2I6QA 1YB4A 2G9UA 1N8NA 1DV2A 1GFZA 2X41A 3V1TC 1U02A 4NXMB 1OGIA 4CGZA 4LC0A 2FTKE 3C5CA 1E1RD 1W59A 4EVIA 1LLUA 2QUJA 2WYOA 3AB3A 3G0IA 3HR8A 2G1JA 1RXEA 4HJRA 5FLYA 2NO5A 2RK6A 3SR4A 3WLKX 3ICQB 5B12A 5K0SA 3VYWA 1IULA 5FTLA 3B85A 4GZ6A 2FX2A 5EJ2A 4AZ0B 1U5AA 1T9BA 1K88A 4HUQA 3W90A 1P0QA 4GUDA 4YUVA 2CRVA 4GXTA 4RD1A 1R00A 1N2XA 2VH5R 4GFDA 2VT2A 3D5QA 3IDSA 4DLVA 5JI3E 1FYWA 3EF1A 4N76A 3O1IC 4RSMA 4YMWA 1YFZA 3KTOA 7MDHA 1EK1A 2PIDA 4ZD6A 3ZXYA 3QKTA 1VDMA 1J8FA 1K63A 1CQZA 2IHVA 2RGNA 2J32A 3BMQA 2PKEA 3PQDA 3RB8A 4DLYA 3OZ7A 1Z4JA 1YJNB 4BC0A 2B7LA 1XC7A 2WSMA 2HXYA 3DV9A 3IXLA 5ALHA 4E1VA 5JDCC 3IV6A 4NESA 3ITKA 1ISIA 5K20A 3W2HA 1CVIA 1H2ZA 3EZGA 4FMDF 1GWNA 3PQCA 2NO7A