4RJVA

Crystal structure of a de novo designed ferredoxin fold, northeast structural genomics consortium (nesg) target or461
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
MEMDIRFRGDDDEALARALLKMVVRAVSFGAQVRFTDDGNDLEIRITGVPEQVLKELAKEAERLAKEFGITVTRTIRGSLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR461
rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords OR461
total genus 24
structure length 83
sequence length 83
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4rjvA00
4DV6J 2UXDJ 2KVQE 4V1Ak 3D3CJ 3D3BJ 4JI7J 4NEYA 1IBKJ 4X66J 5IWAJ 4DR6J 3T1HJ 3J81U 4DR4J 1XMOJ 4DR7J 4NXNJ 4JI2J 4DR5J 2VQFJ 5LMNJ 1I94J 1XNQJ 4K0KJ 4DV0J 4YHHJ 4KHPJ 4LF8J 1XMQJ 4KYZA 5IT9U 1N36J 4DR3J 4JYAJ 4HHUA 4JI6J 4DUZJ 2KL8A 4KY3A 2HHHJ 1N33J 1N32J 3J7AN 3W1YC 5AJ3J 4B3SJ 2VQEJ 4LFCJ 4X64J 4OX9J 4LF5J 5A2QU 5FLXU 4LF7J 4DV4J 4X62J 4LF9J 1IBLJ 4JI0J 3JAMU 3R2CJ 4JV5J 5BR8J 2ZM6J 1HR0J 1HNWJ 2MEWA 1XNRJ 2UXBJ 4NXMJ 2UU9J 4DV7J 4NEZA 4JI8J 4YY3J 3R2DJ 4DV5J 4RJVA 4DV2J 4PWWA 4LFBJ 5LMUJ 4B3RJ 3IMQJ 1IBMJ 4DR1J 1HNXJ 1J5EJ 2MQ8A 4LF6J 4LFAJ 4DR2J 4JI4J 4GKKJ 3J80U 4DV1J 4DUYJ 4JI5J 5LM7E 4JI3J 1FJGJ 2F4VJ 4X65J 4B3TJ 3OTOJ 4DV3J 4JI1J 1HNZJ 4AQYJ 1N34J 4LF4J 3T1YJ 4GKJJ 2UUAJ 2MTLA 2UUCJ 2UUBJ 2E5LJ 2UXCJ 4B3MJ
chains in the Genus database with same CATH superfamily
2XTJP 1RJJA 3M6WA 4ZPVR 2YNHB 1F9EB 2RRNA 3N5FA 2JLFA 4B3RF 3GIJA 2VFVA 1WEXA 3BJYA 3G82A 2XZWA 4FYYB 4X66J 2BKPA 2FGCA 2E29A 3I5CA 3P4UB 3DLBA 1X4FA 4MIAA 2CADA 3DRRA 4NL5A 2BA9A 3N9UC 4RNOA 1N5YA 2YKPA 3N6MA 1S7HA 2QX0A 4JI0F 3VWSA 3W66A 4F0HA 4WFNQ 3TJAA 1G6BA 1NJZA 5BYQA 3MFHA 1FHTA 3FEZA 2QYGA 2RU3A 3KNAA 2OEMA 2XCAA 3M8PB 4EMDA 1XTZA 1H2VZ 4LRDA 3M2VB 5KFZA 1N36J 3UPFA 4UOFA 1M1HA 1N0UA 3BPSP 2NREA 1R3NA 5HROB 5HMXA 3PYEA 2A0FB 2N82B 4JYAJ 1UVIA 3DXSX 4LIWA 2D3UA 2Q43A 3VQTA 3OSPA 4IR1A 3OTOF 2W2MP 2A18A 5J1EA 1H73A 1U2FA 2GIFA 4O4RA 1TV6B 1NZ8A 2NCKL 2YNFB 1RWXB 4WFXA 3TX0A 4EI2A 2XO7A 4PAAA 1I6JA 1S6OA 2HHQA 5LMUF 4ZJQA 1SXLA 4WU2A 2J9CA 2GZOA 1NAQA 5KFJA 2MZ1A 2HFVA 1K1QA 1YG0A 3I96A 3MWBA 2ZUGA 4XDDA 3QMQA 4A46A 4B02A 3K58A 1DLOB 4A8WA 4HVZA 1UFKA 4OYWA 5HANA 2VJVA 2EFOA 3NXZA 1LW2B 4HYKA 1DTQA 1TAQA 4NYOA 4Q2MA 3SCJE 4ED1A 2XS7A 3EM1A 4HTIA 3NP5A 1YJ7A 2B9EA 4J5OA 4OZJA 4PKDB 3VGSA 2ERRA 4MK9A 1ZPVA 2ATCB 2DGVA 3DLEA 4P2MA 2FY8A 3US5A 4LT6A 3ZTSA 5BR8J 3DLKA 3KJVA 3MUMP 2RS2A 1XERA 3KG1A 2WTFA 4F4XA 3I4HX 5HLFB 1S6PA 4EK2A 2O1PA 4WYWA 1WKLA 2BKNA 2OD4A 4V19X 1YZ6A 1HBMB 2PEHA 3T9NA 4LR9A 1T11A 4DV5J 4MK8A 1X8DA 3MI7X 4ELTA 2VG5A 4G1IA 4ZVPB 4HL9A 3VQSA 5AE1A 2FLPA 2CPJA 3MM7A 3OTCA 2JRSA 1ZAVA 2RD5C 5KFXA 2CJXB 1NKBA 2I0XA 3OUYA 3BYRA 1N0VC 1CC7A 3IWLA 1FRXA 4RNFA 3MGJA 1AXQA 3FCWA 3LTOA 2KM8B 3EGNA 1ZAXA 4CLKA 2U2FA 3M4XA 1F3VA 4DR4F 3OTEA 1UVLA 2I8EA 4ED0A 2NXUA 2BJ9A 5KG2A 1VLYA 2WONB 1TMJA 1RHMB 3DHXA 5M2UA 3OVAA 5B09A 2EBEA 2GQ2A 4JB8B 1RXOB 1WACA 1G4CA 1TU0B 5IM0B 4PR6A 4JI1J 1YWXA 3QGGA 5HLFA 3MPVA 4IFVB 2OPRA 2ZWPA 4O4GA 5H9EJ 4DL0C 2VC1A 2NYIA 5C25B 3POTB 4IDKB 4GMKA 3V2UC 1RBOB 4ZLJA 1WC5A 1NXIA 1CSJA 4YB1P 2UUCJ 2UUBJ 2AP6A 1RE1B 5D0HA 3MTKA 3BQ0A 4Q0BA 1UEUA 2HVDA 3NWGA 3PZPA 1N5YB 2COLA 2GFFA 1JNZB 1VMBA 2UU9F 1BY9A 2AJ0A 2B5JA 3PACA 3CDEA 2QYCA 3HCXA 3MM9B 4MJKA 5F9NA 2B0GA 5KG1A 1VQPS 1GFWB 2J6SA 4CLSA 5CCMA 2C22A 1JWWA 4GC6A 4S0MA 1H0HB 3CNQP 4PQUB 3OJSA 4KTQA 3A8KA 4IG0A 2VPZB 4C8MA 2F8MA 2VZ9A 3ZZZA 3MR2A 1VQ9S 2ZZMA 1RWKB 2B3TB 2VH7A 2OFGX 1FVSA 3GB0A 3IM8A 1EB0A 2PFDA 2EFVA 2R8JA 2HHTA 1NLKL 2HIQA 5H9FK 4CYUB 2MLZA 1T9TA 2BVZA 5KFSA 1F0XA 3TAPA 2HFUA 4R0JA 1N48A 3HK2A 2MB0B 1IM6A 4E98A 2RVJA 3PDNA 3M2RB 3EWGA 5JMNA 2W4CA 4C0BA 3C6TB 4DG1B 4BDPA 1T9XA 1TV6A 4ZPTR 2WOMA 1NJYA 1Q7YT 1JKHB 3EZOA 1Q53A 5F3TA 5KFTA 5AE2A 3ITHB 3HM9A 3IBWA 4N76A 1A7GE 4XAKA 1JLFB 5G0RB 5A6WA 1DRZA 5D15A 2XULA 4IUFA 2MSSA 2L08A 4HI2A 4DUZJ 4JYAF 2DPJA 3VAJA 2M70A 5GAEI 1SL1A 2PEBA 2YWWA 2MZQA 2OSQA 4OX9J 1JJ2R 2QZ8A 3KLHB 1WHVA 3KMQA 2ZHAA 5FLXU 2ZHBA 4NXMF 2BQRA 1S0OA 5AT1B 3E51A 3BZQA 1WG4A 3O1LA 3ZFVA 3BO4A 2PT0A 4Q0BB 2R2TA 3IR6B 4FYVB 2OPSB 1KBRA 3BGUA 4X62J 1XN9A 4ZLLA 1KFDA 2I5JA 3VAFA 4JI0J 2XS2A 3O5TB 4K2XA 1HQ2A 2QMWA 3CVKA 4GVBA 4L6V3 5EX0A 4JV5J 1SV5A 4WYLA 3BEGB 3HSZA 4K4XA 3KNGA 5DM7Q 4I2QB 3NLCA 4TYBA 4FZVA 1Q8KA 1VQNS 2W1BA 2HNDA 3M1VA 4Y2MA 1KOOA 3HT0A 4IO1A 2YNHA 3J81j 3GIMA 2W9AA 2GMHA 2WOMB 3LP0B 2J6UA 3L95X 3M7VA 4LRFA 2JOQA 3CJ2A 3I4PA 4FYXB 2UVVA 5BR8F 2K3KA 4NEZA 3ZO7A 3VAIA 3V4IA 4UOCA 3SZ2A 1Q8LA 1H2TZ 4PWUA 5EUHA 3TUJC 1MG7A 2H4YB 2XSJA 2MQLA 3I32A 4U95A 3HXMA 4JV5F 2E66A 2QIFA 2V2VA 1S99A 1SJRA 4NCBA 5AXLA 2M9KA 4W4MA 3VGUA 4H54A 4XK8C 1FCAA 1RWVB 2HWHA 2JWNA 4WP3A 4YN3B 4Z2XA 4IRKA 2HS0A 1OY6A 1XBWA 1RT6A 3DRPB 3AJDA 3CC4S 3G86A 5D77A 5F8GA 3U02A 2P9GA 5LSOA 2BOAA 5EGYA 1MROA 4P2FA 4JV0A 1LWCA 2J5AA 2K1RA 4A4JA 1H3DA 2HK3A 2OPRB 4O4GB 3NGKA 4EEYA 3GP9A 1VQMS 4P74A 4QZVB 2NXNA 3GTYX 3TEHB 2HWIA 4MYUA 4BWJA 4YS2A 2MKIA 2AYGA 1CVJA 1MMLA 2EK6A 3Q86A 1HBUB 3CCUS 1V3SA 3NKYA 4ZPDA 2DGXA 3PW0A 3QSYB 2LQ9A 3MDFA 1JLCB 1JQGA 4F4ZA 3PM9A 4KHMA 4CCHA 1RT1B 4ZVUB 4MTPA 1NSQA 1KHVA 3IGVA 1IKVB 1PJ7A 4GKJJ 2IMWP 2XLKA 4CO2A 3V4IB 3P49B 1URRA 1CLFA 2XGQA 1CS4B 3W2WB 2GJIA 3NWRA 1T9VA 3QWPA 3T41A 2HZVA 2UXCJ 3IA0A 4B3MJ 4IH6A 3N6LA 4Y28C 4N8OA 3FC9A 1YJTA 1HPZB 3KJQB 1SKWA 2MZRA 1GT8A 5A8RB 4KRWA 1RT2B 4I7FB 3TVYA 4CWBA 3CUNA 4B9VA 2AHOB 5IQQA 3JAMY 1IBKJ 1QTNB 3AB4B 1T9WA 4C3KA 3N0VA 2ZNYA 5BXIA 3UN2A 1FNOA 4F67A 1IR2A 2BQUA 2FVSA 4ECYA 1TFYA 4CIOA 2CJAA 2L9WA 2NUUG 3AY0A 3BGRA 8RUCA 2UV8A 4OMFG 5E33A 1S1XB 1YDLA 9RUBA 4EBCA 3S1TA 2V8VA 1JIHA 1X5OA 3LANA 3BBFA 2HQFA 3MUTP 1WSVA 2DD8S 2HWTA 3B8HA 3QGHA 5K14A 3TA0A 2CG8A 3GYGA 1D8YA 4UY8T 2R8KA 2XMKA 3EVWA 4Z7YA 4ED7A 2VPXB 2RE1A 3TZWA 1PYSB 5J2QB 3LGNA 1QAJA 4LF7F 1V3RA 3G82B 2XZTB 4HEA9 4Z37A 2XMTA 2ZKTA 1NH8A 1OPIA 3NCQA 3SBMA 1U1RA 2E1RA 3BSAA 4OZ3A 2R7WA 3BDPA 1TFWA 1ZTWA 3CJ8A 1F2GA 3MAAB 3THVA 3FBBA 1VRUA 2HHHJ 3K17A 3Q8SB 3WHIA 2DNOA 4DZ6A 2AJQA 4YQWA 1M0SA 2V0NA 4X64J 2YKQA 4HTJA 3LGMA 2IA0A 4KE5A 3K5OA 1LFWA 3FGVA 3IP0A 2J6TA 1LEOA 1D09B 3FNNA 4DL5A 4WJBA 2D9OA 3QFHA 2ZH4A 1HFEL 1B70B 2RF2A 3MM6B 3MM5A 4LBPA 1SJFA 2IC3A 1U0HB 1LKZA 4I6WA 1FX4A 4JI3F 4C6AA 4CO3A 1Y10A 2YKMB 3DN9A 1RT4B 2MKHA 4USJC 5DLGA 2M3DA 2MY8A 3TAMB 3W5ZA 2WSCC 1Q81T 2GAGC 2PGCA 2LDIA 2A6OA 1X0FA 1QTMA 3QPIA 5E2QA 4UTGA 2MKKA 2FHKA 2BM1A 2FIUA 3F44A 3B78A 4HHHA 2D7SA 1U8SA 2MKCA 4PXEA 1X31C 3IS9B 5GAGI 3CXCR 3C16B 3HHLD 3CT9A 3HHDA 2DGUA 2DO4A 3CCRS 2ZH5A 2CQBA 3AHPA 2B51A 1FRLA 3SCIE 3MD3A 4FKXA 1HD1A 3GFYA 1QAXA 1UFWA 3DLKB 3KJVB 2ZH1A 3IAS9 4KGXB 2M4MA 2KU7A 4OYZA 3DMJA 1WF2A 1HA1A 1TL4A 5CYJA 4ZJLA 2HMIB 1KR4A 4K8RA 2BANA 2MKJA 2A10A 1HHQA 1G7CB 4F0KA 3OL6A 1M5KC 2EG2A 2X1GA 3B6BA 1UL3A 2RF2B 4PXBA 3OR1B 4ZVOB 4ZN3A 3FSIA 3U1MA 4DV6F 2F9JA 1FK9B 2NS1B 1WJ9A 5F8NA 3MCSA 4ER8A 3DYAB 4TN2A 1S9GA 3FBFA 3SCLE 4M94A 2C3OA 1RAGB 3CF5Q 4D3HA 4H4OA 5LT5A 3OTOJ 1S1UB 2RH3A 2B8QA 3FKBA 4FF1A 4Y2AA 2EK1A 3D6MB 1T9YA 4WE1B 2EPIA 2LEPA 1UWBA 2JVOA 4DXLA 3C46A 3TVKA 3OTBA 1T3OA 3N4WA 4WPAA 2C2KB 5HN0A 3R1LA 2RILA 3NNHA 2ZH6A 4IYQA 3QRRA 2AJ4A 5KFCA 1SI9A 2BE2B 4FS2A 2NZ4A 1VBZA 1Q86T 2UXDJ 5E3PA 4HDHA 1KOHA 4F4WA 1JX4A 2ZBQA 4RBTA 3D3CJ 5KG3A 4U6PA 3UD3P 1NK0A 2QMXA 3DMJB 3FEYB 4LUBA 1XWLA 2IM3A 3UNGC 1UVNA 1U09A 2AGPA 2OO4A 4WZQA 1PILA 2V2KA 1GXUA 1NHKL 1TK0A 3DOLA 2BX6A 4J9LA 1TK5A 1CJKB 1KVKA 4WK3A 3VGVA 1K0VA 1X4GA 4R8UA 1RAEB 3OR1A 3GONA 3VF0B 1U0SA 3LALA 2J7WA 4Y2IA 5E3CA 5E3RA 3J7YI 3PKMA 1T7PA 2QT7A 1BD6A 3W8PA 1LNQA 5DS7A 3OHAA 1TMMA 2B9WA 3SSSA 1WWHA 2WHOA 5CZVA 5IT9U 3WIUA 2O01C 5DG7A 1WOOA 1DLOA 4I4BA 4C11B 3JYTA 4L3NA 2Q66A 3MFIA 1OJ4A 1DTQB 2V9WA 2VOPA 1FWPA 3K57A 3WQPA 1F1BB 2AQ4A 4BBYA 1X9WA 2B9YA 5LOQA 2P9CA 1JK9B 2ILYA 5FDLB 4LF5F 4C3MA 2QSFA 3E3XA 5KFUA 4BHQA 4ECQA 1LFPA 4L72B 2RQCA 4DFKA 4OI0A 3V81B 4ED8A 1T05A 4F04B 1S5ZA 3M30A 4LFCJ 1UP1A 1EP4A 3FFIB 1SH0A 1RZMA 2KYXA 3RAMA 1BGXT 1HBOA 3C15B 5KFKA 4NLYA 1Z1ZA 4NZ6A 4N41A 3UN3A 1C1BB 2AU0A 1HNZF 2XLIA 4Y65A 4DCJB 4O3NA 4R25A 2HIYA 3W5YA 4CLTA 1R27B 3FSXA 2KYZA 3DLLQ 9ATCB 2FHMA 3DOKB 4FPRA 4PPDA 2YQ1A 3NAHA 3T1HF 1S9FA 5HQLA 3RR8A 3MCMA 5KT7A 4OZ5A 1FRHA 4NLUA 5B0CA 4IQXA 3RBZA 1BQXA 2P2CB 2OFHX 4KFBA 2MGZB 1EZZB 1HPZA 1NPRA 1RI7A 3BS9A 2UU9J 3K5MA 5ETOA 2RAQA 3I9ZA 1KSPA 2PDAA 2ZD1B 2WSEC 2BJ3A 3TA1A 3TJ8A 4ED2A 4WBFA 5J1NA 5KOWA 1RT7A 4OZ1A 4NE9C 2EFGA 1ZA1B 1A9NB 1H6KX 1OYDA 3C8YA 2BUNA 5ETRA 4ETZA 3PFOA 3S8SA 2ZE2B 3GFXA 5M2PA 3BSNA 1TL7A 5ETLA 2FB0A 1CC8A 2JFDA 3TZXA 3CCVS 2QL7B 2N4CA 4KR0B 3IBCB 2KZZA 3H20A 1RTDA 2HQGA 3HMJG 3JSYA 1TR0A 2JC1A 3VAHA 1NK4A 4B3SF 4EZ6A 3AXKA 4C8YA 3KK3A 1FRIA 1ZM9A 1R8PA 2XG8A 4RUHA 5EDWA 2OTLS 3PO5A 1RHUB 2U1AA 1NDLA 4X4VA 1RT6B 2PN6A 3BF4A 4PG7A 2PMHA 2E1AA 1WF1A 2DGWA 3DU5A 3HVTA 1TKXB 2DK2A 1LXNA 1NU4A 2DR9A 2Z2MA 4A8XA 2ROPA 4JOUA 3LA0A 1ZETA 4LBIA 1TL5A 1RABB 1Y11A 2M7SA 3PRBA 3IN5A 1CG2A 3D1OA 3GCXP 2K8GA 1BQMA 2D1CA 2MTLA 1JLEB 3JTNA 3MAHA 4OX9F 4DN9A 4ES1A 1X4DA 2JLEA 4DR3F 1WG1A 1LWCB 1N34F 3TWZA 1TELA 2OEJA 1NPPA 4ANCA 1PBUA 3HHLA 1RT1A 5CZXA 3W9HA 5A8WB 1U25A 1WTBA 3N01A 1TKZB 3FEXB 2ZE2A 3R5JB 2Y9HA 3CCES 1HBUA 4LQ9A 1A6LA 1O0PA 4DX6A 2DRBA 5LXRA 1T02A 3PRVA 5SZTA 5J2NB 2Q1LA 2W9CB 1KRPA 1S77D 3QJJA 4O3SA 3D6HB 1PC5A 2C3YA 1KLMA 1H7WA 1MLAA 2MMYA 2Y0SD 5C42B 1NJIT 1HNWF 1D9DA 1UEVA 1A0OB 1JLBA 1MN9A 3ZZYA 2HYIB 3CD0A 1VC6A 5L9NA 1NO8A 2KKHA 5FDLA 4CLYA 1PCAA 3GIIA 3BH7B 4CTAA 2ASDA 3UE2A 1HI8A 2YPYA 2KI2A 3BGRB 4IFVA 4YB7A 3Q8PB 3ILLA 4WTOB 2FUG9 2HZAA 5DQGA 3TNVA 3C15A 4OYOA 3CCWA 1UFLA 1KQFB 1JJCB 1SVDA 3R3TA 2RIJA 4J9QA 4KY3A 4A8YA 4DFMA 4DSLA 3DM2B 4ZIVA 4XDCA 4FF2A 3W1YC 3EGWB 4E0DA 1RA6A 3H90A 1VJWA 4LMZA 1CULB 2CPHA 2HQCA 3MCNA 5EWFA 3R1HA 4UZBA 1V5IB 3BV8A 1X4AA 4LVOP 5KT5A 3N6NA 2VICA 1S9GB 4RNNA 2F1FA 3GJSB 2W2QP 4LFCF 2HS3A 2M5YA 3AOAA 4TLQA 3VAMA 1K0TA 1NZAA 2IDLA 3M6VA 3TJ9A 4M1KA 1CJVB 1Q5VA 1NH7A 3D66A 3ISND 4MKVA 2B8PA 4OJHA 2CXEA 2IAJA 3FQKA 1TVRA 2E5IA 1EQMA 2MHNA 4DV0F 1WKJA 3OFEA 5DZ6A 1KDNA 3R27A 5ETMA 5EX3A 4I69A 4RW9B 2DEIA 3M2RA 4RU2A 1FRJA 2FJBB 2C2RA 2BKOA 3QAEA 2F4FA 1QJHA 4CYUA 1S10A 4TNOA 1LQ9A 3LUYA 4WXWA 4CLZA 1FKOA 2VKRA 4M5JA 4FN5A 1RWUA 2NPIA 4RJVA 5THWA 4CLFA 3IRXA 2KM8C 4AL5A 4LFBJ 2RHQB 1RGVA 3IXQA 4X64F 4CLPA 3HSJA 4MIWA 4DPUA 3IMQJ 3PEHA 4WFAQ 4ECWA 1S0MA 3PRDA 3KMSA 1J27A 4IFYB 4AQYF 3P45B 3Q89A 3UDEA 3NS5A 3TAMA 3WDOA 2WB4A 1SPBP 2W24A 4LFAJ 3UFCX 1WKKA 1HL6A 1ZS6A 4DV1J 1OQ6A 2LDYA 4PXDA 5IOLA 4QU6A 1RWMB 2V68A 3OLBA 5MLCV 3CC2S 1H2UX 3P96A 4X65J 4A47A 1QUVA 3JTPA 3JXOA 4GRSA 2DNPA 1U1LA 5DQHA 4CH1A 2DNYA 3MR3A 2X3DA 1T3NA 4FYDA 2EBGA 1QM9A 1TQLA 5D0GA 1NNDA 2IY5B 1HNZJ 3T5LA 1WC3A 3M1VB 1SJQA 5ETPA 1N5VA 5A76A 1FEEA 2F3JA 1C1CA 2QV6A 1IKXB 1I3OB 2DHHA 4OZLA 5ETNA 2R2RA 2BANB 4WFZA 5KFAA 4NA2A 1S1WB 5BJRA 2W2OP 1RWNB 2IA6A 2RQ4A 2E5LJ 1RYSA 1PJ6A 2XSJB 5J1EB 4DV6J 1FRMA 2QSWA 2JX2A 1IBKF 3UD4P 1KNZA 3NAIA 4LRCA 1DY3A 2O66A 4KPCA 2IJFA 3EXCX 2PE8A 3SSRA 4YFUA 4OI1A 3NGRA 2GO8A 3K59A 3HSDA 3ETMA 4USTA 2R7QA 3GQCA 2FJWA 4B3MF 1P9QC 3TQEA 1RAAB 3QYYA 5DETA 1REVA 3J81U 4Q5VA 2W9BA 3TUIC 3PVXA 4DR4J 3ZTPA 5LJ3Y 3BR9A 4TXSA 4Y00A 2O67A 2VKZG 1KFSA 2HQDA 5HO4A 1XQIA 1IBLF 4PRFA 1JJHA 2N3OA 2LQ8A 1KTVA 3GSIA 4BCAA 3ENWA 5HQMA 5K8NA 3QBCA 1YJ9S 4ZVGA 1VRTB 1YGYA 1ZM4A 4B9MA 1U24A 3W2VA 2J7KA 3MZIA 4QWBA 5K8OA 3DOLB 2OPPB 3E01A 4C2MA 1VIXA 1XMQJ 1HD0A 1BC6A 1Y5LB 3H5YA 4M5HA 2K7JA 3LPEA 3FQLA 1F9HA 4XIUA 5T14A 1C1CB 5L8RC 5C2GA 4DSKA 2R9LA 2HHWA 3D1HA 3MEGA 3CGIA 3MMBA 4NI2B 4DV7F 1KEKA 2CWXA 3R8YA 1S1WA 4B9UA 1EJ7L 3PR4A 2IJNA 1RAIB 2HHVA 2UXDF 4ENOA 1RT3A 1S9EA 3HDSA 3LH2S 4UUXA 3GV8B 1EKSA 4Y2KA 3EGVA 3ILOA 2R8GA 4FXWA 3M8SA 1YHQS 3KHLA 3AD9C 5A2QU 3GV5B 1SKUB 5HP1B 3OFFA 4DQIA 1Y0HA 1PAUB 2DRDA 4ERDA 2CYYA 2R7OA 4QPXA 1U1QA 3DXBA 4EU0A 2PI5A 1VS3A 2AGOA 3WC2A 3MMCA 1U1OA 2MXYA 2C3MA 3MEKA 4DQPA 4FXDA 2D3ZA 2ACYA 2XHCA 3V6KA 1HQUA 4IKAA 2OP5A 3LOUA 3TX8A 3G8SA 1W7WA 1C4CA 2RRBA 4MH8A 5HJYA 3TZZA 3LWMA 1LW0B 2LXFA 1M5HA 4FVCA 4WTYA 3Q23A 2JEFA 3J80Y 2D3OR 3ZZOA 2G2ZA 2BABA 4OYIA 2AF6A 2RUSA 5JVHQ 3TZYA 1LOUA 2LFVA 2XM3A 2C2EA 3ENAA 2FC8A 1IR0A 3DGPA 2F8EX 1MU2B 2GIRA 4USUA 3D7SB 4NRUA 1VC5A 2LQBA 4AT1B 2QFJA 1U1PA 1SQFA 2GV1A 4OZ0A 5K5MA 1SUQB 4C8LA 3RZAA 3W65A 1JLBB 2QG9B 2V8GA 3QGIA 1NB2A 1RKIA 2MZTA 4ECVA 2XQCA 2L9NA 2XBPA 1VHFA 1WHYA 3KJNB 3ZXWA 4UZCA 1HKAA 4EO6A 4J9OA 1S59A 2GHVC 2X1BA 3H5SA 5B0AA 4JI5J 2VPWB 4ZLNA 4NMXA 1FJGJ 1BUXA 2I1RA 3PFEA 2I9SA 4ZMMA 5L38A 5LXYA 1JJ4A 4PWDA 4J91A 3V4MA 2HSEB 5AXMA 1N56A 2UVWA 1JXEA 3MURP 3AOBA 2QN6B 3B82A 3TO8A 3RJMB 3M05A 2R7TA 2R8IA 3CJ5A 3ILJA 4F0MA 4R5PA 2F4VF 2GIQA 7FDRA 3MR6A 5IC6B 1IBMF 5B0BA 1YKWA 2N7YA 3WIVA 4JI8F 2AW0A 2QLFB 4OV6A 2E5JA 4TQRA 4DSIA 1B7FA 3PW7A 1W25A 2IRUA 4DHVA 4KBIA 2JSXA 1FWKA 1RAFB 2ABYA 2DHAA 2XYHB 4MK7A 5KFLA 4DX8H 4Z7CA 3KK1B 3JSMA 1FJ7A 5FIIA 2HFSA 1GX6A 4ICLB 3SFGA 1R8AA 4EBEA 2CQDA 2G2OA 2L9DA 3NCPA 2KVQE 4V1Ak 3SMZA 2HLUA 2I5JB 3D3BJ 4Y0FA 3KLHA 1SUQA 2HURA 2Y3YA 2HGNA 2ASYA 4HT7A 2QTWA 2NPFA 3CD5A 3HHEA 1D1UA 1UAWA 1VBKA 4K5RA 2GC8A 2XCPA 1QSLA 5DLFA 4JI2J 3HT3A 4NA3A 4JI6F 4WIIA 1MWZA 2VQFJ 3SI8A 2DR5A 3G8TA 4OFZA 3PV8A 3AA9A 4PWDB 2YH1A 4OX6A 2E1MC 2ZBCA 4WP9A 3G96A 2V4QA 3FFIA 4NWBA 1UW9A 5ETTA 1S6UA 4NCAA 2W7PA 2FLOA 2CA9A 3LP1A 1DARA 2DCUB 4MMOA 4U7UK 4A8QA 1NK8A 2FVPA 1RHJB 1VDHA 1ZM2A 2DBBA 2OD6A 3GR1A 2FZCB 4X65F 4OZNA 3BPDA 1JLGB 1HNIA 4RWXA 4DR3J 4TU9A 4DDFA 2UVRA 5HJXA 4ETXA 1TAUA 4ZPCA 1NDCA 3D54A 3SYZA 5LJ5Y 1Q78A 5KT4A 1J5EF 2Y1JA 3P5TL 2RKIB 1NSAA 1KQGB 1L5UA 3OR2B 4MFBB 2DRAA 5B7WA 1NSPA 3JTOA 3PX0A 3CB4A 2QLWA 3FRYA 2VQEJ 1O51A 3A3OB 3BO3A 3PHTA 4CT8A 1ITPA 2IPOB 2PSZA 3E8OA 4ID8A 3Q22A 2FJEB 2HAFA 2HKEA 3F0NA 4DEZA 5J2MA 3A3PB 3CJRA 4AXIA 3O44A 4L76A 4D3GA 1NK6A 2DR8A 4TY9A 5T7LB 2KG0A 3RBDA 3PJXA 2HNYB 3K5PA 4ZHRA 2MY7A 3BREA 4KV8B 3I5AA 4QIGA 5F0UA 2BR0A 5MAOA 2KZMA 1FF2A 4RNMA 2A1BA 3TR5A 1Q79A 3OUYB 3CW2C 1VR6A 4MT1A 4FNHA 3RU0A 1FDAA 3ZTRA 2JHEA 5KAKA 3CTRA 2C42A 3JQMA 4I68A 4KJIA 1LWFB 3OW2R 2VFRA 1BWEA 2E44A 3MCOA 2NSBA 1TUWA 2I2YA 4OI4A 1JLQB 4G65A 2A3JA 4PG6A 4USKA 4F36A 2ZKUA 1EX8A 3R7NB 4K4WA 2H65B 3CEDA 4B3OA 2ZJRQ 4NA1A 4A8SA 2VV5A 1H7XA 2HFNA 1HBNB 2CG4A 4P52A 3AD7C 1CEZA 3Q8UA 5LMUJ 2Y1LB 1AZSB 4Y34A 5GMDA 2XO6A 1BHNA 1T05B 1C4AA 1N5SA 3PR5B 1Q95G 4ECZA 2DXEA 5LSRA 2CZ9A 1FDDA 1HNXJ 2Z2ZA 3A1YG 4DCPB 3KK2A 1NEEA 2HNDB 2LQ5A 4DR2J 1RU2A 2V69A 2DJWA 4YB6A 3BKFA 2AIRB 2D9PA 2F8HA 1X4BA 2F4VJ 2APOA 3I82A 4GC7A 3ENVA 4MKBA 1TKTA 3UQSA 2GJ2A 1QDUB 2XHWA 3IO1A 4UOHA 2EFPA 3KK1A 3CCJS 4CLLA 4NLVA 4KSEB 4YUDA 4LQ3A 2EC2A 2R42A 3KDOA 1RP5A 3EVOA 4KGMA 3ZZRA 4OYXA 4YEAA 5AJ3F 3KLIB 4QQBA 5L39A 1N5TA 2W4PA 1KLMB 3HF5A 4X4OA 3CMAS 4C0OC 2HFOA 1RK8A 2KVIA 1JLQA 3NOGA 4IOCQ 4KB7A 1YJRA 3CMQA 3GR0A 3U27A 3PJWA 2P6SA 4B3OB 4O44A 2JNJA 3WZ0A 4J9KA 4TY8A 3UVJB 3UNYA 4ATNA 3QIPB 3EPIA 1YX2A 4DUZF 2UXBF 4FVMA 2E5HA 1YLXA 2OLWA 4NXNF 1IJFB 3M6UA 4NEYA 3HHKA 4J9SA 4W92B 3SFUA 4A8MP 3U1NA 3ETOA 3D0GE 2FJXA 2XMAA 1HARA 2QMUB 5KFQA 3BBBA 1X5TA 3MEEA 3NGTA 2FJVA 2Z2LA 1XMOJ 2DHSA 4MIBA 3R5BA 2AD9A 1GMUA 2L48A 3D4JA 2YX1A 4FNIA 2ZVSA 3QJLA 3BKTA 4B9NA 3C16A 3VCDA 5LMNJ 2R3VA 1TKTB 3V6HA 1S0NA 2R7SA 1T8EA 3MOZA 3DGPB 3RTVA 3CJ0A 1S57A 1REGX 1JLAB 1VK3A 4DJBA 2RKIA 1MN7A 3GLJA 2V67A 2ZBPA 3KK3B 3O6QA 1H98A 1N33F 2VBWA 1KS2A 4QR0A 4C8OA 4WFBQ 1JLEA 1UWAA 1SBRA 1ZOTA 3NG8A 1XR6A 5ETSA 3I6PA 5CH7B 4ZCLA 1HYSA 2LQJA 4L74A 2AYEA 2DNZA 1KHWA 3FDSA 1WHXA 4ZHRB 2AYBA 3G71S 3HHLB 2BV3A 3EICA 4QIWD 1R43A 3GPAA 4GVBB 4QIVA 1R8HA 3W63A 2Z0GA 5LSLA 2FC9A 4DR1F 5KG5A 2PD1A 2OPPA 2HHUA 1XR7A 3V6DA 1KQSR 3U1LA 1XK8A 2IM2A 4LF9J 4HH0A 1S76D 2UV8G 3NMRA 3DCAA 1TUVA 3DLJA 3HHLC 3PY8A 3R2CJ 2QA4G 4YR0A 4ELVA 5H1SV 4DSEA 4ES3A 3W60A 3OJUA 4NLTA 4RU9A 1E6VA 4O0IA 4RPFA 1GK8A 4HT5A 3JSMB 2V4RA 3T5JA 3RB6A 4EFAC 4N5SA 2FPHX 4ICLA 3BR8A 4F26A 4G3IA 4A8KA 1OY8A 4ZP7A 2CNLB 3IC1A 5EWGA 3LW5C 4IH5A 3W9JA 1DBDA 4RW8B 3FUYA 4JI8J 4OI6A 1DTTA 1TL1B 3UD5A 3MHYA 2J9DA 5D8HB 1FRKA 2HPUA 3IWXA 1LWXA 3GG0A 3BQ2A 1O8BA 3HSGA 5JXSA 1EAYC 4CP5A 4DLGA 1RYRA 1Y4ZB 4DR6J 3Q8VA 4K4TA 5DDRC 2Z8QA 3I0RB 5G4DA 4RZRA 3GMGA 3VV2B 1HWIA 1B99A 1SL0A 1VIOA 3S7RA 2W01A 3D67A 4QOTA 3DRRB 4OJ1A 1L3SA 1B0PA 4JI4J 1UA1A 1FT8A 3PYDA 3TOQA 3GIRA 2Y1IA 1H38A 4J9UE 1IKVA 1V9OA 5F3ZA 1VJQA 2L3MA 4EBDA 1GMWD 4HKQA 4FBUA 1U26A 1WI8A 2DNHA 4LIRA 3VVTA 1WORA 4K59A 4K50A 3M2UB 5DDPC 1RSCA 1U1NA 2YWGA 1I94F 3L7PA 4FPIA 2YBVA 1FE0A 1X0PA 5CD4H 2IAJB 3MD1A 1RT2A 5F8LA 1PGZA 1WC1A 1X5SA 4X84A 1U2RA 4AYBD 2BDPA 4LF4J 2AEMA 2ZNZA 4I0WA 2LXIA 4WF9Q 4RW8A 5DG8A 2DPIA 1GTHA 3IG1B 2CKWA 1G2EA 2DGSA 5C24B 1R6VA 2RQMA 2VFTA 2BJ8A 2CZVC 1MNEA 4H4MA 3OHBA 2YKNA 3V81A 2CJ9A 2ZC4A 4KV8A 2F40A 2C28A 1RCOB 5D0RA 1WF0A 3ADAC 3DDIA 5I42A 1ZZFA 3QGPA 4KH0B 1I5OB 2V4JA 3GJQB 2XY6A 3I31A 2CJQA 2C2ZB 4NXNJ 1T0TV 1RT3B 2DGQA 2GW8A 3BH6B 3JQKA 3KJFB 2FDNA 2NXEA 4EWTA 4LF8F 1N8RT 4RKUC 3RW6A 1D9AA 2IBOA 5HMYA 3HFKA 2HBQB 4PPZA 3HVRA 1RBLA 3RRHA 5ADZA 3QZ8A 4DL2A 4QWAA 4P72A 1WD6A 2KJVA 4NLWA 4DV3F 3OV7A 3DOMB 1BLUA 4YHHJ 4DV0J 2ZVIA 3RRGA 2KFZA 3Q0AA 2K1RB 5A0YB 4KYZA 1Z2ZA 2E7VA 4IQMA 2VBXA 1RTHB 2YPZA 2DIVA 2ROEA 4OX8A 2KB2A 4WFYA 2AZ3A 3M32A 3J7Z5 1OS5A 2GJFA 4OX7A 4RBUA 4DV4F 5ITHA 3PX6A 1AFJA 2IHR1 5I3UB 4RL1A 1Q4RA 3GJRB 4LSLA 1N54B 5CYQB 2HBZB 2VBYA 3C6TA 4U7UD 3J7AN 4NLOA 2JEGA 4AE5A 3W8GA 2MQMA 2V34A 3TEGA 2CPXA 1U6ZA 3WX8A 4F3MA 1VQLS 5KFNA 1WC4A 2YTCA 5CHCB 1FDBA 2OHDA 1KD1T 2UP1A 3EX7B 2XWYA 5F8IA 3FBCA 1ICEB 3MEDA 4RUBA 4DV4J 2CQCA 3MM8A 4ID5B 3ICLA 3KFWX 1FWLA 2UUWA 4L73A 1KQKA 4WKYA 1FJGF 5FJ4A 2C1EB 1EETB 2VG6B 3MMJA 4QYRA 3H98A 4ZVTB 1FD8A 5GAHI 5F9LA 4U67Q 1FKPA 4NMLA 3MOJB 5L1JA 2MKYA 1V3ZA 2OTJS 4LF9F 2H5IB 1T94A 1W2IA 2B4UA 4DU7A 2UXCF 1FA0A 1ZM3A 2A2DA 4O3RA 3UVJA 4QPTA 2J0WA 5DDOC 2G1HA 3OL8A 3Q2TC 2OMLA 3H5UA 5CYMA 1UMJA 3UDVA 5HROA 3IRWP 8AT1B 3W2VB 2CQGA 2VBZA 2J0XA 2XEXA 1NCLA 3BB5A 4CO4A 1N52B 2MQNA 3EDRB 4ZP6A 3RG6A 5J2MB 4H4OB 3G4SS 1FNXH 2LA4A 2CQ4A 1RHQB 4DMZA 2HBYB 3KLFB 4K5SA 2GQQA 3C66A 1YQHA 3I0SB 3KLGA 1L3TA 2E9RX 4ANDA 1FK9A 2WZ1A 3PW4A 1D3WA 1UJ5A 3MM9A 1K73T 3MEGB 4WWSA 1HQEA 1S6QA 3AODA 3CIMA 3GG1A 4NZ7A 3M9NB 3LAKA 4LF6J 5CXTA 2XI2A 3MR7A 1GXTA 2VOOA 4AUKA 1U8WA 1WDTA 5IXUA 3OPKA 2QA4S 4TKTA 4PABA 3CSKA 2JEIA 2LMIA 2OSRA 2XMUA 3R7BB 3FMBA 1S12A 2E7WA 3KG4A 3JSBA 5F41A 1DFDA 4B3TJ 1LK7A 2VG6A 4FKYA 4P2XA 5A8KA 5KFBA 1TL3A 1RT7B 3FCHA 3UWTA 4OYMA 2AKWB 1QSSA 4F3QA 2DH8A 4LFBF 3L4BC 3I55S 3PTWA 2R4FA 1AZSA 1RAJA 2JJ4D 2VF3A 4LRAA 4OYAA 4M5DA 1U0HA 3H59A 3ZZ0A 2HVEA 3D28A 1V5VA 5ETQA 3VTIA 1RT4A 1I1GA 1NHVA 1YITS 3HP6A 2XYPB 3SCKE 1RKJA 4GVLA 2MHEA 3T5KA 1YI2S 3RUBL 1GMVA 3UI3A 3CE8A 1GX5A 2YWEA 3MECA 3UDCA 4QCLA 4KAIA 2HQ3A 2MJUA 1MWQA 2AT1B 2VFUA 5U47A 3K5NA 2ZJQQ 4JI7J 1VCTA 3ULHA 1F3FA 3OXGA 1VQ8S 1VK8A 4I6AA 3DRYA 2PMZD 3K7RA 2CQHA 3THTA 4DU8A 3EGZA 2V63A 1WC0A 1PYTA 4KKOB 2EW9A 4LF1A 4ZVSB 2OAUA 4ZP8A 5A0YA 5KFIA 2F65A 1CJVA 2IRXA 5GMKa 3BGLA 4JUZA 2XY7A 2KFNA 1YRTA 3M8QA 4U8VA 5F8HA 1EHWA 2UUAF 1TVRB 2GCFA 2Q6CA 3QLHB 5KFOA 1FXLA 4DWIA 3CD7A 3PYGA 2NXJA 2WONA 3C19A 3K5LA 1S72S 1SH3A 1IKYA 3KUGA 4O23A 5I3UA 2J8AA 1M1GA 3H2UB 5IM0A 4F8RA 3IRXB 4OIXA 4USWA 5B0DA 3AB2B 4ZITA 2FHJA 4AL7A 3RB0A 2BJ7A 3W62A 2RDDA 2GVZA 4KO0A 4PQAA 4YDXA 3M30B 1E6YB 2BE7D 2XMMA 2UUBF 4J9VA 1RA7A 3VAGA 1M90T 1AUSL 5KFMA 4CNYA 3I56S 1IUJA 3CDUA 2WRMA 3MXHP 2IVYA 3MEDB 3QWUA 2YX7A 1Q7LB 4OHVA 1IN0A 2YH0A 2XYGB 4BWMA 6FD1A 5J2PA 3RBEA 2J0QD 4OI2A 5M2RA 3EE3A 3TVZA 1LWFA 3CCSS 3VR1A 1HHTP 1IM4A 2V8DA 1ZA2B 3CWJA 2ZH9A 4CO1A 1VYAA 3R97A 1YJWS 4IR9A 3DLEB 5DM6Q 1IKWB 4G1QB 1JLAA 4UT4A 2HEKA 1CBKA 4AXJA 3VAKA 3WBZA 4N7TA 2YWFA 3RBXA 4KFBB 1ZYQA 2CVIA 2CQ3A 3QSIA 1SQEA 2ZC3A 2AWZA 4PYDA 3JAMU 1X7VA 1AYEA 2FVQA 3QLHA 2ZM6F 5KFYA 3BO2A 5DG9A 1LWEA 2W25A 1LK5A 1RACB 2XLJA 1Q1KA 2BYCA 1G3OA 2W8KA 1O5JA 3DU6A 3IG1A 1K8AT 3ZNUA 3U7JA 2SXLA 2R7XA 2VQFF 4I2PB 3W5XA 4C3LA 3TUPA 4JV1A 4JI2F 2J8SA 3MM7B 4X4SA 4DUTA 4ZDNA 4GKKF 2XZDB 2DHXA 4LVNP 2K2PA 3MPWA 4DV5F 1VQSA 3HO1A 2DNQA 2ZZTA 4CM0A 2EC0A 2IVFB 4YY3J 2GO9A 3V6DB 1ZAWA 2BJEA 2IMOA 2WVEA 1UCNA 2XSFA 3D0IE 3R6GB 4RW4A 3S01A 3ZZUA 3T5HA 1U1KA 1TKXA 2IFXA 4TLRA 3WX4A 3UN5A 2OELA 2B7CB 4FS1A 1E6VB 3H7HB 3O3LA 5KFEA 2KXHA 3QATA 3NGSA 5GAHU 3H2LA 3PJ9A 4ZVRB 4Q2LA 1M5OC 2A2CA 4DL7A 3ELHA 1HR0F 1R0CB 2B43A 4DUYJ 1EIYB 2NZCA 4IOAQ 4JP8A 4WKRA 4DL4A 1HWJA 3QZ7A 3QNWB 1UVJA 1P9YA 1TKZA 3HJFA 1IJEB 2ZZNA 3MMBB 2PC6A 3LAMA 2LCWA 2G2YA 1GNKA 1FTRA 2G1DA 3SEOA 4B9SA 2F7VA 1U6FA 2CNKB 2YY3A 2VG7B 1S1VA 3L7OA 4O3OA 4RWWA 4ZK7M 2JZ5A 1U02A 2CQ2A 2DY9A 2YNFA 5B08A 2DXFA 2WSFC 3ZNJ1 1QLNA 2YKAA 2XMWA 3CJQA 4C98A 5HVHA 4ECRA 1Q82T 1KVJA 3GCWP 4DPOA 1QAIA 2DXDA 2NQPA 3BN4A 4O0NA 2EKNA 2MQPA 2HZCA 1S49A 1PSDA 2WW4A 3I5BA 2MGZA 1BQNB 4CO0A 5HVGA 1Y3JA 3JS9A 1HI1A 1RAHB 1WTFA 2GQCA 1XNRF 3BGFA 1GQEA 2KG1A 2LVWA 3DRSB 5FLXY 1YIJS 1U48A 1GMWA 1S7IA 2FZGB 1GXLA 2F9DA 1G1XA 4IG3B 4YMEA 5GAEU 5JUMA 4N8NA 4PG8A 5LMNF 1SCJB 2O5DA 1YBTA 3MMCB 3AXMA 5E3QA 5CCLA 5RUBA 2OKQA 1ZH5A 3PW5A 3CULA 1IKXA 1JKHA 2WVCA 4USVA 2V9KA 4LSZB 1TL7B 1JLFA 5GADI 1FFSB 1HMVB 2B6AB 2ALZA 1S4EA 4ZVQB 3MPYA 1MMNA 2EEYA 2H5EA 3T19A 3G6ES 3QT6A 3Q8YA 3W7BA 1OSDA 4DR5F 4C8KA 4JI1F 5J2PB 4LF4F 5D4PA 1F60B 1WG5A 3OBIA 1OMSA 3IS9A 4DSJA 3OXFA 2RDIA 1R6YA 4NASA 5HSPA 5I42B 1Q8BA 2G0IA 5CABA 3G6VA 2OIHA 1DQ8A 1IVZA 3OL7A 2W9BB 1X4HA 2E5GA 3ET6A 5HK4A 2LP4A 4NLSA 3CJTA 5IS2A 3T1YJ 3N79A 4NX9A 2CUYA 2OH2A 4B9TA 3HULA 1N33J 1MWYA 1Q16B 3HFVA 5A8RA 5AJ3J 3C6UB 2M8HA 3CJSA 3K89A 4C11A 2V94A 4TVAB 2FGOA 5DGBA 3JYTB 2ILZA 2RDJA 2HQIA 1OYEA 4DL3A 4DF4A 5HMWA 1NUEA 3TYTA 3PW2A 2VD3A 5K20B 3AH6A 2HVIA 2LKZA 3MPUB 4F4YA 3PO4A 3MAQA 4LJMA 2FQQB 3CO9A 4LF7J 3KLEA 3VALA 2CJYB 1SJ1A 5E7OB 3HX9A 4A48A 2N3LA 3A3NB 5C25A 1CJTB 2FHOB 3CCQS 1EP4B 1UETA 2ZHOA 1OSCA 4AL6A 1RT5B 3H8YA 3UDLA 2JL9A 1CPZA 5K8MA 2KXNB 3RR7A 3GFHA 3OXLA 1YJVA 4MAKA 2AV5A 1C1BA 3T1AA 4XPCA 2N4DA 2ZM6J 1DJ0A 3L3CA 3EPGA 3GZ7A 1XNRJ 2OMOA 4ZCMA 1LW2A 1C0UB 3H4DA 1Y7PA 3BSOA 1UJ6A 4H4KC 5HP1A 3KHRA 1XNQF 1KP6A 1HWUA 2RJZA 4J7CA 4ZN1A 1XIQA 4C7QA 6FDRA 3BKUA 4DFJA 5IT9Y 5EWEA 4NLXA 3DHWC 2M88A 4KKOA 4B08A 4DV2J 1N6QB 2AJ1A 2X3GA 2KT5A 4F3OA 4YOEA 1S6PB 1VISA 2QA1A 1FDNA 4NRTA 3C6UA 3EJMA 4RW6B 2V8HA 4NCGB 2IYIA 4OHWA 5ETVA 5L1LA 4AD6A 3N5BA 4X66F 1VBYA 4DR1J 1WNEA 2MQ8A 1PBAA 4YB5A 2HVHA 5DDQC 4TY8B 1NPKA 3PYFA 2NLWA 3RRKA 2VG7A 2XMVA 1YTYA 3QO9B 5C5JA 1NJWA 4C4WA 2KT3A 1RDRA 1HBMA 2JEJA 4ZJOA 4DUYF 1RCXB 4A8FA 1QVFR 1F2HA 2XMJA 4RNHA 5HI7A 5CD4A 1U49A 2LLZA 1WC6A 4J9PA 4DPXA 2P5VA 3R5AA 3GU0A 5HAOA 1RBAA 2ZOGA 3SDEB 3K2YA 4CH7A 5C7PA 3T6BA 5D3GA 4H4KA 3MR5A 2E9ZA 2QJ3A 3CJ4A 1SIZA 3B54A 1FXDA 2GAHC 4NLPA 4LSNB 4QIFA 2DT9A 1Y9OA 4J90A 4DCOB 2EXUA 3HVWA 4URQU 2Q79A 5E3AA 2CPYA 3HVAA 4DX5A 4WCEQ 1D0EA 1REVB 2AEFA 1U2CA 2B4PA 1CQNA 2FTRA 4F50A 4FBTA 3PHEA 2NUHA 3WC0A 5KT2A 4EYHB 1U47A 4DR6F 2MKSA 1WUUA 4KGZB 4CDIA 4M5KA 3FVYA 2OUGA 4RW6A 3R6LB 3O8WA 2DB1A 5KFGA 1BQMB 4UOGA 1AW0A 2XI3A 3NBPB 4LREA 4NI2A 4NLDA 1TUGB 3H2VE 1FXRA 2GGPA 1HNVA 3RW7A 2GX8A 2R7UA 1NHUA 3A8EA 2MDAA 2HRYA 3B4MA 3VZIA 4DR5J 1WOSA 1QAYA 1SL2A 2ATLA 4OHYA 4I6YA 1YVFA 1ELOA 2BRKA 4C97A 3DYAA 2P8IA 4X4PA 4QR1A 1S79A 3IBFB 3MPDA 4NLQA 3BGOP 4R0EA 3MAAA 3M8WA 2GNKA 1S1UA 1XR5A 1H72C 3M9OB 1EKRA 4KT0C 3HD1A 4DV2F 2RUGA 2XNQA 2JVRA 4CM2A 3MM8B 4ID5A 4ZPWR 1VLOA 5C42A 5D4NA 3NCRA 3OQ2A 4LSNA 3CO0P 3VHQA 1HWKA 4EUVA 2R2SA 4P2SA 4K4VA 2GVDB 4C48A 1FKPB 4I67A 3FSYA 1YSJA 2HG4A 2UVUA 2R8HA 2KL8A 2MYFA 2HGMA 1SKSA 1JXVA 3A13A 2AZ1A 5KFVA 3TA2A 4CO5A 2RU9A 2ZITA 2XWXA 3AJ1A 1R0AB 4ZLPA 3ITHA 5KG4A 3L09A 3PIPQ 1FTCA 2V50A 4F02A 3ZZPA 4MKAA 3RAQA 3PCOB 1SC6A 2BRLA 4L3KA 3UO0A 4ZIWA 5GADU 3LP1B 5KFDA 2LECA 2C2DA 3Q24A 1NJXA 1RTDB 4RLEA 1MMDA 1FX2A 2KFYA 1HWLA 5HL7Q 2YNIB 2KDOA 4HACA 4QJVA 4TU7A 3OFHA 4W98A 4ZCKA 1TKDA 2EI5A 2IDEA 3OVSA 2H51B 2FY1A 2QC3A 4WK1A 3FRZA 2ZH8A 4DBQA 2MQOA 2EFQA 1S6QB 4PG4A 1IKWA 4G1QA 4M5MA 4YHHF 1GH8A 3M8PA 4Q45A 1VBXA 4Q8EA 1L3UA 1HR0J 4NXMJ 4Q8FA 2DGOA 5KOXA 1FKAF 3CC7S 4IH7A 5B0GA 1FESA 2XNRA 3M32B 4QYZK 1IWAA 1UW4A 2AJ2A 2J7UA 3GYXB 3HD2A 4XPEA 3K0JA 1NSKL 5KFHA 4DS4A 1VC0A 4EZ9A 2LU1A 1W26A 2HNYA 1B0VA 1RWWB 2OEKA 4I56A 2KHDA 4LSLB 4PWWA 2Z4PA 2K7KA 2DNNA 3CJKA 1PG5B 3DI6A 3QRPA 3DDKA 3POTA 4IDKA 2P9EA 3G87A 1Q0NA 5T41A 3D6FB 3H40A 4UF4A 3T1YF 1PKUA 2LEBA 2G13A 4GKKJ 3J80U 4W90B 2VC0A 4ED6A 4ZVEA 4RBVA 4YP3A 2ADBA 1X60A 1I51B 1QE1A 2KXFA 3KUEA 5F0WA 3UCGA 3QJPA 3W3SA 4DPTA 3L9ZA 1QUPA 4QU7A 1DURA 2AX1A 2WBMA 2QFIA 2BJ1A 2V2ZA 2IM1A 3HFZB 1RTJA 4PUOB 4ZP9A 5E0OA 4CTAB 2W7OA 4J9MA 1APSA 2WK4A 2NYHA 4Y6IA 2B4VA 3IAM9 1F5BA 2UZAA 4HH1A 3KKFA 1IQZA 1C0TB 1O6XA 2CVEA 3FK4A 2QA2A 3T9ZA 5KG7A 5H9EK 1U6BA 1S4FA 1WI6A 2X51A 2BBEA 2LA6A 3CJ3A 3R2DJ 2B9XA 2H5JB 4UQTA 1DZ5A 1B64A 1IR1A 1BE4A 1KONA 2MPUA 4HHJA 4PG5A 4ECSA 2CQIA 4U8YA 4ED4A 3KLFA 3TANA 2UUCF 4NYPA 3EZUA 4U9RA 1AUDA 2E7XA 2GMJA 4OL8A 1E6YA 4KIAA 2Z56B 1SB6A 2CPIA 4RW7A 2C2MB 3KDNA 2HLTA 2X1AA 1OWXA 2HHSA 1F9FA 1ULRA 4K4UA 1S97A 2IIHA 3OTDA 2B56A 3NNCA 2MZJA 1OO0B 2YWKA 4WIQA 3CCMS 1T03A 2OPQB 4X4QA 2JC0A 1I94J 1NDPA 2DNLA 3CDAA 2POKA 3AA8A 4M5IA 1YZ7A 3KUHA 2K06A 1TL1A 2GHWA 2GS8A 4M5DB 4Q7AA 5T7LA 2ROGA 3R5GA 2Z58B 2RSQA 4J9RA 2FLNA 4HHUA 2WW8A 5F8MA 5KFPA 1TL3B 2EVZA 1L3VA 5JVGQ 4JV2A 5JJBA 1SV5B 4K2JA 5I3PA 5K14B 5CAAA 4DSFA 4DPYA 4JI6J 3F41A 2VODA 4IRDA 2D69A 2BACA 1HW9A 3AQPA 3FMWA 4OQJA 5K8PA 4DQQA 4K4YA 2CQ0A 4HI1A 2V5HG 1S1XA 2XY5A 2HBRB 5KG6A 5A8WA 3LGHA 1TK8A 1JXLA 2G4BA 2J0SD 2LYVA 5I3QA 2ZUAA 4ANEA 3EUNA 4F25A 4RX6A 2CAJA 3GWCA 2CDRB 4N47A 3ZTQA 4Q43A 4C8NA 2R2UA 3UW1A 3GYNA 2Q6BA 2Y1RI 3HKWA 4ILMA 3C2PA 3SQGB 4K4SA 1HNXF 1WSRA 3SDEA 1FJCA 3AT1B 3I87A 1AT1B 1IBLJ 2B5JB 1WELA 1UWBB 4OYPA 3O2IA 2DR7A 3RB4A 2DNMA 4M5LA 3RGIA 4ECTA 2BOPA 4C0HA 2RMLA 3ET6B 3SQOP 3TUZC 3W61A 2AYMA 3TW0A 1VRUB 3FCVA 4HR2A 3NOCA 3KLEB 3Q8QB 4IO9Q 3QAUA 1YRUA 5GAGU 1S1TA 3LPYA 3N28A 3K8VA 1U45A 3CMES 1QD1A 3BQ1A 4LR8A 2M2BA 3TARA 4NLGA 5G0RA 1UPPA 2IVMA 2C3PA 5KT3A 1XEZA 5DO2A 3NNAA 2MLXA 3DLHA 4DG1A 4M8LA 2GGPB 4PXCA 5E5NA 4A8OA 2HW3A 4H4MB 1U1MA 2M0GB 2GVZB 1WEZA 4KO0B 4B3RJ 1FVQA 2YKMA 3G8QA 4NLRA 1Z4UA 2MLYA 5IV4A 3HPOA 3ENQA 4J9NA 2EWHA 3MMAB 5EHHA 4X4UA 2DVIA 2VHGA 3Q2SC 2WVBA 1P6TA 4GO7X 4OYBA 3GJTB 4ZA1A 2DCLA 3SQGA 4CT9A 2QO3A 3C14A 4ZVFA 5LM7E 2J9EA 2BE9B 1OIAA 3A4TA 3HHNB 1VFJA 2YNGB 1NM2A 2HGLA 4PYAA 4JI4F 4JBCA 3M6XA 1LWEB 4URGA 1H74A 5IT4A 3KYLA 4DL6A 3PKYA 1W2BR 3ZTOA 2AEJA 4BC7A 3DC2A 2H3EB 5L1KA 1HHSA 4AQYJ 5HATA 2VA3A 5HQ8A 1Y5NB 3LP2B 5KTQA 1ZZNA 4NCGA 2FLLA 4M63A 1NKEA 5CQGA 3OT9A 2JH3A 1EQ0A 3I0RA 2HHXA 2HNZA 4OLOA 3HZEA 4I2QA 7AT1B 1HBOB 3M8YA 4DR2F 2DNKA 3MEEB 1AROP 1S9EB 4Q44A 4DS5A 5CYQA 2KRBA 1VQKS 2VONA 4CLUA 5D3GB 3KHHA 2JDJA 1R8BA 2CNOB 1ZTTA 2WVDA 1RUSA 1WEYA 2ZJPQ 3A8JA 5HMZA 1URNA 3R5CA 5HVFA 5K9FA 1N5QA 1WOPA 4NOHA 1Z2LA 1T03B 2UUTA 4EO8A 1M5VC 1ZPWX 3PIOQ 2RRAA 5CA5A 3DDNA 2J76E 1HBNA 3Q8RB 1X9MA 1KKHA 4WE1A 3BN7A 3S6EA 4JI5F 3AFGA 4DR7J 3RAXA 3NS7B 2BE2A 1FO1A 2PO4A 3CCTA 3CCLS 3K8WA 4PCQA 3J7YU 1HQUB 3VZHA 1GEHA 2FD2A 3CDWA 3I9V9 3R5DA 5CYMB 4X4RA 5J1PA 2YQ3A 2H4WB 1XNQJ 2H9ZA 3IGNA 4KHPJ 4LF8J 1CQMA 1HNVB 4AFFA 1VGYA 4QW8A 3UR0A 2XC9A 4FF3A 3QT8A 2YKNB 2D74B 3DM2A 3GV7B 1JLCA 1F5CA 2QLJB 4MYTA 3W64A 2JLGA 1VQ4S 3I0SA 3F56A 3CJKB 4ILLA 2CPZA 2R7VA 5FD1A 3EYZA 5GMEA 2ALYB 1CJTA 3IM9A 2X1FA 3V6JA 1M1KT 2HNZB 2E9TA 1N36F 2HFZA 2DYAA 1SC4B 2Z2YB 3EZ5A 4P9SA 3SV3A 3P5BP 2ZH3A 2BXJA 2QGFB 2VG5B 3OL9A 3GFZA 3IR5B 4WXOA 4CH0S 4P6QA 2KT2A 1CJUA 1UZDA 1FE4A 3MTJA 4J37A 4LR7A 6AT1B 3PX4A 1RHRB 4DPWA 4EYIB 5DJBA 3DRXA 4RO0A 5HBMA 4B17A 3BYPA 4B9LA 1R0BG 5A8KB 3AQOA 4YY3F 4LF6F 1SJ3P 2BW2A 2HAIA 4F2RA 1P1TA 5B0FA 4ED3A 5AXNA 4OZ2A 1VHIA 5DQIA 1KWMA 4ED5A 1P27B 2CFXA 1BXNA 3D5MA 3GSDA 4ZOSA 2N7CA 2J9DE 2X7IA 3SXLA 4BLGA 4URSA 1SC1B 1UKUA 1VRQC 1U7LA 1RAOA 2ZEJA 3NGDA 4OJGA 2EFNA 3SSQA 5D78A 1Q8IA 2MEWA 2UXBJ 2DITA 4KGVB 3SIPB 4DV7J 1NK5A 1RB0A 3TQ1A 1QVGR 1K9MT 2PA3A 1B3TA 3AD8C 1R8CA 3DOKA 3F73A 4I1TA 5IWAF 2RNEA 1R7IA 1S0VA 1N32F 2DGTA 3QT7A 1NRKA 2E1PA 3RYLA 1V6HA 2KO1A 2LU2A 2F63A 3C14B 5E41A 1KTQA 4ITSA 2WAQD 4DR7F 4LFAF 2VQEF 1Y00A 2QRRA 1EETA 4QWEA 1CJUB 4NZ0A 2IM0A 4EGLA 1J5EJ 1YK9A 1HIYA 1RU1A 2YKOA 1UEKA 2DIUA 3UR3C 4ALZA 2DO0A 1Q5YA 4GKJF 3LF0A 5C2CA 1IBCB 3H25A 2FZKB 5KFRA 1RTIB 1SQGA 2GMLA 1TZ0A 2NSCA 2HK2A 4UW2A 1J2VA 2W4DA 1RISA 2HVZA 4DOZA 3GILA 4FDFA 5BYRA 1NK9A 5ETKA 1X4CA 3PXGa 4KPYA 2DEJA 4F4KA 3SV4A 2V4JB 3QT5A 3NBPA 1K1SA 2YQ0A 4KH1B 5KFFA 3Q83A 1T95A 2CPDA 2DISA 2AGQA 2IBKA 2DNRA 4K0KF 2IC3B 1N88A 2KHCA 2H1YA 2M52A 2Q3PA 4CQ1A 3M8RA 2E5LF 3H5XA 1JLGA 1L3KA 4R8UB 1QE1B 1RWOB 5KFWA 1TTHB 3D1QA 3LQVA 1B7YB 4OV1A 4BC9A 2WCXA 3PNIA 3IFEA 4FF4A 3VVUA 4ES2A 4DFPA 1WHWA 1RTJB 3FZBA 3QQCD 2E1CA 4PUOA 4G1PA 2VPYB 1KVIA 1QY7A 2V2QA 4CZCA 2KTQA 3KLIA 3NRBA 2Y8WA 4K7QA 3KHGA 1C0TA 1OY9A 3T3FA 1SH2A 2CZ4A 2FJDB 8ATCB 1VQ7S 1PO6A 1F6TA 2W2NP 3H4BA 4GO5X 3V5RA 2HS4A 4DLEA 4DQRA 3T1HJ 4USHA 2CRLA 2ZFHA 3D0HE 3IR7B 4FXVA 4KGKA 4L75A 4LBHA 3BBCA 3PEJA 3HLUA 1ACMB 1RTHA 3ONQA 3QIPA 2FYXA 1RTIA 2GHPA 4CNZA 4E2FB 2BMBA 3DLGB 2CDQA 5L9XA 2BW7A 1M5PC 4XTTA 4P7VA 2QEXS 4KC5A 3RB3A 3EVMA 1FKOB 5AXKA 4MKYA 4X4NA 1RQ0A 2D41A 5LL6d 1NK7A 1OQ3A 2C2OB 4X2BA 4ZKAA 1YBAA 4HACB 4UY85 2C2NA 1OPZA 3JSRA 2FVRA 4PQUA 4K0KJ 3M2UA 4ZPBA 1ZBTA 2ZDOA 4LRBA 4RUAA 1YJNS 3TRGA 1FERA 2BEFA 4CI0B 3UCUP 3NS6A 2VUGA 2AJFE 3ISNC 5B0EA 4NPOA 2BQ3A 4B3SJ 2AX0A 2CQPA 3C3LA 1IQTA 4TYAA 4OI3A 4ZVHA 2A6MA 3DRPA 2CPFA 2YWHA 3HI9A 1R31A 5IC4B 2KJWA 2RQKA 2XS5A 1MROB 2F5GA 2IRYA 4IRCA 2YXLA 4PEOA 1AB8A 4V19J 1NBEB 1XJWB 4NYZA 1CJKA 3KLVA 5DRKA 1T9UA 2EKYA 3EXYA 4WZMA 3LP2A 3J7A1 5AE3A 4HDGA 3DLGA 3DI6B 2ZH2A 5KG0A 3D9BA 3G6XA 2KH9A 1U4BA 1HQEB 2CNNB 1XMOF 4X62F 2NXCA 3OD2A 3FZ2A 4Y3CA 3OFGA 1XC9A 2HHPA 3FBEA 4M5GA 1Y3KA 3G6YA 3D2WA 1VQYA 1F5AA 1MW7A 2CJBA 2ZH7A 4I7FA 1VQOS 1DHMA 1HNIB 3EDQB 4N56A 2MZSA 2IYGA 4UUWA 5BYSA 1NKCA 1D9FA 3M9MB 4UQGA 4RW9A 3E2EA 2ASLA 5D4LA 1M5SA 2OPSA 4DX7A 3P3DA 2MJNA 1YRXA 1P8GA 1S1TB 3OVBA 2CIMA 4LF2A 1RTZA 3FJ2A 1RWPB 2RHSB 1EARA 1R0AA 2NR0A 3B4DA 4DN0A 4QIEA 1RHKB 3BSCA 2QL5B 5A2QY 3D6TB 1DTTB 4RR5A 2I6WA 5L46A 3NMAA 5D0EA 2CPEA 3DGVA 3P8BB 1FEHA 2LEAA 2XGPA 3KXDA 3X1LB 4ELUA 2ZWOA 3E01B 4JI3J 4QWCA 1DQAA 4PZVA 3DNCA 2VDIA 1DQ9A 4OHXA 1S48A 5EN1A 2OGUA 1HMVA 2B6AA 4P75A 2O3DA 3GE9A 3MMAA 3G9CA 1GTEA 2L41A 4RW4B 4P7TA 2Z57B 2ADCA 1NB7A 1SIWB 2KN4A 4P10A 4DV3J 1UZHA 1UVKA 3AJ2A 3MECB 1KN6A 3J81Y 1QSYA 4IG0B 3CPWR 5J2NA 2YNIA 2WB1D 1N34J 3DFEA 4IFYA 2Z30B 2H48B 4USMA 2Y8YA 2HRTA 2ZOFA 2YNGA 3EMTA 2UUAJ 2GA7A 2G9OA 4E8UA 4KHRA 3OLAA 4DV1F 2V8PA 1Y5IB 1IWGA 3L7UA 2XB2D 3HZGA 4CLWA 1HYSB 4RUCA 5GVQA 4ILRA 4F2SA 3CCZA 1B4SA 1PAEX 2WBRA 2OI2A 3G2XA 3THPA 4ECXA 2PMWA 1PIEA 1WDDA 4G6VB 2Y0BB 2ZD1A 5IWAJ 2QLBB 2QL9B 3QIDA 2PA8D 2C3UA 4ECUA 4DZDA 1D8ZA 2ZBIA 3QFWA 3DKDA 3CDBA 4YR3A 4WP8A 1PYOB 1S1VB 2LXUA 4O3PA 1VOMA 2VASA 2YX4A 3MM5B 3MM6A 3AAWB 1HLWA 4N77A 5D4OA 1UPMB 5D6GA 3KLGB 4QBUA 3TAQA 3CIZA 1FJEB 1TP7A 2P6TA 1C0UA 2I38A 1ROFA 2FJAB 5DZ7A 1CS4A 2W7AA 2WVFA 5SUHA 3W2WA 2CJKA 3X3UA 3UCZP 3TI0A 2ACMA 1C2PA 3R9LA 2B4OA 1FD2A 4YR2A 1GAOA 1N6QA 2PIIA 1FNMA 4OLPA 3MUVP 4FYWB 1YBUA 4P71A 1KLNA 2ZBRA 2HHHF 2RT3A 5IV3A 4HLBA 2FHJD 5IQ6A 4DF8A 2DKOB 2ZDPA 4C8ZA 2D3O1 3NY0A 3LWLA 5IT0A 1FFWB 4XO0A 3DOMA 4QWDA 2HRUA 3H0PA 3HVTB 3A12A 2FVCA 4O44B 3NEKA 5H9FJ 4U7CA 3ILIA 3KG0A 1KC8T 2AMCB 3W9IA 3M2VA 4TQSA 3J7ZT 3GIKA 4BS2A 2K3IA 2W2PP 4USIA 1N32J 3T6JA 1J5OB 5F8JA 4F7VA 2QLXA 2DH9A 1VI7A 3M8ZA 2BZ2A 2BM0A 1XMQF 2HMIA 1X9SA 2CWKA 3NGUA 2BJDA 3HJVA 2MSTA 4DQSA 2ZOMA 1AA1B 4U96A 4R5PB 4I2PA 4ZPAA 2W9CA 3LO3A 2VIHA 5J2QA 3QO9A 3KTQA 3NL0A 1AFIA 3MF5A 3LP0A 1YJUA 1XMBA 3BM7A 4KQZA 5IFMA 4I64A 3A8IA 4KHPF 1NMEB 4RW7B 4B3TF 2M8DB 5DGAA 4DI6A 5L1IA 2KRRA 2VDHA 4IOBA 4O3QA 2MQQA 1BWVA 1IXKA 1DAXA 2H54B 3HKZD 3M8QB 3KOAA 2DR6A 5KT6A 3ZZTA 2VJUA 1PJ5A 1NDKA 4X4TA 3ZC4A 1HNWJ 1UVMA 4P73A 4F4AA 4JI7F 2OPQA 1UA0A 4M95A 7FD1A 1UTAA 5HBMB 2VA2A 3QRQA 4QR2A 5IZHA 2PI4A 3JB9k 1VQ5S 1IKYB 3KK2B 1P1LA 2G0JA 2ASJA 5C24A 1BMQB 1LW0A 2V6AA 3ISZA 2QE5A 2IJRA 3H42A 4CRJA 2G0CA 2VU5A 1JNRB 2DY1A 1N4LA 2RB7A 3CD6S 4ZS6A 1FI4A 1J5OA 3KWMA 1RLDA 4Y2CA 4M5NA 1IBMJ 3VGTA 3R7SB 2DH7A 1RT5A 1UJ4A 2B7BB 2DNGA 1HI0P 2OJ3A 3D68A 1MSWD 1MU2A 1X5PA 2R7RA 1LV5A 1FFGB 3PG9A 4OHZA 1SC3B 4OJ3A 1BQNA 2VB6A 1CULA 1B0TA 2PFFB 2VFSA 4QW9A 1K44A 4ZCIA 2DTJA 4LF5J 3DRSA 1LXJA 4C9DA 5A6PA 3P6YC 1SKRA 1K47A 4TU8A 3JQJA 2W8LA 1PC4A 1JB0C 2JFKA 2DHGA 2CQ1A 1RADB 2RS8A 3OR2A 4MFBA 1HW8A 1VQ6S 1X4EA 4FP9A 2VL1A 1SJ4P 1RLCL 5I4MA 3IWNC 4K4ZA 4YDDB 3AOCA 3BDEA 4QYZJ 2GVDA 2YVSA 1R89A 3OSNA 1VRTA 3TP2A 4IG3A 1JMTA 4WU3A 2EG1A
chains in the Genus database with same CATH topology
4DV6J 2UXDJ 2KVQE 4V1Ak 3D3CJ 3D3BJ 4JI7J 4NEYA 1IBKJ 4X66J 5IWAJ 4DR6J 3T1HJ 3J81U 4DR4J 1XMOJ 4DR7J 4NXNJ 4JI2J 4DR5J 2VQFJ 5LMNJ 1I94J 1XNQJ 4K0KJ 4DV0J 4YHHJ 4KHPJ 4LF8J 1XMQJ 4KYZA 5IT9U 1N36J 4DR3J 4JYAJ 4HHUA 4JI6J 4DUZJ 2KL8A 4KY3A 2HHHJ 1N33J 1N32J 3J7AN 3W1YC 5AJ3J 4B3SJ 2VQEJ 4LFCJ 4X64J 4OX9J 4LF5J 5A2QU 5FLXU 4LF7J 4DV4J 4X62J 4LF9J 1IBLJ 4JI0J 3JAMU 3R2CJ 4JV5J 5BR8J 2ZM6J 1HR0J 1HNWJ 2MEWA 1XNRJ 2UXBJ 4NXMJ 2UU9J 4DV7J 4NEZA 4JI8J 4YY3J 3R2DJ 4DV5J 4RJVA 4DV2J 4PWWA 4LFBJ 5LMUJ 4B3RJ 3IMQJ 1IBMJ 4DR1J 1HNXJ 1J5EJ 2MQ8A 4LF6J 4LFAJ 4DR2J 4JI4J 4GKKJ 3J80U 4DV1J 4DUYJ 4JI5J 5LM7E 4JI3J 1FJGJ 2F4VJ 4X65J 4B3TJ 3OTOJ 4DV3J 4JI1J 1HNZJ 4AQYJ 1N34J 4LF4J 3T1YJ 4GKJJ 2UUAJ 2MTLA 2UUCJ 2UUBJ 2E5LJ 2UXCJ 4B3MJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 J;  2UXD J;  2KVQ E;  4V1A k;  3D3C J;  3D3B J;  4JI7 J;  4NEY A;  1IBK J;  4X66 J;  5IWA J;  4DR6 J;  3T1H J;  3J81 U;  4DR4 J;  1XMO J;  4DR7 J;  4NXN J;  4JI2 J;  4DR5 J;  2VQF J;  5LMN J;  1I94 J;  1XNQ J;  4K0K J;  4DV0 J;  4YHH J;  4KHP J;  4LF8 J;  1XMQ J;  4KYZ A;  5IT9 U;  1N36 J;  4DR3 J;  4JYA J;  4HHU A;  4JI6 J;  4DUZ J;  2KL8 A;  4KY3 A;  2HHH J;  1N33 J;  1N32 J;  3J7A N;  3W1Y C;  5AJ3 J;  4B3S J;  2VQE J;  4LFC J;  4X64 J;  4OX9 J;  4LF5 J;  5A2Q U;  5FLX U;  4LF7 J;  4DV4 J;  4X62 J;  4LF9 J;  1IBL J;  4JI0 J;  3JAM U;  3R2C J;  4JV5 J;  5BR8 J;  2ZM6 J;  1HR0 J;  1HNW J;  2MEW A;  1XNR J;  2UXB J;  4NXM J;  2UU9 J;  4DV7 J;  4NEZ A;  4JI8 J;  4YY3 J;  3R2D J;  4DV5 J;  4RJV A;  4DV2 J;  4PWW A;  4LFB J;  5LMU J;  4B3R J;  3IMQ J;  1IBM J;  4DR1 J;  1HNX J;  1J5E J;  2MQ8 A;  4LF6 J;  4LFA J;  4DR2 J;  4JI4 J;  4GKK J;  3J80 U;  4DV1 J;  4DUY J;  4JI5 J;  5LM7 E;  4JI3 J;  1FJG J;  2F4V J;  4X65 J;  4B3T J;  3OTO J;  4DV3 J;  4JI1 J;  1HNZ J;  4AQY J;  1N34 J;  4LF4 J;  3T1Y J;  4GKJ J;  2UUA J;  2MTL A;  2UUC J;  2UUB J;  2E5L J;  2UXC J;  4B3M J; 
#chains in the Genus database with same CATH topology
 2XTJ P;  1RJJ A;  3M6W A;  4ZPV R;  2YNH B;  1F9E B;  2RRN A;  3N5F A;  2JLF A;  4B3R F;  3GIJ A;  2VFV A;  1WEX A;  3BJY A;  3G82 A;  2XZW A;  4FYY B;  4X66 J;  2BKP A;  2FGC A;  2E29 A;  3I5C A;  3P4U B;  3DLB A;  1X4F A;  4MIA A;  2CAD A;  3DRR A;  4NL5 A;  2BA9 A;  3N9U C;  4RNO A;  1N5Y A;  2YKP A;  3N6M A;  1S7H A;  2QX0 A;  4JI0 F;  3VWS A;  3W66 A;  4F0H A;  4WFN Q;  3TJA A;  1G6B A;  1NJZ A;  5BYQ A;  3MFH A;  1FHT A;  3FEZ A;  2QYG A;  2RU3 A;  3KNA A;  2OEM A;  2XCA A;  3M8P B;  4EMD A;  1XTZ A;  1H2V Z;  4LRD A;  3M2V B;  5KFZ A;  1N36 J;  3UPF A;  4UOF A;  1M1H A;  1N0U A;  3BPS P;  2NRE A;  1R3N A;  5HRO B;  5HMX A;  3PYE A;  2A0F B;  2N82 B;  4JYA J;  1UVI A;  3DXS X;  4LIW A;  2D3U A;  2Q43 A;  3VQT A;  3OSP A;  4IR1 A;  3OTO F;  2W2M P;  2A18 A;  5J1E A;  1H73 A;  1U2F A;  2GIF A;  4O4R A;  1TV6 B;  1NZ8 A;  2NCK L;  2YNF B;  1RWX B;  4WFX A;  3TX0 A;  4EI2 A;  2XO7 A;  4PAA A;  1I6J A;  1S6O A;  2HHQ A;  5LMU F;  4ZJQ A;  1SXL A;  4WU2 A;  2J9C A;  2GZO A;  1NAQ A;  5KFJ A;  2MZ1 A;  2HFV A;  1K1Q A;  1YG0 A;  3I96 A;  3MWB A;  2ZUG A;  4XDD A;  3QMQ A;  4A46 A;  4B02 A;  3K58 A;  1DLO B;  4A8W A;  4HVZ A;  1UFK A;  4OYW A;  5HAN A;  2VJV A;  2EFO A;  3NXZ A;  1LW2 B;  4HYK A;  1DTQ A;  1TAQ A;  4NYO A;  4Q2M A;  3SCJ E;  4ED1 A;  2XS7 A;  3EM1 A;  4HTI A;  3NP5 A;  1YJ7 A;  2B9E A;  4J5O A;  4OZJ A;  4PKD B;  3VGS A;  2ERR A;  4MK9 A;  1ZPV A;  2ATC B;  2DGV A;  3DLE A;  4P2M A;  2FY8 A;  3US5 A;  4LT6 A;  3ZTS A;  5BR8 J;  3DLK A;  3KJV A;  3MUM P;  2RS2 A;  1XER A;  3KG1 A;  2WTF A;  4F4X A;  3I4H X;  5HLF B;  1S6P A;  4EK2 A;  2O1P A;  4WYW A;  1WKL A;  2BKN A;  2OD4 A;  4V19 X;  1YZ6 A;  1HBM B;  2PEH A;  3T9N A;  4LR9 A;  1T11 A;  4DV5 J;  4MK8 A;  1X8D A;  3MI7 X;  4ELT A;  2VG5 A;  4G1I A;  4ZVP B;  4HL9 A;  3VQS A;  5AE1 A;  2FLP A;  2CPJ A;  3MM7 A;  3OTC A;  2JRS A;  1ZAV A;  2RD5 C;  5KFX A;  2CJX B;  1NKB A;  2I0X A;  3OUY A;  3BYR A;  1N0V C;  1CC7 A;  3IWL A;  1FRX A;  4RNF A;  3MGJ A;  1AXQ A;  3FCW A;  3LTO A;  2KM8 B;  3EGN A;  1ZAX A;  4CLK A;  2U2F A;  3M4X A;  1F3V A;  4DR4 F;  3OTE A;  1UVL A;  2I8E A;  4ED0 A;  2NXU A;  2BJ9 A;  5KG2 A;  1VLY A;  2WON B;  1TMJ A;  1RHM B;  3DHX A;  5M2U A;  3OVA A;  5B09 A;  2EBE A;  2GQ2 A;  4JB8 B;  1RXO B;  1WAC A;  1G4C A;  1TU0 B;  5IM0 B;  4PR6 A;  4JI1 J;  1YWX A;  3QGG A;  5HLF A;  3MPV A;  4IFV B;  2OPR A;  2ZWP A;  4O4G A;  5H9E J;  4DL0 C;  2VC1 A;  2NYI A;  5C25 B;  3POT B;  4IDK B;  4GMK A;  3V2U C;  1RBO B;  4ZLJ A;  1WC5 A;  1NXI A;  1CSJ A;  4YB1 P;  2UUC J;  2UUB J;  2AP6 A;  1RE1 B;  5D0H A;  3MTK A;  3BQ0 A;  4Q0B A;  1UEU A;  2HVD A;  3NWG A;  3PZP A;  1N5Y B;  2COL A;  2GFF A;  1JNZ B;  1VMB A;  2UU9 F;  1BY9 A;  2AJ0 A;  2B5J A;  3PAC A;  3CDE A;  2QYC A;  3HCX A;  3MM9 B;  4MJK A;  5F9N A;  2B0G A;  5KG1 A;  1VQP S;  1GFW B;  2J6S A;  4CLS A;  5CCM A;  2C22 A;  1JWW A;  4GC6 A;  4S0M A;  1H0H B;  3CNQ P;  4PQU B;  3OJS A;  4KTQ A;  3A8K A;  4IG0 A;  2VPZ B;  4C8M A;  2F8M A;  2VZ9 A;  3ZZZ A;  3MR2 A;  1VQ9 S;  2ZZM A;  1RWK B;  2B3T B;  2VH7 A;  2OFG X;  1FVS A;  3GB0 A;  3IM8 A;  1EB0 A;  2PFD A;  2EFV A;  2R8J A;  2HHT A;  1NLK L;  2HIQ A;  5H9F K;  4CYU B;  2MLZ A;  1T9T A;  2BVZ A;  5KFS A;  1F0X A;  3TAP A;  2HFU A;  4R0J A;  1N48 A;  3HK2 A;  2MB0 B;  1IM6 A;  4E98 A;  2RVJ A;  3PDN A;  3M2R B;  3EWG A;  5JMN A;  2W4C A;  4C0B A;  3C6T B;  4DG1 B;  4BDP A;  1T9X A;  1TV6 A;  4ZPT R;  2WOM A;  1NJY A;  1Q7Y T;  1JKH B;  3EZO A;  1Q53 A;  5F3T A;  5KFT A;  5AE2 A;  3ITH B;  3HM9 A;  3IBW A;  4N76 A;  1A7G E;  4XAK A;  1JLF B;  5G0R B;  5A6W A;  1DRZ A;  5D15 A;  2XUL A;  4IUF A;  2MSS A;  2L08 A;  4HI2 A;  4DUZ J;  4JYA F;  2DPJ A;  3VAJ A;  2M70 A;  5GAE I;  1SL1 A;  2PEB A;  2YWW A;  2MZQ A;  2OSQ A;  4OX9 J;  1JJ2 R;  2QZ8 A;  3KLH B;  1WHV A;  3KMQ A;  2ZHA A;  5FLX U;  2ZHB A;  4NXM F;  2BQR A;  1S0O A;  5AT1 B;  3E51 A;  3BZQ A;  1WG4 A;  3O1L A;  3ZFV A;  3BO4 A;  2PT0 A;  4Q0B B;  2R2T A;  3IR6 B;  4FYV B;  2OPS B;  1KBR A;  3BGU A;  4X62 J;  1XN9 A;  4ZLL A;  1KFD A;  2I5J A;  3VAF A;  4JI0 J;  2XS2 A;  3O5T B;  4K2X A;  1HQ2 A;  2QMW A;  3CVK A;  4GVB A;  4L6V 3;  5EX0 A;  4JV5 J;  1SV5 A;  4WYL A;  3BEG B;  3HSZ A;  4K4X A;  3KNG A;  5DM7 Q;  4I2Q B;  3NLC A;  4TYB A;  4FZV A;  1Q8K A;  1VQN S;  2W1B A;  2HND A;  3M1V A;  4Y2M A;  1KOO A;  3HT0 A;  4IO1 A;  2YNH A;  3J81 j;  3GIM A;  2W9A A;  2GMH A;  2WOM B;  3LP0 B;  2J6U A;  3L95 X;  3M7V A;  4LRF A;  2JOQ A;  3CJ2 A;  3I4P A;  4FYX B;  2UVV A;  5BR8 F;  2K3K A;  4NEZ A;  3ZO7 A;  3VAI A;  3V4I A;  4UOC A;  3SZ2 A;  1Q8L A;  1H2T Z;  4PWU A;  5EUH A;  3TUJ C;  1MG7 A;  2H4Y B;  2XSJ A;  2MQL A;  3I32 A;  4U95 A;  3HXM A;  4JV5 F;  2E66 A;  2QIF A;  2V2V A;  1S99 A;  1SJR A;  4NCB A;  5AXL A;  2M9K A;  4W4M A;  3VGU A;  4H54 A;  4XK8 C;  1FCA A;  1RWV B;  2HWH A;  2JWN A;  4WP3 A;  4YN3 B;  4Z2X A;  4IRK A;  2HS0 A;  1OY6 A;  1XBW A;  1RT6 A;  3DRP B;  3AJD A;  3CC4 S;  3G86 A;  5D77 A;  5F8G A;  3U02 A;  2P9G A;  5LSO A;  2BOA A;  5EGY A;  1MRO A;  4P2F A;  4JV0 A;  1LWC A;  2J5A A;  2K1R A;  4A4J A;  1H3D A;  2HK3 A;  2OPR B;  4O4G B;  3NGK A;  4EEY A;  3GP9 A;  1VQM S;  4P74 A;  4QZV B;  2NXN A;  3GTY X;  3TEH B;  2HWI A;  4MYU A;  4BWJ A;  4YS2 A;  2MKI A;  2AYG A;  1CVJ A;  1MML A;  2EK6 A;  3Q86 A;  1HBU B;  3CCU S;  1V3S A;  3NKY A;  4ZPD A;  2DGX A;  3PW0 A;  3QSY B;  2LQ9 A;  3MDF A;  1JLC B;  1JQG A;  4F4Z A;  3PM9 A;  4KHM A;  4CCH A;  1RT1 B;  4ZVU B;  4MTP A;  1NSQ A;  1KHV A;  3IGV A;  1IKV B;  1PJ7 A;  4GKJ J;  2IMW P;  2XLK A;  4CO2 A;  3V4I B;  3P49 B;  1URR A;  1CLF A;  2XGQ A;  1CS4 B;  3W2W B;  2GJI A;  3NWR A;  1T9V A;  3QWP A;  3T41 A;  2HZV A;  2UXC J;  3IA0 A;  4B3M J;  4IH6 A;  3N6L A;  4Y28 C;  4N8O A;  3FC9 A;  1YJT A;  1HPZ B;  3KJQ B;  1SKW A;  2MZR A;  1GT8 A;  5A8R B;  4KRW A;  1RT2 B;  4I7F B;  3TVY A;  4CWB A;  3CUN A;  4B9V A;  2AHO B;  5IQQ A;  3JAM Y;  1IBK J;  1QTN B;  3AB4 B;  1T9W A;  4C3K A;  3N0V A;  2ZNY A;  5BXI A;  3UN2 A;  1FNO A;  4F67 A;  1IR2 A;  2BQU A;  2FVS A;  4ECY A;  1TFY A;  4CIO A;  2CJA A;  2L9W A;  2NUU G;  3AY0 A;  3BGR A;  8RUC A;  2UV8 A;  4OMF G;  5E33 A;  1S1X B;  1YDL A;  9RUB A;  4EBC A;  3S1T A;  2V8V A;  1JIH A;  1X5O A;  3LAN A;  3BBF A;  2HQF A;  3MUT P;  1WSV A;  2DD8 S;  2HWT A;  3B8H A;  3QGH A;  5K14 A;  3TA0 A;  2CG8 A;  3GYG A;  1D8Y A;  4UY8 T;  2R8K A;  2XMK A;  3EVW A;  4Z7Y A;  4ED7 A;  2VPX B;  2RE1 A;  3TZW A;  1PYS B;  5J2Q B;  3LGN A;  1QAJ A;  4LF7 F;  1V3R A;  3G82 B;  2XZT B;  4HEA 9;  4Z37 A;  2XMT A;  2ZKT A;  1NH8 A;  1OPI A;  3NCQ A;  3SBM A;  1U1R A;  2E1R A;  3BSA A;  4OZ3 A;  2R7W A;  3BDP A;  1TFW A;  1ZTW A;  3CJ8 A;  1F2G A;  3MAA B;  3THV A;  3FBB A;  1VRU A;  2HHH J;  3K17 A;  3Q8S B;  3WHI A;  2DNO A;  4DZ6 A;  2AJQ A;  4YQW A;  1M0S A;  2V0N A;  4X64 J;  2YKQ A;  4HTJ A;  3LGM A;  2IA0 A;  4KE5 A;  3K5O A;  1LFW A;  3FGV A;  3IP0 A;  2J6T A;  1LEO A;  1D09 B;  3FNN A;  4DL5 A;  4WJB A;  2D9O A;  3QFH A;  2ZH4 A;  1HFE L;  1B70 B;  2RF2 A;  3MM6 B;  3MM5 A;  4LBP A;  1SJF A;  2IC3 A;  1U0H B;  1LKZ A;  4I6W A;  1FX4 A;  4JI3 F;  4C6A A;  4CO3 A;  1Y10 A;  2YKM B;  3DN9 A;  1RT4 B;  2MKH A;  4USJ C;  5DLG A;  2M3D A;  2MY8 A;  3TAM B;  3W5Z A;  2WSC C;  1Q81 T;  2GAG C;  2PGC A;  2LDI A;  2A6O A;  1X0F A;  1QTM A;  3QPI A;  5E2Q A;  4UTG A;  2MKK A;  2FHK A;  2BM1 A;  2FIU A;  3F44 A;  3B78 A;  4HHH A;  2D7S A;  1U8S A;  2MKC A;  4PXE A;  1X31 C;  3IS9 B;  5GAG I;  3CXC R;  3C16 B;  3HHL D;  3CT9 A;  3HHD A;  2DGU A;  2DO4 A;  3CCR S;  2ZH5 A;  2CQB A;  3AHP A;  2B51 A;  1FRL A;  3SCI E;  3MD3 A;  4FKX A;  1HD1 A;  3GFY A;  1QAX A;  1UFW A;  3DLK B;  3KJV B;  2ZH1 A;  3IAS 9;  4KGX B;  2M4M A;  2KU7 A;  4OYZ A;  3DMJ A;  1WF2 A;  1HA1 A;  1TL4 A;  5CYJ A;  4ZJL A;  2HMI B;  1KR4 A;  4K8R A;  2BAN A;  2MKJ A;  2A10 A;  1HHQ A;  1G7C B;  4F0K A;  3OL6 A;  1M5K C;  2EG2 A;  2X1G A;  3B6B A;  1UL3 A;  2RF2 B;  4PXB A;  3OR1 B;  4ZVO B;  4ZN3 A;  3FSI A;  3U1M A;  4DV6 F;  2F9J A;  1FK9 B;  2NS1 B;  1WJ9 A;  5F8N A;  3MCS A;  4ER8 A;  3DYA B;  4TN2 A;  1S9G A;  3FBF A;  3SCL E;  4M94 A;  2C3O A;  1RAG B;  3CF5 Q;  4D3H A;  4H4O A;  5LT5 A;  3OTO J;  1S1U B;  2RH3 A;  2B8Q A;  3FKB A;  4FF1 A;  4Y2A A;  2EK1 A;  3D6M B;  1T9Y A;  4WE1 B;  2EPI A;  2LEP A;  1UWB A;  2JVO A;  4DXL A;  3C46 A;  3TVK A;  3OTB A;  1T3O A;  3N4W A;  4WPA A;  2C2K B;  5HN0 A;  3R1L A;  2RIL A;  3NNH A;  2ZH6 A;  4IYQ A;  3QRR A;  2AJ4 A;  5KFC A;  1SI9 A;  2BE2 B;  4FS2 A;  2NZ4 A;  1VBZ A;  1Q86 T;  2UXD J;  5E3P A;  4HDH A;  1KOH A;  4F4W A;  1JX4 A;  2ZBQ A;  4RBT A;  3D3C J;  5KG3 A;  4U6P A;  3UD3 P;  1NK0 A;  2QMX A;  3DMJ B;  3FEY B;  4LUB A;  1XWL A;  2IM3 A;  3UNG C;  1UVN A;  1U09 A;  2AGP A;  2OO4 A;  4WZQ A;  1PIL A;  2V2K A;  1GXU A;  1NHK L;  1TK0 A;  3DOL A;  2BX6 A;  4J9L A;  1TK5 A;  1CJK B;  1KVK A;  4WK3 A;  3VGV A;  1K0V A;  1X4G A;  4R8U A;  1RAE B;  3OR1 A;  3GON A;  3VF0 B;  1U0S A;  3LAL A;  2J7W A;  4Y2I A;  5E3C A;  5E3R A;  3J7Y I;  3PKM A;  1T7P A;  2QT7 A;  1BD6 A;  3W8P A;  1LNQ A;  5DS7 A;  3OHA A;  1TMM A;  2B9W A;  3SSS A;  1WWH A;  2WHO A;  5CZV A;  5IT9 U;  3WIU A;  2O01 C;  5DG7 A;  1WOO A;  1DLO A;  4I4B A;  4C11 B;  3JYT A;  4L3N A;  2Q66 A;  3MFI A;  1OJ4 A;  1DTQ B;  2V9W A;  2VOP A;  1FWP A;  3K57 A;  3WQP A;  1F1B B;  2AQ4 A;  4BBY A;  1X9W A;  2B9Y A;  5LOQ A;  2P9C A;  1JK9 B;  2ILY A;  5FDL B;  4LF5 F;  4C3M A;  2QSF A;  3E3X A;  5KFU A;  4BHQ A;  4ECQ A;  1LFP A;  4L72 B;  2RQC A;  4DFK A;  4OI0 A;  3V81 B;  4ED8 A;  1T05 A;  4F04 B;  1S5Z A;  3M30 A;  4LFC J;  1UP1 A;  1EP4 A;  3FFI B;  1SH0 A;  1RZM A;  2KYX A;  3RAM A;  1BGX T;  1HBO A;  3C15 B;  5KFK A;  4NLY A;  1Z1Z A;  4NZ6 A;  4N41 A;  3UN3 A;  1C1B B;  2AU0 A;  1HNZ F;  2XLI A;  4Y65 A;  4DCJ B;  4O3N A;  4R25 A;  2HIY A;  3W5Y A;  4CLT A;  1R27 B;  3FSX A;  2KYZ A;  3DLL Q;  9ATC B;  2FHM A;  3DOK B;  4FPR A;  4PPD A;  2YQ1 A;  3NAH A;  3T1H F;  1S9F A;  5HQL A;  3RR8 A;  3MCM A;  5KT7 A;  4OZ5 A;  1FRH A;  4NLU A;  5B0C A;  4IQX A;  3RBZ A;  1BQX A;  2P2C B;  2OFH X;  4KFB A;  2MGZ B;  1EZZ B;  1HPZ A;  1NPR A;  1RI7 A;  3BS9 A;  2UU9 J;  3K5M A;  5ETO A;  2RAQ A;  3I9Z A;  1KSP A;  2PDA A;  2ZD1 B;  2WSE C;  2BJ3 A;  3TA1 A;  3TJ8 A;  4ED2 A;  4WBF A;  5J1N A;  5KOW A;  1RT7 A;  4OZ1 A;  4NE9 C;  2EFG A;  1ZA1 B;  1A9N B;  1H6K X;  1OYD A;  3C8Y A;  2BUN A;  5ETR A;  4ETZ A;  3PFO A;  3S8S A;  2ZE2 B;  3GFX A;  5M2P A;  3BSN A;  1TL7 A;  5ETL A;  2FB0 A;  1CC8 A;  2JFD A;  3TZX A;  3CCV S;  2QL7 B;  2N4C A;  4KR0 B;  3IBC B;  2KZZ A;  3H20 A;  1RTD A;  2HQG A;  3HMJ G;  3JSY A;  1TR0 A;  2JC1 A;  3VAH A;  1NK4 A;  4B3S F;  4EZ6 A;  3AXK A;  4C8Y A;  3KK3 A;  1FRI A;  1ZM9 A;  1R8P A;  2XG8 A;  4RUH A;  5EDW A;  2OTL S;  3PO5 A;  1RHU B;  2U1A A;  1NDL A;  4X4V A;  1RT6 B;  2PN6 A;  3BF4 A;  4PG7 A;  2PMH A;  2E1A A;  1WF1 A;  2DGW A;  3DU5 A;  3HVT A;  1TKX B;  2DK2 A;  1LXN A;  1NU4 A;  2DR9 A;  2Z2M A;  4A8X A;  2ROP A;  4JOU A;  3LA0 A;  1ZET A;  4LBI A;  1TL5 A;  1RAB B;  1Y11 A;  2M7S A;  3PRB A;  3IN5 A;  1CG2 A;  3D1O A;  3GCX P;  2K8G A;  1BQM A;  2D1C A;  2MTL A;  1JLE B;  3JTN A;  3MAH A;  4OX9 F;  4DN9 A;  4ES1 A;  1X4D A;  2JLE A;  4DR3 F;  1WG1 A;  1LWC B;  1N34 F;  3TWZ A;  1TEL A;  2OEJ A;  1NPP A;  4ANC A;  1PBU A;  3HHL A;  1RT1 A;  5CZX A;  3W9H A;  5A8W B;  1U25 A;  1WTB A;  3N01 A;  1TKZ B;  3FEX B;  2ZE2 A;  3R5J B;  2Y9H A;  3CCE S;  1HBU A;  4LQ9 A;  1A6L A;  1O0P A;  4DX6 A;  2DRB A;  5LXR A;  1T02 A;  3PRV A;  5SZT A;  5J2N B;  2Q1L A;  2W9C B;  1KRP A;  1S77 D;  3QJJ A;  4O3S A;  3D6H B;  1PC5 A;  2C3Y A;  1KLM A;  1H7W A;  1MLA A;  2MMY A;  2Y0S D;  5C42 B;  1NJI T;  1HNW F;  1D9D A;  1UEV A;  1A0O B;  1JLB A;  1MN9 A;  3ZZY A;  2HYI B;  3CD0 A;  1VC6 A;  5L9N A;  1NO8 A;  2KKH A;  5FDL A;  4CLY A;  1PCA A;  3GII A;  3BH7 B;  4CTA A;  2ASD A;  3UE2 A;  1HI8 A;  2YPY A;  2KI2 A;  3BGR B;  4IFV A;  4YB7 A;  3Q8P B;  3ILL A;  4WTO B;  2FUG 9;  2HZA A;  5DQG A;  3TNV A;  3C15 A;  4OYO A;  3CCW A;  1UFL A;  1KQF B;  1JJC B;  1SVD A;  3R3T A;  2RIJ A;  4J9Q A;  4KY3 A;  4A8Y A;  4DFM A;  4DSL A;  3DM2 B;  4ZIV A;  4XDC A;  4FF2 A;  3W1Y C;  3EGW B;  4E0D A;  1RA6 A;  3H90 A;  1VJW A;  4LMZ A;  1CUL B;  2CPH A;  2HQC A;  3MCN A;  5EWF A;  3R1H A;  4UZB A;  1V5I B;  3BV8 A;  1X4A A;  4LVO P;  5KT5 A;  3N6N A;  2VIC A;  1S9G B;  4RNN A;  2F1F A;  3GJS B;  2W2Q P;  4LFC F;  2HS3 A;  2M5Y A;  3AOA A;  4TLQ A;  3VAM A;  1K0T A;  1NZA A;  2IDL A;  3M6V A;  3TJ9 A;  4M1K A;  1CJV B;  1Q5V A;  1NH7 A;  3D66 A;  3ISN D;  4MKV A;  2B8P A;  4OJH A;  2CXE A;  2IAJ A;  3FQK A;  1TVR A;  2E5I A;  1EQM A;  2MHN A;  4DV0 F;  1WKJ A;  3OFE A;  5DZ6 A;  1KDN A;  3R27 A;  5ETM A;  5EX3 A;  4I69 A;  4RW9 B;  2DEI A;  3M2R A;  4RU2 A;  1FRJ A;  2FJB B;  2C2R A;  2BKO A;  3QAE A;  2F4F A;  1QJH A;  4CYU A;  1S10 A;  4TNO A;  1LQ9 A;  3LUY A;  4WXW A;  4CLZ A;  1FKO A;  2VKR A;  4M5J A;  4FN5 A;  1RWU A;  2NPI A;  4RJV A;  5THW A;  4CLF A;  3IRX A;  2KM8 C;  4AL5 A;  4LFB J;  2RHQ B;  1RGV A;  3IXQ A;  4X64 F;  4CLP A;  3HSJ A;  4MIW A;  4DPU A;  3IMQ J;  3PEH A;  4WFA Q;  4ECW A;  1S0M A;  3PRD A;  3KMS A;  1J27 A;  4IFY B;  4AQY F;  3P45 B;  3Q89 A;  3UDE A;  3NS5 A;  3TAM A;  3WDO A;  2WB4 A;  1SPB P;  2W24 A;  4LFA J;  3UFC X;  1WKK A;  1HL6 A;  1ZS6 A;  4DV1 J;  1OQ6 A;  2LDY A;  4PXD A;  5IOL A;  4QU6 A;  1RWM B;  2V68 A;  3OLB A;  5MLC V;  3CC2 S;  1H2U X;  3P96 A;  4X65 J;  4A47 A;  1QUV A;  3JTP A;  3JXO A;  4GRS A;  2DNP A;  1U1L A;  5DQH A;  4CH1 A;  2DNY A;  3MR3 A;  2X3D A;  1T3N A;  4FYD A;  2EBG A;  1QM9 A;  1TQL A;  5D0G A;  1NND A;  2IY5 B;  1HNZ J;  3T5L A;  1WC3 A;  3M1V B;  1SJQ A;  5ETP A;  1N5V A;  5A76 A;  1FEE A;  2F3J A;  1C1C A;  2QV6 A;  1IKX B;  1I3O B;  2DHH A;  4OZL A;  5ETN A;  2R2R A;  2BAN B;  4WFZ A;  5KFA A;  4NA2 A;  1S1W B;  5BJR A;  2W2O P;  1RWN B;  2IA6 A;  2RQ4 A;  2E5L J;  1RYS A;  1PJ6 A;  2XSJ B;  5J1E B;  4DV6 J;  1FRM A;  2QSW A;  2JX2 A;  1IBK F;  3UD4 P;  1KNZ A;  3NAI A;  4LRC A;  1DY3 A;  2O66 A;  4KPC A;  2IJF A;  3EXC X;  2PE8 A;  3SSR A;  4YFU A;  4OI1 A;  3NGR A;  2GO8 A;  3K59 A;  3HSD A;  3ETM A;  4UST A;  2R7Q A;  3GQC A;  2FJW A;  4B3M F;  1P9Q C;  3TQE A;  1RAA B;  3QYY A;  5DET A;  1REV A;  3J81 U;  4Q5V A;  2W9B A;  3TUI C;  3PVX A;  4DR4 J;  3ZTP A;  5LJ3 Y;  3BR9 A;  4TXS A;  4Y00 A;  2O67 A;  2VKZ G;  1KFS A;  2HQD A;  5HO4 A;  1XQI A;  1IBL F;  4PRF A;  1JJH A;  2N3O A;  2LQ8 A;  1KTV A;  3GSI A;  4BCA A;  3ENW A;  5HQM A;  5K8N A;  3QBC A;  1YJ9 S;  4ZVG A;  1VRT B;  1YGY A;  1ZM4 A;  4B9M A;  1U24 A;  3W2V A;  2J7K A;  3MZI A;  4QWB A;  5K8O A;  3DOL B;  2OPP B;  3E01 A;  4C2M A;  1VIX A;  1XMQ J;  1HD0 A;  1BC6 A;  1Y5L B;  3H5Y A;  4M5H A;  2K7J A;  3LPE A;  3FQL A;  1F9H A;  4XIU A;  5T14 A;  1C1C B;  5L8R C;  5C2G A;  4DSK A;  2R9L A;  2HHW A;  3D1H A;  3MEG A;  3CGI A;  3MMB A;  4NI2 B;  4DV7 F;  1KEK A;  2CWX A;  3R8Y A;  1S1W A;  4B9U A;  1EJ7 L;  3PR4 A;  2IJN A;  1RAI B;  2HHV A;  2UXD F;  4ENO A;  1RT3 A;  1S9E A;  3HDS A;  3LH2 S;  4UUX A;  3GV8 B;  1EKS A;  4Y2K A;  3EGV A;  3ILO A;  2R8G A;  4FXW A;  3M8S A;  1YHQ S;  3KHL A;  3AD9 C;  5A2Q U;  3GV5 B;  1SKU B;  5HP1 B;  3OFF A;  4DQI A;  1Y0H A;  1PAU B;  2DRD A;  4ERD A;  2CYY A;  2R7O A;  4QPX A;  1U1Q A;  3DXB A;  4EU0 A;  2PI5 A;  1VS3 A;  2AGO A;  3WC2 A;  3MMC A;  1U1O A;  2MXY A;  2C3M A;  3MEK A;  4DQP A;  4FXD A;  2D3Z A;  2ACY A;  2XHC A;  3V6K A;  1HQU A;  4IKA A;  2OP5 A;  3LOU A;  3TX8 A;  3G8S A;  1W7W A;  1C4C A;  2RRB A;  4MH8 A;  5HJY A;  3TZZ A;  3LWM A;  1LW0 B;  2LXF A;  1M5H A;  4FVC A;  4WTY A;  3Q23 A;  2JEF A;  3J80 Y;  2D3O R;  3ZZO A;  2G2Z A;  2BAB A;  4OYI A;  2AF6 A;  2RUS A;  5JVH Q;  3TZY A;  1LOU A;  2LFV A;  2XM3 A;  2C2E A;  3ENA A;  2FC8 A;  1IR0 A;  3DGP A;  2F8E X;  1MU2 B;  2GIR A;  4USU A;  3D7S B;  4NRU A;  1VC5 A;  2LQB A;  4AT1 B;  2QFJ A;  1U1P A;  1SQF A;  2GV1 A;  4OZ0 A;  5K5M A;  1SUQ B;  4C8L A;  3RZA A;  3W65 A;  1JLB B;  2QG9 B;  2V8G A;  3QGI A;  1NB2 A;  1RKI A;  2MZT A;  4ECV A;  2XQC A;  2L9N A;  2XBP A;  1VHF A;  1WHY A;  3KJN B;  3ZXW A;  4UZC A;  1HKA A;  4EO6 A;  4J9O A;  1S59 A;  2GHV C;  2X1B A;  3H5S A;  5B0A A;  4JI5 J;  2VPW B;  4ZLN A;  4NMX A;  1FJG J;  1BUX A;  2I1R A;  3PFE A;  2I9S A;  4ZMM A;  5L38 A;  5LXY A;  1JJ4 A;  4PWD A;  4J91 A;  3V4M A;  2HSE B;  5AXM A;  1N56 A;  2UVW A;  1JXE A;  3MUR P;  3AOB A;  2QN6 B;  3B82 A;  3TO8 A;  3RJM B;  3M05 A;  2R7T A;  2R8I A;  3CJ5 A;  3ILJ A;  4F0M A;  4R5P A;  2F4V F;  2GIQ A;  7FDR A;  3MR6 A;  5IC6 B;  1IBM F;  5B0B A;  1YKW A;  2N7Y A;  3WIV A;  4JI8 F;  2AW0 A;  2QLF B;  4OV6 A;  2E5J A;  4TQR A;  4DSI A;  1B7F A;  3PW7 A;  1W25 A;  2IRU A;  4DHV A;  4KBI A;  2JSX A;  1FWK A;  1RAF B;  2ABY A;  2DHA A;  2XYH B;  4MK7 A;  5KFL A;  4DX8 H;  4Z7C A;  3KK1 B;  3JSM A;  1FJ7 A;  5FII A;  2HFS A;  1GX6 A;  4ICL B;  3SFG A;  1R8A A;  4EBE A;  2CQD A;  2G2O A;  2L9D A;  3NCP A;  2KVQ E;  4V1A k;  3SMZ A;  2HLU A;  2I5J B;  3D3B J;  4Y0F A;  3KLH A;  1SUQ A;  2HUR A;  2Y3Y A;  2HGN A;  2ASY A;  4HT7 A;  2QTW A;  2NPF A;  3CD5 A;  3HHE A;  1D1U A;  1UAW A;  1VBK A;  4K5R A;  2GC8 A;  2XCP A;  1QSL A;  5DLF A;  4JI2 J;  3HT3 A;  4NA3 A;  4JI6 F;  4WII A;  1MWZ A;  2VQF J;  3SI8 A;  2DR5 A;  3G8T A;  4OFZ A;  3PV8 A;  3AA9 A;  4PWD B;  2YH1 A;  4OX6 A;  2E1M C;  2ZBC A;  4WP9 A;  3G96 A;  2V4Q A;  3FFI A;  4NWB A;  1UW9 A;  5ETT A;  1S6U A;  4NCA A;  2W7P A;  2FLO A;  2CA9 A;  3LP1 A;  1DAR A;  2DCU B;  4MMO A;  4U7U K;  4A8Q A;  1NK8 A;  2FVP A;  1RHJ B;  1VDH A;  1ZM2 A;  2DBB A;  2OD6 A;  3GR1 A;  2FZC B;  4X65 F;  4OZN A;  3BPD A;  1JLG B;  1HNI A;  4RWX A;  4DR3 J;  4TU9 A;  4DDF A;  2UVR A;  5HJX A;  4ETX A;  1TAU A;  4ZPC A;  1NDC A;  3D54 A;  3SYZ A;  5LJ5 Y;  1Q78 A;  5KT4 A;  1J5E F;  2Y1J A;  3P5T L;  2RKI B;  1NSA A;  1KQG B;  1L5U A;  3OR2 B;  4MFB B;  2DRA A;  5B7W A;  1NSP A;  3JTO A;  3PX0 A;  3CB4 A;  2QLW A;  3FRY A;  2VQE J;  1O51 A;  3A3O B;  3BO3 A;  3PHT A;  4CT8 A;  1ITP A;  2IPO B;  2PSZ A;  3E8O A;  4ID8 A;  3Q22 A;  2FJE B;  2HAF A;  2HKE A;  3F0N A;  4DEZ A;  5J2M A;  3A3P B;  3CJR A;  4AXI A;  3O44 A;  4L76 A;  4D3G A;  1NK6 A;  2DR8 A;  4TY9 A;  5T7L B;  2KG0 A;  3RBD A;  3PJX A;  2HNY B;  3K5P A;  4ZHR A;  2MY7 A;  3BRE A;  4KV8 B;  3I5A A;  4QIG A;  5F0U A;  2BR0 A;  5MAO A;  2KZM A;  1FF2 A;  4RNM A;  2A1B A;  3TR5 A;  1Q79 A;  3OUY B;  3CW2 C;  1VR6 A;  4MT1 A;  4FNH A;  3RU0 A;  1FDA A;  3ZTR A;  2JHE A;  5KAK A;  3CTR A;  2C42 A;  3JQM A;  4I68 A;  4KJI A;  1LWF B;  3OW2 R;  2VFR A;  1BWE A;  2E44 A;  3MCO A;  2NSB A;  1TUW A;  2I2Y A;  4OI4 A;  1JLQ B;  4G65 A;  2A3J A;  4PG6 A;  4USK A;  4F36 A;  2ZKU A;  1EX8 A;  3R7N B;  4K4W A;  2H65 B;  3CED A;  4B3O A;  2ZJR Q;  4NA1 A;  4A8S A;  2VV5 A;  1H7X A;  2HFN A;  1HBN B;  2CG4 A;  4P52 A;  3AD7 C;  1CEZ A;  3Q8U A;  5LMU J;  2Y1L B;  1AZS B;  4Y34 A;  5GMD A;  2XO6 A;  1BHN A;  1T05 B;  1C4A A;  1N5S A;  3PR5 B;  1Q95 G;  4ECZ A;  2DXE A;  5LSR A;  2CZ9 A;  1FDD A;  1HNX J;  2Z2Z A;  3A1Y G;  4DCP B;  3KK2 A;  1NEE A;  2HND B;  2LQ5 A;  4DR2 J;  1RU2 A;  2V69 A;  2DJW A;  4YB6 A;  3BKF A;  2AIR B;  2D9P A;  2F8H A;  1X4B A;  2F4V J;  2APO A;  3I82 A;  4GC7 A;  3ENV A;  4MKB A;  1TKT A;  3UQS A;  2GJ2 A;  1QDU B;  2XHW A;  3IO1 A;  4UOH A;  2EFP A;  3KK1 A;  3CCJ S;  4CLL A;  4NLV A;  4KSE B;  4YUD A;  4LQ3 A;  2EC2 A;  2R42 A;  3KDO A;  1RP5 A;  3EVO A;  4KGM A;  3ZZR A;  4OYX A;  4YEA A;  5AJ3 F;  3KLI B;  4QQB A;  5L39 A;  1N5T A;  2W4P A;  1KLM B;  3HF5 A;  4X4O A;  3CMA S;  4C0O C;  2HFO A;  1RK8 A;  2KVI A;  1JLQ A;  3NOG A;  4IOC Q;  4KB7 A;  1YJR A;  3CMQ A;  3GR0 A;  3U27 A;  3PJW A;  2P6S A;  4B3O B;  4O44 A;  2JNJ A;  3WZ0 A;  4J9K A;  4TY8 A;  3UVJ B;  3UNY A;  4ATN A;  3QIP B;  3EPI A;  1YX2 A;  4DUZ F;  2UXB F;  4FVM A;  2E5H A;  1YLX A;  2OLW A;  4NXN F;  1IJF B;  3M6U A;  4NEY A;  3HHK A;  4J9S A;  4W92 B;  3SFU A;  4A8M P;  3U1N A;  3ETO A;  3D0G E;  2FJX A;  2XMA A;  1HAR A;  2QMU B;  5KFQ A;  3BBB A;  1X5T A;  3MEE A;  3NGT A;  2FJV A;  2Z2L A;  1XMO J;  2DHS A;  4MIB A;  3R5B A;  2AD9 A;  1GMU A;  2L48 A;  3D4J A;  2YX1 A;  4FNI A;  2ZVS A;  3QJL A;  3BKT A;  4B9N A;  3C16 A;  3VCD A;  5LMN J;  2R3V A;  1TKT B;  3V6H A;  1S0N A;  2R7S A;  1T8E A;  3MOZ A;  3DGP B;  3RTV A;  3CJ0 A;  1S57 A;  1REG X;  1JLA B;  1VK3 A;  4DJB A;  2RKI A;  1MN7 A;  3GLJ A;  2V67 A;  2ZBP A;  3KK3 B;  3O6Q A;  1H98 A;  1N33 F;  2VBW A;  1KS2 A;  4QR0 A;  4C8O A;  4WFB Q;  1JLE A;  1UWA A;  1SBR A;  1ZOT A;  3NG8 A;  1XR6 A;  5ETS A;  3I6P A;  5CH7 B;  4ZCL A;  1HYS A;  2LQJ A;  4L74 A;  2AYE A;  2DNZ A;  1KHW A;  3FDS A;  1WHX A;  4ZHR B;  2AYB A;  3G71 S;  3HHL B;  2BV3 A;  3EIC A;  4QIW D;  1R43 A;  3GPA A;  4GVB B;  4QIV A;  1R8H A;  3W63 A;  2Z0G A;  5LSL A;  2FC9 A;  4DR1 F;  5KG5 A;  2PD1 A;  2OPP A;  2HHU A;  1XR7 A;  3V6D A;  1KQS R;  3U1L A;  1XK8 A;  2IM2 A;  4LF9 J;  4HH0 A;  1S76 D;  2UV8 G;  3NMR A;  3DCA A;  1TUV A;  3DLJ A;  3HHL C;  3PY8 A;  3R2C J;  2QA4 G;  4YR0 A;  4ELV A;  5H1S V;  4DSE A;  4ES3 A;  3W60 A;  3OJU A;  4NLT A;  4RU9 A;  1E6V A;  4O0I A;  4RPF A;  1GK8 A;  4HT5 A;  3JSM B;  2V4R A;  3T5J A;  3RB6 A;  4EFA C;  4N5S A;  2FPH X;  4ICL A;  3BR8 A;  4F26 A;  4G3I A;  4A8K A;  1OY8 A;  4ZP7 A;  2CNL B;  3IC1 A;  5EWG A;  3LW5 C;  4IH5 A;  3W9J A;  1DBD A;  4RW8 B;  3FUY A;  4JI8 J;  4OI6 A;  1DTT A;  1TL1 B;  3UD5 A;  3MHY A;  2J9D A;  5D8H B;  1FRK A;  2HPU A;  3IWX A;  1LWX A;  3GG0 A;  3BQ2 A;  1O8B A;  3HSG A;  5JXS A;  1EAY C;  4CP5 A;  4DLG A;  1RYR A;  1Y4Z B;  4DR6 J;  3Q8V A;  4K4T A;  5DDR C;  2Z8Q A;  3I0R B;  5G4D A;  4RZR A;  3GMG A;  3VV2 B;  1HWI A;  1B99 A;  1SL0 A;  1VIO A;  3S7R A;  2W01 A;  3D67 A;  4QOT A;  3DRR B;  4OJ1 A;  1L3S A;  1B0P A;  4JI4 J;  1UA1 A;  1FT8 A;  3PYD A;  3TOQ A;  3GIR A;  2Y1I A;  1H38 A;  4J9U E;  1IKV A;  1V9O A;  5F3Z A;  1VJQ A;  2L3M A;  4EBD A;  1GMW D;  4HKQ A;  4FBU A;  1U26 A;  1WI8 A;  2DNH A;  4LIR A;  3VVT A;  1WOR A;  4K59 A;  4K50 A;  3M2U B;  5DDP C;  1RSC A;  1U1N A;  2YWG A;  1I94 F;  3L7P A;  4FPI A;  2YBV A;  1FE0 A;  1X0P A;  5CD4 H;  2IAJ B;  3MD1 A;  1RT2 A;  5F8L A;  1PGZ A;  1WC1 A;  1X5S A;  4X84 A;  1U2R A;  4AYB D;  2BDP A;  4LF4 J;  2AEM A;  2ZNZ A;  4I0W A;  2LXI A;  4WF9 Q;  4RW8 A;  5DG8 A;  2DPI A;  1GTH A;  3IG1 B;  2CKW A;  1G2E A;  2DGS A;  5C24 B;  1R6V A;  2RQM A;  2VFT A;  2BJ8 A;  2CZV C;  1MNE A;  4H4M A;  3OHB A;  2YKN A;  3V81 A;  2CJ9 A;  2ZC4 A;  4KV8 A;  2F40 A;  2C28 A;  1RCO B;  5D0R A;  1WF0 A;  3ADA C;  3DDI A;  5I42 A;  1ZZF A;  3QGP A;  4KH0 B;  1I5O B;  2V4J A;  3GJQ B;  2XY6 A;  3I31 A;  2CJQ A;  2C2Z B;  4NXN J;  1T0T V;  1RT3 B;  2DGQ A;  2GW8 A;  3BH6 B;  3JQK A;  3KJF B;  2FDN A;  2NXE A;  4EWT A;  4LF8 F;  1N8R T;  4RKU C;  3RW6 A;  1D9A A;  2IBO A;  5HMY A;  3HFK A;  2HBQ B;  4PPZ A;  3HVR A;  1RBL A;  3RRH A;  5ADZ A;  3QZ8 A;  4DL2 A;  4QWA A;  4P72 A;  1WD6 A;  2KJV A;  4NLW A;  4DV3 F;  3OV7 A;  3DOM B;  1BLU A;  4YHH J;  4DV0 J;  2ZVI A;  3RRG A;  2KFZ A;  3Q0A A;  2K1R B;  5A0Y B;  4KYZ A;  1Z2Z A;  2E7V A;  4IQM A;  2VBX A;  1RTH B;  2YPZ A;  2DIV A;  2ROE A;  4OX8 A;  2KB2 A;  4WFY A;  2AZ3 A;  3M32 A;  3J7Z 5;  1OS5 A;  2GJF A;  4OX7 A;  4RBU A;  4DV4 F;  5ITH A;  3PX6 A;  1AFJ A;  2IHR 1;  5I3U B;  4RL1 A;  1Q4R A;  3GJR B;  4LSL A;  1N54 B;  5CYQ B;  2HBZ B;  2VBY A;  3C6T A;  4U7U D;  3J7A N;  4NLO A;  2JEG A;  4AE5 A;  3W8G A;  2MQM A;  2V34 A;  3TEG A;  2CPX A;  1U6Z A;  3WX8 A;  4F3M A;  1VQL S;  5KFN A;  1WC4 A;  2YTC A;  5CHC B;  1FDB A;  2OHD A;  1KD1 T;  2UP1 A;  3EX7 B;  2XWY A;  5F8I A;  3FBC A;  1ICE B;  3MED A;  4RUB A;  4DV4 J;  2CQC A;  3MM8 A;  4ID5 B;  3ICL A;  3KFW X;  1FWL A;  2UUW A;  4L73 A;  1KQK A;  4WKY A;  1FJG F;  5FJ4 A;  2C1E B;  1EET B;  2VG6 B;  3MMJ A;  4QYR A;  3H98 A;  4ZVT B;  1FD8 A;  5GAH I;  5F9L A;  4U67 Q;  1FKP A;  4NML A;  3MOJ B;  5L1J A;  2MKY A;  1V3Z A;  2OTJ S;  4LF9 F;  2H5I B;  1T94 A;  1W2I A;  2B4U A;  4DU7 A;  2UXC F;  1FA0 A;  1ZM3 A;  2A2D A;  4O3R A;  3UVJ A;  4QPT A;  2J0W A;  5DDO C;  2G1H A;  3OL8 A;  3Q2T C;  2OML A;  3H5U A;  5CYM A;  1UMJ A;  3UDV A;  5HRO A;  3IRW P;  8AT1 B;  3W2V B;  2CQG A;  2VBZ A;  2J0X A;  2XEX A;  1NCL A;  3BB5 A;  4CO4 A;  1N52 B;  2MQN A;  3EDR B;  4ZP6 A;  3RG6 A;  5J2M B;  4H4O B;  3G4S S;  1FNX H;  2LA4 A;  2CQ4 A;  1RHQ B;  4DMZ A;  2HBY B;  3KLF B;  4K5S A;  2GQQ A;  3C66 A;  1YQH A;  3I0S B;  3KLG A;  1L3T A;  2E9R X;  4AND A;  1FK9 A;  2WZ1 A;  3PW4 A;  1D3W A;  1UJ5 A;  3MM9 A;  1K73 T;  3MEG B;  4WWS A;  1HQE A;  1S6Q A;  3AOD A;  3CIM A;  3GG1 A;  4NZ7 A;  3M9N B;  3LAK A;  4LF6 J;  5CXT A;  2XI2 A;  3MR7 A;  1GXT A;  2VOO A;  4AUK A;  1U8W A;  1WDT A;  5IXU A;  3OPK A;  2QA4 S;  4TKT A;  4PAB A;  3CSK A;  2JEI A;  2LMI A;  2OSR A;  2XMU A;  3R7B B;  3FMB A;  1S12 A;  2E7W A;  3KG4 A;  3JSB A;  5F41 A;  1DFD A;  4B3T J;  1LK7 A;  2VG6 A;  4FKY A;  4P2X A;  5A8K A;  5KFB A;  1TL3 A;  1RT7 B;  3FCH A;  3UWT A;  4OYM A;  2AKW B;  1QSS A;  4F3Q A;  2DH8 A;  4LFB F;  3L4B C;  3I55 S;  3PTW A;  2R4F A;  1AZS A;  1RAJ A;  2JJ4 D;  2VF3 A;  4LRA A;  4OYA A;  4M5D A;  1U0H A;  3H59 A;  3ZZ0 A;  2HVE A;  3D28 A;  1V5V A;  5ETQ A;  3VTI A;  1RT4 A;  1I1G A;  1NHV A;  1YIT S;  3HP6 A;  2XYP B;  3SCK E;  1RKJ A;  4GVL A;  2MHE A;  3T5K A;  1YI2 S;  3RUB L;  1GMV A;  3UI3 A;  3CE8 A;  1GX5 A;  2YWE A;  3MEC A;  3UDC A;  4QCL A;  4KAI A;  2HQ3 A;  2MJU A;  1MWQ A;  2AT1 B;  2VFU A;  5U47 A;  3K5N A;  2ZJQ Q;  4JI7 J;  1VCT A;  3ULH A;  1F3F A;  3OXG A;  1VQ8 S;  1VK8 A;  4I6A A;  3DRY A;  2PMZ D;  3K7R A;  2CQH A;  3THT A;  4DU8 A;  3EGZ A;  2V63 A;  1WC0 A;  1PYT A;  4KKO B;  2EW9 A;  4LF1 A;  4ZVS B;  2OAU A;  4ZP8 A;  5A0Y A;  5KFI A;  2F65 A;  1CJV A;  2IRX A;  5GMK a;  3BGL A;  4JUZ A;  2XY7 A;  2KFN A;  1YRT A;  3M8Q A;  4U8V A;  5F8H A;  1EHW A;  2UUA F;  1TVR B;  2GCF A;  2Q6C A;  3QLH B;  5KFO A;  1FXL A;  4DWI A;  3CD7 A;  3PYG A;  2NXJ A;  2WON A;  3C19 A;  3K5L A;  1S72 S;  1SH3 A;  1IKY A;  3KUG A;  4O23 A;  5I3U A;  2J8A A;  1M1G A;  3H2U B;  5IM0 A;  4F8R A;  3IRX B;  4OIX A;  4USW A;  5B0D A;  3AB2 B;  4ZIT A;  2FHJ A;  4AL7 A;  3RB0 A;  2BJ7 A;  3W62 A;  2RDD A;  2GVZ A;  4KO0 A;  4PQA A;  4YDX A;  3M30 B;  1E6Y B;  2BE7 D;  2XMM A;  2UUB F;  4J9V A;  1RA7 A;  3VAG A;  1M90 T;  1AUS L;  5KFM A;  4CNY A;  3I56 S;  1IUJ A;  3CDU A;  2WRM A;  3MXH P;  2IVY A;  3MED B;  3QWU A;  2YX7 A;  1Q7L B;  4OHV A;  1IN0 A;  2YH0 A;  2XYG B;  4BWM A;  6FD1 A;  5J2P A;  3RBE A;  2J0Q D;  4OI2 A;  5M2R A;  3EE3 A;  3TVZ A;  1LWF A;  3CCS S;  3VR1 A;  1HHT P;  1IM4 A;  2V8D A;  1ZA2 B;  3CWJ A;  2ZH9 A;  4CO1 A;  1VYA A;  3R97 A;  1YJW S;  4IR9 A;  3DLE B;  5DM6 Q;  1IKW B;  4G1Q B;  1JLA A;  4UT4 A;  2HEK A;  1CBK A;  4AXJ A;  3VAK A;  3WBZ A;  4N7T A;  2YWF A;  3RBX A;  4KFB B;  1ZYQ A;  2CVI A;  2CQ3 A;  3QSI A;  1SQE A;  2ZC3 A;  2AWZ A;  4PYD A;  3JAM U;  1X7V A;  1AYE A;  2FVQ A;  3QLH A;  2ZM6 F;  5KFY A;  3BO2 A;  5DG9 A;  1LWE A;  2W25 A;  1LK5 A;  1RAC B;  2XLJ A;  1Q1K A;  2BYC A;  1G3O A;  2W8K A;  1O5J A;  3DU6 A;  3IG1 A;  1K8A T;  3ZNU A;  3U7J A;  2SXL A;  2R7X A;  2VQF F;  4I2P B;  3W5X A;  4C3L A;  3TUP A;  4JV1 A;  4JI2 F;  2J8S A;  3MM7 B;  4X4S A;  4DUT A;  4ZDN A;  4GKK F;  2XZD B;  2DHX A;  4LVN P;  2K2P A;  3MPW A;  4DV5 F;  1VQS A;  3HO1 A;  2DNQ A;  2ZZT A;  4CM0 A;  2EC0 A;  2IVF B;  4YY3 J;  2GO9 A;  3V6D B;  1ZAW A;  2BJE A;  2IMO A;  2WVE A;  1UCN A;  2XSF A;  3D0I E;  3R6G B;  4RW4 A;  3S01 A;  3ZZU A;  3T5H A;  1U1K A;  1TKX A;  2IFX A;  4TLR A;  3WX4 A;  3UN5 A;  2OEL A;  2B7C B;  4FS1 A;  1E6V B;  3H7H B;  3O3L A;  5KFE A;  2KXH A;  3QAT A;  3NGS A;  5GAH U;  3H2L A;  3PJ9 A;  4ZVR B;  4Q2L A;  1M5O C;  2A2C A;  4DL7 A;  3ELH A;  1HR0 F;  1R0C B;  2B43 A;  4DUY J;  1EIY B;  2NZC A;  4IOA Q;  4JP8 A;  4WKR A;  4DL4 A;  1HWJ A;  3QZ7 A;  3QNW B;  1UVJ A;  1P9Y A;  1TKZ A;  3HJF A;  1IJE B;  2ZZN A;  3MMB B;  2PC6 A;  3LAM A;  2LCW A;  2G2Y A;  1GNK A;  1FTR A;  2G1D A;  3SEO A;  4B9S A;  2F7V A;  1U6F A;  2CNK B;  2YY3 A;  2VG7 B;  1S1V A;  3L7O A;  4O3O A;  4RWW A;  4ZK7 M;  2JZ5 A;  1U02 A;  2CQ2 A;  2DY9 A;  2YNF A;  5B08 A;  2DXF A;  2WSF C;  3ZNJ 1;  1QLN A;  2YKA A;  2XMW A;  3CJQ A;  4C98 A;  5HVH A;  4ECR A;  1Q82 T;  1KVJ A;  3GCW P;  4DPO A;  1QAI A;  2DXD A;  2NQP A;  3BN4 A;  4O0N A;  2EKN A;  2MQP A;  2HZC A;  1S49 A;  1PSD A;  2WW4 A;  3I5B A;  2MGZ A;  1BQN B;  4CO0 A;  5HVG A;  1Y3J A;  3JS9 A;  1HI1 A;  1RAH B;  1WTF A;  2GQC A;  1XNR F;  3BGF A;  1GQE A;  2KG1 A;  2LVW A;  3DRS B;  5FLX Y;  1YIJ S;  1U48 A;  1GMW A;  1S7I A;  2FZG B;  1GXL A;  2F9D A;  1G1X A;  4IG3 B;  4YME A;  5GAE U;  5JUM A;  4N8N A;  4PG8 A;  5LMN F;  1SCJ B;  2O5D A;  1YBT A;  3MMC B;  3AXM A;  5E3Q A;  5CCL A;  5RUB A;  2OKQ A;  1ZH5 A;  3PW5 A;  3CUL A;  1IKX A;  1JKH A;  2WVC A;  4USV A;  2V9K A;  4LSZ B;  1TL7 B;  1JLF A;  5GAD I;  1FFS B;  1HMV B;  2B6A B;  2ALZ A;  1S4E A;  4ZVQ B;  3MPY A;  1MMN A;  2EEY A;  2H5E A;  3T19 A;  3G6E S;  3QT6 A;  3Q8Y A;  3W7B A;  1OSD A;  4DR5 F;  4C8K A;  4JI1 F;  5J2P B;  4LF4 F;  5D4P A;  1F60 B;  1WG5 A;  3OBI A;  1OMS A;  3IS9 A;  4DSJ A;  3OXF A;  2RDI A;  1R6Y A;  4NAS A;  5HSP A;  5I42 B;  1Q8B A;  2G0I A;  5CAB A;  3G6V A;  2OIH A;  1DQ8 A;  1IVZ A;  3OL7 A;  2W9B B;  1X4H A;  2E5G A;  3ET6 A;  5HK4 A;  2LP4 A;  4NLS A;  3CJT A;  5IS2 A;  3T1Y J;  3N79 A;  4NX9 A;  2CUY A;  2OH2 A;  4B9T A;  3HUL A;  1N33 J;  1MWY A;  1Q16 B;  3HFV A;  5A8R A;  5AJ3 J;  3C6U B;  2M8H A;  3CJS A;  3K89 A;  4C11 A;  2V94 A;  4TVA B;  2FGO A;  5DGB A;  3JYT B;  2ILZ A;  2RDJ A;  2HQI A;  1OYE A;  4DL3 A;  4DF4 A;  5HMW A;  1NUE A;  3TYT A;  3PW2 A;  2VD3 A;  5K20 B;  3AH6 A;  2HVI A;  2LKZ A;  3MPU B;  4F4Y A;  3PO4 A;  3MAQ A;  4LJM A;  2FQQ B;  3CO9 A;  4LF7 J;  3KLE A;  3VAL A;  2CJY B;  1SJ1 A;  5E7O B;  3HX9 A;  4A48 A;  2N3L A;  3A3N B;  5C25 A;  1CJT B;  2FHO B;  3CCQ S;  1EP4 B;  1UET A;  2ZHO A;  1OSC A;  4AL6 A;  1RT5 B;  3H8Y A;  3UDL A;  2JL9 A;  1CPZ A;  5K8M A;  2KXN B;  3RR7 A;  3GFH A;  3OXL A;  1YJV A;  4MAK A;  2AV5 A;  1C1B A;  3T1A A;  4XPC A;  2N4D A;  2ZM6 J;  1DJ0 A;  3L3C A;  3EPG A;  3GZ7 A;  1XNR J;  2OMO A;  4ZCM A;  1LW2 A;  1C0U B;  3H4D A;  1Y7P A;  3BSO A;  1UJ6 A;  4H4K C;  5HP1 A;  3KHR A;  1XNQ F;  1KP6 A;  1HWU A;  2RJZ A;  4J7C A;  4ZN1 A;  1XIQ A;  4C7Q A;  6FDR A;  3BKU A;  4DFJ A;  5IT9 Y;  5EWE A;  4NLX A;  3DHW C;  2M88 A;  4KKO A;  4B08 A;  4DV2 J;  1N6Q B;  2AJ1 A;  2X3G A;  2KT5 A;  4F3O A;  4YOE A;  1S6P B;  1VIS A;  2QA1 A;  1FDN A;  4NRT A;  3C6U A;  3EJM A;  4RW6 B;  2V8H A;  4NCG B;  2IYI A;  4OHW A;  5ETV A;  5L1L A;  4AD6 A;  3N5B A;  4X66 F;  1VBY A;  4DR1 J;  1WNE A;  2MQ8 A;  1PBA A;  4YB5 A;  2HVH A;  5DDQ C;  4TY8 B;  1NPK A;  3PYF A;  2NLW A;  3RRK A;  2VG7 A;  2XMV A;  1YTY A;  3QO9 B;  5C5J A;  1NJW A;  4C4W A;  2KT3 A;  1RDR A;  1HBM A;  2JEJ A;  4ZJO A;  4DUY F;  1RCX B;  4A8F A;  1QVF R;  1F2H A;  2XMJ A;  4RNH A;  5HI7 A;  5CD4 A;  1U49 A;  2LLZ A;  1WC6 A;  4J9P A;  4DPX A;  2P5V A;  3R5A A;  3GU0 A;  5HAO A;  1RBA A;  2ZOG A;  3SDE B;  3K2Y A;  4CH7 A;  5C7P A;  3T6B A;  5D3G A;  4H4K A;  3MR5 A;  2E9Z A;  2QJ3 A;  3CJ4 A;  1SIZ A;  3B54 A;  1FXD A;  2GAH C;  4NLP A;  4LSN B;  4QIF A;  2DT9 A;  1Y9O A;  4J90 A;  4DCO B;  2EXU A;  3HVW A;  4URQ U;  2Q79 A;  5E3A A;  2CPY A;  3HVA A;  4DX5 A;  4WCE Q;  1D0E A;  1REV B;  2AEF A;  1U2C A;  2B4P A;  1CQN A;  2FTR A;  4F50 A;  4FBT A;  3PHE A;  2NUH A;  3WC0 A;  5KT2 A;  4EYH B;  1U47 A;  4DR6 F;  2MKS A;  1WUU A;  4KGZ B;  4CDI A;  4M5K A;  3FVY A;  2OUG A;  4RW6 A;  3R6L B;  3O8W A;  2DB1 A;  5KFG A;  1BQM B;  4UOG A;  1AW0 A;  2XI3 A;  3NBP B;  4LRE A;  4NI2 A;  4NLD A;  1TUG B;  3H2V E;  1FXR A;  2GGP A;  1HNV A;  3RW7 A;  2GX8 A;  2R7U A;  1NHU A;  3A8E A;  2MDA A;  2HRY A;  3B4M A;  3VZI A;  4DR5 J;  1WOS A;  1QAY A;  1SL2 A;  2ATL A;  4OHY A;  4I6Y A;  1YVF A;  1ELO A;  2BRK A;  4C97 A;  3DYA A;  2P8I A;  4X4P A;  4QR1 A;  1S79 A;  3IBF B;  3MPD A;  4NLQ A;  3BGO P;  4R0E A;  3MAA A;  3M8W A;  2GNK A;  1S1U A;  1XR5 A;  1H72 C;  3M9O B;  1EKR A;  4KT0 C;  3HD1 A;  4DV2 F;  2RUG A;  2XNQ A;  2JVR A;  4CM2 A;  3MM8 B;  4ID5 A;  4ZPW R;  1VLO A;  5C42 A;  5D4N A;  3NCR A;  3OQ2 A;  4LSN A;  3CO0 P;  3VHQ A;  1HWK A;  4EUV A;  2R2S A;  4P2S A;  4K4V A;  2GVD B;  4C48 A;  1FKP B;  4I67 A;  3FSY A;  1YSJ A;  2HG4 A;  2UVU A;  2R8H A;  2KL8 A;  2MYF A;  2HGM A;  1SKS A;  1JXV A;  3A13 A;  2AZ1 A;  5KFV A;  3TA2 A;  4CO5 A;  2RU9 A;  2ZIT A;  2XWX A;  3AJ1 A;  1R0A B;  4ZLP A;  3ITH A;  5KG4 A;  3L09 A;  3PIP Q;  1FTC A;  2V50 A;  4F02 A;  3ZZP A;  4MKA A;  3RAQ A;  3PCO B;  1SC6 A;  2BRL A;  4L3K A;  3UO0 A;  4ZIW A;  5GAD U;  3LP1 B;  5KFD A;  2LEC A;  2C2D A;  3Q24 A;  1NJX A;  1RTD B;  4RLE A;  1MMD A;  1FX2 A;  2KFY A;  1HWL A;  5HL7 Q;  2YNI B;  2KDO A;  4HAC A;  4QJV A;  4TU7 A;  3OFH A;  4W98 A;  4ZCK A;  1TKD A;  2EI5 A;  2IDE A;  3OVS A;  2H51 B;  2FY1 A;  2QC3 A;  4WK1 A;  3FRZ A;  2ZH8 A;  4DBQ A;  2MQO A;  2EFQ A;  1S6Q B;  4PG4 A;  1IKW A;  4G1Q A;  4M5M A;  4YHH F;  1GH8 A;  3M8P A;  4Q45 A;  1VBX A;  4Q8E A;  1L3U A;  1HR0 J;  4NXM J;  4Q8F A;  2DGO A;  5KOX A;  1FKA F;  3CC7 S;  4IH7 A;  5B0G A;  1FES A;  2XNR A;  3M32 B;  4QYZ K;  1IWA A;  1UW4 A;  2AJ2 A;  2J7U A;  3GYX B;  3HD2 A;  4XPE A;  3K0J A;  1NSK L;  5KFH A;  4DS4 A;  1VC0 A;  4EZ9 A;  2LU1 A;  1W26 A;  2HNY A;  1B0V A;  1RWW B;  2OEK A;  4I56 A;  2KHD A;  4LSL B;  4PWW A;  2Z4P A;  2K7K A;  2DNN A;  3CJK A;  1PG5 B;  3DI6 A;  3QRP A;  3DDK A;  3POT A;  4IDK A;  2P9E A;  3G87 A;  1Q0N A;  5T41 A;  3D6F B;  3H40 A;  4UF4 A;  3T1Y F;  1PKU A;  2LEB A;  2G13 A;  4GKK J;  3J80 U;  4W90 B;  2VC0 A;  4ED6 A;  4ZVE A;  4RBV A;  4YP3 A;  2ADB A;  1X60 A;  1I51 B;  1QE1 A;  2KXF A;  3KUE A;  5F0W A;  3UCG A;  3QJP A;  3W3S A;  4DPT A;  3L9Z A;  1QUP A;  4QU7 A;  1DUR A;  2AX1 A;  2WBM A;  2QFI A;  2BJ1 A;  2V2Z A;  2IM1 A;  3HFZ B;  1RTJ A;  4PUO B;  4ZP9 A;  5E0O A;  4CTA B;  2W7O A;  4J9M A;  1APS A;  2WK4 A;  2NYH A;  4Y6I A;  2B4V A;  3IAM 9;  1F5B A;  2UZA A;  4HH1 A;  3KKF A;  1IQZ A;  1C0T B;  1O6X A;  2CVE A;  3FK4 A;  2QA2 A;  3T9Z A;  5KG7 A;  5H9E K;  1U6B A;  1S4F A;  1WI6 A;  2X51 A;  2BBE A;  2LA6 A;  3CJ3 A;  3R2D J;  2B9X A;  2H5J B;  4UQT A;  1DZ5 A;  1B64 A;  1IR1 A;  1BE4 A;  1KON A;  2MPU A;  4HHJ A;  4PG5 A;  4ECS A;  2CQI A;  4U8Y A;  4ED4 A;  3KLF A;  3TAN A;  2UUC F;  4NYP A;  3EZU A;  4U9R A;  1AUD A;  2E7X A;  2GMJ A;  4OL8 A;  1E6Y A;  4KIA A;  2Z56 B;  1SB6 A;  2CPI A;  4RW7 A;  2C2M B;  3KDN A;  2HLT A;  2X1A A;  1OWX A;  2HHS A;  1F9F A;  1ULR A;  4K4U A;  1S97 A;  2IIH A;  3OTD A;  2B56 A;  3NNC A;  2MZJ A;  1OO0 B;  2YWK A;  4WIQ A;  3CCM S;  1T03 A;  2OPQ B;  4X4Q A;  2JC0 A;  1I94 J;  1NDP A;  2DNL A;  3CDA A;  2POK A;  3AA8 A;  4M5I A;  1YZ7 A;  3KUH A;  2K06 A;  1TL1 A;  2GHW A;  2GS8 A;  4M5D B;  4Q7A A;  5T7L A;  2ROG A;  3R5G A;  2Z58 B;  2RSQ A;  4J9R A;  2FLN A;  4HHU A;  2WW8 A;  5F8M A;  5KFP A;  1TL3 B;  2EVZ A;  1L3V A;  5JVG Q;  4JV2 A;  5JJB A;  1SV5 B;  4K2J A;  5I3P A;  5K14 B;  5CAA A;  4DSF A;  4DPY A;  4JI6 J;  3F41 A;  2VOD A;  4IRD A;  2D69 A;  2BAC A;  1HW9 A;  3AQP A;  3FMW A;  4OQJ A;  5K8P A;  4DQQ A;  4K4Y A;  2CQ0 A;  4HI1 A;  2V5H G;  1S1X A;  2XY5 A;  2HBR B;  5KG6 A;  5A8W A;  3LGH A;  1TK8 A;  1JXL A;  2G4B A;  2J0S D;  2LYV A;  5I3Q A;  2ZUA A;  4ANE A;  3EUN A;  4F25 A;  4RX6 A;  2CAJ A;  3GWC A;  2CDR B;  4N47 A;  3ZTQ A;  4Q43 A;  4C8N A;  2R2U A;  3UW1 A;  3GYN A;  2Q6B A;  2Y1R I;  3HKW A;  4ILM A;  3C2P A;  3SQG B;  4K4S A;  1HNX F;  1WSR A;  3SDE A;  1FJC A;  3AT1 B;  3I87 A;  1AT1 B;  1IBL J;  2B5J B;  1WEL A;  1UWB B;  4OYP A;  3O2I A;  2DR7 A;  3RB4 A;  2DNM A;  4M5L A;  3RGI A;  4ECT A;  2BOP A;  4C0H A;  2RML A;  3ET6 B;  3SQO P;  3TUZ C;  3W61 A;  2AYM A;  3TW0 A;  1VRU B;  3FCV A;  4HR2 A;  3NOC A;  3KLE B;  3Q8Q B;  4IO9 Q;  3QAU A;  1YRU A;  5GAG U;  1S1T A;  3LPY A;  3N28 A;  3K8V A;  1U45 A;  3CME S;  1QD1 A;  3BQ1 A;  4LR8 A;  2M2B A;  3TAR A;  4NLG A;  5G0R A;  1UPP A;  2IVM A;  2C3P A;  5KT3 A;  1XEZ A;  5DO2 A;  3NNA A;  2MLX A;  3DLH A;  4DG1 A;  4M8L A;  2GGP B;  4PXC A;  5E5N A;  4A8O A;  2HW3 A;  4H4M B;  1U1M A;  2M0G B;  2GVZ B;  1WEZ A;  4KO0 B;  4B3R J;  1FVQ A;  2YKM A;  3G8Q A;  4NLR A;  1Z4U A;  2MLY A;  5IV4 A;  3HPO A;  3ENQ A;  4J9N A;  2EWH A;  3MMA B;  5EHH A;  4X4U A;  2DVI A;  2VHG A;  3Q2S C;  2WVB A;  1P6T A;  4GO7 X;  4OYB A;  3GJT B;  4ZA1 A;  2DCL A;  3SQG A;  4CT9 A;  2QO3 A;  3C14 A;  4ZVF A;  5LM7 E;  2J9E A;  2BE9 B;  1OIA A;  3A4T A;  3HHN B;  1VFJ A;  2YNG B;  1NM2 A;  2HGL A;  4PYA A;  4JI4 F;  4JBC A;  3M6X A;  1LWE B;  4URG A;  1H74 A;  5IT4 A;  3KYL A;  4DL6 A;  3PKY A;  1W2B R;  3ZTO A;  2AEJ A;  4BC7 A;  3DC2 A;  2H3E B;  5L1K A;  1HHS A;  4AQY J;  5HAT A;  2VA3 A;  5HQ8 A;  1Y5N B;  3LP2 B;  5KTQ A;  1ZZN A;  4NCG A;  2FLL A;  4M63 A;  1NKE A;  5CQG A;  3OT9 A;  2JH3 A;  1EQ0 A;  3I0R A;  2HHX A;  2HNZ A;  4OLO A;  3HZE A;  4I2Q A;  7AT1 B;  1HBO B;  3M8Y A;  4DR2 F;  2DNK A;  3MEE B;  1ARO P;  1S9E B;  4Q44 A;  4DS5 A;  5CYQ A;  2KRB A;  1VQK S;  2VON A;  4CLU A;  5D3G B;  3KHH A;  2JDJ A;  1R8B A;  2CNO B;  1ZTT A;  2WVD A;  1RUS A;  1WEY A;  2ZJP Q;  3A8J A;  5HMZ A;  1URN A;  3R5C A;  5HVF A;  5K9F A;  1N5Q A;  1WOP A;  4NOH A;  1Z2L A;  1T03 B;  2UUT A;  4EO8 A;  1M5V C;  1ZPW X;  3PIO Q;  2RRA A;  5CA5 A;  3DDN A;  2J76 E;  1HBN A;  3Q8R B;  1X9M A;  1KKH A;  4WE1 A;  3BN7 A;  3S6E A;  4JI5 F;  3AFG A;  4DR7 J;  3RAX A;  3NS7 B;  2BE2 A;  1FO1 A;  2PO4 A;  3CCT A;  3CCL S;  3K8W A;  4PCQ A;  3J7Y U;  1HQU B;  3VZH A;  1GEH A;  2FD2 A;  3CDW A;  3I9V 9;  3R5D A;  5CYM B;  4X4R A;  5J1P A;  2YQ3 A;  2H4W B;  1XNQ J;  2H9Z A;  3IGN A;  4KHP J;  4LF8 J;  1CQM A;  1HNV B;  4AFF A;  1VGY A;  4QW8 A;  3UR0 A;  2XC9 A;  4FF3 A;  3QT8 A;  2YKN B;  2D74 B;  3DM2 A;  3GV7 B;  1JLC A;  1F5C A;  2QLJ B;  4MYT A;  3W64 A;  2JLG A;  1VQ4 S;  3I0S A;  3F56 A;  3CJK B;  4ILL A;  2CPZ A;  2R7V A;  5FD1 A;  3EYZ A;  5GME A;  2ALY B;  1CJT A;  3IM9 A;  2X1F A;  3V6J A;  1M1K T;  2HNZ B;  2E9T A;  1N36 F;  2HFZ A;  2DYA A;  1SC4 B;  2Z2Y B;  3EZ5 A;  4P9S A;  3SV3 A;  3P5B P;  2ZH3 A;  2BXJ A;  2QGF B;  2VG5 B;  3OL9 A;  3GFZ A;  3IR5 B;  4WXO A;  4CH0 S;  4P6Q A;  2KT2 A;  1CJU A;  1UZD A;  1FE4 A;  3MTJ A;  4J37 A;  4LR7 A;  6AT1 B;  3PX4 A;  1RHR B;  4DPW A;  4EYI B;  5DJB A;  3DRX A;  4RO0 A;  5HBM A;  4B17 A;  3BYP A;  4B9L A;  1R0B G;  5A8K B;  3AQO A;  4YY3 F;  4LF6 F;  1SJ3 P;  2BW2 A;  2HAI A;  4F2R A;  1P1T A;  5B0F A;  4ED3 A;  5AXN A;  4OZ2 A;  1VHI A;  5DQI A;  1KWM A;  4ED5 A;  1P27 B;  2CFX A;  1BXN A;  3D5M A;  3GSD A;  4ZOS A;  2N7C A;  2J9D E;  2X7I A;  3SXL A;  4BLG A;  4URS A;  1SC1 B;  1UKU A;  1VRQ C;  1U7L A;  1RAO A;  2ZEJ A;  3NGD A;  4OJG A;  2EFN A;  3SSQ A;  5D78 A;  1Q8I A;  2MEW A;  2UXB J;  2DIT A;  4KGV B;  3SIP B;  4DV7 J;  1NK5 A;  1RB0 A;  3TQ1 A;  1QVG R;  1K9M T;  2PA3 A;  1B3T A;  3AD8 C;  1R8C A;  3DOK A;  3F73 A;  4I1T A;  5IWA F;  2RNE A;  1R7I A;  1S0V A;  1N32 F;  2DGT A;  3QT7 A;  1NRK A;  2E1P A;  3RYL A;  1V6H A;  2KO1 A;  2LU2 A;  2F63 A;  3C14 B;  5E41 A;  1KTQ A;  4ITS A;  2WAQ D;  4DR7 F;  4LFA F;  2VQE F;  1Y00 A;  2QRR A;  1EET A;  4QWE A;  1CJU B;  4NZ0 A;  2IM0 A;  4EGL A;  1J5E J;  1YK9 A;  1HIY A;  1RU1 A;  2YKO A;  1UEK A;  2DIU A;  3UR3 C;  4ALZ A;  2DO0 A;  1Q5Y A;  4GKJ F;  3LF0 A;  5C2C A;  1IBC B;  3H25 A;  2FZK B;  5KFR A;  1RTI B;  1SQG A;  2GML A;  1TZ0 A;  2NSC A;  2HK2 A;  4UW2 A;  1J2V A;  2W4D A;  1RIS A;  2HVZ A;  4DOZ A;  3GIL A;  4FDF A;  5BYR A;  1NK9 A;  5ETK A;  1X4C A;  3PXG a;  4KPY A;  2DEJ A;  4F4K A;  3SV4 A;  2V4J B;  3QT5 A;  3NBP A;  1K1S A;  2YQ0 A;  4KH1 B;  5KFF A;  3Q83 A;  1T95 A;  2CPD A;  2DIS A;  2AGQ A;  2IBK A;  2DNR A;  4K0K F;  2IC3 B;  1N88 A;  2KHC A;  2H1Y A;  2M52 A;  2Q3P A;  4CQ1 A;  3M8R A;  2E5L F;  3H5X A;  1JLG A;  1L3K A;  4R8U B;  1QE1 B;  1RWO B;  5KFW A;  1TTH B;  3D1Q A;  3LQV A;  1B7Y B;  4OV1 A;  4BC9 A;  2WCX A;  3PNI A;  3IFE A;  4FF4 A;  3VVU A;  4ES2 A;  4DFP A;  1WHW A;  1RTJ B;  3FZB A;  3QQC D;  2E1C A;  4PUO A;  4G1P A;  2VPY B;  1KVI A;  1QY7 A;  2V2Q A;  4CZC A;  2KTQ A;  3KLI A;  3NRB A;  2Y8W A;  4K7Q A;  3KHG A;  1C0T A;  1OY9 A;  3T3F A;  1SH2 A;  2CZ4 A;  2FJD B;  8ATC B;  1VQ7 S;  1PO6 A;  1F6T A;  2W2N P;  3H4B A;  4GO5 X;  3V5R A;  2HS4 A;  4DLE A;  4DQR A;  3T1H J;  4USH A;  2CRL A;  2ZFH A;  3D0H E;  3IR7 B;  4FXV A;  4KGK A;  4L75 A;  4LBH A;  3BBC A;  3PEJ A;  3HLU A;  1ACM B;  1RTH A;  3ONQ A;  3QIP A;  2FYX A;  1RTI A;  2GHP A;  4CNZ A;  4E2F B;  2BMB A;  3DLG B;  2CDQ A;  5L9X A;  2BW7 A;  1M5P C;  4XTT A;  4P7V A;  2QEX S;  4KC5 A;  3RB3 A;  3EVM A;  1FKO B;  5AXK A;  4MKY A;  4X4N A;  1RQ0 A;  2D41 A;  5LL6 d;  1NK7 A;  1OQ3 A;  2C2O B;  4X2B A;  4ZKA A;  1YBA A;  4HAC B;  4UY8 5;  2C2N A;  1OPZ A;  3JSR A;  2FVR A;  4PQU A;  4K0K J;  3M2U A;  4ZPB A;  1ZBT A;  2ZDO A;  4LRB A;  4RUA A;  1YJN S;  3TRG A;  1FER A;  2BEF A;  4CI0 B;  3UCU P;  3NS6 A;  2VUG A;  2AJF E;  3ISN C;  5B0E A;  4NPO A;  2BQ3 A;  4B3S J;  2AX0 A;  2CQP A;  3C3L A;  1IQT A;  4TYA A;  4OI3 A;  4ZVH A;  2A6M A;  3DRP A;  2CPF A;  2YWH A;  3HI9 A;  1R31 A;  5IC4 B;  2KJW A;  2RQK A;  2XS5 A;  1MRO B;  2F5G A;  2IRY A;  4IRC A;  2YXL A;  4PEO A;  1AB8 A;  4V19 J;  1NBE B;  1XJW B;  4NYZ A;  1CJK A;  3KLV A;  5DRK A;  1T9U A;  2EKY A;  3EXY A;  4WZM A;  3LP2 A;  3J7A 1;  5AE3 A;  4HDG A;  3DLG A;  3DI6 B;  2ZH2 A;  5KG0 A;  3D9B A;  3G6X A;  2KH9 A;  1U4B A;  1HQE B;  2CNN B;  1XMO F;  4X62 F;  2NXC A;  3OD2 A;  3FZ2 A;  4Y3C A;  3OFG A;  1XC9 A;  2HHP A;  3FBE A;  4M5G A;  1Y3K A;  3G6Y A;  3D2W A;  1VQY A;  1F5A A;  1MW7 A;  2CJB A;  2ZH7 A;  4I7F A;  1VQO S;  1DHM A;  1HNI B;  3EDQ B;  4N56 A;  2MZS A;  2IYG A;  4UUW A;  5BYS A;  1NKC A;  1D9F A;  3M9M B;  4UQG A;  4RW9 A;  3E2E A;  2ASL A;  5D4L A;  1M5S A;  2OPS A;  4DX7 A;  3P3D A;  2MJN A;  1YRX A;  1P8G A;  1S1T B;  3OVB A;  2CIM A;  4LF2 A;  1RTZ A;  3FJ2 A;  1RWP B;  2RHS B;  1EAR A;  1R0A A;  2NR0 A;  3B4D A;  4DN0 A;  4QIE A;  1RHK B;  3BSC A;  2QL5 B;  5A2Q Y;  3D6T B;  1DTT B;  4RR5 A;  2I6W A;  5L46 A;  3NMA A;  5D0E A;  2CPE A;  3DGV A;  3P8B B;  1FEH A;  2LEA A;  2XGP A;  3KXD A;  3X1L B;  4ELU A;  2ZWO A;  3E01 B;  4JI3 J;  4QWC A;  1DQA A;  4PZV A;  3DNC A;  2VDI A;  1DQ9 A;  4OHX A;  1S48 A;  5EN1 A;  2OGU A;  1HMV A;  2B6A A;  4P75 A;  2O3D A;  3GE9 A;  3MMA A;  3G9C A;  1GTE A;  2L41 A;  4RW4 B;  4P7T A;  2Z57 B;  2ADC A;  1NB7 A;  1SIW B;  2KN4 A;  4P10 A;  4DV3 J;  1UZH A;  1UVK A;  3AJ2 A;  3MEC B;  1KN6 A;  3J81 Y;  1QSY A;  4IG0 B;  3CPW R;  5J2N A;  2YNI A;  2WB1 D;  1N34 J;  3DFE A;  4IFY A;  2Z30 B;  2H48 B;  4USM A;  2Y8Y A;  2HRT A;  2ZOF A;  2YNG A;  3EMT A;  2UUA J;  2GA7 A;  2G9O A;  4E8U A;  4KHR A;  3OLA A;  4DV1 F;  2V8P A;  1Y5I B;  1IWG A;  3L7U A;  2XB2 D;  3HZG A;  4CLW A;  1HYS B;  4RUC A;  5GVQ A;  4ILR A;  4F2S A;  3CCZ A;  1B4S A;  1PAE X;  2WBR A;  2OI2 A;  3G2X A;  3THP A;  4ECX A;  2PMW A;  1PIE A;  1WDD A;  4G6V B;  2Y0B B;  2ZD1 A;  5IWA J;  2QLB B;  2QL9 B;  3QID A;  2PA8 D;  2C3U A;  4ECU A;  4DZD A;  1D8Z A;  2ZBI A;  3QFW A;  3DKD A;  3CDB A;  4YR3 A;  4WP8 A;  1PYO B;  1S1V B;  2LXU A;  4O3P A;  1VOM A;  2VAS A;  2YX4 A;  3MM5 B;  3MM6 A;  3AAW B;  1HLW A;  4N77 A;  5D4O A;  1UPM B;  5D6G A;  3KLG B;  4QBU A;  3TAQ A;  3CIZ A;  1FJE B;  1TP7 A;  2P6T A;  1C0U A;  2I38 A;  1ROF A;  2FJA B;  5DZ7 A;  1CS4 A;  2W7A A;  2WVF A;  5SUH A;  3W2W A;  2CJK A;  3X3U A;  3UCZ P;  3TI0 A;  2ACM A;  1C2P A;  3R9L A;  2B4O A;  1FD2 A;  4YR2 A;  1GAO A;  1N6Q A;  2PII A;  1FNM A;  4OLP A;  3MUV P;  4FYW B;  1YBU A;  4P71 A;  1KLN A;  2ZBR A;  2HHH F;  2RT3 A;  5IV3 A;  4HLB A;  2FHJ D;  5IQ6 A;  4DF8 A;  2DKO B;  2ZDP A;  4C8Z A;  2D3O 1;  3NY0 A;  3LWL A;  5IT0 A;  1FFW B;  4XO0 A;  3DOM A;  4QWD A;  2HRU A;  3H0P A;  3HVT B;  3A12 A;  2FVC A;  4O44 B;  3NEK A;  5H9F J;  4U7C A;  3ILI A;  3KG0 A;  1KC8 T;  2AMC B;  3W9I A;  3M2V A;  4TQS A;  3J7Z T;  3GIK A;  4BS2 A;  2K3I A;  2W2P P;  4USI A;  1N32 J;  3T6J A;  1J5O B;  5F8J A;  4F7V A;  2QLX A;  2DH9 A;  1VI7 A;  3M8Z A;  2BZ2 A;  2BM0 A;  1XMQ F;  2HMI A;  1X9S A;  2CWK A;  3NGU A;  2BJD A;  3HJV A;  2MST A;  4DQS A;  2ZOM A;  1AA1 B;  4U96 A;  4R5P B;  4I2P A;  4ZPA A;  2W9C A;  3LO3 A;  2VIH A;  5J2Q A;  3QO9 A;  3KTQ A;  3NL0 A;  1AFI A;  3MF5 A;  3LP0 A;  1YJU A;  1XMB A;  3BM7 A;  4KQZ A;  5IFM A;  4I64 A;  3A8I A;  4KHP F;  1NME B;  4RW7 B;  4B3T F;  2M8D B;  5DGA A;  4DI6 A;  5L1I A;  2KRR A;  2VDH A;  4IOB A;  4O3Q A;  2MQQ A;  1BWV A;  1IXK A;  1DAX A;  2H54 B;  3HKZ D;  3M8Q B;  3KOA A;  2DR6 A;  5KT6 A;  3ZZT A;  2VJU A;  1PJ5 A;  1NDK A;  4X4T A;  3ZC4 A;  1HNW J;  1UVM A;  4P73 A;  4F4A A;  4JI7 F;  2OPQ A;  1UA0 A;  4M95 A;  7FD1 A;  1UTA A;  5HBM B;  2VA2 A;  3QRQ A;  4QR2 A;  5IZH A;  2PI4 A;  3JB9 k;  1VQ5 S;  1IKY B;  3KK2 B;  1P1L A;  2G0J A;  2ASJ A;  5C24 A;  1BMQ B;  1LW0 A;  2V6A A;  3ISZ A;  2QE5 A;  2IJR A;  3H42 A;  4CRJ A;  2G0C A;  2VU5 A;  1JNR B;  2DY1 A;  1N4L A;  2RB7 A;  3CD6 S;  4ZS6 A;  1FI4 A;  1J5O A;  3KWM A;  1RLD A;  4Y2C A;  4M5N A;  1IBM J;  3VGT A;  3R7S B;  2DH7 A;  1RT5 A;  1UJ4 A;  2B7B B;  2DNG A;  1HI0 P;  2OJ3 A;  3D68 A;  1MSW D;  1MU2 A;  1X5P A;  2R7R A;  1LV5 A;  1FFG B;  3PG9 A;  4OHZ A;  1SC3 B;  4OJ3 A;  1BQN A;  2VB6 A;  1CUL A;  1B0T A;  2PFF B;  2VFS A;  4QW9 A;  1K44 A;  4ZCI A;  2DTJ A;  4LF5 J;  3DRS A;  1LXJ A;  4C9D A;  5A6P A;  3P6Y C;  1SKR A;  1K47 A;  4TU8 A;  3JQJ A;  2W8L A;  1PC4 A;  1JB0 C;  2JFK A;  2DHG A;  2CQ1 A;  1RAD B;  2RS8 A;  3OR2 A;  4MFB A;  1HW8 A;  1VQ6 S;  1X4E A;  4FP9 A;  2VL1 A;  1SJ4 P;  1RLC L;  5I4M A;  3IWN C;  4K4Z A;  4YDD B;  3AOC A;  3BDE A;  4QYZ J;  2GVD A;  2YVS A;  1R89 A;  3OSN A;  1VRT A;  3TP2 A;  4IG3 A;  1JMT A;  4WU3 A;  2EG1 A; 
#chains in the Genus database with same CATH homology
 4DV6 J;  2UXD J;  2KVQ E;  4V1A k;  3D3C J;  3D3B J;  4JI7 J;  4NEY A;  1IBK J;  4X66 J;  5IWA J;  4DR6 J;  3T1H J;  3J81 U;  4DR4 J;  1XMO J;  4DR7 J;  4NXN J;  4JI2 J;  4DR5 J;  2VQF J;  5LMN J;  1I94 J;  1XNQ J;  4K0K J;  4DV0 J;  4YHH J;  4KHP J;  4LF8 J;  1XMQ J;  4KYZ A;  5IT9 U;  1N36 J;  4DR3 J;  4JYA J;  4HHU A;  4JI6 J;  4DUZ J;  2KL8 A;  4KY3 A;  2HHH J;  1N33 J;  1N32 J;  3J7A N;  3W1Y C;  5AJ3 J;  4B3S J;  2VQE J;  4LFC J;  4X64 J;  4OX9 J;  4LF5 J;  5A2Q U;  5FLX U;  4LF7 J;  4DV4 J;  4X62 J;  4LF9 J;  1IBL J;  4JI0 J;  3JAM U;  3R2C J;  4JV5 J;  5BR8 J;  2ZM6 J;  1HR0 J;  1HNW J;  2MEW A;  1XNR J;  2UXB J;  4NXM J;  2UU9 J;  4DV7 J;  4NEZ A;  4JI8 J;  4YY3 J;  3R2D J;  4DV5 J;  4RJV A;  4DV2 J;  4PWW A;  4LFB J;  5LMU J;  4B3R J;  3IMQ J;  1IBM J;  4DR1 J;  1HNX J;  1J5E J;  2MQ8 A;  4LF6 J;  4LFA J;  4DR2 J;  4JI4 J;  4GKK J;  3J80 U;  4DV1 J;  4DUY J;  4JI5 J;  5LM7 E;  4JI3 J;  1FJG J;  2F4V J;  4X65 J;  4B3T J;  3OTO J;  4DV3 J;  4JI1 J;  1HNZ J;  4AQY J;  1N34 J;  4LF4 J;  3T1Y J;  4GKJ J;  2UUA J;  2MTL A;  2UUC J;  2UUB J;  2E5L J;  2UXC J;  4B3M J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...