4RJLA

Gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus complexed with gdpcp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of gamma subunit of the translation initiation factor 2 from Sulfolobus solfataricus in complex with GDPCP at 1.64A resolution
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 112
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rjlA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rjlA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rjlA01
3U3JA 1N0WA 2WWWA 1XJ0A 4OJKA 1T5LA 1QF9A 2OK7A 4BLSA 4QHYA 3ADBA 1AS3A 1E9RA 2QAGC 4HDCA 2PIAA 2VP6A 3P4XA 2GEVA 4KBGA 2YV5A 2FGKA 2AX4A 4JBWA 1N6PA 1CU1A 3QPWA 4BEJA 3GJ3A 1FX0B 4M1WA 3CF6R 1S1MA 3SDZA 2O8FA 1E32A 4I1OA 4JL8A 3V4RA 4ACBA 5FUVA 1P73A 2NQ2C 2AFHE 2WJGA 4UNQA 4ASUA 1DG1G 2QM8A 3A1VA 1RRPA 3SJBA 1NF3A 4BGDA 4G3XA 4Q7MB 3WP1B 3CC7B 5EUQB 1OXTA 2IYYA 3K8YA 4HB4A 1S8FA 3SJZA 1XZQA 5FBWB 4MGYR 5JZVA 1M1KD 2NO6A 1YZGA 4RD6A 2P5SA 4LPKA 5E4FA 4L9WA 2YHSA 5L3SA 3UATA 4TYYA 2CRVA 3UXMA 1FRQA 3N2EA 3R9IA 4OL0A 1E9SA 4JLVA 1Q22A 2P3SA 2CCJA 1WDTA 1SHKA 1TVCA 1G3RA 1YQTA 1IONA 4LHVA 4LWZA 1E63A 5FPYA 3T61A 4GOXA 5GJWC 2W83A 3T35A 2RHDA 2C77A 4RZXA 1K8RA 4D4KA 1EFHA 5TY0A 4B48A 5KSZA 1B23P 1YVDA 3R8FA 1P72A 4NP6A 1EP3B 3VHXA 2G0NA 4QHTA 1SVLA 3LX5A 2AFIE 3FHTA 4B33A 2ODEA 4B75A 3LD9A 4LHZA 1SKQA 2OBNA 3KX2A 4PGOA 4DSTA 1G7TA 2F9MA 2OG2A 3K09A 5DE3A 1BJKA 4HUQB 4O2RA 4QHSA 4NCHA 4V0KA 1KI7A 1GL9B 2LKDA 4MGIR 2I1VB 3W5VA 3MD0A 4YAWA 3Q7QA 4HAUA 2GQFA 1MRNA 3CO5A 1A82A 1J70A 4LJ9A 3W3ZB 3C4JA 3U60B 1W1WA 2FSHA 1GL6A 3TR5A 4A6XA 4TYNA 3BS4A 1XMVA 1DPFA 1EFRD 2OO7A 5BQ5A 3M1IA 1E69A 2F1RA 1GL7A 1FNCA 2ZRFA 3C5HA 3G5UA 4B73A 4B47A 1E9CA 4R2IA 3SOPA 2WKRA 4DLWA 2ZRIA 1CJUC 4OI4A 2ZJOA 3UANA 5JHHB 2O8BB 1NJGA 5EXSA 4PC1A 1JB1A 1DEKA 2JLQA 1PVOA 1RC8A 2QDXA 3QG5A 1FNNA 4CF7A 2PT5A 1GNQA 1G6HA 3U2QA 1FNDA 3GLIB 4FWTA 1G6OA 1U9IC 2VIIA 1KNXA 4U7DA 3BFVA 1XU4A 1AS2A 3KTAA 5KO2A 2VP0A 1BYUA 5L3QB 2J9RA 2YYZA 2HF9A 2AWOA 1ELOA 2IHYA 5K8LA 2RGNC 1TU3A 2JIZA 4KCGA 4M21A 3ZC3A 2IEYA 3QXXA 2BMEA 2ZANA 2CHVA 1MABA 1D9ZA 1KNQA 1ZW6A 4QL3A 3OFND 1FZQA 3ETLA 1XD9A 1VCOA 3EPLA 3GEIA 1DO0A 1QG0A 4BUJA 4Q7LA 2QSYA 2GNOA 4PHTA 3O8CA 4PR0A 3LNCA 4II7A 3MHPA 1MO3A 2ZE5A 4S2EA 1B0UA 2IF0A 4LV6A 2VNHA 1FRNA 1IN6A 5CK4A 1XTSA 3M0EA 1AZSC 3EZ9A 4BFZA 1W49A 2VF8A 4RZ3A 4KITB 3QVUA 4AF6A 1YJWB 2PEZA 4ZI3A 2TMKA 1IXSB 1CP2A 3PVSA 1VG8A 1YR6A 4DQLA 4NCIA 2VO1A 3AVYA 2N1BA 4GNKA 3RYTC 2ZE8A 1N6HA 4DUGA 5CYOA 1G17A 3GLFE 2BN4A 2XZPA 3LA6A 4IVRA 1E4VA 2VF7A 3SS8A 1FTSA 3LDAA 5KNBA 4CEHB 1N0VC 2OESA 4ZDJA 3VO2A 4EQ6A 1K5DA 4R9UC 2GK6A 3SJCA 1N3BA 2PLRA 4LYAA 1E98A 3AKEA 1ZBDA 1E94E 2J0UA 1KTVA 3FMIA 2RGAA 3I61A 4ESHA 2FJUA 3VR5A 2V54A 4K1XA 3A1SA 3B7GA 1E2HA 2C98A 421PA 3KJEA 1C4OA 1FOEB 3QBTA 1B2RA 3BIFA 3QENA 4PHGA 1ZCBA 2P5TB 3W6OA 4B74A 2XZLA 1DOAA 1Q3TA 3T06B 1X1RA 1LVGA 2WVJA 3AV0B 2GETA 1HT1E 3P27A 2FSFA 3EWAA 4KLNA 4ZGNB 4ESVA 1KMHB 2GZDA 3IIJA 4IKEA 1QX4A 3NH6A 1MOZA 2C95A 1JA1A 1W87A 2QGNA 2WMNB 3F3YA 4G5RA 3LW8A 3JQRA 1W4AA 5KDLA 1LW7A 2P2LA 1D2EA 2CCKA 4OKSA 1JR6A 2XXAB 1E79A 3NH9A 1HE8B 2A5JA 4XWOA 3P1JA 1G3MA 1JXMA 2YOFA 1MR3F 3CR8A 4B2PA 4HAXA 2JDIA 3EIHA 1CR2A 1H8EA 1RJ9B 2ZPTX 2ZI7A 4Z8XA 2Q9BA 2XNSA 3BGWA 3ADDA 4PANA 4IJMA 2VQSA 2OAQ1 2QRZA 2REBA 3QKSB 4Q66C 1EFCA 3CRVA 2QUZA 3FPKA 4L9SA 3I92A 3W34A 4PC3A 5SZJA 3I3SR 3UPUA 2X19A 3GEEA 3OIVA 4BEBA 2DFLA 3GFTA 4JLMA 4PXAA 1W35A 1W2HA 1Q86D 4DSNA 5A5GA 2DEUA 3SYKA 1GO2A 3W3AA 2NO9A 3TAUA 4E22A 2G1KA 2JJ2A 3LO8A 4OQMA 2HLDD 3DOFA 3HU1A 4OI2A 4TSFD 3TR0A 3OZVA 1A7JA 1NMYA 1W4BA 2ORWA 4C30A 3H4MA 4JLAA 4UJ3A 4D25A 1FNBA 3K0EA 1GJRA 1IXZA 2QNRA 2XITA 4G5SA 5FL3A 1XF9A 1ZUHA 3U6KA 5H70A 2LWIA 3CUEF 1N8RD 2ZRNA 1JR3A 1SHZA 1KK2A 1LTQA 4HLCA 1YR7A 4AKGA 4L5BA 1R5BA 3AF2A 2FF7A 3X2SA 2RGBA 3BJIC 1NJID 1SVSA 3W8NA 4P0TA 5JRZA 4LV8B 1E4YA 4NE2A 3ZJYA 3EIQA 3B82A 3KQLA 2AD5A 1ZVQA 5SZKB 4URZR 2VHTA 3TW4A 2ZS8A 4FW9A 3CCUB 3QOFA 1KDTA 3AF3A 4DLYA 1EP2B 2B8TA 2V3CC 1PLLA 1U8AA 1YZQA 4Y9RA 5KU1A 2W0MA 3A58B 3E2IA 2GEUA 3EG5A 3BORA 4BFXA 5JLJA 3WXMA 1F2UA 3LAWA 4PSAA 3U3RA 1UJ2A 5TDHA 4Q48A 5JRJA 1KDPA 4CVNA 4RD2A 1ZNYA 3CNLA 2QT0A 3UMRA 3ND8A 2C04A 2ZRBA 3O8BA 4JSTA 4YC7A 5BN4A 3VKWA 2R6AA 4GP7A 2O8CB 3EARA 3KUCA 3U44A 1GILA 3WNDA 1SQ5A 4Z1MA 3X1ZA 5ELXA 4UNRA 5JSZA 3QEOA 2JJ1D 3LO5A 3CRW1 4KV9A 1XEXB 2Q6TA 2JLSA 2V4ZA 4F4JA 4E09A 1CJMA 4DJTA 4DBLC 4ZGQB 3CX7A 1OFUX 4HB3A 2W2XA 2I3BA 3CWZA 1DG3A 1E2PA 1TF7A 2OFXA 3GJ4A 3NDPA 1RKBA 2IK8A 2GVZC 2R2AA 3M6AA 1CS4C 3SQWA 4EPVA 4LBVA 2QP3A 5AJWA 2JLWA 5HXBA 3BH6A 2AKYA 5G40A 4XVRA 2AXNA 3GJ8A 1TQ6A 3SR0A 3DZ8A 2E1RA 2CMKA 5C18A 2ZJYA 1YJ9B 4LRWA 3VFDA 1HURA 3M4YA 3RRMA 5AK0A 1SVMA 2H5EA 1U2RA 2EFGA 2O8FB 5EE5B 1VQKB 2JEOA 3W2IA 4UJ5A 4A0GA 1DAFA 1SKYE 1US8A 1XEWX 1OXSC 2ZJAA 4LJ6A 5FOWA 1QHYA 5FPSA 5FBVB 3QF7A 1G18A 2MMCA 2VYFA 4YXWD 3VNUA 3A1TA 1XCMA 2H18A 1XEWY 4X8HA 2QROA 1VHTA 1L4UA 3UIEA 1H65A 5LD2C 4PX9A 4PTLA 4EPRA 4PQFA 5L3SB 1COWA 1YU9A 4A2PA 1AM4D 1L7VC 4ZDIA 3GLFA 2A5FA 5HTKA 5BXQC 4Q00A 5F98A 2NMVA 2IYUA 4TYQA 3REGA 4U9UA 1Q82D 3QXJA 2DETA 4KBFA 5KDOA 1YJ5A 4B6EA 1BX1A 4HDQB 2G3YA 2YWFA 3B6EA 4C0SA 2CDNA 4V0OA 3GCGA 2QG6A 2UZ3A 3TGPA 4CEJA 1UKVY 3FYHA 4FCWA 3RANA 4JLKA 5DHFA 4CZ2A 2IEZA 3G0HA 3CPWB 3I8SA 4DC9A 4F4IA 1AZTA 2FPMA 4TL8A 3RNLA 3QEJA 1OKKD 3NBFA 2GILA 3AGQA 3OEHD 4PSKA 1GVHA 4TLBA 4JVMA 2L0XA 2WJVA 1HH4A 2B92A 2E9SA 4FCVA 2R6HA 1CRQA 3ADKA 2GPJA 1YE8A 3KXLA 5DISB 2IWHA 2ZS9A 4IDNA 3IQXA 1CF4A 2GAAA 4G0NA 3PENA 3SBEA 4KODA 4S35A 4QNRA 2IC5A 4TQ9A 2JLXA 1EK0A 2QTZA 1HTWA 1KI6A 1OXUA 5G41A 3CRQA 1EX7A 4LJ5A 3MWKA 2ZJ5A 2HYIC 4BRUA 3BRWD 4WZAE 3OESA 1IQPA 4HB0A 1N6OA 3ASYA 1EG7A 2J0QA 2ECKA 4M1YA 4XSGA 3RS7A 2GCPA 1MO5A 4Q9IA 5KNDA 2ZVQX 3FHOA 4B3CA 1GWNA 1EESA 3CWQA 1W0KA 4Q1DA 2IWRA 2MMGA 3EPHA 1ZD9A 1DAHA 2IA5A 1Z0IA 3L2OB 2NG1A 4M9SA 2Q3FA 4M1KA 5J4HA 2CLSA 3UMFA 1NMZA 4B2IA 3KTAB 2AXPA 3S1AA 2IYTA 2QPOA 4M1TA 2F7SA 2I1QA 3K70B 2WM9B 4EIWA 5BW8A 4CIDA 1Q44A 3DMNA 5HZHA 2DR3A 3MG9A 1NG1A 1MABB 4K8OA 5FL7D 3OEEA 4D0GA 4RCYA 1L4YA 3DM5A 4Q1CA 2NTYC 3IIKA 4BQSA 1Z2CA 1GNRA 2DYKA 1KI9A 3K9GA 1OIXA 1G7CA 3LW7A 4C0BA 4IHQA 3FPAA 4RVCA 3P26A 4RD1A 2QMHA 3QY0A 3WRYC 3EX7C 1YZTA 4HB2A 1DAGA 5K8IA 2IYSA 3ES9A 1VQ4B 4Q1AA 3TQCA 4DCVA 1UDWA 3I1FA 1OPXA 5CJPA 4PPFA 2OCYC 3BBPA 4C43A 3B8HA 1NN3A 1TPZA 3NEYA 1KKLA 2R6FA 4EJSA 2RC6A 5BWMA 1E1QA 3VKHA 3E1YE 4DCTA 1E1RD 1F60A 4DSUA 4XD7D 2ZU0C 3ZGXA 521PA 4B71A 2QPTA 3QKRA 1II8A 1U0JA 3NBXX 3JQPA 1R0ZA 4NTZA 2WJHA 4Q1BA 1JAHA 3CW2A 4PPQA 4D2IA 3LLMA 5F3WB 1HY3A 4F7WA 5CDFA 4NYJR 5C2JB 1S96A 2B6HA 4TL6A 3TH5A 4G5OA 5JJIA 2PH1A 3GMTA 3ONWA 2QSZA 4O2LA 2DERA 4W5JA 4AIIA 2AK3A 4Z51A 1M90D 2QP4A 1EWYA 4EQ6B 4V0ME 1NIPA 1CJTC 2V7QD 3A8TA 3B9QA 2XGJA 1EFUA 1ZINA 1UADA 3W5UA 1VDZA 4EKDA 2J0UB 4LY6A 2QP9X 2ZRAA 5JS8A 4FN5A 1VMAA 4CT4B 2J41A 1Z0JA 4QG7A 1YZKA 1Z0KA 1DDIA 1Z47A 5EP4A 3ZH9B 2H17A 4EFMA 1AQUA 4OYHA 3KL4A 5DIFA 1WQ1R 4P6VF 2FFQA 4NZYA 1QRAA 2WJIA 4YONB 3MFYA 3VR6A 1Z5ZA 2VP5A 2C8VA 2BVNA 3P4YA 4AK9A 2EFEB 1CQXA 2WPDD 2OILA 5EE9A 3SYLA 4GSYA 2PT7A 3SHWA 3PEWA 3AF4A 3D3QA 4DDWA 4JKIA 1P4SA 4LHXA 3ZYCA 3A4LA 4MUBA 2KE5A 4AWXA 4Q4JA 2IYQA 5AUOB 1I4TD 3V4FA 1Y3AA 1ZM7A 2A5GA 3A4NA 4G5QA 3OZXA 4MITA 2CVFA 3C5CA 3LLUA 1GG2A 4P33A 5DYIA 3I32A 4OK3A 4MYCA 2K5UA 1V43A 4K81B 1SXJA 1VECA 1IY1A 3EZ7A 4PO8A 4TTQA 4DHEA 4DLVA 1G291 2PZFA 3Q3JB 1XD2A 4QBHA 3RLFA 2YZ2A 2XOKD 1QHHA 3LVBA 4W9MC 1QH0A 4OQFA 2ZYTX 3BWDD 4LBZA 4DCSA 4NYIR 1GAJA 1W36C 4MH0R 2Y8EA 1HUQA 4Q5IA 3THXA 1DBSA 1E9AA 1L8QA 4TMWA 2JCSA 2H16A 2HJGA 3Q72A 3U3MA 2HF8A 2OFOA 1IJFA 3VO1A 3LBIA 3CNOA 1XEFA 3GLHE 3W2EA 4IEEA 4TQAA 4B34A 1CR4A 1IBRA 3CCJB 3U5ZB 1Q12A 4IFBA 4EFLA 1KD1D 1Z6TA 2GESA 3NKVA 4BLPA 1F6BA 1OT3A 1XCGB 4Q4LA 3SEAA 2CLCX 3EZ2A 1W36D 1P2UA 2J0VA 4URXR 2ZI6A 4DEYA 3U4QA 2PJZA 2GEDA 721PA 1QVAA 1HYQA 4ZCLA 3QKTA 1GKUB 4ITRC 1G16A 5HKKD 5KPJA 3NXSA 4BZPA 5JWRA 2ZRDA 2ANBA 3OFNA 4NYMQ 2BHRA 1KSHA 2ZSFA 4URWR 1WRBA 1VQLB 1ZUIA 2CLDX 1E3MA 4TYWA 1ZC3A 2CE7A 4AY2A 1I2DA 2R6DA 1UBFA 4FK8A 3ZBTA 2OTJB 3DKVA 4HZIA 4JBYA 3SQXA 5AN9A 1E9EA 1YI2B 5FTKA 1NKSA 1Q1EA 3U7GA 2VL7A 2IYWA 1S3SA 2IS2A 3AVPA 1XX6A 3GFPA 3NEJA 4UQOA 4W5HA 4YMTA 3ICQB 2KBEA 4LPSA 4OHWA 4JLJA 5AJZA 2J87A 1BH2A 4LBWA 1X8LA 3C14C 1EWRA 1QHGA 4XTCS 5FFMA 1UEIA 1S4QA 1VQNB 2GVDC 2RB4A 4MYHA 5B58C 2J7PD 1JAIA 1XDBA 1GR1A 1F2UB 1E2EA 2BCJQ 3HYTA 3KKPA 5AJXA 1BMFD 3SYNA 3EAQA 4XVQA 5M04A 1JJ2B 4RFSA 1QBKC 4V03A 2H7VA 4CYMA 3K9NA 1JQJC 2YOHA 1N6RA 3GLGE 1ZRHA 1OFIA 1GFIA 1FQKA 3U44B 2FH5B 4N3GA 2Q21A 5TXGA 3ZVLA 4B6FA 4KFTA 3KXKA 1G4UR 1Y63A 5JSZB 1XCPA 5JJLA 2GRJA 3KQNA 2ZUCA 2G83A 4MA4A 4UNSA 2KWIA 3OF5A 3CRZA 3CNNA 3VQTA 2BCGY 2IUSA 4TTRA 5JWHA 1JJVA 2GCOA 2IYXA 4C0LA 2BMFA 4Y9UA 1YR8A 1YZUA 2N46A 4TN1A 1HA3A 3QI2A 2C99A 1QFJA 1F2TA 5B64A 4N3NA 1BX0A 2ZJ2A 5JEDA 2AHOA 2CL6X 1Z08A 3WHKA 3KJHA 1G20E 4Q4AA 4DWJA 3DKPA 4JVLA 1NVVQ 4Q01A 1P9RA 1S3GA 3QPUA 2HT1A 2IS4A 3R20A 4LJAA 1FUKA 1O3YA 2ZRCA 3K0CA 5AJYA 5FOXA 4BLOA 2FEOA 3PIRA 4D0LB 3IQWA 2FPLA 2Z0MA 3I62A 4FD2A 2ORVA 1FFHA 2R6GA 3P32A 3E1SA 1XE1A 4BRWA 1Q1ZA 4M8NE 1R6BX 1X8KA 3AKYA 1UBEA 2GAOA 2VSXA 2QI9C 2B8WA 2XB4A 2XSZD 1E0SA 1LV7A 4WBSA 2REOA 1US8B 3RS0A 5C4MA 2WAYA 1GZSA 1ZIOA 1NSTA 3CH4B 2QQEA 3R8CA 3MJHA 2GXUA 3LBHA 2VNKA 3E20A 2IYVA 4DQKA 1KMQA 2BM0A 2PZEA 1N6IA 1ONBA 3U3KA 4Z8YA 5IDVA 2ZETA 3QJYA 1BIFA 4A15A 2ZYVX 4KHZA 1NSFA 2ZSBA 4R2HA 3D7MA 1NRJB 3KXIA 1N5LA 1Z8FA 1OLOA 5KDDA 3IDQA 4A36A 2NPFA 3PUYA 2QN6A 3GLFB 1XTKA 4B4DA 3LWNA 3TKLA 4MKHA 1OB2A 5JECA 1XWIA 2QTHA 1VCIA 4D81A 4GRAA 2EIXA 4YAFA 3GQBA 4V0MA 3SNHA 4UXJA 1OHHD 4F92B 3AKCA 1KO1A 1W7AA 2EQBA 1JNYA 3W6NA 3CKLA 1IY2A 4LCBA 4Y7CA 5FI0B 4N0DA 3X1DA 4KO8A 1Q1QA 3D8BA 4DDVA 2A78A 2RHMA 1I7PA 3NWJA 4Q9LA 1G9XA 4LDJA 5FBQB 4CEJB 2ZUBA 1P60A 3VHLB 4TMXA 2GK7A 2HLDA 4TSFA 3NHAA 2JATA 2WJYA 2ZR0A 1DARA 3BERA 5TARA 2FG5A 3TSZA 4BFVA 3I56B 3BB3A 4HE6A 4Q9KA 3DMDA 3AB3A 2XJ9A 1GKYA 3CZQA 4KVGA 2ZU6A 3RABA 3FVQA 3TJZA 4M1OA 2EW1A 2DY1A 1ZJ6A 1XBTA 5FTLA 3CPHA 1T8TA 3TNFA 4YAUA 2VP9A 3H2YA 2BSAA 3QVVA 3AKDA 2FFBA 1OH7A 3VTKA 1AMOA 3FFAA 2BDTA 5JJKA 1JQLB 3TVTA 3ZZTA 2G6BA 2W0SA 2ZRJA 1NG9A 2WTUA 1UDXA 2IBMA 5J4KA 2QY9A 4NHOA 3TRFA 3VR2A 3JQQA 2PMDA 1CTQA 3AP2A 3TK1A 1ZUNB 2GWHA 2J1LA 2V6JA 5E7IA 5FH9A 1KI6B 4BLRA 3CCSB 1UMKA 4TQUS 4PHFA 1SZPA 3RS3A 1KY2A 3RVBA 3BOSA 1KO7A 4CEIA 2GBLA 4DEXA 2DWQA 3X1YA 3IO3A 4C2TA 4PPNA 4DLRA 4ZKEA 1NJFA 2QPAA 5EXPA 1UPTA 2EU8A 2ZIAA 1JPJA 1IB0A 1U8ZA 4ASUD 3WBKA 4OQLA 3SBDA 3I8XA 3ZVNA 1WB9A 1GNPA 3RHFA 2IHBA 2LKCA 1ZM4A 2FSGA 3MUFA 4LK2A 3RC3A 4BFSA 1D2NA 4WIAA 3PV0A 5DNYB 1IAQA 1NL3A 2V6IA 3DDCA 3EA5A 1YHNA 3W2HA 1OIVA 2ZYWX 2G1JA 2ZSAA 3GLHA 1E99A 2FFHA 1K73D 3MWJA 2WHXA 1Z6GA 1ZNZA 3S1AB 4LJ7A 4TLDA 2VLIA 4V0LA 3ZIAD 3U6BA 1PZNA 2B5OA 4AKEA 3QFSA 2JJ1A 3AVTA 1R0WA 3VR3A 3B85A 2DFNA 2R8RA 3N70A 3K09C 4M22A 4CW7A 1E2LA 4KFSA 4WA7A 5IF9A 3TE6A 1ZD1A 6Q21A 1NLYA 3U61B 3TLXA 4B3FX 4CGZA 2JLUA 3WBJA 3Q5DA 1F48A 1FTNA 2FNAA 4K46A 4LOAA 2QE7D 2AN9A 2OBLA 2OT3B 5BYKA 1GP2A 1CLUA 4C4PA 1LS1A 1Q21A 1ZU4A 3AH8A 1MH1A 3LQQA 3BE4A 4TYPA 5KSYA 2CBZA 4LI0A 1ZMXA 2FZLA 1KI3A 3KZ1E 2QBYA 3FMFA 3CCQB 3HYRA 4EJSB 4IOKA 4RKEA 3I73A 4B3BA 1TQ4A 3ZDQA 2PL3A 1GM5A 1XB2A 3SI7A 4Q9JA 2A30A 4MDFA 4XVUA 3QKRB 1E2QA 1II8B 4D26A 3TUZC 1KKMA 5E3HA 1VG0B 4YXWA 4HLUA 4WZBE 2FWRA 5DI9A 4B44A 2AR7A 4Q1FA 3NC0C 5FTMA 2BPOA 4N1AA 2G0TA 3BB1A 3PEUA 1TLLA 3LV8A 4BPRA 5KSOA 3K70C 4HDOB 1T0JB 3OW2B 3EZFA 4LC1A 3SE0A 1FP6A 1P3JA 3CF2A 1OXXK 2EFHB 3QIAA 4UXHA 5JI2E 2BM1A 2Z4RA 3ZD7A 4TT3D 1O87A 4QRHA 4M53A 1XD8A 4NYMR 1M7GA 2JGNA 2KSQA 5B30A 2ZUDA 4BFUA 1T0HB 1W2BB 2J5XA 1PLJA 1T8UA 1UM8A 1A1VA 1E2JA 1W2GA 5AR1A 1YKSA 2BV3A 3LVQE 1CKEA 4FI3C 1QGZA 4GMXA 1RYFA 4UNNA 3I72A 4DVGA 821PA 1Z06A 4PPGA 3NHBA 4JLPA 3R9XA 2YWEA 1YIJB 1NP6A 5HPYB 4P32A 1U99A 1N5KA 1DTSA 1TQDA 3QG1A 4IVQA 3FB4A 2ZRKA 2F9LA 2WAXA 3B1VA 1FQJA 1XTQA 3GJ6A 5CIWA 2J46A 2KB0A 3KQKA 1OKKA 3HWSA 1T4GA 5CB8A 5GV8A 1P61B 1OF1A 4L16A 4GMDA 2RMKA 3PUZA 3IHLA 3AUXA 4Q4JB 4TTPA 5JI3E 1KJZA 4ON9A 4LHWA 1P7CA 5HCNA 1DAKA 4HAVA 2H8KA 4NCJA 1G41A 1KJYA 2OE2A 3W5JA 1DAMA 3JZAA 1SXJB 3HP1A 5EP1A 3PUXA 1NVWQ 3ZQJA 4DCNA 1XD2B 2HMAA 4XH9B 3CCEB 4URYR 1Q3HA 1QHHB 1YRBA 3NBYC 3SU8A 4C0HA 4TMZA 3F5FA 4HE5A 3B60A 3L43A 4F7DA 3THXB 2FSIA 5DI3A 1F3OA 3A1WA 1G5TA 2FA9A 1KI4A 2OUKA 5DLQC 4RD0A 2FEMA 4DLUA 1WE2A 2WBLC 2GA8A 2ZITA 3ZS9A 1T3LA 4C0JA 4DUGD 3PEYA 2DPXA 2C2HA 2XEXA 1I2MA 4D80A 2WIBA 2X8AA 1W46A 3MWYW 1RPZA 2OK8A 1ZP6A 1WXQA 4FMCB 4Q18A 2V1XA 1M7HA 3PCRB 2RKOA 1NVVR 2F6RA 3VR1A 3DL0A 3L0IB 5DH9A 5EXTA 1TTTA 1OV4A 4PQRA 2IUUA 2F43A 2FE4A 2ZSDA 5GJBA 5IK2D 2VTKA 1W34A 1J2JA 1FPMA 4QFMA 1G21E 3R7WA 3U4QB 4IDOA 2QMOA 3CCMB 2HXYA 4CRWB 4KYIB 1E2IA 2QMUA 2R62A 1CNEA 3EPKA 2DFTA 5FL7A 4TLEA 3FTQA 2ZRHA 2EVWX 5L8VA 2VH5R 1Z0AA 3ADCA 1PJRA 1Q0UA 3L8ZA 1Z6AA 1GRQA 3T5DA 1E0AA 1JECA 1P62B 3WY9A 1N6NA 3FKSD 2B7CA 4C3ZA 4DLXA 2ORIA 2MSEB 3ZVMA 2PJRA 2O0HA 3AVXA 3RSLA 2BJWA 5EJEA 3WMGA 2F55A 1X8JA 2QTLA 1E0KA 5BN3A 4E03A 4Q47A 3PJRA 4JYBA 2G9NA 3CC4B 1VYVA 3BFXA 5HCIA 3PG5A 2D2EA 1FMJA 2OHFA 1WA5A 4NBSA 2QA4B 2GJSA 4NMMA 5CK5A 2WZQA 1N5JA 3W2FA 1W0JD 2P6NA 4RFSB 4GT1A 1II9A 5KHOC 3I5XA 1H8ED 2RGEA 1RZ3A 4P3YA 2BOVA 3HJNA 1NBMD 2XNDA 5LPNA 1Z22A 3ZBUA 2YKGA 2ZI5A 4DRZA 2XB2A 4LC0A 2O8EA 4I81A 2IUTA 2DHRA 2IS1A 3DPUA 1OB5A 1V5WA 2FX3A 2QT1A 5KSPA 1TX4B 2CE2X 4KFUA 2QRNA 4LYHA 4A8JA 3IEUA 3NTUA 1UAAA 3AM1A 4JIMA 5IT5A 3GFOA 4JL5A 3AF0A 4X8OA 2VEDA 4NDZA 2GCOB 3KKMA 4YDHB 3ASZA 4V0NA 2ZJZA 1OIWA 1F2TB 1G8HA 1LY1A 1XJQA 2P6RA 4EPXA 2EWWA 3EIEA 4XTRA 3HU3A 4GPTA 4Q4AB 1OXVA 4PO9A 4QBIA 4M1SA 1G8YA 5G3ZA 3RWMB 3QFCA 4ZDWA 1R8SA 3IIMA 2WPDA 1CR1A 3G71B 4GL2A 1ZIPA 1E2DA 2XX3A 3SC3A 4F93B 4DIEA 4D4LA 2NO7A 2HT6A 1JR3D 2WICA 4RZUA 3GJXC 4ZIRA 1K6MA 4NU0A 2WWYA 5JCPA 1LNZA 2Z83A 3MLEA 2VZLA 4Q02A 1E0JA 3RRZA 3OIUA 2ZE6A 2DFKB 2ZYUX 4RD4A 5EE3A 1P2TA 5LB4A 3PUWA 4I4LA 1MKYA 2ZS7A 2QM7A 4U00A 2OM2A 2R44A 3NVAA 1KK1A 5JBQA 2GJAA 2RAPA 4AC9A 1W44A 2W6ID 3QKUA 4OI1A 1II0A 4DDTA 3G6EB 2G77B 1G19A 2XOKA 1IN7A 1T3HA 4M9XA 1ZM9A 3B1ZA 2C5LA 1RIFA 5DN6A 2I4IA 1UKEA 4D6PA 1UEJA 2QENA 1G7RA 2E87A 2YVUA 2CCGA 1OH8A 1G3QA 1Z0FA 2AD1A 3AF1A 3T12A 2IYRA 4IDHA 4AYWA 4BLQA 2CNWD 2AWNA 4IRUB 2H1LA 3T1OA 1XMIA 4KSCA 1WF3A 3OZWA 3NG1A 1WBDA 4G1VA 4RJLA 4RZ2A 2DWOA 5CJ2A 4A4DA 2A5DA 1P9NA 3CCLB 2XTNA 4OQNA 2W2TA 4G5GA 5J47A 1E9BA 2OFWA 4PZZA 4R98A 2CJWA 1U94A 1XNJA 4LV5B 2WWGA 2BC9A 4GI7A 3N2IA 1T91A 2GHIA 3H86A 4QM7A 1PV4A 1RE0A 3SFZA 4IW3B 5HKKA 1S1CA 1RYHA 4LZZA 4M4SA 1E64A 3K9HA 4JMPA 3CPJB 1R5NA 4GOKA 4AG5A 3GEHA 5FR1A 2VRWA 2WJJA 1CIPA 3KDSE 1P2VA 2ONJA 3TIFA 4GZMA 4F91B 5CLLA 4MKFA 1LF5A 4A2WA 1M34E 2H92A 1VG9B 1BQEA 4XIGS 3KB2A 2EYUA 2C78A 1IHUA 3L82B 4XJXA 3LXXA 5J40A 4EPWA 4QM6A 1KDOA 2ZQ5A 2C96A 3RDPA 1UFQA 4KJZA 2OEPA 2F1JA 1XXHE 4CEIB 3FKQA 3GD7A 3OZUA 1CR0A 1YZLA 1H8HD 2O5VA 1KI1A 3CXCB 2OLKA 1F20A 2QAGA 5KOYA 1VHLA 3TVDA 2NO0A 2WWXA 5GJVC 1JJ7A 2OZEA 3QPVA 4YMUA 2QGZA 3OAAD 1BMFA 2CXXA 3BH7A 1OE0A 3BH0A 3VU9A 1UKYA 1VQ7B 5CIQA 2W00A 2G88A 1K5GA 3QFRA 2VA8A 3FE2A 2IF2A 3GLHB 1VTKA 1Q1BA 1KC8D 1A2BA 4M0LA 1COWD 3B5JA 3RS5A 4A9AA 4ACAA 2QTFA 5F9FA 3T15A 2VPPA 1AKYA 4I1UA 1J8YF 4Q19A 4EAQA 3IUYA 3ZVRA 2P6UA 1NMXA 4JT2A 1S9DA 4QOSA 2ZEJA 1KO4A 5EUMA 4A1FA 5B57C 1T6NA 2ATXA 3H0KA 3T5GA 1H85A 1KHTA 5JWOA 1QG4A 1I4DD 1TAGA 2Q3HA 3IGFA 4HLDA 1VCMA 3IEVA 1K9MD 2V9PA 4US0R 2PEYA 3IBYA 4ZPXA 1VQ8B 2WKQA 1SVIA 4F4CA 3GP8A 3AGPA 4J0QA 2C9YA 1DVRA 2ASEA 4FINA 2FDCA 2O8DA 2Z4SA 3RS2A 4P4UA 1G8GA 1N2CE 4Q4HA 2P67A 4DXAA 121PA 2C9OA 2RGGA 3A36A 2QBYB 3QSYA 4US1R 2NZ8A 4MYUA 2ZROA 1R0YA 2XTZA 1CRPA 1WP9A 1YITB 1UBGA 4KSBA 4A92A 3ND9A 3HDTA 2ONKA 2FV8A 5KUTA 4X8LA 4YMWA 2VHUA 5GJCA 2XSZA 3ZLJA 1BKDR 1KYIA 3RRNA 1N25A 3EWSA 5TVKA 2J7KA 3RC8A 3H1TA 4Q1EA 1EXMA 2D4HA 3J81k 5AUPB 1EFRA 1KOFA 1KZGB 5H68A 1AJEA 2BMDA 3CC2B 5C4GB 1ODFA 3I55B 4FXPA 2ZRLA 1DAEA 4A0HA 1AKEA 4JT4A 4MQBA 1NI3A 1OFTA 2BGIA 3VX4A 221PA 2PBRA 4MRRA 2ZAOA 4IXNA 2D3WA 5DHAA 1J7KA 5EE0A 4PHHA 4JBXA 3O8RA 4B2LA 4G01B 4AYXA 2GKSA 2FZ4A 4AKIA 1K8AD 2IT1A 2ODWA 3QNUA 2ERXA 2GJKA 5JS7A 2ZM5A 1D2MA 2VSOA 1W0KD 3BB4A 1XTJA 1QUEA 1OHHA 2O52A 3ZS8A 3WYFA 1J90A 1Q57A 1QUFA 3CLVA 4LGMA 4AURA 2XZOA 2ZVPX 4EPYA 2WSSD 4E5UA 4TMVA 4E07A 1U98A 2BMWA 3IILA 1SVKA 4UKDA 5L3RA 2W6JD 4ARZA 5J4LA 1HQCA 2O0JA 4PC6A 1KSGA 5H1YA 2OAP1 3MGCA 4OHYA 4OJQA 4P4SA 4QKQA 4QXAA 1C1YA 2CK3D 2Q3MA 2YC2C 4W5WA 1TF2A 1M74A 2F3TA 4HYYA 4IOJA 4JVSB 1U9IA 1M6NA 2VYQA 3EASA 2CHGA 4MGKR 2QEQA 1QGYA 2QQ0A 4B3DA 1VQMB 1SVOA 2HJVA 2RGNA 1QFZA 3EPJA 1AGRA 4YMVA 4NPHA 2EFCB 5FUYA 1YHQB 1HQYE 1Q20A 4I99A 4ERNA 3DO6A 3CX6A 3X1WA 3LX8A 5LDDC 3QQ5A 3BD9A 3SFVA 2RGXA 3QXHA 1CULC 4ZDKA 1U0HC 8OHMA 4HZUA 4IXMA 2X77A 1NDHA 4AD8A 1BS1A 4AF7A 3ICEA 3L0SA 4CDGA 1Z2AA 1E1QD 3LY5A 3FMPB 3LBNA 1AS0A 4L8GA 4BFWA 3SJAA 1QDEA 1XMSA 4I1VA 5DI3B 3MAAC 1D8TA 1ZAKA 5TB5A 4JS0A 3RAPR 1ESMA 4JLNA 1NBME 1DELA 3CX8A 5JEEA 1KSJA 3WP0A 4Y0VA 3CD6B 4JSYA 5ANRB 3W90A 1FNMA 3FGNA 2F1HA 5IRCD 2GTPA 5FOTA 3C16C 3LRPA 5AUQA 4JLDA 1M2OB 1QG2A 2V55B 3JVVA 3OE7D 2AKAB 4MRSA 4POAA 4EPTA 2VSFA 1I4LD 3IKJA 1CJKC 4RD3A 2FGJA 2VP2A 3PUVA 2F43B 5EZ6B 3RS4A 1IJEA 1OH5A 1A4RA 4EJSC 3R7WB 3O8DA 3ZIAA 1X1SA 5E95A 5BYJA 1CXZA 4FIDA 3CMAB 1L2TA 1Z07A 1A2KC 1EGAA 1ZNXA 2YC4C 4MKGA 2VP4A 4Z54A 2ZSEA 4M9ZA 2R6CA 2VHCA 2NIPA 3AVUA 3CBQA 3D6TB 4L4UA 2A3RA 1SXJC 3K0AA 2IL1A 2HUPA 4PAQA 1XPRA 3AVQA 5J4YA 1P9WA 4OK5A 1XPOA 2XNJA 1G5RA 2QE7A 3AP3A 4PFSA 4WZ6A 5AJVB 4YDSA 3X1XA 1GUAA 5J4VA 1KGDA 1JR3E 3Q8XB 3REFA 2WWFA 1FP7A 4TL7A 3AP1A 2OXRA 1GAQA 2H57A 3QF4A 4G1UC 4MYTA 5TV2A 3C41J 4QGAA 2ZE7A 2QZ4A 4TL9A 1G5PA 4B3GA 1QGAA 3B78A 1R8QA 2R9VA 1XXHA 4AKHA 1LB1B 1OGJA 1BOFA 1S72B 1SXJD 4Y0AA 2DB3A 1GSIA 4I1SA 4OHVA 1KO5A 1JI0A 3TAHA 2D74A 1N6KA 3IBGA 4Q7KA 2ZREA 4TLAA 4YLGA 2C03A 2ODNA 2PZGA 4D0NA 2O8EB 5A0FA 1NN0A 4Q21A 1MV5A 1ZYUA 3P20A 4IDPA 1CNFA 4X8MA 5G53C 4KXFB 2RH5A 1RRGA 1VKJA 1TUEA 2B7BA 2VHJA 2BWJA 2IYLD 2O0KA 3KFXA 4A8JB 4DT1B 1BYIA 5JMTA 4TT3A 4WAUA 5J5CA 3BFKA 4UXIA 1XPUA 1UKZA 4RY2A 3CH5A 3Q9LA 1VQ6B 3HPRA 4C9BA 5CB6A 3F8TA 1VQOB 2XNCA 1LS6A 2QTVB 621PA 2D2FA 3EA0A 1P2SA 1E9DA 1GRNA 3A1UA 4B3XA 4RFVA 5CM8B 3THOA 4DB2A 4TMTA 3EW9A 1AGPA 2A7QA 2ZRMA 2IW3A 2BKEA 3IPXA 1FMLA 1W5SA 1IN8A 3DOEA 1J8MF 5EE1A 4TWZA 2RGDA 3CONA 3E5HA 2UVQA 5TR9A 4U02A 5LBIA 2BEKA 3BXZA 4IVPA 3THYA 4ZCMA 4KYUA 1SM4A 1MO4A 3ZZUA 3CCRB 2D06A 3L0OA 4ZIRB 4ZV4A 4C7OA 1Z0DA 4FMBB 5A4JA 3A4MA 1NIJA 4A0RA 1N6LA 1AIPA 4DDUA 2FFAA 3FJOA 1X3SA 2KBFA 2J0SA 1ETUA 4IEIA 4O0MA 2YWHA 2PMKA 4BFTA 4DKXA 4NCNA 2V8OA 4FCTA 1P75A 5JHGB 4ZCIA 1XTRA 2UZIR 2RC5A 2VHQA 4OHZA 2ATVA 5EP3A 4WXPA 1GIAA 1W47A 3B1XA 1QHIA 1VQPB 1P6XA 4URUR 1T3SA 1X6VA 2WKPA 2JASA 1EFTA 4OK6A 2ZR7A 1VPLA 5EZ5A 5KTYA 2BMJA 4IOLA 2GJ9A 5FOUA 4BECA 3QE2A 1KAGA 1GVNB 2BBSA 1E2KA 4QC2A 3KQHA 3CM0A 3LQRA 3AVOA 4B76A 2V1UA 1NNEA 2AL7A 4B35A 3V76A 2X1VA 3LFUA 3GLIE 5CM9C 3THWA 3KJIA 3K0CC 3TSOA 2AK2A 5C46F 2ZI3A 2CJWB 1ESNA 3QUSA 5FR2A 3U3OA 4B32A 1JALA 1W36B 2DBYA 4JL6A 5IK2A 4H1VA 4Q7JB 3U7EB 1M1YE 3KUDA 5D3MA 2WV9A 3AQ4A 1IOZA 2Z5FA 4QGHA 1Z3IX 5EMNA 2OLJA 3T1QA 3PR1A 3WMEA 2HEIA 2Q9CA 3RRYA 2X2FA 1SULA 2WWHA 4YAOA 2Q9AA 1OFHA 1E2MA 2RCNA 4V02A 4HEJA 4HATA 3WRXC 3FMOB 3FKSA 4HLQB 3I4LA 3CR7A 1C9KA 4AYTA 1KSFX 2REXB 2MSDB 1NN5A 1FUUA 5DSZA 2IXGA 2PCJA 2QAJA 2W2VA 4ZO4A 4ZI2A 4TZ0A 4WOPA 4BZQA 2QAGB 3BC1A 2IX3A 3VKGA 1N0UA 1S0UA 4XWAA 1QVGB 3UMSA 1JBKA 3AVVA 3Q7PA 2GXSA 1W0JA 2GCNA 3A6PC 3NBZC 1SVWA 5LB2A 3GLGA 3T34A 4PC2A 1RRFA 2MSCB 3VU9B 1F5NA 1NBMA 5FI1B 2GZHA 3W2GA 1OW3B 1CBUA 2D7DA 2WMOB 3GJ5A 3BK7A 4A2QA 2CEAA 3EC2A 4ILEA 2F1IA 4A0FA 1OYWA 1PLKA 2QL6A 1G4AE 1Z29A 3C8UA 3JZMA 4RKFA 2OBMA 4A6PA 1MT0A 1PUJA 3DEFA 4KFRA 4C0KA 4IFEA 3VX3A 1W48A 2PLFA 4NKRA 3K0FA 3K70D 5H5JA 2JIZD 4D82A 5FUWA 2KJQA 4JJZA 2ZAMA 4MUAA 2VNJA 3D31A 1VQ5B 4KAXA 3OHMA 4G1BA 3OEHA 4URVR 4NYJQ 5CLQA 4EH1A 4JYCA 5F9HA 3U7HB 3KKOA 2O8DB 1TL7C 5IHPA 3CB4A 5BN5A 4Q4HB 4BPBA 2GBLC 3UWOA 1XFAA 1J9ZA 1BO6A 1EWQA 1RW4A 1TUIA 4LX0A 1SKYB 2OV2A 4U5XA 3UWKA 1G3UA 1FX0A 2UKDA 2X2EA 1QFYA 4R7ZA 5D3QA 5DYGA 4XWKA 3W5HA 3E70C 4IDQA 4KI0A 4MRPA 5K8TA 3G82C 3MWLA 2D62A 1TMKA 2HDNB 4WQMA 5KSWB 2BBTA 2W6IA 3W5IA 3GJ0A 1XP8A 2HCBA 4MGZR 3QXSA 3HU2A 4DZZA 2ERYA 3L0PA 2P65A 3RSOA 4DCUA 1S9HA 4OQXA 2WOOA 1R4AA 2BBWA 3A37A 3FOZA 1IN4A 3WNBA 3V00A 2BGJA 5CDFE 1S2MA 3KJGA 3W6PA 1JEDA 4CT5A 5L3VA 3PFIA 1J99A 2ZR9A 2CNWA 4BLTA 1DDGA 4QBGB 5E7MA 2BKUA 4JJKA 4ZKDA 1NY6A 4OI0A 4JVNA 1TNDA 1FDRA 1W4CA 3CPEA 2GDJA 4TZ6A 3MCAA 1RVDA 2NGRA 2QMEA 4YHBA 3NIBA 4FMDB 2QORA 4ARZB 4M9QA 4JLOA 4C0AC 5H8WA 5SZIA 1AK2A 3CF0A 4NYIQ 1W4RA 1XMJA 2NOAA 3K53A 4NONA 4P31A 4QBFA 4WXRA 4P4SB 1PUIA 4PAOA 4KLZA 4PSVA 3W8RA 3LXRA 3CCVB 4LJ4A 3PXGA 3HPQA 3CZPA 1SGWA 5EXXA 4UAJA 2OCBA 1D9XA 1H42A 3LH5A 3Q85A 3VAAA 1FW6A 2ZI9A 5P21A 1R5OA 1OSNA 3WYAA 5G3YA 1W5TA 4BWYA 3DZDA 4DT1A 1R2QA 2BEJA 3IPYA 2DWPA 4LJYA 3MSXA 4HLUC 4HI0E 4HAZA 3UK6A 4HUQA 2Z6VA 2Z43A 1E79D 5FPHA 1JB9A 1E1RA 1Z28A 2OCPA 4HZUB 4XD7A 1G8FA 1RRCA 3T1VA 2YWGA 5DGXA 1TQ2A 2J45A 2EWVA 2JDID 2PX0A 2SHKA 3FDIA 1KY3A 3C7KA 3HR8A 3KKQA 5FUXA 3SZRA 2CL0X 1UF9A 1H8HA 3KB1A 4KVAA 3QE0A 4GP6A 4PZYA 4D4MA 1SXJE 1IM2A 1DO2A 4LJ8A 3DVLA 4PZLA 5KPDA 2CL7X 1TF5A 1U8YA 2J3EA 3OAAA 1FL9A 4JKYA 5THXA 1QHXA 3UG7A 3Q5EA 2V7QA 2W58A 4NL4H 5GV7A 1HEIA 4PQYA 4B43A 1VCNA 1DAIA 2HYDA 2O8BA 1KZ7B 4DIDA 1HV8A 1JA0A 1YZNA 1GTVA 1E9FA 3EZ6A 5E7JA 1GAWA 2EYQA 2IXEA 1ZC4A 4US2R 1E96A 3GLIA 1DE0A 4PC7A 2JJ2D 1KK0A 2YINC 2GZAA 1YR9A 5JFGA 2D7CA 3WMFA 2A2ZA 2BBOA 2IYZA 4BASA 2NZJA 5L3QA 3KKNA 5KYKA 1RFLA 5GVRA 4BFYA 3L8YA 4HSEA 5K8UA 5FBRB 1KAOA 1P5ZB 5GADl 4Q9HA 1IN5A 1UBCA 2CVHA 3PEVA 4YALA 1A5TA 4LYJA 3R9WA 2R65A 3K0AB 3BAFA 5FPKA 1NY5A 1XRJA 2ZTSA 1VYTA 4ABYA 3AEZA 4BE7B 1E2GA 2ANCA 1Q81D 3TQFA 5HE8A 1ZD8A 3PITA 1AA9A 4RCZA 4D4JA 1AQYA 1T5IA 4QJ3A 1GDDA 1M7BA 3EXAA 1LFDB 5B2ZA 3T1TA 3QF4B 3I5YA 3TSWA 3SHFA 3K9LA 2C9CA 3WNCA 4QJ5A 3JVUA 1IY0A 2VNIA 2ODBA 3SN6A 4DSOA 3MMPA 1XXHB 5GVSA 1ZM3A 1OGIA 1M8PA 1U81A 1TEVA 3B9PA 4XSHA 4YQFA 4LUCA 2OSBA 1D1NA 1KI2A 4O3MA 4MKIA 4EFNA 3QBVA 2JLYA 1VQ9B 2YNMA 1G1MA 1U90A 3HR7A 4GOJA 3WYGA 5EP2A 1Z63A 1KQSB 2HXSA 3UG6A 4LBYA 5CITA 1E2FA 1VG1A 4JLBA 2ZXUA 3U7FB 1QVRA 2GXQA 3TBKA 4M2LA 1KJWA 4Z1MD 4CEHA 3O47A 4HAYA 4LYFA 1QHSA 2GF9A 4L15A 3VMFA 2YJTD 2HCJB 2ZJBA 4WVFA 2FU5C 3GJ7A 1G64A 4AI6A 3N5CA 1EX6A 2NPIA 1GKIA 3PQCA 2KI5A 4MRNA 2N42A 3FFBA 5H59A 5FTNA 2WWIA 1JEEA 2XJ4A 1G8PA 2WSSA 1CJVC 4PO1A 1X86B 3B1YA 2W6JA 3ZZ0A 1XJCA 3KQUA 2NO1A 1GITA 1ANKA 2FOLA 3RWOA 1R10A 4GBMA 2CK3A 4QGGA 5FTJA 4F38A 3CRMA 3THYB 3QXCA 1WCV1 1E2NA 2HV8A 4C7OB 4H9GA 5EQTA 1KMHA 4MDEA 4OBEA 3CMEB 2VBCA 4Q03A 4TMKA 5TMPA 2QA5A 2OTLB 3MRSA 1R7RA 1KI8A 2XAUA 4QJ4A 2DCUA 3VNVA 2GJ8A 1WBBA 3K1JA 1HE1C 1QZXA 3FWYA 2J7PA 3B1WA 2JLVA 2XXAA 4FMCF 4H1UA 4DLSA 1U0LA 1NN1A 4FWIB 2PCLA 2IXFA 2PX3A 1GRRA 4C0QC 1G3IA 1Q7YD 4N0EA 2WOJA 4O25A 4A8JC 1NVXQ 1RJ9A 3NDBB 1VYUA 1DADA 2JLRA 4JZKA 4KU4A 3ZQ6A 1OH6A 2FPKA 4GDFA 3V9PA 5JCZA 2X3UA 4P4TA 3TUIC 3MJRA 3LVRE 1NVUQ 4LSGA 4C2UA 3OJWA 4XOIA 2XNDD 5CYPA 3QKSA 4FMDF 1QVFB 5AUNB 2QU8A 1N5IA 2YOGA 5SZHB 1T9HA 1E62A 4IOMA 1DS6A 3OE7A 3THWB 2GXAA 1YJNB 4TLCA 1OJLA 4OHXA 4WW0A 1G7SA 5FPTA 1CEEA 3W9YA 1MO6A 1XTIA 2J59A 1VIYA 2BF4A 1EP1B 3NC1C 4DLZA 1D6JA 4R71A 1LF0A 1R0XA 2JJ8A 3OIYA 5D3MB 1D5CA 1KK3A 3DHWC 4UNPA 1JPNA 3G4SB 1NLZA 1YRAA 4A82A 5AWFC 1TADA 2JAQA 4GFDA 3F0TA 2OXCA 3VR4A 2A5YB 3UKDA 5KNCA 5UKDA 4DLTA 4DB4A 4AG6A 4NH0A 2BJVA 3TUJC 4BZXA 3ZD6A 1XZPA 2XTMA 3EC1A 2JA1A 1AN0A 1TU4A 2WSMA 3GPLA 3K0SA 2IS6A 1TEXA 4QGFA 1HT2E 1KDRA 1OYYA 5F2EA 4HAWA 1NKTA 3QFTA 5FBLB 4EUNA 1KO8A 4EDHA 4M1MA 1KRHA 4QNMA 1Z6YA 4PAMA 4YMSA 2F3RA 3KFVA 4RSGA 2CHQA 5HR5A 1MRSA 3GLGB 3CIOA 3AVWA 3AUYA 5C1BA 3CRRA 1QHNA 3B2EA 4HUTA 2FMXA 3OIWA 2ZRPA 1Z83A 3DM9B 3TW8B 4LHYA 2BIFA 2B21A 2CNDA 1ZNWA 4W7SA 2LCFA 5DN6D 2A9KA 2FN4A 2P0EA 2RGCA 5HZKA 5HE9A 1WMSA 3ECCA 2ZI4A 3FHCB 2OCAA 2O8CA 5FOVA 1JXOA 1GOTA 2JLZA 3C15C 1ZU5A 5FOSA 3OJXA 3K0FB 5LD2B 4GZLA 1A8PA 5FA6A 2ZRGA 4NCKA 1ZM2A 1NLFA 1XEXA 1IXRC 1E6CA 3B13B 1VIAA 3IO5A 2EFDB 5DO9A 2ZJ8A 3OEED 2WIAA 1Z6XA 3H84A 1KIMA 1ZCAA 2GF0A 2Q0HA 3TMKA 3IHWA 4MRVA 3WHLA 2QEXB
chains in the Genus database with same CATH superfamily
5BN5B 2XA2A 3KEMA 4OJKA 3LDUA 3HHPA 2GPWA 3JQAB 3WLLA 1QF9A 3VZDA 5MDHA 2OK7A 2VCYA 4ID9A 3GWZA 5DNAA 1E7WA 3RHSA 3E2PA 5BT9A 1AS3A 1E9RA 3QITA 2BKLA 3DLCA 4L85A 5LBUA 3E03A 4KBGA 1F8GA 3V7FA 4LWPA 4F45A 1NUSA 2FUNB 4RW0A 3OVMA 4B7ZA 1WCYA 2P9QA 3GJ3A 2JFYA 1N7IA 3PUHA 2EP5A 3V7AA 1S1MA 2V7EA 3SDZA 1MC4A 1SIWA 2HBRA 4LTNA 1YQGA 4JL8A 3TIGA 3PCTA 2NQ2C 1LC3A 4LYYA 5JZOA 3TNYA 3DB1A 3ANTA 5IXSA 2QM8A 1T25A 3IHTA 4M37A 1RRPA 3SJBA 4AXXA 5IF3A 2QTNA 1NF2A 2QW0X 2W2QA 3K0KA 5DRYA 4G3XA 4KRYA 2BLNA 4QU9A 3R7FA 3WP1B 4DN6A 1FSZA 2IYYA 4OU5A 5F7ZA 4HB4A 5DBGA 1S8FA 1AU9A 5DHTA 1P1RA 3UTDA 1M1KD 2H7XA 4LPKA 4KK4A 3AXSA 2YHSA 4P5PA 4OPVA 3L01A 4GKAA 3SIRA 3SXJA 3R41A 5K6RA 3O26A 3N2EA 4FT4A 4JITA 4YJDA 3R9IA 2V4DA 1Q22A 1I7LA 4YIKA 2CCJA 3OA0A 4JOSA 4Z0TA 4B6SA 4MA5A 5FUQA 4FN4A 4LHVA 1GADO 1L6IA 3HDYA 5FPYA 3SPXA 3IPCA 1C7QA 2F00A 3O38A 1TJ5A 4QDZA 1Z73A 4LOLA 5IM4A 2C77A 3LBAA 5TLSA 5HF9A 5KSZA 1B23P 2W5UA 5C8YA 1YVDA 4JJGA 4EP1A 4NJEA 5A6VA 4HHEA 1IN1A 3H5NA 2O50A 1AG9A 2PG3A 4G9GA 3VHXA 2HSDA 3PFWO 4D3ZA 4NF2A 1I3CA 4G0OA 2ZRQA 3QWHA 1W25A 4ZN6A 1SKQA 1GARA 1VSBA 1GCUA 2OBNA 2OG2A 3KX2A 3GUZA 4KB5A 4TWRA 3QEAZ 3VPGA 3K09A 1TXGA 2WSBA 3OIGA 3OQPA 1SO8A 4WNAA 5DE3A 1XVIA 1ZJYA 4YV0A 5KC8A 2XZDA 2I9KA 3D8TA 2VJMA 1GL9B 3WHIA 2DJIA 2P5YA 4F5YA 2HIMA 3T8YA 2I1VB 3W5VA 3RTDA 1B43A 2A5LA 1X7XA 2GQFA 3W7VA 2XYPA 2M6KA 4WJLA 1UD3A 4ND4A 2IH2A 1HKHA 4A6XA 1N2ZA 4BNMA 3BTUA 2VDVE 3BS4A 3JD3A 1RLIA 5ALZA 3RWBA 2G63A 2XBMA 1EFRD 2OO7A 4MSUA 3M1IA 2GAFA 1EK1A 1BS2A 2D3NA 1GL7A 1MAHA 2F1RA 2PUVA 2VKQA 2ZRFA 1STOA 4YJGB 5F1KA 4BLUA 4B73A 1PTKA 4CV1A 5GOTA 4GUAA 2ZRIA 3R5FA 4OI4A 5B4TA 4WOCA 1PU2A 4DK1A 2GFHA 5B3KA 3N8HA 3ZQKA 2VBUA 5LYJA 3EZNA 1DEKA 2JLQA 2GD1O 4D7AA 3T3GA 2H85A 4LRYA 3A0RB 3QG5A 4YMIA 2YIVX 2B98A 2PT5A 3G68A 3IOEA 3QU5A 2BFEB 3PC2A 1KNXA 4NJMA 2XRMA 4BFCA 3QPAA 2Y2VA 3BFVA 1NUAA 3AYXB 1E5XA 2A9PA 2YYZA 4PSUA 1GZUA 2RGNC 2JIZA 4KCGA 2YJNA 1V39A 3FPCA 2DWCA 3GT7A 1AVTA 3QXXA 1DEHA 1QANA 1MABA 2CHVA 3RFCA 4LTMA 1EX1A 1NBAA 4YDRA 1AKTA 1BH6A 1ZW6A 2GRAA 3OFND 3TZCA 4X63A 3H2KA 4KBYA 5FA5A 1JV2B 4KH0A 4ZZ2A 3ROKA 1N2CA 2BFNA 1NRXA 2FR8A 5AKXA 1NPDA 1N1EA 1RE1A 2Q3EA 3DT6A 4X1KB 3BMQB 4BUJA 3QJGA 3TG8A 1NUTA 1DRVA 1QCCA 2QSYA 1A9QA 4CF6A 2ZWIA 3HCBA 2XOEA 1MB4A 4BIMA 5CH5A 2Z6UA 1CFZA 3EVFA 4MV9A 4S2EA 4ALIA 3AI2A 5TQ0A 4AJNA 2PWAA 2VNHA 3INNA 4FONA 4MZDA 3C3DA 1FRNA 3K94A 2XBLA 4OMUA 1IN6A 2C2KA 4QQNA 4JJAA 4DUPA 3F9RA 3Q3VA 1U0GA 3QYAA 4BFZA 4L4RA 1DIHA 5HDBB 1UZUA 4YRTA 2J8ZA 2I7XA 3CLTC 3DD1A 4KITB 2GRUA 1QP4A 1JNXX 1FRVA 3C8DA 2GYUA 2OO5A 4LXGA 4YT5A 5AK4A 2O7QA 4AF6A 1YJWB 2FK7A 2NVUA 4I08A 2WFLA 4MW5A 2WJ3A 4RA9A 4WLUA 3PPYA 1USKA 2EBHX 3UZUA 4H3KB 4AMBA 4IIJB 1MJFA 4L95C 4FE3A 2KLHA 2QV7A 1L5LA 2PWPA 3GPDG 3S81A 1RU3A 2COUA 2R6JA 2YDYA 3DAPA 1RBMA 5BVGB 4YECA 1T43A 5CYOA 1C1XA 2GMWA 4IVRA 3SS8A 5ALEA 1R6VA 1IDOA 3RC1A 5DGCA 3LDAA 3BXFA 3P2MA 1XQWA 4ZDJA 1UINA 3BEDA 3MUNA 4S3MA 3FNEA 2XBUA 2ZWVA 1R9JA 3EGXB 3GUVA 1V5IA 3TCKA 3IRUA 3B3QA 1N3BA 1P4AA 2PLRA 3CU5A 5AK6A 3ONVA 1Z6QA 1E98A 4JJ8A 3B53X 5MN5A 3I61A 3FMIA 1DWOA 1SUCA 5C3UA 2DY0A 3DMPA 1WL8A 2XA1A 5CFMA 5J23A 3ZHYA 1QYDA 2ISQA 3ESBA 2P9JA 3KJEA 2GEFA 3M81A 5IWCA 3KKKA 3LC0A 1P2DA 2H4JA 3ZWNA 3SGLA 2QRVB 4CKXA 2EZ4A 4ZT5A 2AKEA 1CUYA 3AB7A 4H3HB 1LVUA 1F4LA 2P5TB 2Q49A 5SY4A 1HNWB 4DTCA 4NBKA 2XYGA 4U7JA 2EERA 3RIGA 1GDTA 3EUAA 2RJNA 4JLUA 3BWBA 4LE0A 1LVGA 4ZODA 1WEHA 1Z7WA 3DLHA 3EWAA 4MTLA 4ZGNB 3MELA 4ESVA 1HDZA 3IIJA 3OE1A 5DJ5A 5FLYA 4TT8A 3PXBA 3VGPA 3NH6A 1NHGA 4KMSA 1LDBA 4XD2A 3LS2A 5DNVA 3W5BA 3RVSA 2P2LA 4D74A 4F9EA 3GJRA 5F2NA 1JR6A 3FFWA 4GPEA 3I2JA 4AQYB 1DQYA 1G3MA 1RM0A 4Q4DA 2OBTA 3GV0A 3L7AA 3CR8A 3VZSA 3ZIUA 1N2OA 4HAXA 3FVWA 4IGFA 4GC9A 4UHDA 1X70A 4DOMA 3ICCA 4EG4A 4AM8A 3PTAA 1RJ9B 1TM7E 1EK2A 1SG6A 2ZPTX 5ALSA 1YGYA 3B5IA 4O2BB 3ST7A 4ZYXA 3PKIA 5K03A 2XNSA 4JUDX 4DC1A 1NVKA 3HBNA 1UBUS 1T8SA 4H77A 5CAEB 4P4LA 3D6VA 3ADDA 2P9HA 4Q82A 3QKSB 2OAQ1 1KYYA 1VBMA 3LIPA 1EFCA 3CRVA 4NMWA 4TVBA 2QUZA 3LECA 3AHJA 4NFYA 4PC3A 1MW8X 3PUIA 2MIIA 2OZVA 1LLDA 2LIVA 2AW5A 3UPUA 1CNMA 1G21B 2X19A 4M6WA 5KINB 3ZDAA 1TCVA 2DBRA 5A1JA 1GUFA 1W2HA 2EWMA 3GIWA 1TLFA 2DEUA 1GO2A 3W3AA 4E22A 3JU3A 4LVOA 3DOFA 4YRPA 3U3ZA 4HXEB 3OZVA 4A3SA 1E1DA 2QVBA 4HX5A 5IFLA 1NAIA 2ORWA 3QPBA 4JJEA 2VBVA 4TTTS 3BE8A 4UJ3A 2XD9A 3L4BA 2SKDA 1YQDA 3PL1A 3KDPA 1VZ3A 1NULA 2XITA 2WAAA 4MLPA 3RT7A 3EMKA 1ZJZA 5FL3A 4LXIA 4M7OA 1ZUHA 4L8JA 1K63A 1T5EA 1U1GA 2AFIA 2LWIA 4R1PA 5H70A 5JO9A 1ACMA 1WW2A 2FMTA 1Z34A 3FSGA 5BNWA 3NDIA 2R86A 1DIBA 2VT3A 3CN9A 2MR6A 4L5BA 1R5BA 2Z3VA 3AF2A 3VR2D 2XODA 3PE3A 2P6PA 3QWIA 3X2SA 2B5VA 2EF1A 1BDIA 1A50B 1VP9A 4LV8B 1E4YA 3K0HA 4KQ9A 4X54A 3HYCA 4KXLA 1P39A 2NUTA 5JR3A 1ZVQA 2HK8A 4URZR 3TW4A 5HUJA 1H4SA 4FW9A 3CCUB 4EG8A 3GFGA 1X9IA 1EP2B 1HRKA 2FN7A 1YZQA 1DT5A 5KU1A 3O3MB 3A58B 3EG5A 4LRTB 1SEPA 2G9VA 3BORA 3SEZA 3NUZA 4QOFA 4U6QA 3LAWA 1UJ2A 3I76A 3FDJA 4NZOA 2IXDA 1Y81A 4XX0B 4Q48A 1T5DX 5TMBA 1BKSB 1XAHA 3R76A 3OURA 5JXGA 2R79A 3TOVA 2C04A 3TQRA 1ONPA 1C3LA 1T26A 2WR8A 3OJLA 4JY7A 5BN4A 4BE4A 3E82A 5LP6A 3A9TA 1XLUA 1Z2PX 4FFSA 1V11A 2DFDA 5IJ9A 1GGVA 1CQZA 1Z25A 2ZIFA 3ZWCA 1W88B 3ZI7A 4Z1MA 4C3UA 2FW8A 5B12A 5A03A 2OZLB 3QEOA 5D85A 2XPCA 4P0QB 3FFTA 4KV9A 4UHBA 1Y3DE 1ORHA 4L07A 4M89A 4UREA 4E09A 3DT8A 4B82A 4R6XA 2X0KA 2JAXA 2G06A 2JC3A 4ZGQB 1JLMA 4DBLC 1OFUX 4DJTA 2O2GA 3B6IA 2R2AA 2KM1A 4CETA 4RF4A 3ZCTA 5LMZA 2H0AA 3ML1A 4GECA 4JC8A 5HXBA 5T6BA 4EPVA 4HNSA 4UCFA 4V1CA 2ENUA 1XCOA 5G40A 1AH2A 3A06A 1XRQA 3BJEA 3WQBA 3ICPA 1XKQA 4BBJA 3GJ8A 1GR0A 3UJPA 3U4MA 1EVJA 3T5MA 1YDFA 5C18A 4LRWA 1P74A 1HE2A 3M4YA 3R9KA 4R8LA 5TT0A 1FVOA 2H5EA 1U2RA 4E32A 5I7SA 4GYJA 4BO6A 5EE5B 4D41A 1ZAYA 1DAFA 4UTOA 5EJMA 2W6MA 2CEKA 1US8A 1FXUA 5FBVB 1PR2A 5FOWA 3LF2A 3PE6A 4MW1A 1DEXA 2P9GA 2FWIA 3QV1A 2QN1A 3ORSA 4LJSA 2FP4B 2W22A 2ZZNA 3BD6A 1TRHA 3SY8A 1VL5A 2J85A 4X1YA 4NU6A 4ENRA 3QMMA 1P9LA 3HVUA 3VTAA 4I9FA 3FCOA 2Z57A 3X1JA 3P0EA 2Z2IA 4MUGA 2BFFA 4RS4A 4D6XA 3IOMA 3KJZA 4PTLA 5I7RA 5L3SB 2I7DA 4O4IF 4NX2A 4C21A 4ZDIA 3EF0A 2Q4TA 3PFKA 3EQZA 2AMFA 3MT0A 2A5FA 2IPOA 5HTKA 2YW2A 4F9TA 3CSDA 3EVCA 4I1IA 2X3FA 4MWCA 3REGA 2RD2A 3H5WA 1AHHA 3QXJA 2DETA 3HH8A 4BMSA 2AQ8A 1I3OA 3BGSA 1NSYA 3GY0A 1YJ5A 5D51S 3H6GA 2AN1A 4AY3A 2WE8A 4HDQB 4N7JA 1CQJB 4YP5A 2CDNA 3GCGA 3WJ2A 1A4IA 2H7CA 2RH9B 1UKVY 2WD8A 3FYHA 5DHFA 4FFPA 4D9BA 3WJ7A 5JJ5A 2IOQA 4UDOA 3Q7RA 3UPTA 1P5HA 3W1VA 3KAKA 3I8SA 4D4GA 2XE8A 3B9RA 1GNVA 3G13A 4WJKB 2H2AA 2ZR8A 3CB2A 3QEJA 4RHUA 1OKKD 2CXNA 2X4LA 3P4UA 1GA6A 2XMBA 3TEJA 1Z7GA 5LIPA 2CF6A 4TLBA 1IPEA 4AJHA 3VHRA 2B92A 4CKCA 1DG9A 3RUPA 5M29A 2F59A 1BQ4A 4G4SP 1PNVA 2WYIA 2BY4A 4JCOA 4AECA 1CRQA 5KQLA 1SMKA 3TEMA 3KXLA 2JBAB 4Q12A 3JQAD 4FSDA 2ZUWA 4JI5B 3AJRA 4I9NA 1ABEA 3IQXA 3KLOA 4WCFA 5EPEA 5A4MS 3ZLBA 1LSOA 4L2IB 3RRXA 2XRYA 1NZFA 4GI3A 3JY6A 4WK4B 4LF7B 2IC5A 3KPUA 4HX2A 1EK0A 1HTWA 1OXUA 3AI7A 1M6VA 4NBNA 4TQ9A 5G41A 4C14A 1GTJ1 1YCDA 1PYGA 4DCJA 4LJ5A 3AL0C 3EQ2A 4EJFA 2R8BA 1M2JA 1YB6A 3WJAA 3QLVA 1X74A 2E6UX 1IQPA 1PWXA 4HB0A 4BJ5A 1ML4A 1UZLA 2P3OA 1R8JA 3UAYA 2QL5A 1GN8A 3GVPA 4NHEA 2Q29A 3C45A 2NSJA 3CUSA 5IVKA 3IUBA 2JVIA 2BEVA 5A9RA 5I6DA 3Q8WA 4QTXA 2ZVQX 2HXGA 3UUFA 1GWNA 1P44A 3DEHA 3PQ5A 5FPQA 4Z4CA 1EESA 2Q1XA 1VLYA 1ADGA 1OBVA 1ZD9A 2XE6A 1H05A 3NNDA 3PQ6A 3TVYA 1Z0IA 2JI6A 3I01M 1ZOLA 1SQGA 2NG1A 1B6SA 1J22A 1NUPA 1TYCA 1ECLA 2NV0A 2AJDA 2Q3FA 1X1TA 3ANNA 3BCSA 3GJYA 4FD3A 4YRDA 1GQOA 1XKXA 3KTAB 3S1AA 2IYTA 1J8QA 1RYYA 5BW8A 2QR2A 1CY8A 1NG1A 1QOPB 2R68A 2FMKA 1XPJA 4MI6A 5FL7D 1QRUA 1YKFA 3TX2A 2Z30A 2GD2A 1DX6A 2ZGVA 1NNI1 2IZ7A 3DM5A 3ZK8A 4D0GA 3QWFA 5F5LA 1SBYA 2DYKA 2KS6A 2QGFA 1OIXA 3F6RA 3KE9A 3AJ9A 4MWZA 2IYEA 3UAWA 4C0BA 4DA8A 3E9RA 4RVCA 2QOEA 3FPAA 5JD4A 3P26A 2QMHA 3RYFB 3WRYC 1C9YA 5IDWA 5AESA 2QYOA 4KQFA 5FJIA 5GMOA 3F3KA 2FB9A 2QX9A 1DAGA 2IEDA 4FIZA 2IYSA 2JGDA 1D2HA 4RETA 4Q1AA 3GZJA 3I1FA 1OPXA 2BKAA 4PLGA 5BQPA 1ZR2A 4C43A 1YNSA 4U2CA 5DWVA 4DMFA 4CGYA 2OHVA 3OTWA 1U3DA 2A0YA 2R6FA 3EHEA 1FF9A 1XN1A 3O7MA 3LUCA 1R6TA 3AIMA 5L4NA 4DCTA 5GAJA 3DE5X 1E1RD 1MB2A 4PONA 3WGKA 1MX5A 1XTTA 4QX6A 2OHXA 1K6XA 5ERYA 521PA 4X20B 3KAQA 4B71A 5JSFA 2QPTA 3ZVKA 1R0ZA 1Z6ZA 3GLUA 7YASA 1XZIA 2X22A 3TWOA 1JAHA 3GDOA 1PNOA 5JJCA 5F3WB 2O20A 1Z9BA 1HY3A 3Q6MA 4KC0A 4BQIA 1KDVA 1S96A 1PZMA 1PR3A 1EGQA 1W30A 4YXFA 3ONWA 1ZRMA 2DERA 4Z51A 2AK3A 2BE9A 1Q0ZA 4YAKA 4AJ2A 4EQ6B 2V7WA 1CJTC 2JLBA 3B9QA 5HP4A 1X13A 1AQLA 3W5UA 1VDZA 4BZZA 1PR4A 4REMA 2QP9X 5DASA 4IMIB 5JS8A 4JA0A 3EXHC 4DUYB 2ZSKA 4D0SA 1Z0JA 3A6DA 1OXKB 4IZ6A 5CNJA 4EK9A 4E15A 3O4IA 4PBRA 1AQUA 4OYHA 3RVLA 5DTIA 3B70A 2GEBA 1UBHS 4XR6A 1HMYA 3WGYA 1BZYA 2CF5A 4FX2A 4NZYA 5HEKA 4QASA 3T4UA 3VR6A 1XZGA 1GT6A 1OREA 1Z5ZA 1XROA 2BVNA 3P4YA 2WJWA 2EFEB 3AEKB 3OJFA 1CQXA 1ZG3A 1S2IA 4KXNA 5LQDA 3SYLA 3L4KA 4GSYA 2YJZA 2JNWA 3CMCO 1PR9A 3ABRB 1X9GA 2XAAA 3EWIA 3IT2A 3UXYA 4AMZA 3RIMA 4FE7A 3LQYA 1L1QA 4JKIA 1P4SA 2BP7A 3ZYCA 2B4TO 4QYTA 1I2BA 2HREA 5CXXA 1XIVA 2B2XA 1Y6RA 2KE5A 2ZSIA 3UT5A 5AUOB 3CGGA 4L8WB 2A5GA 5LUAA 1ZSVA 2YFKA 3I9V1 1S01A 3N2LA 4GVLA 2EBUA 4XN0A 4RF5A 2C8LA 3HCEA 4JHXA 2EJBA 1FFEA 4MYCA 1QQTA 3X43A 1V43A 3WV5A 1VECA 1BWSA 1IY1A 1F1BA 3EY4A 3EZ7A 4PO8A 1FP4B 4QDOA 2PZFA 4QBHA 4X44A 3IH5A 4R83A 1BTOA 2JH3A 1TT5B 1QAQA 1QHHA 1WXWA 1XFDA 2Q1YA 2R1VA 1QH0A 3B48A 3KSMA 2ZYTX 1DU4A 3T53B 4S24A 3EISA 5F52A 4DCSA 3K6SB 5DM60 2A86A 3OPVA 1HI9A 2Y8EA 1TTPB 3QTLA 3S2SA 2HNAA 1PRYA 4N0PA 1RHKA 1L8QA 1E9AA 1GA1A 5AQ1A 2AOVA 5TPZA 4DIKA 4YQZA 4EF5A 2QU7A 3N0WA 3VO1A 2X58A 2VF4X 2B30A 1LNQA 5EJGA 5M5BA 2RHJA 2VFAA 5C1DA 4UBKA 1CR4A 2GBCA 2ISCA 2J5RA 4UTNA 3CCJB 5LQMA 1YFJA 1OR8A 4WJZA 1TFUA 2QAIA 1NXVA 3RVMA 4BKRA 5CFLA 2O57A 2WILA 3CTPA 3H9JA 1O94C 1XCGB 4UUNA 4G25A 1W36D 4ZRDA 4BLVA 4MQEA 1HLFA 1CR6A 3FYUA 1NM5A 5HILA 4URXR 3VSEA 2ZI6A 3H1BA 1JHRA 2Q8QA 1T4CA 2YXNA 3PT5A 5FHQA 4ZCLA 3FI0A 1QIIA 2PT9A 3NXSA 1CQIB 1ORIA 4ZCSA 2GN2A 2C7GA 2JHGA 5TQJA 2QD5A 5EGNA 5JWRA 2C2YA 4NYMQ 1KSHA 1UMCA 3R6DA 2AMJA 2Q1UA 3PDIB 3PUMA 1Q14A 1VQLB 2CLDX 4NWIA 4URWR 5AVYA 2HCRA 4LVCA 1E2BA 1WU7A 3G6WA 1D2RA 1I2DA 3HBJA 3NR2A 4WEQA 4HVTA 1UBFA 4Q15A 4CTKA 2V0GA 4J1NA 3AFNA 1XDUA 4M7WA 1E4OA 1WXHA 4XX1A 1FUIA 4FNMA 4CM7A 3M1AA 3RIYA 4D3XA 1NKSA 4AMVA 1A8HA 2CT8A 4D8WA 2QIPA 1OWOA 1TD1A 2TECE 2O7RA 1XX6A 3W0LB 1ZGHA 3NEJA 4FBMA 4ND8A 4CMIB 1IJKA 3HB0A 1R50A 3VJKA 2H2IA 2C0PA 4OY3A 1T3GA 3DLAA 1NONA 3JAKB 1NRKA 3NOOA 4HK4A 4LXXA 3T7JA 5DNUA 2QLBA 1UEIA 4XWYA 3BCHA 5HWSA 4G5HA 4TKOB 4A27A 5C37A 4BVGA 1FYEA 1X7ZB 1NV9A 4HMOA 1PEAA 1YO6A 2YZNA 2GBPA 4HQNA 3WLOA 2PFSA 3DEYX 3T3PB 4BN0A 2V6MA 1JQJC 3K9NA 4EYSA 3FNQA 3ILXA 3EGCA 1ND5A 1OYVA 1UJNA 3IR5A 4TKMA 1JDSA 2BD0A 2WYWA 2E5FA 4CQMB 3U44B 1MBZA 2Q21A 1GFSA 1HRDA 4B6FA 5IT9A 1G4UR 1RWNA 1XCPA 4KVFA 4IZIA 4NENB 2GRJA 1ES9A 4MA4A 2FSVC 1JU3A 3ADOA 3QFFA 1EDDA 2PVCA 5LOVF 3CRZA 4YCLA 3RVNA 2BCGY 5KYXA 2C20A 3G0OA 1JJVA 2GCOA 1M2HA 1P0PA 5DWQA 2YWJA 5EVCA 4C0LA 1YZUA 2N46A 1A8QA 3QU9A 2C99A 3DLBA 1BX0A 1AUQA 1SPBS 4IDFA 2AHOA 2XUJA 1T13A 2CL6X 3KJHA 1J0BA 3WGLA 3RU9A 2OKCA 2R47A 3DS8A 1S3GA 2PRSA 2DFPA 3WK6A 3R20A 1O3YA 3K0CA 4PU0A 4BLOA 4X97A 5KNCD 3EXIA 2BMAA 4F6RA 4D0LB 4CKZA 3NT2A 4JNCA 2QNBA 2AZDA 4CV2A 4E08A 2NQ8A 3O82A 4EG0A 1FFHA 1PZFA 3TECE 3SF0A 3E1SA 1XRNA 1AHNA 5AW2A 1R6BX 4IHJA 1X8KA 1UBEA 4B87A 5HRUA 3CLRC 1E0SA 1SKBA 1TJ3A 1DOZA 5A3JA 1U9CA 2NU6A 4EZEA 3TOZA 1QCDA 2QQEA 3HM2A 3R8CA 1YAJA 5COBA 3K1AA 4V39A 2A92A 3EVDA 1KMQA 4DV4B 3G2HA 4JT8A 2GYWA 1RWKA 2ZM6B 1KFCB 4K9RA 1CZRA 3HR4A 3QJYA 4JB2A 4Z8YA 4S04A 5DM70 3W8EA 2O2YA 3NPMA 3A8IA 1F12A 3D7MA 3L8CA 1CUAA 1N5LA 1OFGA 3WK8A 5JW6A 1ZICA 3U26A 3IDQA 1WDKA 4A36A 2G1AA 1Q7RA 4RLZA 1JSCA 3PUYA 2QN6A 5A4KA 3LWNA 4DXHA 3AZQA 4MKHA 1OA0A 1A4XA 1VCIA 2QTHA 4GBED 3X1MA 2F8SA 4D81A 2Q4RA 5FAXA 5IC5A 3VC3A 1FEZA 2EIXA 4P83A 3SNHA 3O90A 1XRLA 3CCFA 4K6CA 2NSHA 1KO1A 3ICOA 3IR6A 2XUFA 2EQBA 4OHRA 1KU6A 5DYTA 5IARA 5JVDF 4V0QA 4Y7CA 3NANA 3AUFA 3E1GA 4UU0A 5FI0B 4N0DA 4K9OA 1Y8RB 4KO8A 3X1DA 4OAPA 1QAOA 1I7PA 1CVRA 3JD1A 4I4TB 1MEEA 3CT4A 4LDJA 1PP4A 2ZUBA 4YRZA 1P7YA 2GK7A 1ZUWA 2JKYA 2P6MA 2WP0A 3JAWA 4RPCA 1GYRA 3C1UA 1L5GB 1J39A 1VPEA 3CURA 3K31A 2JATA 1D7AA 3R23A 5LVAA 1TAHA 3BERA 2QRGA 3LZDA 2CDRA 1DT3A 4P5EA 5EJFA 4BDSA 1NV8A 3MJDA 1M3SA 2BHNA 3H83A 3IDAA 4PGHA 2AJ8A 4UCXA 4Y6OA 3WOVA 4AMUA 4OX9Y 2PKCA 3FVQA 5C7YA 2DY1A 1ZJ6A 3RYHB 1QXSA 2HQRA 2ISSD 1JLKA 4OIMA 3H2YA 2BSAA 3RC2A 2P2YA 3DTTA 3I1YA 1AMOA 4G0XA 4HYEA 1SOVA 1UJBA 1KOLA 1JKMA 3ZZTA 1MA3A 1NG9A 2GZMA 2MYNA 3B9BA 4EHLA 3NOVA 4NHOA 4MUFA 1JX6A 2I22A 1KYVA 3AP2A 1ZUNB 5AVJA 2B6NA 2V6JA 2VDWA 4X6XA 4QVGA 3AEUB 5E7IA 1KI6B 3QVGA 3ZE8A 4TQUS 1EDBA 2UDPA 2IIBA 4PHFA 3VH3A 3RS3A 4WKBA 3ZCSA 1I3MA 4UVEA 4DEXA 2DWQA 3TF5A 4MARA 1M2WA 4AJ9A 1AD2A 5ESWA 1NA5A 4JWTA 2YV3A 3G23A 2R4UA 5EXPA 4ZKEA 3ZE7A 5FXMA 4ASUD 1IB0A 4CLHA 5HIMA 1JG6A 4OQLA 3T7AA 3QUTA 1QAMA 1EJ2A 2COKA 2FSGA 3NDJA 1GGMA 4G81A 1N78A 2CJYA 2X2PA 1IAQA 1DKPA 3CLTD 3ZGLA 1X7WA 4IICA 3WLTA 5I9BA 1YHNA 3W2HA 2RHCA 3IEKA 3UO8B 2V7VA 3UJAA 5BSEA 1YHZA 1YDGA 2YCBA 2ZATA 2ZSAA 4Z4SA 5HJEA 1DI0A 2FFHA 3MWJA 4I55F 2WHXA 1Z6GA 3FZQA 3K7EA 1X7DA 4TLDA 3M6FA 4NULA 4N0QA 1N9ZA 2OO3A 5CT6A 4PZ9A 5TQ2A 3AUKA 3U6BA 1PZNA 5EJ2A 4XGRA 3RJTA 3VR3A 2D6FA 1NVFA 3PJFA 4C4YA 3N70A 4CW7A 1CRWG 4IZHA 1E2LA 4KFSA 2DG2A 3HNOA 4GWGA 4EFKA 4K2AA 4G84A 4CQLA 4QU8A 2DLDA 1NLYA 4A6EA 3OOCA 3U61B 1FLNA 3IAEA 3EDCA 1Q7CA 2Z56A 4CGZA 1ITZA 1JHDA 5CURA 3Q5DA 1FTNA 4DZRA 2QE7D 2OBLA 3PX2A 1XMPA 2BHLA 1LS1A 1ZK1A 2RHBA 3AH8A 5CGQB 1AT1A 2YHIB 3PNBA 3LWDA 1EI9A 1R5JA 1Y3FE 2CBZA 3PUKA 3SLRA 2I1LA 2FZLA 1KI3A 2D2VA 1JQAA 4F21A 4TKVB 5HGXA 5DGDA 3RV3A 5JHHB 3LWBA 2QBYA 3FUUA 3R5TA 2PKWA 4RKEA 3RUCA 4B3BA 2PL3A 3PA2A 1XB2A 4FZVA 3MT9A 1I2CA 4IRXA 4MPRA 4Q9JA 2I3DA 1AUOA 3V4VB 3CCBA 4WI1A 4ZZIA 2A30A 3AL3A 4QQRA 3CUWA 4XVUA 1KBOA 1GT91 3QKRB 5LP6F 5A3QA 2DPGA 1GQQA 4OTZA 4OQDA 3WTCA 4Z4VA 2NYAA 4CMBA 4YXWA 4U39A 2Y66A 4HLUA 3ZDEA 4MW7A 4S0XA 1RQRA 1FMTA 1DX9A 2H54A 3NC0C 2F1OA 3C7AA 3ASSA 4N1AA 5FTMA 3KOMA 1TLLA 3CPSA 1TA0A 3TJRA 1CZHA 5BNIA 3DKRA 1RPJA 1AXGA 3OW2B 2JFFA 5JALA 1FP6A 3PA8A 3DBHA 2C0QA 2EFHB 3QX9A 5HJ7A 3IALA 4DR4B 2Z4RA 2J3HA 4TT3D 1WHTB 4NYMR 1WMEA 3KT3A 2JGNA 3LZCA 4FNGA 1NAHA 1W2BB 5DHPA 1A9YA 3RVDA 1L4BA 3FYSA 1KFKB 4TTAA 1SXGA 2PZBA 4H1WA 4KWIA 4IDDA 5F23A 1NPYA 2IPXA 3SHOA 4UTRA 1QGZA 2Q99A 5LJLA 4ONEA 4GMXA 4RAOA 4H7PA 4RHTA 4AN1A 4XGNA 5DK4A 1QR2A 4XYGA 1OI2A 2I65A 2YWEA 4ZO9A 2XF2A 3OFSA 1N7JA 1U99A 5EFZA 3EULA 4NAVA 4YCNA 5CH3A 4OPSA 5HFJA 1MGOA 2G4LA 2X9QA 5LQJA 2F9LA 2WAXA 4FLFA 3UM9A 1K8ZB 3VBEA 4A0SA 1FQJA 4YJ2B 1RXVA 5H82A 1QQBA 3WJ1A 5E6UB 1FJGB 2VHVA 4K05A 3IDSA 3TJMA 2GWRA 1T4GA 1D2GA 3UKJA 3VZBA 4DNOA 9ABPA 4JMLA 4QARA 4GKBA 1P61B 1KS2A 4L16A 4Q4JB 1VHJA 3AUXA 3T9AA 4RHCA 5C52B 4ARIA 1ZDMA 5ESXA 4P1VA 2I03A 5HCNA 1LBHA 4HAVA 2H8KA 1MF7A 3KTOA 4LSZA 1TW3A 1OX4A 1CRZA 1SXJB 3AESA 3HP1A 5AD1A 1NVWQ 3EG9A 3KLPX 3CG4A 4TV9A 2PSEA 1Y37A 1Q3HA 3VTZA 4B7XA 1K0FA 5E9QA 5MN4A 4UHHA 3ZNQA 2FPPB 1H3EA 4IFTA 1Q50A 1YH3A 2Z6AA 3N53A 4X66B 3O93A 1U8CB 4XM3A 3BRWA 4QU0A 1UXIA 4BO2A 2D1FA 2D5CA 2XECA 3ILSA 4Q39A 2Y1GA 2FA9A 5ERGB 2VJLA 3VO9A 2AN3A 5DLQC 5A4DA 2FEMA 4DLUA 3N7TA 2ZITA 2PYDA 2X9LA 5K1ZA 3LUGA 2DPXA 4Z9BA 3VKUA 4D80A 1JUDA 2WIBA 5KKNB 2WNSA 3MWYW 2ZAYA 1ST3A 3B20A 4KDEA 4U7GA 2V1XA 1M7HA 2KHZA 1JXAA 2Z2ZA 4M38A 1RYNA 3D2LA 3VC1A 3VR1A 5ITWA 1J0DA 3UMMA 4OEHA 1TTTA 1OV4A 4FHEA 4J1QA 2CSUA 2IUUA 4JB3A 2HA0A 1KBQA 4R1TA 3TXAA 5GJBA 2C82A 2AYXA 2RBEA 1FPMA 5KTKA 1N5OX 2FSPA 4IDOA 1JSXA 5JMWA 3T0GA 4CRWB 3UAVA 4KYIB 4R3NA 3VR5D 4ARBA 3CZRA 4L6AA 1UK9A 2SKEA 1VLJA 2ZPAA 3EMDA 3FTQA 1O96A 3JV7A 4TV8F 4A03A 1JDNA 5B53A 3BY2A 4JUAA 2G67A 3VGJA 2SICE 1Q0UA 3STVA 3BCRA 2AH5A 4UQPA 5AKHA 3FNHA 4P54A 4CR7A 1BDBA 1JECA 1EFVA 3RTCA 1P62B 3WY9A 2JJQA 4X00A 3ZTYA 3FKSD 2QMYA 4YTEA 4UOZA 3CKYA 3HJCA 4R1SA 3F3SA 1N9GB 2MSEB 4HC4A 3EIUA 5EJEA 2BJWA 1DRJA 3LWZA 1YJAA 1X8JA 1E0KA 4IH9A 5CLHA 3WMGA 4YLYA 5BN3A 5KYGA 3LP5A 2V31A 2DSTA 5JY1A 1A8IA 1VYVA 1MX3A 2PNFA 3AFGA 3BFXA 4RKYA 2BR5A 4QDXA 1G8AA 2PWYA 4N5DA 3MJ4A