4RJVA

Crystal structure of a de novo designed ferredoxin fold, northeast structural genomics consortium (nesg) target or461
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
MEMDIRFRGDDDEALARALLKMVVRAVSFGAQVRFTDDGNDLEIRITGVPEQVLKELAKEAERLAKEFGITVTRTIRGSLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR461
rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords OR461
total genus 24
structure length 83
sequence length 83
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4rjvA00
1N32J 1IBLJ 3J81U 4DV2J 1XMQJ 4YY3J 4JI8J 2UU9J 1I94J 4X65J 4B3MJ 3W1YC 5LMNJ 1FJGJ 3JAMU 4KHPJ 2UXDJ 4DV7J 5AJ3J 4JI4J 4KY3A 4NXNJ 4JI0J 4DV4J 3T1YJ 5LM7E 4DR5J 4DV6J 4JI6J 4YHHJ 4DR3J 3J80U 1IBKJ 3IMQJ 1HNZJ 2ZM6J 5LMUJ 4DV1J 2E5LJ 4DV0J 2UXBJ 4V1Ak 4PWWA 1XMOJ 4LF9J 4X62J 1XNQJ 4X64J 2UXCJ 4LFCJ 2KVQE 3R2DJ 2MQ8A 4LFBJ 4X66J 4HHUA 4B3SJ 4OX9J 5IT9U 4DR2J 1IBMJ 5FLXU 4JI7J 4JI2J 4DR7J 4JV5J 2MTLA 4GKKJ 4DR6J 4B3TJ 4DUYJ 1N34J 2VQEJ 4NXMJ 4NEYA 3OTOJ 2MEWA 1XNRJ 5A2QU 4NEZA 3J7AN 4LF8J 2UUCJ 4JI1J 2UUAJ 5BR8J 2F4VJ 3T1HJ 4KYZA 5IWAJ 4JI3J 1J5EJ 4GKJJ 1HR0J 2UUBJ 4JYAJ 4B3RJ 2HHHJ 4RJVA 2KL8A 4DR4J 4LF7J 4DV3J 3D3BJ 3D3CJ 1N36J 1N33J 4LF5J 4DR1J 1HNXJ 4AQYJ 4DUZJ 4DV5J 4K0KJ 1HNWJ 4LFAJ 4LF6J 2VQFJ 4JI5J 3R2CJ 4LF4J
chains in the Genus database with same CATH superfamily
2YNGA 3DKDA 4HEA9 2C42A 3QIPB 3SBMA 1OSDA 5BYSA 1S1VB 2G0CA 1RWXB 3SCJE 2M88A 2DIUA 2ZHOA 1TKDA 1PJ6A 4RBVA 4PG7A 3I56S 4K0KF 3NG8A 2LEAA 3H98A 2DTJA 2HNZB 1X4FA 1NAQA 3LAMA 4F3OA 4WIIA 5D6GA 4I4BA 3W3SA 1M0SA 3FEZA 5KFGA 2EK1A 2XYHB 4DV7J 4PXDA 2YNGB 3FMBA 4NLQA 3WIUA 3K17A 3BDPA 2A18A 2QC3A 5IS2A 1S1VA 1RQ0A 4HTIA 3ADAC 5LSRA 2Y3YA 5HQMA 5KFCA 2HLUA 4JI7F 1AXQA 4QIGA 4QPXA 3MM6A 1UPMB 2ERRA 1QDUB 4X4VA 4JI6J 4U6PA 5CZVA 3CJQA 3J80U 4XPEA 1FNMA 2G2YA 5C2CA 3CJKB 1NK6A 1HMVB 1B64A 4JBCA 3MM9A 4PWWA 4FYWB 5HP1A 4H4MB 1RTJA 5H9FJ 3LTOA 3D6MB 3AOCA 5HLFB 1JQGA 4Y28C 2XI2A 2WAQD 4ILRA 4TN2A 2HNYB 2EG1A 4DUTA 2IMWP 1YBAA 4CNYA 4X64J 4LFCJ 4AE5A 1RDRA 1A0OB 4NMLA 2KVQE 4KHRA 3NY0A 2HHPA 4LRBA 3VF0B 4DU7A 2HG4A 2KTQA 1U02A 2MQ8A 2AYMA 2XMWA 1S1WB 4RW8B 4YDDB 4KH1B 5HL7Q 1MWYA 1Y0HA 3UQSA 4ANDA 2MZ1A 4LQ3A 4RBUA 2DXDA 2KJWA 3OL7A 3W9HA 4MH8A 3PX4A 4OX9J 2O67A 2QA2A 3HDSA 2ZJRQ 1VBZA 1Q8IA 1CJTA 5DGBA 3ILLA 4IFYA 1N0VC 2L08A 4TQSA 4DLEA 1UFWA 2VC0A 5KG0A 5CAAA 1YKWA 3G96A 2DGQA 3I32A 1NKEA 2B7BB 4GKJF 3IR6B 3NWRA 1FRKA 4KKOA 2RH3A 3R97A 2V68A 4CH1A 3ZTPA 4DR3F 3FSXA 4KGVB 1JXEA 4KPYA 2ZZNA 5KAKA 1BY9A 1Z2LA 2IRYA 4B9MA 3TA1A 1OSCA 1OS5A 1JMTA 3EZOA 3L95X 3MZIA 3QT7A 3BQ1A 1RTDA 2BACA 2XY5A 2FJVA 2VA3A 1TFYA 1IVZA 3OJSA 4O4GA 2NXEA 3IWLA 2BRLA 3OV7A 3T1HJ 2VFUA 3IRXB 1R27B 2H4YB 2KB2A 2RHSB 3PYGA 1B7YB 1RAOA 1VI7A 2I0XA 2ZFHA 5H1SV 1LK7A 4N8NA 2M4MA 2X51A 3P5TL 4FYXB 4M5LA 3SCIE 1FRMA 4C0BA 4C7QA 1L3SA 4X4NA 2JRSA 3D9BA 5J2MA 1FX2A 1PYTA 2CQ4A 5E3PA 5IT0A 4S0MA 2R9LA 5I3PA 5C42A 5L9NA 1AYEA 3EMTA 3MCMA 4E2FB 3MURP 2KHDA 5D4PA 1P9QC 4A48A 2M7SA 2KL8A 4RUAA 4LF2A 1Z2ZA 4CNZA 4DWIA 3KLIA 1N56A 3L4BC 4ID5A 4HI1A 4PPDA 3CJRA 1VC5A 4ECUA 3ZZPA 1D8YA 4RR5A 5BYQA 3DM2B 2R7UA 2HVHA 2IVYA 2AEJA 1S1TB 3FBBA 2XMJA 2KH9A 1IQZA 4J9NA 1D0EA 1UVIA 1HNXJ 3HLUA 1P1LA 4PUOB 4P10A 4Q5VA 1LW0B 2B3TB 2XY7A 4RW6B 1H38A 2DNKA 1IBKF 2DH8A 2BJ9A 4WXOA 1NPPA 3JYTA 4OZ0A 1U1MA 4IDKB 3MCNA 2D3OR 2GHWA 3OTCA 1N32J 1VBKA 4DQIA 2LXIA 4JI8J 2J0XA 4B02A 1K8AT 1TKTA 4P52A 3UNGC 3GYXB 2UU9J 2CIMA 4F4KA 3QJJA 2GO8A 4Q0BA 2E44A 4JI8F 4PWDB 2EFPA 3MPYA 4UY8T 3KLFB 3HCXA 1R89A 1C1BA 5KFUA 3ZZYA 4B9VA 3EYZA 1KVJA 1ZZNA 4NI2B 1DJ0A 5E41A 4PQUA 1KDNA 4URGA 4CWBA 4WZQA 3G82A 2BDPA 4M5MA 1EJ7L 2AW0A 1NU4A 1SC6A 1S6QB 3ETOA 1RXOB 5T41A 4E0DA 3V6DA 5A8WB 5CA5A 1TZ0A 4M5DB 4ED8A 3UWTA 2OJ3A 1S0OA 1RWPB 3BN4A 4WU3A 1JLFA 4K4XA 4NYOA 1XBWA 4IH5A 3TW0A 4QR1A 4GVBA 4ED0A 2HGNA 1S1UA 1O5JA 2CQCA 3GFXA 3M8YA 4NLYA 3CMAS 4AL7A 4C4WA 3ENWA 2EBEA 2RF2A 3EZ5A 1S6QA 4DFJA 4G1QA 1F3VA 4J9MA 4CLYA 1WG4A 4X62J 4LVOP 3RB3A 2CJYB 1VMBA 3LWLA 1U49A 2ASYA 1RWMB 1VIOA 2Z58B 3PJWA 5AE1A 7FD1A 1RT2A 3GYGA 2DRBA 5CD4H 1U4BA 1EAYC 2HQIA 4USWA 3KOAA 1LV5A 2HK3A 3H2VE 5K8OA 3UCUP 1IXKA 1BHNA 2HVZA 3NWGA 1F5BA 3T1AA 2ZH7A 2XYGB 4BWJA 4ECSA 1M5HA 3SSSA 5K5MA 2MTLA 2FZCB 2VKRA 2KG0A 3I55S 4J9RA 1S6UA 4B3RF 3OHBA 3C16B 4KO0B 1N34J 2QSWA 3RR8A 3ISND 2XM3A 4K8RA 3ILOA 3NCQA 3PRVA 2F8EX 4NEYA 3OTOJ 4KHPF 2QA1A 3HSDA 5B0BA 1RWKB 3RRGA 3HHLD 1WDTA 1WI8A 2D3UA 1V3ZA 5A76A 6AT1B 3KHLA 1RYRA 4C2MA 3J7Z5 3PW2A 3HSJA 3Q8YA 4FVMA 4GKKF 2FHJA 4KO0A 4PKDB 3M2RA 1TK5A 2VG6B 1XC9A 1HARA 2DHGA 2OPSA 3CJSA 1ZH5A 2YKNB 4CO5A 2CQ3A 4CO4A 4X4RA 1K0TA 2I5JB 4FPIA 5K8NA 1Q5YA 3H4DA 4FF3A 4Y34A 4X4UA 3BR8A 2NUUG 5KFLA 1YITS 1ZBTA 2VJVA 4AFFA 2MKHA 1IM4A 1FXDA 1GFWB 1SC4B 2MKSA 3KG0A 3UVJB 4C8MA 2KXNB 1KQSR 3X3UA 3ONQA 4M5GA 2FVPA 3AT1B 1IR0A 1X31C 2V6AA 4W4MA 2ZH8A 2MMYA 1SBRA 1MROB 3LO3A 2FUG9 2JZ5A 4C0OC 4CH0S 2PEBA 5MLCV 3PJ9A 1V3RA 4ZLLA 4G1IA 1XMQF 1NK5A 1K44A 1NUEA 2P9GA 3M8SA 4QIFA 2HBYB 3N0VA 2R2UA 1RT6A 2LXFA 3TJ9A 3QATA 3W65A 4WFBQ 3KLEA 1M90T 3PYFA 1H2UX 2JC0A 2CQ2A 1YJNS 2JFKA 2IRUA 1FKAF 3UN5A 1QTNB 2IAJA 4C11B 1N33J 1VR6A 3MTJA 4DPUA 1FEEA 2C2NA 2BQRA 1ZM3A 4F26A 2PT0A 3OPKA 1VQ4S 4LF6J 4X4TA 4L75A 3TO8A 1BUXA 2UU9F 1VISA 1GMWA 1HL6A 3BDEA 5CYQA 5D0HA 2C3OA 3W62A 4DF8A 2RS8A 3ZO7A 3BYPA 4Q2MA 5M2UA 4C8YA 3OQ2A 4JB8B 1EX8A 2JOQA 2HIYA 4KBIA 2OTJS 3KDNA 2VZ9A 4IH7A 1T9XA 4N77A 2BJDA 3BPDA 4J9PA 4PUOA 2HW3A 2N4DA 2B8QA 1LQ9A 4P2MA 3UW1A 2U2FA 5J2PB 2DXEA 4X65J 1KS2A 2LMIA 2VFRA 2M2BA 5CYQB 3J7YI 4ZKAA 3VAMA 4USVA 4K4UA 4WK1A 1VGYA 3VAIA 3RB4A 1VLOA 4QWCA 4OQJA 1NH8A 4JP8A 1P8GA 3ET6A 4MYUA 3A13A 3TUPA 5A0YA 1NSPA 1TL3A 3K5LA 3E01A 1KQKA 2E1CA 5EWEA 1PYSB 1S9GA 1V9OA 3EVWA 4UTGA 3OL8A 2AJ2A 4U96A 4ZLPA 4P75A 1TVRA 1PG5B 1G4CA 1YRTA 3VGVA 2VA2A 1IKWB 3W5XA 2UXBJ 1YJVA 2BYCA 1U7LA 2VBZA 2PDAA 4OZ3A 4N76A 3NAIA 2DGTA 1T11A 4RUCA 2AZ1A 4Z2XA 3PR4A 4LRAA 2UUTA 1DY3A 3I6PA 3PG9A 2OPQB 4BS2A 2PSZA 4WFYA 1RLCL 1ITPA 1NCLA 1HWUA 2J9EA 2VBYA 5B0DA 1LWCA 2AJFE 4ZCKA 2EFQA 1WKKA 1WSVA 3W66A 2GVZB 3LQVA 2V9WA 3O5TB 1JLEB 4X66J 1OY6A 2FVCA 2HGLA 2RF2B 4N56A 1YI2S 3ELHA 3R5AA 4G1QB 1HI0P 5CXTA 3MXHP 2JHEA 5F3ZA 2GA7A 2J76E 2FTRA 2YXLA 3H42A 2XQCA 4IO9Q 1S7HA 2BM1A 4K4SA 2G0JA 4JV2A 4PR6A 1TUGB 4FYYB 4JV5J 1SV5B 3DLKB 1TKZA 3P96A 3SCKE 2C3UA 1KFDA 2Y1JA 3GIRA 2N82B 1CQMA 4UOCA 2Y1IA 4I64A 3A8JA 4TXSA 3DYAA 3CULA 3H2UB 2JVRA 2KT2A 2HKEA 5F8LA 2VDHA 1FWKA 2DO0A 3ZZZA 1QVFR 1DTTA 2FDNA 2FLOA 2CPHA 2MEWA 5DQIA 5H9EJ 4OJGA 2EEYA 4OYZA 1UJ6A 2EW9A 3DRRB 1KN6A 1MLAA 3CW2C 3DLKA 2DHAA 5F0UA 3CD6S 2YNFB 2QYCA 4EFAC 1BD6A 5HBMA 1FWPA 3OUYB 2W4CA 3MR5A 2J0WA 2FIUA 1JNZB 3DYAB 1AW0A 3L09A 3OTBA 2PD1A 2CDQA 3JS9A 4O3NA 2CPFA 4JI1J 3VZIA 3I4PA 4QW8A 3RG6A 1XMOF 4B9SA 5KFFA 3C66A 3EJMA 2VFSA 3SFUA 1FJEB 4ECTA 2J8SA 3DGPB 3BZQA 3RAMA 5DQGA 1X9SA 1HFEL 3GCXP 1U1LA 1BQNB 1NK0A 5AXMA 1V6HA 4LREA 2MXYA 2IHR1 3K59A 3NNCA 2R2RA 4OHWA 1DLOB 3LALA 5IM0B 1MN7A 1R6VA 4X65F 2V2KA 1AROP 3MEGB 2W7AA 5LJ5Y 4K5RA 2LEBA 1KR4A 1CSJA 3IBCB 1SXLA 2GJ2A 4TYAA 4FS2A 1UWBA 4F2RA 3VGUA 5IT9Y 1QJHA 4OI1A 3HHLC 2ZM6F 4DV3J 4DV1F 4B9NA 3SDEB 2ZH4A 4WZMA 1QVGR 3RBEA 2DR7A 2V8VA 4DX7A 1SL0A 1XJWB 2WVDA 4OI3A 3C6UA 3MTKA 1KEKA 1N6QB 2AIRB 2J5AA 2HAIA 3CT9A 2HVIA 2F1FA 1XK8A 3MPDA 3BH7B 5ETQA 4ZIVA 3CO9A 1NZ8A 5B0AA 1FWLA 1HPZA 2FY8A 1VJWA 4OLPA 3HMJG 4IKAA 1S72S 1RTIA 1HNWJ 1U25A 1GXTA 3N5BA 1P27B 2FLPA 2ZUGA 3O3LA 3HD2A 4I0WA 1HBNA 4NCGA 2VQFJ 1X9WA 5BJRA 3KG4A 3EPIA 5LSOA 1WEXA 1MWZA 4JUZA 5KT7A 5CYJA 3HP6A 2NXUA 2EVZA 2C3MA 4N8OA 1NZAA 5KFXA 2L41A 1XMQJ 1IBLJ 2KYZA 4K50A 2V34A 2IA0A 1RTIB 2QJ3A 3I31A 3D2WA 3SQOP 1UEVA 2P8IA 2V63A 5JVGQ 4NLRA 4QU6A 3CDUA 3HULA 1Q4RA 1N4LA 4ED5A 1HQ2A 1NJYA 4OYWA 3O1LA 1REVA 3BN7A 3AD7C 4ZCLA 1FJGF 2W7PA 1TV6B 4XPCA 2CADA 1RWWB 3H2LA 1X4BA 1WACA 1SQEA 3R9LA 1RB0A 4AT1B 1CS4B 3MAQA 2VV5A 2J6UA 1LKZA 1VK8A 1SJFA 1FXRA 1O0PA 1REVB 1TL3B 2QMWA 4MIAA 1HQEA 4V1Ak 2R8HA 4DR2F 4ED3A 4IQXA 2B9YA 1RT4A 4YOEA 3M30A 2EWHA 4OFZA 3QYYA 3ZZRA 4B08A 4DZ6A 1FDBA 3MPVA 2YWGA 2EFGA 2N3LA 4C8KA 2EXUA 3BF4A 3I5AA 4Y0FA 2AGPA 1U1NA 2X7IA 3EXCX 3OSNA 1P9YA 4MFBA 3C6TA 4RZRA 4OI2A 2ILYA 3OVSA 4ATNA 2GVDB 1JJHA 3DHWC 3K7RA 1KSPA 3B4DA 3IAM9 3N01A 5D4LA 3IR5B 2MB0B 5HROB 5DLGA 3BQ2A 4O3SA 4NZ6A 2YY3A 2E29A 2GQQA 1XQIA 4XDCA 2OD4A 4OJ3A 1TMMA 2Y1LB 2V9KA 3F0NA 2JX2A 5JUMA 3KLGA 1NK8A 2K06A 4IOAQ 2CQ1A 2R2SA 2KVIA 1XTZA 2CPJA 1S0MA 1IJFB 4DFPA 5T7LA 7FDRA 3KLHB 5CYMB 3HM9A 2C2KB 4KJIA 5KFDA 3VAFA 4OHVA 2VQEJ 2VJUA 4LF8F 3LP2A 4O44A 2A1BA 3AA9A 3CJ5A 3IBWA 5KG1A 4L3KA 3TEHB 3HO1A 1N33F 3DLHA 1TKXA 3PKMA 4KFBB 3DDNA 2VFVA 1RT7A 3HVTA 3V5RA 4EU0A 4DS5A 3PO4A 4W92B 3R27A 1J5OB 2G13A 2DISA 1R7IA 3ENQA 5CZXA 3C3LA 1HNXF 3HVRA 3BS9A 1FDAA 3FCHA 3CCUS 1DZ5A 5KFBA 4K2JA 2QG9B 3VZHA 2JFDA 3CCWA 2RAQA 2NXNA 5KFOA 3GV5B 4IR1A 3ZZOA 1VRTB 1OQ6A 2LQ8A 4K5SA 4FS1A 4RNMA 3J81j 2LCWA 2Y8YA 2O5DA 2CVIA 2AJQA 2HHXA 1J2VA 2WB1D 1T03A 4DCPB 5KT6A 4P2XA 4ED2A 2BA9A 2XYPB 3T5KA 4PG8A 1QAYA 4RNOA 2OP5A 3KLVA 3BBBA 3JTOA 4JOUA 2CG4A 2NPFA 3VV2B 3KHGA 4OHZA 2UUBF 5DS7A 3M8QB 1N36F 3QIDA 2GO9A 4NA1A 4LF7J 1EQ0A 4HH1A 2DGWA 1DLOA 5A8KA 1I6JA 2NS1B 3I5BA 3MEGA 3WDOA 2HAFA 1UJ4A 2J7KA 2NSBA 1WF2A 1HNIB 4CT9A 2WBRA 2J9DE 3KK2A 4L3NA 4CLWA 3K5NA 5GAEU 2CJKA 2W8LA 1B70B 2I2YA 4DU8A 2ZC4A 1JLGA 4CO1A 2ADCA 1S1XB 1AZSB 3CD7A 1RISA 3MEDB 2KRBA 3CDEA 3KMSA 1N48A 1JIHA 3J81U 2Y9HA 1YIJS 3GFZA 2I9SA 3A4TA 5K8PA 2BE7D 3KHHA 2XB2D 2VQFF 2E5GA 4KKOB 3GIMA 1YRXA 3GSIA 2CDRB 2RKIA 2Z2ZA 5LT5A 4X4SA 3KK2B 2EBGA 3V6HA 1S59A 4WYWA 4ZPVR 5LMUF 4ZP7A 4DUZF 1T9VA 3QGHA 4X4PA 3L7PA 4H4OB 3OW2R 3TR5A 2R3VA 3AJ1A 4C3LA 4ZJLA 4CTAB 1HWJA 3RZAA 1UEUA 4GMKA 2XEXA 1WKJA 2ZD1B 4DV4J 3OHAA 1XN9A 2VC1A 1C4AA 4IG3B 3CB4A 2DNHA 4PYDA 4RW6A 3VHQA 3SV3A 5CCMA 2QL7B 1KONA 3UR3C 2AT1B 4ID8A 2GV1A 2VICA 3D66A 2HEKA 2DGUA 2CJBA 4M5IA 2KXFA 3NBPB 5HMZA 1FERA 2BKOA 2PA3A 3PHTA 3W60A 5HJXA 1BE4A 3GZ7A 3RJMB 2UXCJ 3D0HE 2WHOA 4RNNA 1C1BB 1ZS6A 2YKMB 4DX6A 1BWVA 3TI0A 1KOOA 4NI2A 4FBTA 5HJYA 1ZAXA 1BQMA 2E7WA 1K9MT 3ENVA 2UVVA 1VDHA 3NBPA 1KC8T 3ZTQA 1U1PA 4A46A 4NCAA 3VQTA 5ETSA 5FIIA 2I8EA 3MR6A 3N28A 3N79A 3F56A 1NB2A 1XR6A 4DUYJ 2CPEA 2VIHA 5EUHA 4IRKA 2F40A 1Q82T 2MLXA 2RMLA 3MM8B 1U1OA 3TVZA 3DI6A 3FRYA 2C2DA 1IKYA 1FCAA 2BANA 4A8OA 3QWUA 1TL5A 4EBEA 4ZPDA 1RHMB 2DGXA 4NLTA 4DPXA 5RUBA 2MQQA 3FFIB 1SC1B 3KLFA 2Y0SD 1ZAVA 3DRPA 3Q0AA 2SXLA 2C2MB 4TY8A 4J9VA 2DCUB 1YJWS 2QV6A 2ZJQQ 2J9DA 2B4PA 3V81A 2BABA 2WONA 3U27A 4U7UD 1T8EA 2BJ8A 3LPEA 1YJ7A 2RQKA 2OO4A 4LRFA 1TP7A 3MR3A 1WOPA 4WXWA 2NYHA 4OZLA 1X4AA 2HMIB 1M5VC 3CJKA 2X3GA 1UVMA 1F9HA 4JI0F 3CCJS 4H4MA 2J6SA 1LWEB 3BBCA 3D67A 2CRLA 1H7XA 4MKAA 4OYAA 2BMBA 1FDDA 1HI8A 1ZA1B 2OKQA 4UF4A 2HNYA 3FKBA 1PJ5A 3KXDA 1RSCA 3MGJA 1VQPS 4FYVB 1OY9A 4ZP8A 4WKRA 3CWJA 3VGSA 2NCKL 3HVAA 2MGZB 4JV5F 2FB0A 1WI6A 1NLKL 1S1WA 2HRUA 1T03B 1QM9A 1R0BG 3MUVP 3MOJB 4NOHA 2FZKB 2V2VA 3CDBA 2VG6A 1AUSL 3HFZB 1T7PA 3TZYA 3E2EA 2IBOA 1RT3B 4CT8A 3TAPA 3S1TA 1HBOA 1IQTA 4A8FA 1ULRA 1U1KA 4FF1A 1CBKA 3H20A 1S99A 4DSEA 3JAMY 3GIJA 4NYPA 1TL7B 2ROGA 3FRZA 2W9BB 3CIZA 1RTJB 2AMCB 4RX6A 5K14B 2B5JA 1U09A 4E98A 2RS2A 4FXWA 2H5IB 2FJDB 4IR9A 2RJZA 1S0NA 1RT3A 1CJUA 4A8XA 2CZ9A 4F4ZA 3EGWB 4P9SA 2RB7A 4J9KA 1H2TZ 4ZK7M 5KFEA 3W9IA 1U6BA 4C8OA 2MQOA 1AZSA 1S1XA 4JI2F 3LH2S 2VPWB 4OX6A 1R8AA 3GU0A 2YQ0A 4NLOA 1VLYA 5K14A 4QU7A 2HYIB 3D0GE 4JI4J 1H7WA 4O23A 1ROFA 3KKFA 1EARA 4ZLNA 2XCPA 1HW9A 4LF5F 1ZM4A 2CQIA 1FRXA 3GILA 1TAUA 5JXSA 1IKVA 4OIXA 4DX8H 4CLPA 1Q8LA 2IYIA 3BGUA 2PFDA 3BGRB 1VRUA 5KFYA 4EEYA 1K0VA 2PMWA 2CWKA 2MJNA 3UVJA 4CTAA 4ZPAA 4WP3A 1CEZA 1DTQB 2M3DA 3I9V9 2O1PA 3OBIA 1FFGB 3PEHA 4HH0A 2HVEA 2MQNA 4LSNB 1JLQA 4RW4A 4DV4F 4B3OB 2FYXA 3CMES 4M94A 3IC1A 1E6VB 1RAIB 1UZHA 1NRKA 1OMSA 1REGX 2P2CB 3GV8B 1LW2B 1U8SA 3G6ES 4IUFA 3HHLB 2KKHA 3OR1B 3NL0A 1RT6B 2YWKA 1LNQA 2ROPA 4KH0B 3RBXA 4UT4A 4ZIWA 3KLEB 1HA1A 2DNOA 2HZVA 4RUBA 1DTQA 4LFBJ 1GMUA 2HFVA 2EI5A 2RSQA 3TA0A 5EWFA 1C4CA 4X62F 1C2PA 1QTMA 2HZAA 1Y11A 3IWNC 4ZS6A 2VPXB 5KFZA 5I42A 2BBEA 4NX9A 1RLDA 4OI6A 1E6VA 3TJ8A 1X4CA 2MZQA 3AXKA 4RBTA 2PIIA 5IC6B 3U1MA 4OX7A 2MZSA 3TWZA 3CC7S 5DM7Q 1UEKA 4EO8A 2HIQA 1U47A 1TVRB 2BR0A 4OJ1A 5J2MB 3OL9A 2HWHA 4KRWA 4XO0A 1LFWA 1U0HB 4FYDA 1FK9B 5IFMA 1RCXB 5H9EK 4IG0A 4OV6A 1DQAA 2HNDA 5A8RB 4W90B 4FNIA 4QQBA 4ELVA 1UW4A 3W8PA 1Y7PA 2M70A 2KT5A 4NEZA 5KG5A 1Y10A 3OL6A 3HT3A 2XC9A 4DUYF 1B99A 4J5OA 3AQOA 2FGOA 2F9DA 3A3PB 4UW2A 1DURA 1Q0NA 2KJVA 3L9ZA 1T95A 2DIVA 3R6LB 2R8KA 1W25A 2ZE2A 4WPAA 4ZVUB 3KDOA 3TZWA 9ATCB 1FK9A 4LF8J 2F9JA 1KLMA 2WOMA 4IG0B 4CM2A 3H5SA 1I94F 5KG3A 4I6YA 3AOBA 2N7CA 4EZ6A 2Q1LA 3TEGA 1N8RT 1EP4B 3FEYB 1XMBA 1JLFB 4IYQA 1AB8A 1SV5A 1SC3B 2CQBA 2QYGA 3SQGB 5AE3A 3M4XA 4MK8A 1HHSA 3NGKA 4MIWA 5HK4A 4XK8C 2CPIA 2E7XA 2JH3A 1YVFA 2M0GB 4I67A 4P7VA 2C1EB 3C8YA 3JQJA 1WC5A 3ETMA 1F5CA 2B9XA 3FGVA 2AU0A 2MSTA 3OFGA 1P6TA 2CG8A 2K3KA 2XULA 3OTEA 3BV8A 3GJTB 3UO0A 5F41A 1LWCB 1RT2B 4B3SF 3NNAA 3PTWA 2H1YA 3DU6A 2HFUA 2MKCA 2QX0A 3D6HB 4L76A 5HVGA 4ZHRB 1RYSA 2R8JA 2L3MA 3BB5A 4DSLA 2V4RA 1DARA 5A8WA 1RK8A 3N5FA 3PYDA 4KGXB 4RO0A 3RBZA 3T6JA 2BUNA 4DN0A 2FHMA 3CPWR 3HK2A 4RU9A 1SPBP 4I7FA 1SL2A 3OVBA 5LXRA 3BGOP 3OR2B 2HBRB 4TY9A 4NZ7A 3E3XA 2OLWA 3S7RA 1VQ5S 2XS7A 3UCGA 1BWEA 1ZPWX 3RTVA 5KOXA 2MHEA 1ZTWA 3AAWB 4ENOA 4YY3J 2YKQA 2GIFA 1W7WA 1A6LA 2WCXA 2ZDPA 3DOLB 3PZPA 1HBOB 2IIHA 4Q45A 5DLFA 2CPZA 3OTOF 4B3TF 4KHPJ 1V5VA 3G87A 4J37A 4K2XA 2R7XA 1F0XA 4A4JA 2YKOA 3POTB 4BHQA 3SDEA 3CNQP 4UY85 1UWAA 4OZ5A 2HQDA 3THVA 1WHYA 1SQFA 4ZPTR 1S48A 3V6JA 1ICEB 3FBCA 5E3QA 2W2PP 1GT8A 8AT1B 2V8DA 1FRIA 1MMNA 1S4FA 4ZOSA 1XWLA 2R7RA 2QEXS 2N4CA 5GAGU 2AX1A 2RNEA 5HO4A 3BSOA 4PXBA 5HVHA 4F04B 2K1RA 1FNOA 3CDAA 1BQNA 1H73A 2B4VA 3I0RB 3IBFB 5BYRA 4YMEA 2COLA 3MUMP 3UCZP 3VAKA 1E6YB 3OFEA 4ZJOA 1H72C 2Q3PA 2C2ZB 3MECB 3R5DA 1R0CB 4OX9F 4F36A 4D3GA 2FQQB 1UWBB 3SEOA 3ZNUA 1NKCA 1Y00A 3GV7B 2JSXA 3HSZA 2FJXA 4BDPA 3M8PB 4DFMA 4F02A 2HS4A 2IC3B 1WEZA 4J9UE 3M2RB 4DV1J 1WORA 4LFCF 4DSFA 4LMZA 2QLBB 3T9NA 4NRTA 3BR9A 3R8YA 1S0VA 4U67Q 2NZCA 3L3CA 2VKZG 3HXMA 1WC0A 4HL9A 4ZPBA 1DBDA 2IJRA 5IQQA 3R5JB 2B9EA 2JJ4D 3CVKA 3SMZA 4ELUA 4IO1A 4F3MA 4LJMA 5D0EA 1FESA 2GW8A 4DF4A 2DJWA 2V0NA 2KRRA 4M5HA 2E1AA 4MAKA 2RDIA 4P72A 4WBFA 3QFWA 4EGLA 2LDYA 3GG0A 4KGKA 4FBUA 1S9FA 3DCAA 1JJCB 1FRLA 4K4YA 1RI7A 3MUTP 4YQWA 4YB6A 2FHKA 4DDFA 3MMJA 3BEGB 1MSWD 1VCTA 3A3OB 4BLGA 4C3KA 3AD8C 3HSGA 3NGTA 4IRCA 4F4YA 1RU1A 1NKBA 2ZBCA 3NAHA 4DV3F 1JKHA 3KFWX 5L8RC 3C6TB 4H54A 3AY0A 3SI8A 3PW0A 1BMQB 4CLKA 2ZH3A 2R4FA 5T14A 3J7ZT 3EX7B 1IBMF 2CNKB 3KK3B 3E01B 2J7WA 3DHXA 4YR2A 3EUNA 1C1CA 2C2EA 3KYLA 1S10A 5L1LA 1GXUA 5KFRA 3OSPA 2OHDA 3EGVA 4MKBA 1AT1B 3KLGB 1NJXA 1N54B 2D41A 3WHIA 2X1BA 3K89A 3PKYA 1KLMB 1T05A 3EGZA 2GGPA 5EHHA 1NMEB 4N47A 2E5JA 2XO6A 3KK3A 3MHYA 1JJ2R 2DGOA 2ZZTA 5M2RA 4DPWA 1WOOA 3GJRB 4O44B 2UUCF 3QBCA 2AGQA 3MMBB 1X0FA 1QSSA 2V8GA 2JLFA 2LP4A 2AWZA 2B0GA 4ZVFA 1JLEA 4NL5A 2WZ1A 9RUBA 2YH0A 3AA8A 1J5OA 3I0SA 4A8WA 2HFNA 2AJ1A 1CJVB 3MAAA 2XWYA 1JJ4A 2W01A 3Q83A 1RHRB 1RACB 3QIPA 4QWEA 2RQCA 2HRYA 4ECXA 3K8WA 2D3O1 3MMBA 1FHTA 4DSKA 2GHPA 2POKA 1VHIA 3QO9A 4FXDA 3R2CJ 1JLBA 1UPPA 3CJ2A 4UOHA 4C0HA 2W1BA 4G6VB 4X64F 2EFNA 3UPFA 3I0SB 2UXDF 2JLEA 4USIA 1QE1B 3A8IA 2CNLB 3OTDA 1HBUB 4A8QA 3PX0A 3HHNB 2LA4A 4WF9Q 4F8RA 1A9NB 2EFOA 2AYEA 3TZXA 2GC8A 3GPAA 4BBYA 4IOCQ 4OX8A 1WTBA 1NB7A 1JX4A 4DL0C 1BXNA 4I2QB 3GCWP 4D3HA 4WFAQ 3G6XA 4ECRA 3D4JA 3GB0A 4TU9A 3LP1B 1YX2A 4EYHB 1UFKA 2HGMA 5HI7A 4UZCA 3SXLA 2PI4A 4HHHA 3TAMB 4J90A 4YB5A 1KVKA 3GG1A 4DLGA 1Q81T 4JI0J 1S57A 1RHKB 4LR8A 5HLFA 4OYBA 4WTYA 2KHCA 2M8DB 4KPCA 1PAEX 1OY8A 2C3PA 3CEDA 2LA6A 5I3QA 2GIQA 2CJQA 2IM0A 2DK2A 2ILZA 4OI4A 2VUGA 2LQ9A 5L9XA 3C14B 3ZXWA 4ZN3A 4A8MP 5G0RA 1PBAA 2CQPA 3WX4A 3MEDA 4OYMA 4O3QA 2W7OA 4ED1A 2J6TA 4F2SA 2ZZMA 1QAIA 3M9MB 2YQ3A 5DJBA 4WU2A 1LEOA 1U26A 1U48A 2LU1A 3R7BB 2GMLA 3H4BA 3KJNB 2H9ZA 1PAUB 3C6UB 2QMXA 3DRXA 4I2PA 4ZPCA 4DEZA 1XERA 1EIYB 3QJPA 3KJQB 2M8HA 4P73A 2BZ2A 3VAJA 1JXVA 2K2PA 2OEKA 2MKIA 2HQGA 4P7TA 2FVSA 2HHUA 3RW7A 1HHQA 1F9EB 2XTJP 1IBMJ 2DYAA 2HSEB 4JI7J 4EMDA 5CCLA 3OT9A 1C0TA 1XR7A 3FK4A 1JLGB 1OO0B 1P1TA 4DPYA 1HNVB 4CI0B 4YHHF 1TUVA 4K4VA 2XMKA 3WC2A 4RWWA 1WUUA 3FCWA 2KXHA 1IUJA 2IJNA 3QMQA 1L3KA 3OFFA 2DPIA 3LOUA 2DR9A 2LXUA 2ROEA 1URRA 4AL5A 1L3VA 4HI2A 2KN4A 2EC2A 1AUDA 1XNRJ 2LYVA 3P45B 2RILA 2ZVIA 5DDQC 3QWPA 2VPZB 2YKPA 4HYKA 5LSLA 1NK4A 4ICLA 5HMYA 1WHVA 2DITA 2XMAA 2XSJA 3CE8A 2H54B 4LUBA 4ZLJA 2KFNA 1VQOS 2OMOA 3DN9A 3CCES 4ECYA 4KTQA 3QRPA 2QGFB 3M1VA 1HD1A 2CA9A 3E51A 2F8HA 2VG5A 1K1SA 3O44A 1U6FA 4NCGB 4UQTA 3R7SB 4TU7A 1I1GA 1S79A 3DLLQ 3WC0A 2HRTA 3GLJA 4QOTA 5IWAJ 4WJBA 2ZH2A 2XNRA 1OPIA 1HR0J 1FKPB 1GTHA 2BX6A 5ETTA 2XLIA 1GX6A 1QAXA 4C9DA 1S9EB 5F8JA 2RUGA 2JWNA 2GMJA 2D74B 2D9PA 2MZTA 1DQ8A 2P6TA 3GFYA 4YDXA 3BQ0A 5M2PA 3MEEB 4KV8A 3Q86A 2UZAA 2VBXA 2OPRB 4ZVTB 4ECWA 1RT1B 3M05A 4AUKA 1UW9A 3JSMB 3BJYA 3KK1B 1FVQA 1W26A 3Q8QB 4EBDA 1R43A 1TK8A 2UXBF 2P5VA 5HATA 1D09B 1HQUB 2HZCA 3IM8A 2CQ0A 2ASDA 2GVDA 1T9WA 1OWXA 3NS6A 2CZVC 5GMDA 5JMNA 4ETZA 4OI0A 1G7CB 3KUHA 1RTHB 4DG1A 4DR1J 4ITSA 2YH1A 3CCMS 1KWMA 2IDLA 2IM1A 3FMWA 4LIRA 5KG6A 5FJ4A 2R7VA 4M1KA 5F8MA 2HNZA 2BM0A 2FJEB 4PAAA 3QAEA 1WF0A 5BXIA 3R7NB 3UR0A 3GIIA 1RT4B 3ENAA 2A2DA 5ETKA 1L3UA 3OJUA 4CYUA 4ZVPB 1ZYQA 3AB4B 4O0NA 4U8YA 3RYLA 4MIBA 3M8RA 1VJQA 3FFIA 2U1AA 2Z2MA 4OYIA 3DRPB 2BXJA 4NE9C 2MY7A 2QO3A 3K2YA 5AXLA 3BO3A 5E2QA 3UFCX 1RAHB 2B4UA 4UZBA 1S1UB 2XWXA 3MM9B 3Q23A 1X5SA 4WP8A 4LFAF 1SH0A 4KY3A 4CDIA 1MU2B 4X4OA 3QGGA 4N7TA 3AQPA 4G1PA 5C2GA 3CCQS 2UUAF 2NR0A 5HMWA 4DR5J 3M32A 4OZ1A 4ILMA 3RU0A 4YR0A 2BOAA 3PIPQ 3PW5A 1IBKJ 2Y0BB 3R5CA 3UI3A 3H5XA 2WK4A 2NUHA 3KMQA 3LUYA 1FD2A 2ADBA 5D4OA 4DHVA 5EX0A 4FKYA 1IBLF 3T5LA 1CJTB 1RT7B 3EDRB 1HWIA 3EWGA 1Q5VA 1FX4A 2F4VF 1JLAB 4K4ZA 3FQKA 2VOOA 2K7KA 1B0TA 5B0GA 2KDOA 2WVEA 2R42A 3G6VA 2MGZA 4F0HA 5A8KB 4DQRA 1VQ6S 3QNWB 6FDRA 2FPHX 5GAGI 3C2PA 2AKWB 1S6PA 3C16A 4LFBF 2DEJA 3PO5A 2XGQA 2HK2A 4UOFA 4X4QA 4LRCA 3VQSA 2IM3A 1VRTA 4P74A 4URQU 4RUHA 5IOLA 1JLAA 1IR2A 2G2ZA 5B0CA 3IG1A 5AJ3F 3DLBA 5C5JA 2L9WA 2G1HA 1T0TV 1G3OA 4QJVA 3S6EA 1NSAA 3TA2A 1D8ZA 1RGVA 3HVWA 2EFVA 1OJ4A 4Y2IA 3BSNA 1VYAA 2KU7A 4P2SA 5LOQA 4IFYB 4U7UK 3AODA 2H51B 3PACA 3V4IA 3M8QA 5HQLA 2PN6A 2E9ZA 4DBQA 4ANCA 1QY7A 1X8DA 1U45A 2G4BA 4J9OA 3P5BP 1RKIA 1HNVA 4Y6IA 1ZTTA 4QWAA 1NDCA 5KG2A 2KT3A 3J7AN 1GMWD 1NHKL 1UL3A 1GK8A 1FDNA 4MK9A 2HQCA 2XMMA 2KI2A 2QRRA 3CC2S 4KSEB 4YS2A 5E3RA 2UUAJ 1RAJA 2WW4A 2YX4A 3AHPA 2ZDOA 4Q44A 3G8SA 3LWMA 1IWGA 4UOGA 3WZ0A 3SFGA 1KKHA 1NBEB 4AQYF 4QYZJ 1H0HB 1NDKA 3KLIB 1R8BA 2FHOB 1RA6A 5KFMA 4K7QA 4FF2A 3QQCD 3DOKB 2ASLA 2QLWA 1NDPA 4WFXA 2JLGA 1OYEA 4R0JA 1M5PC 2Q6CA 1SJ1A 3LGMA 1NHUA 1S1TA 1RADB 4L74A 1HNZF 4RW4B 1NXIA 1UA0A 3FEXB 4DQPA 4M8LA 1DRZA 4B3OA 2HNDB 4XDDA 5C24B 1GTEA 1Y3JA 1ZETA 1HHTP 3PR5B 4DL6A 2G0IA 3R6GB 3C15A 3UDLA 4ZJQA 2YKMA 3D3CJ 3VAHA 1F2HA 2Y1RI 3DOKA 2HHHF 5HMXA 3N9UC 2MQLA 2DVIA 3I96A 2DCLA 2DNPA 2XBPA 2CQDA 1K47A 1FFWB 2KYXA 2VF3A 1G6BA 3Q8VA 5C24A 1V3SA 2X1GA 3KK1A 5KOWA 4JI4F 4J9QA 1S49A 5GADU 1U8WA 5K8MA 2RRNA 1BGXT 4H4KA 1JLCB 1CG2A 4R5PA 2OH2A 5CQGA 3TAQA 5KG7A 3PY8A 1R8HA 1RTHA 4DG1B 3R5BA 4DV2J 3A8EA 5A0YB 2LFVA 1F2GA 3V6DB 5FD1A 1FJGJ 1KP6A 2WBMA 4ZVSB 4ECVA 1WHXA 4ZP6A 2VASA 3RW6A 3HFKA 4P71A 1YBTA 3D6FB 3CGIA 3M8WA 3OD2A 1TL4A 1ZZFA 2OAUA 3ZTRA 4K4WA 4ZITA 1GQEA 4CYUB 1TKTB 2ZHBA 2OD6A 2RUSA 4F3QA 3LA0A 4NXNJ 1YG0A 4Q0BB 2OI2A 2P9CA 5IQ6A 1F3FA 4GO7X 2B8PA 2F8MA 3S8SA 2IVFB 4PQUB 5GVQA 2PE8A 3H5UA 2VPYB 4JI6F 2J8AA 5DG9A 3IR7B 4F0MA 4ED4A 5L1IA 4ZCMA 1YJRA 2RQMA 3HPOA 4ECZA 2DGVA 1LWEA 2P6SA 3V4MA 1IM6A 1MU2A 2HWIA 4OZNA 3V2UC 5EDWA 3MM5A 1WOSA 3DRYA 4WIQA 2J7UA 4O3PA 3H7HB 2ZH9A 1O51A 5J2QA 2ALZA 3EE3A 1N5QA 4TY8B 2NYIA 2W2QP 3QGPA 2LLZA 2YKAA 4DCJB 1NJZA 3M2VA 2DR8A 3TX0A 2KM8B 1SCJB 3BBFA 5J1PA 3QFHA 3MM5B 4I56A 3Q8PB 2ZH6A 5J2QB 5L39A 2VDIA 1YJUA 4Q7AA 3M9OB 4C98A 1Q16B 5D3GA 2V2ZA 2KM8C 2QSFA 3CD5A 2W8KA 4I7FB 4QPTA 1PILA 3MFIA 2Z2YB 2WSCC 3VVUA 3QT8A 1BLUA 2AGOA 4FZVA 2BRKA 5L38A 5LJ3Y 2YPYA 4WTOB 2MZRA 3DU5A 2V67A 3ZZUA 4O4RA 4USKA 2ZJPQ 1YHQS 4NXMJ 3A3NB 2DXFA 4HDGA 1B3TA 1B0VA 1RWVB 1RWUA 2GFFA 2ABYA 4USHA 2H3EB 1PIEA 4A8YA 3QT6A 2QN6B 4TQRA 4HDHA 5SZTA 3QZ7A 3F73A 2IC3A 2LQBA 2WW8A 3M7VA 1FVSA 2ZBQA 3HKZD 4NLWA 4QCLA 4NA3A 4DV7F 3H90A 4FKXA 4U95A 5IM0A 4LF9J 3WQPA 1R8PA 1U6ZA 1U2RA 2MPUA 8ATCB 2X1FA 3E8OA 3US5A 3EGNA 3W5YA 1FRHA 1SKUB 2GAGC 3BGRA 2QTWA 4HACB 4MK7A 2KG1A 4DR1F 4QYZK 5KFSA 3Q24A 3CC4S 1HBMA 1EETA 3IM9A 3D1OA 2YKNA 1WTFA 5ITHA 3HKWA 1CJUB 1URNA 3IRXA 3MFHA 4O3RA 1DFDA 2OUGA 3CUNA 1Y9OA 2UV8G 2DH9A 3EXYA 5I3UB 3HHLA 3FC9A 4MYTA 2N7YA 3DLEB 3M8PA 4USUA 1NK7A 4FXVA 3L7OA 3U02A 4JI5F 4NYZA 1HBMB 3RBDA 3RAXA 4RL1A 1EETB 4ZPWR 4F4WA 2E5IA 5AE2A 4CIOA 2FHJD 3IGNA 1UVNA 1QSLA 1C0UB 1YWXA 2QMUB 4J91A 1G1XA 3UNYA 1SKRA 3U1NA 4LFAJ 5J2PA 3R1HA 1JK9B 2I1RA 2RQ4A 2H65B 1T02A 1NNDA 2Z30B 4PEOA 2OGUA 3TUIC 4F67A 5KFVA 3DLJA 4EK2A 2WTFA 4DS4A 3B54A 1S5ZA 4OYXA 2PO4A 1JLQB 3IWXA 4Y2KA 4FDFA 4L6V3 2E1MC 3CJ4A 3BSAA 3QSIA 3H25A 1VS3A 2UXCF 3I87A 1TV6A 5KT2A 1FTCA 4WK3A 3HD1A 2ACMA 3ZZTA 2AZ3A 2B6AA 2V2QA 5J2NB 4R5PB 4X84A 1TR0A 3RUBL 1N34F 3R3TA 1RT5B 4F0KA 2XG8A 2YNIA 1YSJA 3S01A 1DHMA 2OPPB 1AA1B 2WOMB 4R0EA 1QAJA 4LRDA 4OZJA 3I5CA 2WSEC 2Z56B 3TZZA 5KFKA 4U7CA 4LF4F 2HBQB 5KFTA 1RWOB 2GZOA 1SUQB 2RE1A 2V4JA 4O3OA 3K8VA 4LBIA 3D1HA 3G4SS 2XS2A 4M95A 3BKFA 3CJ3A 3D28A 5LMNF 3QO9B 1PGZA 1RT5A 2IM2A 1EQMA 5KFIA 4IFVA 1M5KC 3ET6B 1F9FA 3GYNA 1FJCA 3RB6A 2VL1A 1VQKS 1PBUA 4YEAA 3CF5Q 3PXGa 3VWSA 1TFWA 4M5DA 2DHSA 3FJ2A 5D77A 2HS3A 1S12A 1S9GB 3OXLA 2ZWOA 1GAOA 4MKVA 4RU2A 1PC4A 2UVWA 1J27A 1FJ7A 4PQAA 3KWMA 1VOMA 1N52B 4GVBB 3RGIA 5DDRC 2ZE2B 1CLFA 1TKZB 2E5LF 1NDLA 1NH7A 2AP6A 3H59A 4B3SJ 1KTQA 3DMJB 5DETA 4ED7A 5T7LB 3KLHA 3CSKA 1YZ7A 2LU2A 2AJ4A 1CJKA 1TU0B 5GMKa 1S77D 1RJJA 5IT9U 1NO8A 2OPQA 2NPIA 2BW7A 2RIJA 4KGMA 1EP4A 4ALZA 3ZTSA 4DPTA 1Q7LB 2A10A 3ITHB 3QLHA 1EB0A 2HHSA 1AFIA 4PPZA 2B56A 2FC8A 2JDJA 1LXJA 4B3TJ 1SL1A 2XHCA 2QLFB 2ACYA 3OVAA 3BYRA 1KD1T 3DMJA 2MHNA 4USJC 3OLBA 3BKTA 3G6YA 3V6KA 3AH6A 3RRKA 5D3GB 1HBUA 1VQSA 2Q43A 3K5OA 4Q8EA 3MF5A 1D9DA 1NM2A 4NASA 4PYAA 3TVYA 2MZJA 1SH2A 2LEPA 5HVFA 4ECQA 1NJWA 1ZM2A 3GSDA 5K9FA 3DXBA 2CQGA 4I2PB 2VODA 3QRQA 2L48A 4PCQA 3PRDA 1DTTB 4L73A 4OHXA 5SUHA 1LFPA 3DDKA 4PZVA 2VFTA 3GJSB 3SZ2A 2QLXA 4WFZA 1DAXA 3CJ0A 3MM7A 4OV1A 2F7VA 5E3CA 5HBMB 3TYTA 3CCTA 1TUWA 2DPJA 4R8UA 3ZZ0A 4MKYA 1SJ4P 1KRPA 4B3RJ 3JTPA 3O6QA 3W2VB 3IN5A 4OZ2A 3KUEA 1VQMS 3QRRA 5EGYA 3NGUA 4MMOA 3ILIA 1HNIA 2OSRA 2WRMA 1X4EA 2UV8A 1XR5A 1X5TA 4CRJA 3NGRA 4Z7CA 4AL6A 2CVEA 4IRDA 4GRSA 2IBKA 1WWHA 2PFFB 3G2XA 1KTVA 3VTIA 4YUDA 3OXGA 2IDEA 3O8WA 4DV5J 4ANEA 2ALYB 3IA0A 1RBLA 3NGSA 4DL4A 1PO6A 4WFNQ 3NNHA 2JEJA 4JI5J 4GO5X 5IV4A 3Q8SB 3ILJA 1TTHB 1Q53A 5HQ8A 2YQ1A 1FKPA 4FP9A 3HZGA 4Z7YA 2HMIA 1E6YA 2ATCB 1RBOB 1C0UA 2GS8A 2CJ9A 1RAAB 3C46A 4DI6A 4XTTA 3HHDA 3I82A 3K58A 3BO4A 3UD5A 1RAFB 1SB6A 4CQ1A 1CULB 3K0JA 4ZA1A 2BV3A 3NOGA 3BREA 1JKHB 1WG5A 4BC7A 2XSJB 1HIYA 3W7BA 4JI1F 1VQ9S 2OFHX 5AXNA 4LF1A 1HQEB 4OMFG 1XNRF 1HI1A 1GXLA 4XAKA 2VB6A 2ZH5A 2C22A 4URSA 1M1GA 4FNHA 3CJTA 5LM7E 2DKOB 5FDLA 2VG7A 2B6AB 3NCPA 5A6WA 2V8HA 1PJ7A 1ACMB 1RU2A 3O2IA 5F3TA 2ZHAA 1PCAA 1RP5A 1YZ6A 5ETPA 2DY1A 3P6YC 2UVRA 3CJ8A 5GAEI 2PMHA 4RW9A 5E5NA 4F7VA 4TNOA 1O8BA 2RD5C 2V4JB 4CH7A 3MD3A 2X1AA 3T41A 2R7OA 1KLNA 1N5YA 1F60B 1SI9A 2V4QA 3A8KA 1M1HA 3DFEA 3GR1A 3VGTA 3J7A1 4QIEA 2JL9A 4HT7A 5GADI 1X7VA 2GIRA 5CYMA 1RAGB 1UFLA 1ZM9A 1X4DA 2QZ8A 1RHUB 2FJBB 3MAAB 4I1TA 4Q2LA 2G9OA 2ZITA 3DRSB 2XZDB 3LP2B 3MM8A 2GHVC 4EWTA 2CYYA 3PCOB 3VAGA 4DR2J 1RKJA 1IKYB 2BANB 2BJ3A 2D69A 3HF5A 4HHJA 1J5EF 2BOPA 4JI2J 1YLXA 1PSDA 5DO2A 2ASJA 4DR7J 1JLBB 3Q8UA 5F8HA 1FRJA 1N0UA 1U2FA 4DL3A 3PV8A 2C2RA 1NK9A 1T05B 4HR2A 3NEKA 4IH6A 1I5OB 4NLXA 1RHJB 2Z4PA 5H9FK 3T1HF 1IN0A 2M52A 3V81B 2J0SD 2NXJA 4B9TA 5ETLA 2YPZA 2QE5A 2R2TA 1HYSB 3T5JA 3KTQA 2DR6A 2R8GA 5HANA 1KQFB 4CLFA 4I2QA 3IFEA 1NPKA 2DBBA 3M8ZA 2QA4S 4OYOA 4AYBD 4PRFA 3R1LA 4X2BA 3JQMA 3LGHA 4KE5A 3PW7A 4CLZA 2Q6BA 5BR8J 1IWAA 5JJBA 4HTJA 3NRBA 1KHVA 2BJ7A 2NREA 4DR6F 3MM6B 4CLTA 3HVTB 2YBVA 4O0IA 4DXLA 1MW7A 3IG1B 2YWWA 4RWXA 2BJEA 3UN2A 2CUYA 2CJAA 4J9SA 4JYAJ 2GQCA 5A6PA 2ZH1A 4RW7B 3THPA 4KHMA 4J7CA 5ETMA 3W63A 4GC6A 1H6KX 1TELA 4C8NA 4RJVA 5CH7B 3NMRA 3EM1A 3RR7A 4OL8A 1T9TA 2CXEA 5I4MA 5L1JA 4NPOA 2XZTB 3LP1A 2F4FA 5KFNA 2YNHA 1UETA 4LF9F 5LMUJ 4V19J 4NRUA 1RABB 2W9BA 2CFXA 2B5JB 1D1UA 3FVYA 3FZBA 1Y5NB 2UUWA 4K0KJ 2ZWPA 3CCRS 1FEHA 2H5JB 2O3DA 3OLAA 1FO1A 3MAHA 4B9LA 3H40A 4I69A 1N6QA 2CZ4A 5HAOA 4ZDNA 1HD0A 5KFPA 3A12A 5KT5A 2ZEJA 4ZVRB 2QFIA 1CVJA 1UVJA 3FBFA 2EK6A 4KAIA 3B6BA 4MT1A 4U8VA 3J80Y 1T9YA 3TANA 1VQNS 3NS5A 4QW9A 5DG8A 4Q8FA 2ZD1A 4JI3F 2C28A 4YY3F 3W1YC 3NKYA 3V4IB 1WC3A 5ETRA 2HHTA 1MMDA 4A47A 1FKOB 4CLUA 2E9TA 2RU9A 4LSLB 3C15B 2AX0A 4DN9A 3P3DA 4WCEQ 1B4SA 2V50A 3NGDA 2QLJB 4MTPA 2DNLA 2R7QA 2IVMA 3M1VB 3AJDA 3MMAB 4L72B 1I51B 3TQ1A 5CD4A 4TVAB 5D4NA 4O4GB 4F4AA 3TARA 2PI5A 3MR7A 1FFSB 4ZN1A 2W4PA 1FKOA 1FT8A 2KFZA 2CPXA 3MMCB 4YB1P 2FGCA 4AXIA 4DPOA 1WG1A 3B8HA 4QR0A 3OR1A 4DV0J 1Q86T 1CPZA 2GJIA 4WKYA 3JSRA 4QBUA 2DRAA 1RWNB 1RUSA 3D7SB 3MMAA 1H2VZ 3ZTOA 1LWFB 5FLXY 4K4TA 3ICLA 3MEKA 1HKAA 3M6UA 2O66A 3TNVA 2DY9A 3KG1A 4DJBA 4JV1A 3UDCA 5I42B 4EUVA 3MI7X 3GIKA 1Q78A 3W8GA 4DL7A 2BJ1A 5GAHU 2XMUA 4ICLB 3AJ2A 2BEFA 3G9CA 3DOMB 5B7WA 1HQUA 1OQ3A 3I9ZA 4WE1A 2R7TA 3Q8RB 3DM2A 1EKRA 4LT6A 2PA8D 1M1KT 2KZZA 4DQQA 2G1DA 2AJ0A 3M30B 2L9NA 2VG5B 3UDVA 5HSPA 4USTA 2KO1A 2QL5B 2RRAA 5E7OB 2WB4A 2Z57B 4NCBA 2NZ4A 4GVLA 1WC6A 4Y2MA 1UVLA 4GKKJ 4QWBA 2FLLA 4ETXA 2R7WA 4WE1B 1RA7A 1VQLS 1X5OA 1JLCA 1NEEA 1X4HA 2CJXB 3JYTB 3TJAA 1UVKA 4CP5A 1Q1KA 1UA1A 2AV5A 3AFGA 1M5SA 3WBZA 3LGNA 4BCAA 5D0RA 2MYFA 1SQGA 1M5OC 5J1EB 3Q2SC 3Q2TC 1Q7YT 4PWDA 2D1CA 1QUVA 4CCHA 4OJHA 3SYZA 4QZVB 1FNXH 1PC5A 3MDFA 2HPUA 3MCSA 3F44A 2BE9B 3B4MA 4TLRA 2OELA 4Y00A 4F4XA 1Q79A 3HZEA 3FSIA 1Z1ZA 2OIHA 2FY1A 2R8IA 2E1RA 3EVOA 1MNEA 3ULHA 1TKXB 4ZCIA 4HVZA 4KFBA 4PXEA 2Z0GA 3M32B 2DEIA 1WELA 3GP9A 4UUXA 1W2IA 1N5TA 3CTRA 2HHWA 2GJFA 2UUBJ 1MG7A 2OTLS 1YGYA 5AT1B 1N88A 2DR5A 1OIAA 1U1QA 2WVCA 1SH3A 2CNOB 5D15A 2C2OB 1TMJA 2YWEA 3FZ2A 2RVJA 4H4KC 3LW5C 4KR0B 2I6WA 4YFUA 4C8LA 2FVQA 1FF2A 1ZA2B 1XEZA 1K1QA 2I38A 3J81Y 1SKSA 1Y3KA 3PHEA 4U9RA 3VVTA 7AT1B 2DNNA 1WF1A 1UTAA 2GMHA 3OR2A 4RW8A 4TYBA 3VALA 4NLGA 1FXLA 1GNKA 2MQPA 3NP5A 4KB7A 4NA2A 1S6PB 1VHFA 5F8GA 2K3IA 3BH6B 4LF5J 4I6WA 2GQ2A 1YJ9S 4I68A 5IV3A 2XI3A 5G4DA 2LQJA 3DOLA 3OXFA 3JXOA 1W2BR 4UQGA 3FNNA 8RUCA 4J9LA 1EZZB 3EPGA 4ZVGA 1CC8A 2QIFA 2HS0A 3HHEA 3PJXA 3G8TA 1LXNA 4LBPA 3OFHA 4B9UA 3IXQA 4WP9A 2RDDA 4ZVEA 5DQHA 3MR2A 1QLNA 3ZFVA 1R0AB 2MQMA 2AF6A 2VH7A 4LBHA 1KHWA 1PKUA 1I94J 5LMNJ 4DCOB 1HWKA 2XMVA 5DDOC 1IKVB 2O01C 2BKPA 2MSSA 5I3UA 3IRWP 5LL6d 3TUJC 2UXDJ 4M5JA 3CD0A 3AXMA 2PC6A 3GTYX 4FVCA 1KQGB 1VBYA 2EC0A 3I0RA 1QUPA 4LSNA 3W2WA 2A2CA 3DC2A 5L1KA 1WHWA 1A7GE 3GJQB 1R0AA 1S97A 3D6TB 2DNQA 2M9KA 4NXMF 2B51A 2A0FB 4DL5A 1G2EA 2I5JA 4DV6J 2YWFA 1X0PA 1UZDA 3M6XA 3NXZA 4DR3J 1QSYA 4H4OA 2NLWA 2OEJA 2W9AA 3EZUA 3TX8A 4OLOA 5KFAA 3PX6A 1XMOJ 4FF4A 2ZKUA 5C42B 1N5VA 1HW8A 1Q8KA 1L5UA 3QZ8A 2HBZB 4NZ0A 3TQEA 1XNQF 4NLDA 4ES2A 1S4EA 1SJQA 3LP0A 4EO6A 3BO2A 4A8SA 3QGIA 2GCFA 1HWLA 1RTDB 2DO4A 3LF0A 2OMLA 2RU3A 1VRUB 3MPWA 3GWCA 2YX7A 1ZOTA 4FPRA 3IGVA 5KFHA 2MKKA 2ZM6J 1LWFA 2HVDA 2IAJB 4C11A 3BSCA 2G2OA 4WYLA 5F8IA 4Q43A 3UD3P 4JYAF 3TRGA 1RBAA 5DG7A 3GFHA 2A3JA 4QWDA 2V8PA 1R8CA 3DOMA 1SUQA 1LW2A 2MLYA 3CXCR 2DB1A 5IXUA 4DR6J 3D54A 1CQNA 2IRXA 4ERDA 2OFGX 2EKYA 2QL9B 1VIXA 1BQMB 1IKWA 3NOCA 1F6TA 4R25A 4ZP9A 5BR8F 3J7YU 4YN3B 3QSYB 4C97A 2JEFA 4JV0A 2UP1A 1KFSA 1RZMA 2IJFA 1WC4A 2IMOA 3UD4P 3D68A 3PEJA 4ID5B 1D9FA 1UMJA 3CCSS 1VQ7S 2LDIA 3KHRA 3W5ZA 2IPOB 2BW2A 2CQHA 1K73T 3P49B 3F41A 2HFZA 3N4WA 2H5EA 1LOUA 1U0HA 2XSFA 2YNIB 3CO0P 1DQ9A 1V5IB 4B17A 5GMEA 3U1LA 3EICA 2HQFA 1LW0A 3H8YA 3JB9k 4DR4J 5F8NA 4RLEA 1GMVA 2HURA 3LANA 5C25A 4DV2F 2LKZA 4KYZA 3LAKA 1VK3A 4DFKA 3WIVA 4JI3J 2YVSA 5DDPC 2ZC3A 1IJEB 1T3NA 5AXKA 1YBUA 4DL2A 1X9MA 1EHWA 1J5EJ 1KVIA 4ES3A 3B82A 3HJFA 2V5HG 3CMQA 4ZHRA 5MAOA 4DSJA 2FJAB 2WONB 4CLSA 4EBCA 2P9EA 2LQ5A 2B4OA 3GONA 3ZNJ1 4N5SA 2W25A 3N6LA 5C25B 3W9JA 2KZMA 4Y65A 3T3FA 2EKNA 5J2NA 3R2DJ 3PVXA 4C6AA 2IYGA 1T9UA 1TQLA 1S76D 4X66F 2W24A 4NLVA 2YNFA 4LR9A 2GNKA 3G82B 2AEFA 2X3DA 4M63A 3NLCA 1TL1B 5E33A 1QE1A 3ZC4A 4AD6A 2K7JA 2DNZA 2H48B 3MWBA 3X1LB 2A6OA 3K57A 4DMZA 1WD6A 2CWXA 3UDEA 2ZUAA 3KNGA 2QA4G 4A8KA 5F9LA 2FC9A 3MM7B 1R3NA 3POTA 4USMA 2AYBA 2RT3A 2ZNZA 2NXCA 3AD9C 3PNIA 4CO0A 1NHVA 1Y5LB 1X60A 3T1YF 1WEYA 1YTYA 1IR1A 1MN9A 4QIVA 5JVHQ 3JAMU 3C19A 5F0WA 4LVNP 2E1PA 1LWXA 2V94A 2ZOGA 3H5YA 2M5YA 3CCVS 1TL7A 3MOZA 5KFWA 3M2VB 2DNMA 2IY5B 3TVKA 2WSFC 4NLPA 2BE2A 2CAJA 1GEHA 3K5MA 2OPSB 2WVBA 3C14A 1U24A 1RHQB 3H0PA 5DM6Q 4FN5A 4DOZA 1VQYA 3FCVA 2ZVSA 5EWGA 3T1YJ 2B43A 3DGPA 4HACA 1NPRA 3IMQJ 1HBNB 3AB2B 4CO3A 5ADZA 3GMGA 5KG4A 1HNZJ 2H4WB 2PEHA 3JSBA 2E5LJ 3D1QA 2BE2B 2DNYA 1S6OA 3TOQA 3W2WB 3BGLA 3HJVA 4ER8A 5IC4B 2IFXA 3FUYA 3MD1A 3R5GA 2YWHA 2RDJA 2DT9A 4LF6F 3KJVA 4QIWD 1MROA 2ZBRA 2ZOFA 1VRQC 1ELOA 1T3OA 1YRUA 1IKXA 4CO2A 3RB0A 2AQ4A 4PG6A 2Y8WA 1XNQJ 2E5HA 2MY8A 2D7SA 5DZ7A 1SKWA 1HLWA 2XCAA 2K1RB 1SJRA 3IAS9 2AEMA 3QPIA 4TKTA 4YP3A 3M9NB 5DGAA 3BPSP 3GQCA 1D3WA 4HHUA 4KQZA 4PABA 1L3TA 4G3IA 2XS5A 3MECA 4IQMA 1VFJA 4DV6F 4DSIA 3LP0B 5J1NA 1HPZB 1IKXB 1KNZA 5B0FA 2D3ZA 5KFQA 5FLXU 4NXNF 2DGSA 5B09A 4W98A 2CKWA 1Z4UA 4ZVQB 5L46A 3SV4A 5ETNA 5EN1A 2L9DA 2MJUA 5B08A 5ETOA 5IT4A 2RHQB 4M5NA 5THWA 3T19A 5LXYA 3NS7B 1WNEA 1TAQA 5CABA 2VU5A 1F1BB 1R31A 4LF7F 4PG4A 1C1CB 1WJ9A 3ISZA 4RNHA 4KGZB 2UVUA 3DLEA 3CIMA 3P8BB 1CULA 1N5YB 3SCLE 3M6WA 4P6QA 4NMXA 4BC9A 4DR7F 4WWSA 1RAEB 3D0IE 6FD1A 3WX8A 1KBRA 5GAHI 2UUCJ 1JWWA 5A8RA 4OHYA 4DQSA 1JNRB 4PWUA 1I3OB 4QR2A 2F4VJ 5ETVA 3DRSA 1BC6A 4NWBA 2OPRA 1FA0A 2F3JA 2VG7B 3T9ZA 3PFEA 2CPDA 3NMAA 1MWQA 3PYEA 4KIAA 3FDSA 3HFVA 3HI9A 4IFVB 5A2QY 1UP1A 1H3DA 4DZDA 2HHHJ 4RW9B 5C7PA 5HN0A 2HWTA 2YTCA 3PDNA 4ZVOB 1S7IA 1UKUA 2JEIA 4I6AA 4Y2CA 3G71S 3T6BA 2FZGB 4G65A 1Y5IB 3QJLA 2VOPA 2HFOA 3EVMA 3SQGA 5KTQA 1NSQA 2JVOA 5F9NA 2OPPA 1N36J 1OPZA 2LECA 3KJFB 4CLLA 3FSYA 2GGPB 2EG2A 4NLUA 3NCRA 2XO7A 5HROA 4AQYJ 2OEMA 3PFOA 4DUZJ 1RCOB 2ATLA 3CCLS 1NJIT 1N32F 1QD1A 3ITHA 3QLHB 4QYRA 4F25A 2VONA 4ZVHA 2PGCA 2GX8A 1YDLA 3M6VA 5DRKA 1U2CA 1WSRA 4AXJA 1NSKL 1RTZA 2ZBIA 3PRBA 5IWAF 4LF4J 1TL1A 2J0QD 1FD8A 1UAWA 2W4DA 4B3MF 2HHQA 1PYOB 2XGPA 2F63A 5E3AA 4CZCA 2MDAA 1GH8A 4B3MJ 4N41A 3DRRA 2XLKA 1U0SA 1HYSA 2W2NP 2K8GA 2ZBPA 2ZNYA 4E8UA 4DV0F 3I4HX 2GVZA 4Z37A 5KFJA 4TU8A 4DR5F 3PW4A 3QAUA 2NQPA 3P4UB 4HKQA 3OUYA 1FE0A 1RE1B 2BVZA 1VC6A 2YNHB 2YX1A 3PM9A 1CJKB 1SIZA 1YQHA 2MKYA 5D78A 1HMVA 4ES1A 5AJ3J 4XIUA 2AHOB 4DV5F 2FLNA 4Y2AA 5HP1B 2ZKTA 3DGVA 4PXCA 2VQEF 4C8ZA 2IA6A 2VBWA 3IO1A 1BQXA 1CC7A 3UE2A 4C48A 1SVDA 2F5GA 3KUGA 3G86A 5DZ6A 3TUZC 4YHHJ 2XLJA 3Q22A 1GX5A 1VBXA 1YJTA 2E7VA 1MMLA 1SIWB 2Z2LA 2E9RX 3W2VA 2BKNA 4RW7A 2D9OA 3TAMA 1H98A 4MJKA 4OYPA 5CHCB 3MCOA 4ZMMA 3JTNA 3VR1A 3KNAA 2QFJA 3QT5A 3THTA 2RKIB 3AOAA 3IP0A 1Q8BA 1XIQA 2DD8S 1IBCB 4ILLA 3RRHA 2A6MA 2DNGA 3A1YG 5G0RB 2C3YA 2XHWA 1H74A 1OYDA 2E66A 3D5MA 4KT0C 3U7JA 1FTRA 3CCZA 3KJVB 2FJWA 2Q66A 1EKSA 2JNJA 1UCNA 1TK0A 4F50A 3N6NA 4M5KA 4YR3A 5D8HB 1N5SA 3BKUA 1UJ5A 5KT3A 2HFSA 3EDQB 2EPIA 3GE9A 3L7UA 4C3MA 2XZWA 3TP2A 3HHKA 2GAHC 1WC1A 1X4GA 2DRDA 3BGFA 5E0OA 4R8UB 4DR4F 3VCDA 3DXSX 3HX9A 3DDIA 1KOHA 3IS9B 2B7CB 1VC0A 2DHXA 2DH7A 2V69A 2DNRA 3SIPB 2N3OA 3PIOQ 2CNNB 2LVWA 2NSCA 2PMZD 2W2OP 3W61A 4ED6A 2XNQA 3RAQA 1LK5A 5A2QU 1Q95G 4LSZB 2QT7A 2J9CA 1HR0F 1YK9A 1C0TB 4Y3CA 4ELTA 2OSQA 2ZOMA 5K20B 2BQUA 2HHVA 4LSLA 2VD3A 3B78A 1D9AA 3IS9A 1S9EA 2RRBA 2FD2A 3N6MA 4YB7A 2FVRA 4NLSA 4BWMA 1ZAWA 3DLGB 1WDDA 3FQLA 3MEEA 4KV8B 5EX3A 5D0GA 3SSQA 2WVFA 2VHGA 4P2FA 1RT1A 5FDLB 3JSMA 1APSA 3G8QA 4K59A 4RKUC 4IG3A 1FI4A 2W9CA 2MKJA 3CDWA 4RNFA 3W64A 4GKJJ 2JEGA 3MMCA 5B0EA 2DHHA 4HLBA 2APOA 3MPUB 3GR0A 1X5PA 1T94A 1WKLA 2W2MP 3T5HA 3DNCA 4LIWA 2AD9A 3DLGA 4V19X 1HNWF 1VQ8S 4CM0A 1FE4A 4EYIB 5KT4A 2AYGA 3DI6B 3M2UB 4RPFA 2HLTA 5IZHA 5U47A 2W9CB 5J1EA 3D3BJ 2R7SA 1ZPVA 4MFBB 1F5AA 3FBEA 3HT0A 3JQKA 4LQ9A 3K5PA 1B7FA 2Q79A 3JSYA 2Z8QA 3ISNC 3Q89A 3SSRA 1R6YA 2MLZA 4TLQA 1SJ3P 1Y4ZB 4IDKA 3LPYA 4UUWA 4EZ9A 3BM7A 1O6XA 3M2UA 2JC1A 2B9WA 4IOBA 4LR7A 4PG5A 1U1RA 4EI2A 4GC7A 1JB0C 2KFYA 2HQ3A 4HT5A 4KC5A 1B0PA 1CS4A 1JXLA 2BQ3A 4DX5A 2XY6A 1AFJA 2CPYA 2F65A 2XMTA 1CJVA 3UN3A
chains in the Genus database with same CATH topology
1N32J 1IBLJ 3J81U 4DV2J 1XMQJ 4YY3J 4JI8J 2UU9J 1I94J 4X65J 4B3MJ 3W1YC 5LMNJ 1FJGJ 3JAMU 4KHPJ 2UXDJ 4DV7J 5AJ3J 4JI4J 4KY3A 4NXNJ 4JI0J 4DV4J 3T1YJ 5LM7E 4DR5J 4DV6J 4JI6J 4YHHJ 4DR3J 3J80U 1IBKJ 3IMQJ 1HNZJ 2ZM6J 5LMUJ 4DV1J 2E5LJ 4DV0J 2UXBJ 4V1Ak 4PWWA 1XMOJ 4LF9J 4X62J 1XNQJ 4X64J 2UXCJ 4LFCJ 2KVQE 3R2DJ 2MQ8A 4LFBJ 4X66J 4HHUA 4B3SJ 4OX9J 5IT9U 4DR2J 1IBMJ 5FLXU 4JI7J 4JI2J 4DR7J 4JV5J 2MTLA 4GKKJ 4DR6J 4B3TJ 4DUYJ 1N34J 2VQEJ 4NXMJ 4NEYA 3OTOJ 2MEWA 1XNRJ 5A2QU 4NEZA 3J7AN 4LF8J 2UUCJ 4JI1J 2UUAJ 5BR8J 2F4VJ 3T1HJ 4KYZA 5IWAJ 4JI3J 1J5EJ 4GKJJ 1HR0J 2UUBJ 4JYAJ 4B3RJ 2HHHJ 4RJVA 2KL8A 4DR4J 4LF7J 4DV3J 3D3BJ 3D3CJ 1N36J 1N33J 4LF5J 4DR1J 1HNXJ 4AQYJ 4DUZJ 4DV5J 4K0KJ 1HNWJ 4LFAJ 4LF6J 2VQFJ 4JI5J 3R2CJ 4LF4J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 J;  1IBL J;  3J81 U;  4DV2 J;  1XMQ J;  4YY3 J;  4JI8 J;  2UU9 J;  1I94 J;  4X65 J;  4B3M J;  3W1Y C;  5LMN J;  1FJG J;  3JAM U;  4KHP J;  2UXD J;  4DV7 J;  5AJ3 J;  4JI4 J;  4KY3 A;  4NXN J;  4JI0 J;  4DV4 J;  3T1Y J;  5LM7 E;  4DR5 J;  4DV6 J;  4JI6 J;  4YHH J;  4DR3 J;  3J80 U;  1IBK J;  3IMQ J;  1HNZ J;  2ZM6 J;  5LMU J;  4DV1 J;  2E5L J;  4DV0 J;  2UXB J;  4V1A k;  4PWW A;  1XMO J;  4LF9 J;  4X62 J;  1XNQ J;  4X64 J;  2UXC J;  4LFC J;  2KVQ E;  3R2D J;  2MQ8 A;  4LFB J;  4X66 J;  4HHU A;  4B3S J;  4OX9 J;  5IT9 U;  4DR2 J;  1IBM J;  5FLX U;  4JI7 J;  4JI2 J;  4DR7 J;  4JV5 J;  2MTL A;  4GKK J;  4DR6 J;  4B3T J;  4DUY J;  1N34 J;  2VQE J;  4NXM J;  4NEY A;  3OTO J;  2MEW A;  1XNR J;  5A2Q U;  4NEZ A;  3J7A N;  4LF8 J;  2UUC J;  4JI1 J;  2UUA J;  5BR8 J;  2F4V J;  3T1H J;  4KYZ A;  5IWA J;  4JI3 J;  1J5E J;  4GKJ J;  1HR0 J;  2UUB J;  4JYA J;  4B3R J;  2HHH J;  4RJV A;  2KL8 A;  4DR4 J;  4LF7 J;  4DV3 J;  3D3B J;  3D3C J;  1N36 J;  1N33 J;  4LF5 J;  4DR1 J;  1HNX J;  4AQY J;  4DUZ J;  4DV5 J;  4K0K J;  1HNW J;  4LFA J;  4LF6 J;  2VQF J;  4JI5 J;  3R2C J;  4LF4 J; 
#chains in the Genus database with same CATH topology
 2YNG A;  3DKD A;  4HEA 9;  2C42 A;  3QIP B;  3SBM A;  1OSD A;  5BYS A;  1S1V B;  2G0C A;  1RWX B;  3SCJ E;  2M88 A;  2DIU A;  2ZHO A;  1TKD A;  1PJ6 A;  4RBV A;  4PG7 A;  3I56 S;  4K0K F;  3NG8 A;  2LEA A;  3H98 A;  2DTJ A;  2HNZ B;  1X4F A;  1NAQ A;  3LAM A;  4F3O A;  4WII A;  5D6G A;  4I4B A;  3W3S A;  1M0S A;  3FEZ A;  5KFG A;  2EK1 A;  2XYH B;  4DV7 J;  4PXD A;  2YNG B;  3FMB A;  4NLQ A;  3WIU A;  3K17 A;  3BDP A;  2A18 A;  2QC3 A;  5IS2 A;  1S1V A;  1RQ0 A;  4HTI A;  3ADA C;  5LSR A;  2Y3Y A;  5HQM A;  5KFC A;  2HLU A;  4JI7 F;  1AXQ A;  4QIG A;  4QPX A;  3MM6 A;  1UPM B;  2ERR A;  1QDU B;  4X4V A;  4JI6 J;  4U6P A;  5CZV A;  3CJQ A;  3J80 U;  4XPE A;  1FNM A;  2G2Y A;  5C2C A;  3CJK B;  1NK6 A;  1HMV B;  1B64 A;  4JBC A;  3MM9 A;  4PWW A;  4FYW B;  5HP1 A;  4H4M B;  1RTJ A;  5H9F J;  3LTO A;  3D6M B;  3AOC A;  5HLF B;  1JQG A;  4Y28 C;  2XI2 A;  2WAQ D;  4ILR A;  4TN2 A;  2HNY B;  2EG1 A;  4DUT A;  2IMW P;  1YBA A;  4CNY A;  4X64 J;  4LFC J;  4AE5 A;  1RDR A;  1A0O B;  4NML A;  2KVQ E;  4KHR A;  3NY0 A;  2HHP A;  4LRB A;  3VF0 B;  4DU7 A;  2HG4 A;  2KTQ A;  1U02 A;  2MQ8 A;  2AYM A;  2XMW A;  1S1W B;  4RW8 B;  4YDD B;  4KH1 B;  5HL7 Q;  1MWY A;  1Y0H A;  3UQS A;  4AND A;  2MZ1 A;  4LQ3 A;  4RBU A;  2DXD A;  2KJW A;  3OL7 A;  3W9H A;  4MH8 A;  3PX4 A;  4OX9 J;  2O67 A;  2QA2 A;  3HDS A;  2ZJR Q;  1VBZ A;  1Q8I A;  1CJT A;  5DGB A;  3ILL A;  4IFY A;  1N0V C;  2L08 A;  4TQS A;  4DLE A;  1UFW A;  2VC0 A;  5KG0 A;  5CAA A;  1YKW A;  3G96 A;  2DGQ A;  3I32 A;  1NKE A;  2B7B B;  4GKJ F;  3IR6 B;  3NWR A;  1FRK A;  4KKO A;  2RH3 A;  3R97 A;  2V68 A;  4CH1 A;  3ZTP A;  4DR3 F;  3FSX A;  4KGV B;  1JXE A;  4KPY A;  2ZZN A;  5KAK A;  1BY9 A;  1Z2L A;  2IRY A;  4B9M A;  3TA1 A;  1OSC A;  1OS5 A;  1JMT A;  3EZO A;  3L95 X;  3MZI A;  3QT7 A;  3BQ1 A;  1RTD A;  2BAC A;  2XY5 A;  2FJV A;  2VA3 A;  1TFY A;  1IVZ A;  3OJS A;  4O4G A;  2NXE A;  3IWL A;  2BRL A;  3OV7 A;  3T1H J;  2VFU A;  3IRX B;  1R27 B;  2H4Y B;  2KB2 A;  2RHS B;  3PYG A;  1B7Y B;  1RAO A;  1VI7 A;  2I0X A;  2ZFH A;  5H1S V;  1LK7 A;  4N8N A;  2M4M A;  2X51 A;  3P5T L;  4FYX B;  4M5L A;  3SCI E;  1FRM A;  4C0B A;  4C7Q A;  1L3S A;  4X4N A;  2JRS A;  3D9B A;  5J2M A;  1FX2 A;  1PYT A;  2CQ4 A;  5E3P A;  5IT0 A;  4S0M A;  2R9L A;  5I3P A;  5C42 A;  5L9N A;  1AYE A;  3EMT A;  3MCM A;  4E2F B;  3MUR P;  2KHD A;  5D4P A;  1P9Q C;  4A48 A;  2M7S A;  2KL8 A;  4RUA A;  4LF2 A;  1Z2Z A;  4CNZ A;  4DWI A;  3KLI A;  1N56 A;  3L4B C;  4ID5 A;  4HI1 A;  4PPD A;  3CJR A;  1VC5 A;  4ECU A;  3ZZP A;  1D8Y A;  4RR5 A;  5BYQ A;  3DM2 B;  2R7U A;  2HVH A;  2IVY A;  2AEJ A;  1S1T B;  3FBB A;  2XMJ A;  2KH9 A;  1IQZ A;  4J9N A;  1D0E A;  1UVI A;  1HNX J;  3HLU A;  1P1L A;  4PUO B;  4P10 A;  4Q5V A;  1LW0 B;  2B3T B;  2XY7 A;  4RW6 B;  1H38 A;  2DNK A;  1IBK F;  2DH8 A;  2BJ9 A;  4WXO A;  1NPP A;  3JYT A;  4OZ0 A;  1U1M A;  4IDK B;  3MCN A;  2D3O R;  2GHW A;  3OTC A;  1N32 J;  1VBK A;  4DQI A;  2LXI A;  4JI8 J;  2J0X A;  4B02 A;  1K8A T;  1TKT A;  4P52 A;  3UNG C;  3GYX B;  2UU9 J;  2CIM A;  4F4K A;  3QJJ A;  2GO8 A;  4Q0B A;  2E44 A;  4JI8 F;  4PWD B;  2EFP A;  3MPY A;  4UY8 T;  3KLF B;  3HCX A;  1R89 A;  1C1B A;  5KFU A;  3ZZY A;  4B9V A;  3EYZ A;  1KVJ A;  1ZZN A;  4NI2 B;  1DJ0 A;  5E41 A;  4PQU A;  1KDN A;  4URG A;  4CWB A;  4WZQ A;  3G82 A;  2BDP A;  4M5M A;  1EJ7 L;  2AW0 A;  1NU4 A;  1SC6 A;  1S6Q B;  3ETO A;  1RXO B;  5T41 A;  4E0D A;  3V6D A;  5A8W B;  5CA5 A;  1TZ0 A;  4M5D B;  4ED8 A;  3UWT A;  2OJ3 A;  1S0O A;  1RWP B;  3BN4 A;  4WU3 A;  1JLF A;  4K4X A;  4NYO A;  1XBW A;  4IH5 A;  3TW0 A;  4QR1 A;  4GVB A;  4ED0 A;  2HGN A;  1S1U A;  1O5J A;  2CQC A;  3GFX A;  3M8Y A;  4NLY A;  3CMA S;  4AL7 A;  4C4W A;  3ENW A;  2EBE A;  2RF2 A;  3EZ5 A;  1S6Q A;  4DFJ A;  4G1Q A;  1F3V A;  4J9M A;  4CLY A;  1WG4 A;  4X62 J;  4LVO P;  3RB3 A;  2CJY B;  1VMB A;  3LWL A;  1U49 A;  2ASY A;  1RWM B;  1VIO A;  2Z58 B;  3PJW A;  5AE1 A;  7FD1 A;  1RT2 A;  3GYG A;  2DRB A;  5CD4 H;  1U4B A;  1EAY C;  2HQI A;  4USW A;  3KOA A;  1LV5 A;  2HK3 A;  3H2V E;  5K8O A;  3UCU P;  1IXK A;  1BHN A;  2HVZ A;  3NWG A;  1F5B A;  3T1A A;  2ZH7 A;  2XYG B;  4BWJ A;  4ECS A;  1M5H A;  3SSS A;  5K5M A;  2MTL A;  2FZC B;  2VKR A;  2KG0 A;  3I55 S;  4J9R A;  1S6U A;  4B3R F;  3OHB A;  3C16 B;  4KO0 B;  1N34 J;  2QSW A;  3RR8 A;  3ISN D;  2XM3 A;  4K8R A;  3ILO A;  3NCQ A;  3PRV A;  2F8E X;  4NEY A;  3OTO J;  4KHP F;  2QA1 A;  3HSD A;  5B0B A;  1RWK B;  3RRG A;  3HHL D;  1WDT A;  1WI8 A;  2D3U A;  1V3Z A;  5A76 A;  6AT1 B;  3KHL A;  1RYR A;  4C2M A;  3J7Z 5;  3PW2 A;  3HSJ A;  3Q8Y A;  4FVM A;  4GKK F;  2FHJ A;  4KO0 A;  4PKD B;  3M2R A;  1TK5 A;  2VG6 B;  1XC9 A;  1HAR A;  2DHG A;  2OPS A;  3CJS A;  1ZH5 A;  2YKN B;  4CO5 A;  2CQ3 A;  4CO4 A;  4X4R A;  1K0T A;  2I5J B;  4FPI A;  5K8N A;  1Q5Y A;  3H4D A;  4FF3 A;  4Y34 A;  4X4U A;  3BR8 A;  2NUU G;  5KFL A;  1YIT S;  1ZBT A;  2VJV A;  4AFF A;  2MKH A;  1IM4 A;  1FXD A;  1GFW B;  1SC4 B;  2MKS A;  3KG0 A;  3UVJ B;  4C8M A;  2KXN B;  1KQS R;  3X3U A;  3ONQ A;  4M5G A;  2FVP A;  3AT1 B;  1IR0 A;  1X31 C;  2V6A A;  4W4M A;  2ZH8 A;  2MMY A;  1SBR A;  1MRO B;  3LO3 A;  2FUG 9;  2JZ5 A;  4C0O C;  4CH0 S;  2PEB A;  5MLC V;  3PJ9 A;  1V3R A;  4ZLL A;  4G1I A;  1XMQ F;  1NK5 A;  1K44 A;  1NUE A;  2P9G A;  3M8S A;  4QIF A;  2HBY B;  3N0V A;  2R2U A;  1RT6 A;  2LXF A;  3TJ9 A;  3QAT A;  3W65 A;  4WFB Q;  3KLE A;  1M90 T;  3PYF A;  1H2U X;  2JC0 A;  2CQ2 A;  1YJN S;  2JFK A;  2IRU A;  1FKA F;  3UN5 A;  1QTN B;  2IAJ A;  4C11 B;  1N33 J;  1VR6 A;  3MTJ A;  4DPU A;  1FEE A;  2C2N A;  2BQR A;  1ZM3 A;  4F26 A;  2PT0 A;  3OPK A;  1VQ4 S;  4LF6 J;  4X4T A;  4L75 A;  3TO8 A;  1BUX A;  2UU9 F;  1VIS A;  1GMW A;  1HL6 A;  3BDE A;  5CYQ A;  5D0H A;  2C3O A;  3W62 A;  4DF8 A;  2RS8 A;  3ZO7 A;  3BYP A;  4Q2M A;  5M2U A;  4C8Y A;  3OQ2 A;  4JB8 B;  1EX8 A;  2JOQ A;  2HIY A;  4KBI A;  2OTJ S;  3KDN A;  2VZ9 A;  4IH7 A;  1T9X A;  4N77 A;  2BJD A;  3BPD A;  4J9P A;  4PUO A;  2HW3 A;  2N4D A;  2B8Q A;  1LQ9 A;  4P2M A;  3UW1 A;  2U2F A;  5J2P B;  2DXE A;  4X65 J;  1KS2 A;  2LMI A;  2VFR A;  2M2B A;  5CYQ B;  3J7Y I;  4ZKA A;  3VAM A;  4USV A;  4K4U A;  4WK1 A;  1VGY A;  3VAI A;  3RB4 A;  1VLO A;  4QWC A;  4OQJ A;  1NH8 A;  4JP8 A;  1P8G A;  3ET6 A;  4MYU A;  3A13 A;  3TUP A;  5A0Y A;  1NSP A;  1TL3 A;  3K5L A;  3E01 A;  1KQK A;  2E1C A;  5EWE A;  1PYS B;  1S9G A;  1V9O A;  3EVW A;  4UTG A;  3OL8 A;  2AJ2 A;  4U96 A;  4ZLP A;  4P75 A;  1TVR A;  1PG5 B;  1G4C A;  1YRT A;  3VGV A;  2VA2 A;  1IKW B;  3W5X A;  2UXB J;  1YJV A;  2BYC A;  1U7L A;  2VBZ A;  2PDA A;  4OZ3 A;  4N76 A;  3NAI A;  2DGT A;  1T11 A;  4RUC A;  2AZ1 A;  4Z2X A;  3PR4 A;  4LRA A;  2UUT A;  1DY3 A;  3I6P A;  3PG9 A;  2OPQ B;  4BS2 A;  2PSZ A;  4WFY A;  1RLC L;  1ITP A;  1NCL A;  1HWU A;  2J9E A;  2VBY A;  5B0D A;  1LWC A;  2AJF E;  4ZCK A;  2EFQ A;  1WKK A;  1WSV A;  3W66 A;  2GVZ B;  3LQV A;  2V9W A;  3O5T B;  1JLE B;  4X66 J;  1OY6 A;  2FVC A;  2HGL A;  2RF2 B;  4N56 A;  1YI2 S;  3ELH A;  3R5A A;  4G1Q B;  1HI0 P;  5CXT A;  3MXH P;  2JHE A;  5F3Z A;  2GA7 A;  2J76 E;  2FTR A;  2YXL A;  3H42 A;  2XQC A;  4IO9 Q;  1S7H A;  2BM1 A;  4K4S A;  2G0J A;  4JV2 A;  4PR6 A;  1TUG B;  4FYY B;  4JV5 J;  1SV5 B;  3DLK B;  1TKZ A;  3P96 A;  3SCK E;  2C3U A;  1KFD A;  2Y1J A;  3GIR A;  2N82 B;  1CQM A;  4UOC A;  2Y1I A;  4I64 A;  3A8J A;  4TXS A;  3DYA A;  3CUL A;  3H2U B;  2JVR A;  2KT2 A;  2HKE A;  5F8L A;  2VDH A;  1FWK A;  2DO0 A;  3ZZZ A;  1QVF R;  1DTT A;  2FDN A;  2FLO A;  2CPH A;  2MEW A;  5DQI A;  5H9E J;  4OJG A;  2EEY A;  4OYZ A;  1UJ6 A;  2EW9 A;  3DRR B;  1KN6 A;  1MLA A;  3CW2 C;  3DLK A;  2DHA A;  5F0U A;  3CD6 S;  2YNF B;  2QYC A;  4EFA C;  1BD6 A;  5HBM A;  1FWP A;  3OUY B;  2W4C A;  3MR5 A;  2J0W A;  2FIU A;  1JNZ B;  3DYA B;  1AW0 A;  3L09 A;  3OTB A;  2PD1 A;  2CDQ A;  3JS9 A;  4O3N A;  2CPF A;  4JI1 J;  3VZI A;  3I4P A;  4QW8 A;  3RG6 A;  1XMO F;  4B9S A;  5KFF A;  3C66 A;  3EJM A;  2VFS A;  3SFU A;  1FJE B;  4ECT A;  2J8S A;  3DGP B;  3BZQ A;  3RAM A;  5DQG A;  1X9S A;  1HFE L;  3GCX P;  1U1L A;  1BQN B;  1NK0 A;  5AXM A;  1V6H A;  4LRE A;  2MXY A;  2IHR 1;  3K59 A;  3NNC A;  2R2R A;  4OHW A;  1DLO B;  3LAL A;  5IM0 B;  1MN7 A;  1R6V A;  4X65 F;  2V2K A;  1ARO P;  3MEG B;  2W7A A;  5LJ5 Y;  4K5R A;  2LEB A;  1KR4 A;  1CSJ A;  3IBC B;  1SXL A;  2GJ2 A;  4TYA A;  4FS2 A;  1UWB A;  4F2R A;  3VGU A;  5IT9 Y;  1QJH A;  4OI1 A;  3HHL C;  2ZM6 F;  4DV3 J;  4DV1 F;  4B9N A;  3SDE B;  2ZH4 A;  4WZM A;  1QVG R;  3RBE A;  2DR7 A;  2V8V A;  4DX7 A;  1SL0 A;  1XJW B;  2WVD A;  4OI3 A;  3C6U A;  3MTK A;  1KEK A;  1N6Q B;  2AIR B;  2J5A A;  2HAI A;  3CT9 A;  2HVI A;  2F1F A;  1XK8 A;  3MPD A;  3BH7 B;  5ETQ A;  4ZIV A;  3CO9 A;  1NZ8 A;  5B0A A;  1FWL A;  1HPZ A;  2FY8 A;  1VJW A;  4OLP A;  3HMJ G;  4IKA A;  1S72 S;  1RTI A;  1HNW J;  1U25 A;  1GXT A;  3N5B A;  1P27 B;  2FLP A;  2ZUG A;  3O3L A;  3HD2 A;  4I0W A;  1HBN A;  4NCG A;  2VQF J;  1X9W A;  5BJR A;  3KG4 A;  3EPI A;  5LSO A;  1WEX A;  1MWZ A;  4JUZ A;  5KT7 A;  5CYJ A;  3HP6 A;  2NXU A;  2EVZ A;  2C3M A;  4N8O A;  1NZA A;  5KFX A;  2L41 A;  1XMQ J;  1IBL J;  2KYZ A;  4K50 A;  2V34 A;  2IA0 A;  1RTI B;  2QJ3 A;  3I31 A;  3D2W A;  3SQO P;  1UEV A;  2P8I A;  2V63 A;  5JVG Q;  4NLR A;  4QU6 A;  3CDU A;  3HUL A;  1Q4R A;  1N4L A;  4ED5 A;  1HQ2 A;  1NJY A;  4OYW A;  3O1L A;  1REV A;  3BN7 A;  3AD7 C;  4ZCL A;  1FJG F;  2W7P A;  1TV6 B;  4XPC A;  2CAD A;  1RWW B;  3H2L A;  1X4B A;  1WAC A;  1SQE A;  3R9L A;  1RB0 A;  4AT1 B;  1CS4 B;  3MAQ A;  2VV5 A;  2J6U A;  1LKZ A;  1VK8 A;  1SJF A;  1FXR A;  1O0P A;  1REV B;  1TL3 B;  2QMW A;  4MIA A;  1HQE A;  4V1A k;  2R8H A;  4DR2 F;  4ED3 A;  4IQX A;  2B9Y A;  1RT4 A;  4YOE A;  3M30 A;  2EWH A;  4OFZ A;  3QYY A;  3ZZR A;  4B08 A;  4DZ6 A;  1FDB A;  3MPV A;  2YWG A;  2EFG A;  2N3L A;  4C8K A;  2EXU A;  3BF4 A;  3I5A A;  4Y0F A;  2AGP A;  1U1N A;  2X7I A;  3EXC X;  3OSN A;  1P9Y A;  4MFB A;  3C6T A;  4RZR A;  4OI2 A;  2ILY A;  3OVS A;  4ATN A;  2GVD B;  1JJH A;  3DHW C;  3K7R A;  1KSP A;  3B4D A;  3IAM 9;  3N01 A;  5D4L A;  3IR5 B;  2MB0 B;  5HRO B;  5DLG A;  3BQ2 A;  4O3S A;  4NZ6 A;  2YY3 A;  2E29 A;  2GQQ A;  1XQI A;  4XDC A;  2OD4 A;  4OJ3 A;  1TMM A;  2Y1L B;  2V9K A;  3F0N A;  2JX2 A;  5JUM A;  3KLG A;  1NK8 A;  2K06 A;  4IOA Q;  2CQ1 A;  2R2S A;  2KVI A;  1XTZ A;  2CPJ A;  1S0M A;  1IJF B;  4DFP A;  5T7L A;  7FDR A;  3KLH B;  5CYM B;  3HM9 A;  2C2K B;  4KJI A;  5KFD A;  3VAF A;  4OHV A;  2VQE J;  2VJU A;  4LF8 F;  3LP2 A;  4O44 A;  2A1B A;  3AA9 A;  3CJ5 A;  3IBW A;  5KG1 A;  4L3K A;  3TEH B;  3HO1 A;  1N33 F;  3DLH A;  1TKX A;  3PKM A;  4KFB B;  3DDN A;  2VFV A;  1RT7 A;  3HVT A;  3V5R A;  4EU0 A;  4DS5 A;  3PO4 A;  4W92 B;  3R27 A;  1J5O B;  2G13 A;  2DIS A;  1R7I A;  3ENQ A;  5CZX A;  3C3L A;  1HNX F;  3HVR A;  3BS9 A;  1FDA A;  3FCH A;  3CCU S;  1DZ5 A;  5KFB A;  4K2J A;  2QG9 B;  3VZH A;  2JFD A;  3CCW A;  2RAQ A;  2NXN A;  5KFO A;  3GV5 B;  4IR1 A;  3ZZO A;  1VRT B;  1OQ6 A;  2LQ8 A;  4K5S A;  4FS1 A;  4RNM A;  3J81 j;  2LCW A;  2Y8Y A;  2O5D A;  2CVI A;  2AJQ A;  2HHX A;  1J2V A;  2WB1 D;  1T03 A;  4DCP B;  5KT6 A;  4P2X A;  4ED2 A;  2BA9 A;  2XYP B;  3T5K A;  4PG8 A;  1QAY A;  4RNO A;  2OP5 A;  3KLV A;  3BBB A;  3JTO A;  4JOU A;  2CG4 A;  2NPF A;  3VV2 B;  3KHG A;  4OHZ A;  2UUB F;  5DS7 A;  3M8Q B;  1N36 F;  3QID A;  2GO9 A;  4NA1 A;  4LF7 J;  1EQ0 A;  4HH1 A;  2DGW A;  1DLO A;  5A8K A;  1I6J A;  2NS1 B;  3I5B A;  3MEG A;  3WDO A;  2HAF A;  1UJ4 A;  2J7K A;  2NSB A;  1WF2 A;  1HNI B;  4CT9 A;  2WBR A;  2J9D E;  3KK2 A;  4L3N A;  4CLW A;  3K5N A;  5GAE U;  2CJK A;  2W8L A;  1B70 B;  2I2Y A;  4DU8 A;  2ZC4 A;  1JLG A;  4CO1 A;  2ADC A;  1S1X B;  1AZS B;  3CD7 A;  1RIS A;  3MED B;  2KRB A;  3CDE A;  3KMS A;  1N48 A;  1JIH A;  3J81 U;  2Y9H A;  1YIJ S;  3GFZ A;  2I9S A;  3A4T A;  5K8P A;  2BE7 D;  3KHH A;  2XB2 D;  2VQF F;  2E5G A;  4KKO B;  3GIM A;  1YRX A;  3GSI A;  2CDR B;  2RKI A;  2Z2Z A;  5LT5 A;  4X4S A;  3KK2 B;  2EBG A;  3V6H A;  1S59 A;  4WYW A;  4ZPV R;  5LMU F;  4ZP7 A;  4DUZ F;  1T9V A;  3QGH A;  4X4P A;  3L7P A;  4H4O B;  3OW2 R;  3TR5 A;  2R3V A;  3AJ1 A;  4C3L A;  4ZJL A;  4CTA B;  1HWJ A;  3RZA A;  1UEU A;  4GMK A;  2XEX A;  1WKJ A;  2ZD1 B;  4DV4 J;  3OHA A;  1XN9 A;  2VC1 A;  1C4A A;  4IG3 B;  3CB4 A;  2DNH A;  4PYD A;  4RW6 A;  3VHQ A;  3SV3 A;  5CCM A;  2QL7 B;  1KON A;  3UR3 C;  2AT1 B;  4ID8 A;  2GV1 A;  2VIC A;  3D66 A;  2HEK A;  2DGU A;  2CJB A;  4M5I A;  2KXF A;  3NBP B;  5HMZ A;  1FER A;  2BKO A;  2PA3 A;  3PHT A;  3W60 A;  5HJX A;  1BE4 A;  3GZ7 A;  3RJM B;  2UXC J;  3D0H E;  2WHO A;  4RNN A;  1C1B B;  1ZS6 A;  2YKM B;  4DX6 A;  1BWV A;  3TI0 A;  1KOO A;  4NI2 A;  4FBT A;  5HJY A;  1ZAX A;  1BQM A;  2E7W A;  1K9M T;  3ENV A;  2UVV A;  1VDH A;  3NBP A;  1KC8 T;  3ZTQ A;  1U1P A;  4A46 A;  4NCA A;  3VQT A;  5ETS A;  5FII A;  2I8E A;  3MR6 A;  3N28 A;  3N79 A;  3F56 A;  1NB2 A;  1XR6 A;  4DUY J;  2CPE A;  2VIH A;  5EUH A;  4IRK A;  2F40 A;  1Q82 T;  2MLX A;  2RML A;  3MM8 B;  1U1O A;  3TVZ A;  3DI6 A;  3FRY A;  2C2D A;  1IKY A;  1FCA A;  2BAN A;  4A8O A;  3QWU A;  1TL5 A;  4EBE A;  4ZPD A;  1RHM B;  2DGX A;  4NLT A;  4DPX A;  5RUB A;  2MQQ A;  3FFI B;  1SC1 B;  3KLF A;  2Y0S D;  1ZAV A;  3DRP A;  3Q0A A;  2SXL A;  2C2M B;  4TY8 A;  4J9V A;  2DCU B;  1YJW S;  2QV6 A;  2ZJQ Q;  2J9D A;  2B4P A;  3V81 A;  2BAB A;  2WON A;  3U27 A;  4U7U D;  1T8E A;  2BJ8 A;  3LPE A;  1YJ7 A;  2RQK A;  2OO4 A;  4LRF A;  1TP7 A;  3MR3 A;  1WOP A;  4WXW A;  2NYH A;  4OZL A;  1X4A A;  2HMI B;  1M5V C;  3CJK A;  2X3G A;  1UVM A;  1F9H A;  4JI0 F;  3CCJ S;  4H4M A;  2J6S A;  1LWE B;  3BBC A;  3D67 A;  2CRL A;  1H7X A;  4MKA A;  4OYA A;  2BMB A;  1FDD A;  1HI8 A;  1ZA1 B;  2OKQ A;  4UF4 A;  2HNY A;  3FKB A;  1PJ5 A;  3KXD A;  1RSC A;  3MGJ A;  1VQP S;  4FYV B;  1OY9 A;  4ZP8 A;  4WKR A;  3CWJ A;  3VGS A;  2NCK L;  3HVA A;  2MGZ B;  4JV5 F;  2FB0 A;  1WI6 A;  1NLK L;  1S1W A;  2HRU A;  1T03 B;  1QM9 A;  1R0B G;  3MUV P;  3MOJ B;  4NOH A;  2FZK B;  2V2V A;  3CDB A;  2VG6 A;  1AUS L;  3HFZ B;  1T7P A;  3TZY A;  3E2E A;  2IBO A;  1RT3 B;  4CT8 A;  3TAP A;  3S1T A;  1HBO A;  1IQT A;  4A8F A;  1ULR A;  1U1K A;  4FF1 A;  1CBK A;  3H20 A;  1S99 A;  4DSE A;  3JAM Y;  3GIJ A;  4NYP A;  1TL7 B;  2ROG A;  3FRZ A;  2W9B B;  3CIZ A;  1RTJ B;  2AMC B;  4RX6 A;  5K14 B;  2B5J A;  1U09 A;  4E98 A;  2RS2 A;  4FXW A;  2H5I B;  2FJD B;  4IR9 A;  2RJZ A;  1S0N A;  1RT3 A;  1CJU A;  4A8X A;  2CZ9 A;  4F4Z A;  3EGW B;  4P9S A;  2RB7 A;  4J9K A;  1H2T Z;  4ZK7 M;  5KFE A;  3W9I A;  1U6B A;  4C8O A;  2MQO A;  1AZS A;  1S1X A;  4JI2 F;  3LH2 S;  2VPW B;  4OX6 A;  1R8A A;  3GU0 A;  2YQ0 A;  4NLO A;  1VLY A;  5K14 A;  4QU7 A;  2HYI B;  3D0G E;  4JI4 J;  1H7W A;  4O23 A;  1ROF A;  3KKF A;  1EAR A;  4ZLN A;  2XCP A;  1HW9 A;  4LF5 F;  1ZM4 A;  2CQI A;  1FRX A;  3GIL A;  1TAU A;  5JXS A;  1IKV A;  4OIX A;  4DX8 H;  4CLP A;  1Q8L A;  2IYI A;  3BGU A;  2PFD A;  3BGR B;  1VRU A;  5KFY A;  4EEY A;  1K0V A;  2PMW A;  2CWK A;  2MJN A;  3UVJ A;  4CTA A;  4ZPA A;  4WP3 A;  1CEZ A;  1DTQ B;  2M3D A;  3I9V 9;  2O1P A;  3OBI A;  1FFG B;  3PEH A;  4HH0 A;  2HVE A;  2MQN A;  4LSN B;  1JLQ A;  4RW4 A;  4DV4 F;  4B3O B;  2FYX A;  3CME S;  4M94 A;  3IC1 A;  1E6V B;  1RAI B;  1UZH A;  1NRK A;  1OMS A;  1REG X;  2P2C B;  3GV8 B;  1LW2 B;  1U8S A;  3G6E S;  4IUF A;  3HHL B;  2KKH A;  3OR1 B;  3NL0 A;  1RT6 B;  2YWK A;  1LNQ A;  2ROP A;  4KH0 B;  3RBX A;  4UT4 A;  4ZIW A;  3KLE B;  1HA1 A;  2DNO A;  2HZV A;  4RUB A;  1DTQ A;  4LFB J;  1GMU A;  2HFV A;  2EI5 A;  2RSQ A;  3TA0 A;  5EWF A;  1C4C A;  4X62 F;  1C2P A;  1QTM A;  2HZA A;  1Y11 A;  3IWN C;  4ZS6 A;  2VPX B;  5KFZ A;  5I42 A;  2BBE A;  4NX9 A;  1RLD A;  4OI6 A;  1E6V A;  3TJ8 A;  1X4C A;  2MZQ A;  3AXK A;  4RBT A;  2PII A;  5IC6 B;  3U1M A;  4OX7 A;  2MZS A;  3TWZ A;  3CC7 S;  5DM7 Q;  1UEK A;  4EO8 A;  2HIQ A;  1U47 A;  1TVR B;  2BR0 A;  4OJ1 A;  5J2M B;  3OL9 A;  2HWH A;  4KRW A;  4XO0 A;  1LFW A;  1U0H B;  4FYD A;  1FK9 B;  5IFM A;  1RCX B;  5H9E K;  4IG0 A;  4OV6 A;  1DQA A;  2HND A;  5A8R B;  4W90 B;  4FNI A;  4QQB A;  4ELV A;  1UW4 A;  3W8P A;  1Y7P A;  2M70 A;  2KT5 A;  4NEZ A;  5KG5 A;  1Y10 A;  3OL6 A;  3HT3 A;  2XC9 A;  4DUY F;  1B99 A;  4J5O A;  3AQO A;  2FGO A;  2F9D A;  3A3P B;  4UW2 A;  1DUR A;  1Q0N A;  2KJV A;  3L9Z A;  1T95 A;  2DIV A;  3R6L B;  2R8K A;  1W25 A;  2ZE2 A;  4WPA A;  4ZVU B;  3KDO A;  3TZW A;  9ATC B;  1FK9 A;  4LF8 J;  2F9J A;  1KLM A;  2WOM A;  4IG0 B;  4CM2 A;  3H5S A;  1I94 F;  5KG3 A;  4I6Y A;  3AOB A;  2N7C A;  4EZ6 A;  2Q1L A;  3TEG A;  1N8R T;  1EP4 B;  3FEY B;  1XMB A;  1JLF B;  4IYQ A;  1AB8 A;  1SV5 A;  1SC3 B;  2CQB A;  2QYG A;  3SQG B;  5AE3 A;  3M4X A;  4MK8 A;  1HHS A;  3NGK A;  4MIW A;  5HK4 A;  4XK8 C;  2CPI A;  2E7X A;  2JH3 A;  1YVF A;  2M0G B;  4I67 A;  4P7V A;  2C1E B;  3C8Y A;  3JQJ A;  1WC5 A;  3ETM A;  1F5C A;  2B9X A;  3FGV A;  2AU0 A;  2MST A;  3OFG A;  1P6T A;  2CG8 A;  2K3K A;  2XUL A;  3OTE A;  3BV8 A;  3GJT B;  3UO0 A;  5F41 A;  1LWC B;  1RT2 B;  4B3S F;  3NNA A;  3PTW A;  2H1Y A;  3DU6 A;  2HFU A;  2MKC A;  2QX0 A;  3D6H B;  4L76 A;  5HVG A;  4ZHR B;  1RYS A;  2R8J A;  2L3M A;  3BB5 A;  4DSL A;  2V4R A;  1DAR A;  5A8W A;  1RK8 A;  3N5F A;  3PYD A;  4KGX B;  4RO0 A;  3RBZ A;  3T6J A;  2BUN A;  4DN0 A;  2FHM A;  3CPW R;  3HK2 A;  4RU9 A;  1SPB P;  4I7F A;  1SL2 A;  3OVB A;  5LXR A;  3BGO P;  3OR2 B;  2HBR B;  4TY9 A;  4NZ7 A;  3E3X A;  2OLW A;  3S7R A;  1VQ5 S;  2XS7 A;  3UCG A;  1BWE A;  1ZPW X;  3RTV A;  5KOX A;  2MHE A;  1ZTW A;  3AAW B;  4ENO A;  4YY3 J;  2YKQ A;  2GIF A;  1W7W A;  1A6L A;  2WCX A;  2ZDP A;  3DOL B;  3PZP A;  1HBO B;  2IIH A;  4Q45 A;  5DLF A;  2CPZ A;  3OTO F;  4B3T F;  4KHP J;  1V5V A;  3G87 A;  4J37 A;  4K2X A;  2R7X A;  1F0X A;  4A4J A;  2YKO A;  3POT B;  4BHQ A;  3SDE A;  3CNQ P;  4UY8 5;  1UWA A;  4OZ5 A;  2HQD A;  3THV A;  1WHY A;  1SQF A;  4ZPT R;  1S48 A;  3V6J A;  1ICE B;  3FBC A;  5E3Q A;  2W2P P;  1GT8 A;  8AT1 B;  2V8D A;  1FRI A;  1MMN A;  1S4F A;  4ZOS A;  1XWL A;  2R7R A;  2QEX S;  2N4C A;  5GAG U;  2AX1 A;  2RNE A;  5HO4 A;  3BSO A;  4PXB A;  5HVH A;  4F04 B;  2K1R A;  1FNO A;  3CDA A;  1BQN A;  1H73 A;  2B4V A;  3I0R B;  3IBF B;  5BYR A;  4YME A;  2COL A;  3MUM P;  3UCZ P;  3VAK A;  1E6Y B;  3OFE A;  4ZJO A;  1H72 C;  2Q3P A;  2C2Z B;  3MEC B;  3R5D A;  1R0C B;  4OX9 F;  4F36 A;  4D3G A;  2FQQ B;  1UWB B;  3SEO A;  3ZNU A;  1NKC A;  1Y00 A;  3GV7 B;  2JSX A;  3HSZ A;  2FJX A;  4BDP A;  3M8P B;  4DFM A;  4F02 A;  2HS4 A;  2IC3 B;  1WEZ A;  4J9U E;  3M2R B;  4DV1 J;  1WOR A;  4LFC F;  4DSF A;  4LMZ A;  2QLB B;  3T9N A;  4NRT A;  3BR9 A;  3R8Y A;  1S0V A;  4U67 Q;  2NZC A;  3L3C A;  2VKZ G;  3HXM A;  1WC0 A;  4HL9 A;  4ZPB A;  1DBD A;  2IJR A;  5IQQ A;  3R5J B;  2B9E A;  2JJ4 D;  3CVK A;  3SMZ A;  4ELU A;  4IO1 A;  4F3M A;  4LJM A;  5D0E A;  1FES A;  2GW8 A;  4DF4 A;  2DJW A;  2V0N A;  2KRR A;  4M5H A;  2E1A A;  4MAK A;  2RDI A;  4P72 A;  4WBF A;  3QFW A;  4EGL A;  2LDY A;  3GG0 A;  4KGK A;  4FBU A;  1S9F A;  3DCA A;  1JJC B;  1FRL A;  4K4Y A;  1RI7 A;  3MUT P;  4YQW A;  4YB6 A;  2FHK A;  4DDF A;  3MMJ A;  3BEG B;  1MSW D;  1VCT A;  3A3O B;  4BLG A;  4C3K A;  3AD8 C;  3HSG A;  3NGT A;  4IRC A;  4F4Y A;  1RU1 A;  1NKB A;  2ZBC A;  3NAH A;  4DV3 F;  1JKH A;  3KFW X;  5L8R C;  3C6T B;  4H54 A;  3AY0 A;  3SI8 A;  3PW0 A;  1BMQ B;  4CLK A;  2ZH3 A;  2R4F A;  5T14 A;  3J7Z T;  3EX7 B;  1IBM F;  2CNK B;  3KK3 B;  3E01 B;  2J7W A;  3DHX A;  4YR2 A;  3EUN A;  1C1C A;  2C2E A;  3KYL A;  1S10 A;  5L1L A;  1GXU A;  5KFR A;  3OSP A;  2OHD A;  3EGV A;  4MKB A;  1AT1 B;  3KLG B;  1NJX A;  1N54 B;  2D41 A;  3WHI A;  2X1B A;  3K89 A;  3PKY A;  1KLM B;  1T05 A;  3EGZ A;  2GGP A;  5EHH A;  1NME B;  4N47 A;  2E5J A;  2XO6 A;  3KK3 A;  3MHY A;  1JJ2 R;  2DGO A;  2ZZT A;  5M2R A;  4DPW A;  1WOO A;  3GJR B;  4O44 B;  2UUC F;  3QBC A;  2AGQ A;  3MMB B;  1X0F A;  1QSS A;  2V8G A;  2JLF A;  2LP4 A;  2AWZ A;  2B0G A;  4ZVF A;  1JLE A;  4NL5 A;  2WZ1 A;  9RUB A;  2YH0 A;  3AA8 A;  1J5O A;  3I0S A;  4A8W A;  2HFN A;  2AJ1 A;  1CJV B;  3MAA A;  2XWY A;  1JJ4 A;  2W01 A;  3Q83 A;  1RHR B;  1RAC B;  3QIP A;  4QWE A;  2RQC A;  2HRY A;  4ECX A;  3K8W A;  2D3O 1;  3MMB A;  1FHT A;  4DSK A;  2GHP A;  2POK A;  1VHI A;  3QO9 A;  4FXD A;  3R2C J;  1JLB A;  1UPP A;  3CJ2 A;  4UOH A;  4C0H A;  2W1B A;  4G6V B;  4X64 F;  2EFN A;  3UPF A;  3I0S B;  2UXD F;  2JLE A;  4USI A;  1QE1 B;  3A8I A;  2CNL B;  3OTD A;  1HBU B;  4A8Q A;  3PX0 A;  3HHN B;  2LA4 A;  4WF9 Q;  4F8R A;  1A9N B;  2EFO A;  2AYE A;  3TZX A;  2GC8 A;  3GPA A;  4BBY A;  4IOC Q;  4OX8 A;  1WTB A;  1NB7 A;  1JX4 A;  4DL0 C;  1BXN A;  4I2Q B;  3GCW P;  4D3H A;  4WFA Q;  3G6X A;  4ECR A;  3D4J A;  3GB0 A;  4TU9 A;  3LP1 B;  1YX2 A;  4EYH B;  1UFK A;  2HGM A;  5HI7 A;  4UZC A;  3SXL A;  2PI4 A;  4HHH A;  3TAM B;  4J90 A;  4YB5 A;  1KVK A;  3GG1 A;  4DLG A;  1Q81 T;  4JI0 J;  1S57 A;  1RHK B;  4LR8 A;  5HLF A;  4OYB A;  4WTY A;  2KHC A;  2M8D B;  4KPC A;  1PAE X;  1OY8 A;  2C3P A;  3CED A;  2LA6 A;  5I3Q A;  2GIQ A;  2CJQ A;  2IM0 A;  2DK2 A;  2ILZ A;  4OI4 A;  2VUG A;  2LQ9 A;  5L9X A;  3C14 B;  3ZXW A;  4ZN3 A;  4A8M P;  5G0R A;  1PBA A;  2CQP A;  3WX4 A;  3MED A;  4OYM A;  4O3Q A;  2W7O A;  4ED1 A;  2J6T A;  4F2S A;  2ZZM A;  1QAI A;  3M9M B;  2YQ3 A;  5DJB A;  4WU2 A;  1LEO A;  1U26 A;  1U48 A;  2LU1 A;  3R7B B;  2GML A;  3H4B A;  3KJN B;  2H9Z A;  1PAU B;  3C6U B;  2QMX A;  3DRX A;  4I2P A;  4ZPC A;  4DEZ A;  1XER A;  1EIY B;  3QJP A;  3KJQ B;  2M8H A;  4P73 A;  2BZ2 A;  3VAJ A;  1JXV A;  2K2P A;  2OEK A;  2MKI A;  2HQG A;  4P7T A;  2FVS A;  2HHU A;  3RW7 A;  1HHQ A;  1F9E B;  2XTJ P;  1IBM J;  2DYA A;  2HSE B;  4JI7 J;  4EMD A;  5CCL A;  3OT9 A;  1C0T A;  1XR7 A;  3FK4 A;  1JLG B;  1OO0 B;  1P1T A;  4DPY A;  1HNV B;  4CI0 B;  4YHH F;  1TUV A;  4K4V A;  2XMK A;  3WC2 A;  4RWW A;  1WUU A;  3FCW A;  2KXH A;  1IUJ A;  2IJN A;  3QMQ A;  1L3K A;  3OFF A;  2DPI A;  3LOU A;  2DR9 A;  2LXU A;  2ROE A;  1URR A;  4AL5 A;  1L3V A;  4HI2 A;  2KN4 A;  2EC2 A;  1AUD A;  1XNR J;  2LYV A;  3P45 B;  2RIL A;  2ZVI A;  5DDQ C;  3QWP A;  2VPZ B;  2YKP A;  4HYK A;  5LSL A;  1NK4 A;  4ICL A;  5HMY A;  1WHV A;  2DIT A;  2XMA A;  2XSJ A;  3CE8 A;  2H54 B;  4LUB A;  4ZLJ A;  2KFN A;  1VQO S;  2OMO A;  3DN9 A;  3CCE S;  4ECY A;  4KTQ A;  3QRP A;  2QGF B;  3M1V A;  1HD1 A;  2CA9 A;  3E51 A;  2F8H A;  2VG5 A;  1K1S A;  3O44 A;  1U6F A;  4NCG B;  4UQT A;  3R7S B;  4TU7 A;  1I1G A;  1S79 A;  3DLL Q;  3WC0 A;  2HRT A;  3GLJ A;  4QOT A;  5IWA J;  4WJB A;  2ZH2 A;  2XNR A;  1OPI A;  1HR0 J;  1FKP B;  1GTH A;  2BX6 A;  5ETT A;  2XLI A;  1GX6 A;  1QAX A;  4C9D A;  1S9E B;  5F8J A;  2RUG A;  2JWN A;  2GMJ A;  2D74 B;  2D9P A;  2MZT A;  1DQ8 A;  2P6T A;  3GFY A;  4YDX A;  3BQ0 A;  5M2P A;  3MEE B;  4KV8 A;  3Q86 A;  2UZA A;  2VBX A;  2OPR B;  4ZVT B;  4ECW A;  1RT1 B;  3M05 A;  4AUK A;  1UW9 A;  3JSM B;  3BJY A;  3KK1 B;  1FVQ A;  1W26 A;  3Q8Q B;  4EBD A;  1R43 A;  1TK8 A;  2UXB F;  2P5V A;  5HAT A;  1D09 B;  1HQU B;  2HZC A;  3IM8 A;  2CQ0 A;  2ASD A;  2GVD A;  1T9W A;  1OWX A;  3NS6 A;  2CZV C;  5GMD A;  5JMN A;  4ETZ A;  4OI0 A;  1G7C B;  3KUH A;  1RTH B;  4DG1 A;  4DR1 J;  4ITS A;  2YH1 A;  3CCM S;  1KWM A;  2IDL A;  2IM1 A;  3FMW A;  4LIR A;  5KG6 A;  5FJ4 A;  2R7V A;  4M1K A;  5F8M A;  2HNZ A;  2BM0 A;  2FJE B;  4PAA A;  3QAE A;  1WF0 A;  5BXI A;  3R7N B;  3UR0 A;  3GII A;  1RT4 B;  3ENA A;  2A2D A;  5ETK A;  1L3U A;  3OJU A;  4CYU A;  4ZVP B;  1ZYQ A;  3AB4 B;  4O0N A;  4U8Y A;  3RYL A;  4MIB A;  3M8R A;  1VJQ A;  3FFI A;  2U1A A;  2Z2M A;  4OYI A;  3DRP B;  2BXJ A;  4NE9 C;  2MY7 A;  2QO3 A;  3K2Y A;  5AXL A;  3BO3 A;  5E2Q A;  3UFC X;  1RAH B;  2B4U A;  4UZB A;  1S1U B;  2XWX A;  3MM9 B;  3Q23 A;  1X5S A;  4WP8 A;  4LFA F;  1SH0 A;  4KY3 A;  4CDI A;  1MU2 B;  4X4O A;  3QGG A;  4N7T A;  3AQP A;  4G1P A;  5C2G A;  3CCQ S;  2UUA F;  2NR0 A;  5HMW A;  4DR5 J;  3M32 A;  4OZ1 A;  4ILM A;  3RU0 A;  4YR0 A;  2BOA A;  3PIP Q;  3PW5 A;  1IBK J;  2Y0B B;  3R5C A;  3UI3 A;  3H5X A;  2WK4 A;  2NUH A;  3KMQ A;  3LUY A;  1FD2 A;  2ADB A;  5D4O A;  4DHV A;  5EX0 A;  4FKY A;  1IBL F;  3T5L A;  1CJT B;  1RT7 B;  3EDR B;  1HWI A;  3EWG A;  1Q5V A;  1FX4 A;  2F4V F;  1JLA B;  4K4Z A;  3FQK A;  2VOO A;  2K7K A;  1B0T A;  5B0G A;  2KDO A;  2WVE A;  2R42 A;  3G6V A;  2MGZ A;  4F0H A;  5A8K B;  4DQR A;  1VQ6 S;  3QNW B;  6FDR A;  2FPH X;  5GAG I;  3C2P A;  2AKW B;  1S6P A;  3C16 A;  4LFB F;  2DEJ A;  3PO5 A;  2XGQ A;  2HK2 A;  4UOF A;  4X4Q A;  4LRC A;  3VQS A;  2IM3 A;  1VRT A;  4P74 A;  4URQ U;  4RUH A;  5IOL A;  1JLA A;  1IR2 A;  2G2Z A;  5B0C A;  3IG1 A;  5AJ3 F;  3DLB A;  5C5J A;  2L9W A;  2G1H A;  1T0T V;  1G3O A;  4QJV A;  3S6E A;  1NSA A;  3TA2 A;  1D8Z A;  1RGV A;  3HVW A;  2EFV A;  1OJ4 A;  4Y2I A;  3BSN A;  1VYA A;  2KU7 A;  4P2S A;  5LOQ A;  4IFY B;  4U7U K;  3AOD A;  2H51 B;  3PAC A;  3V4I A;  3M8Q A;  5HQL A;  2PN6 A;  2E9Z A;  4DBQ A;  4ANC A;  1QY7 A;  1X8D A;  1U45 A;  2G4B A;  4J9O A;  3P5B P;  1RKI A;  1HNV A;  4Y6I A;  1ZTT A;  4QWA A;  1NDC A;  5KG2 A;  2KT3 A;  3J7A N;  1GMW D;  1NHK L;  1UL3 A;  1GK8 A;  1FDN A;  4MK9 A;  2HQC A;  2XMM A;  2KI2 A;  2QRR A;  3CC2 S;  4KSE B;  4YS2 A;  5E3R A;  2UUA J;  1RAJ A;  2WW4 A;  2YX4 A;  3AHP A;  2ZDO A;  4Q44 A;  3G8S A;  3LWM A;  1IWG A;  4UOG A;  3WZ0 A;  3SFG A;  1KKH A;  1NBE B;  4AQY F;  4QYZ J;  1H0H B;  1NDK A;  3KLI B;  1R8B A;  2FHO B;  1RA6 A;  5KFM A;  4K7Q A;  4FF2 A;  3QQC D;  3DOK B;  2ASL A;  2QLW A;  1NDP A;  4WFX A;  2JLG A;  1OYE A;  4R0J A;  1M5P C;  2Q6C A;  1SJ1 A;  3LGM A;  1NHU A;  1S1T A;  1RAD B;  4L74 A;  1HNZ F;  4RW4 B;  1NXI A;  1UA0 A;  3FEX B;  4DQP A;  4M8L A;  1DRZ A;  4B3O A;  2HND B;  4XDD A;  5C24 B;  1GTE A;  1Y3J A;  1ZET A;  1HHT P;  3PR5 B;  4DL6 A;  2G0I A;  3R6G B;  3C15 A;  3UDL A;  4ZJQ A;  2YKM A;  3D3C J;  3VAH A;  1F2H A;  2Y1R I;  3DOK A;  2HHH F;  5HMX A;  3N9U C;  2MQL A;  2DVI A;  3I96 A;  2DCL A;  2DNP A;  2XBP A;  2CQD A;  1K47 A;  1FFW B;  2KYX A;  2VF3 A;  1G6B A;  3Q8V A;  5C24 A;  1V3S A;  2X1G A;  3KK1 A;  5KOW A;  4JI4 F;  4J9Q A;  1S49 A;  5GAD U;  1U8W A;  5K8M A;  2RRN A;  1BGX T;  4H4K A;  1JLC B;  1CG2 A;  4R5P A;  2OH2 A;  5CQG A;  3TAQ A;  5KG7 A;  3PY8 A;  1R8H A;  1RTH A;  4DG1 B;  3R5B A;  4DV2 J;  3A8E A;  5A0Y B;  2LFV A;  1F2G A;  3V6D B;  5FD1 A;  1FJG J;  1KP6 A;  2WBM A;  4ZVS B;  4ECV A;  1WHX A;  4ZP6 A;  2VAS A;  3RW6 A;  3HFK A;  4P71 A;  1YBT A;  3D6F B;  3CGI A;  3M8W A;  3OD2 A;  1TL4 A;  1ZZF A;  2OAU A;  3ZTR A;  4K4W A;  4ZIT A;  1GQE A;  4CYU B;  1TKT B;  2ZHB A;  2OD6 A;  2RUS A;  4F3Q A;  3LA0 A;  4NXN J;  1YG0 A;  4Q0B B;  2OI2 A;  2P9C A;  5IQ6 A;  1F3F A;  4GO7 X;  2B8P A;  2F8M A;  3S8S A;  2IVF B;  4PQU B;  5GVQ A;  2PE8 A;  3H5U A;  2VPY B;  4JI6 F;  2J8A A;  5DG9 A;  3IR7 B;  4F0M A;  4ED4 A;  5L1I A;  4ZCM A;  1YJR A;  2RQM A;  3HPO A;  4ECZ A;  2DGV A;  1LWE A;  2P6S A;  3V4M A;  1IM6 A;  1MU2 A;  2HWI A;  4OZN A;  3V2U C;  5EDW A;  3MM5 A;  1WOS A;  3DRY A;  4WIQ A;  2J7U A;  4O3P A;  3H7H B;  2ZH9 A;  1O51 A;  5J2Q A;  2ALZ A;  3EE3 A;  1N5Q A;  4TY8 B;  2NYI A;  2W2Q P;  3QGP A;  2LLZ A;  2YKA A;  4DCJ B;  1NJZ A;  3M2V A;  2DR8 A;  3TX0 A;  2KM8 B;  1SCJ B;  3BBF A;  5J1P A;  3QFH A;  3MM5 B;  4I56 A;  3Q8P B;  2ZH6 A;  5J2Q B;  5L39 A;  2VDI A;  1YJU A;  4Q7A A;  3M9O B;  4C98 A;  1Q16 B;  5D3G A;  2V2Z A;  2KM8 C;  2QSF A;  3CD5 A;  2W8K A;  4I7F B;  4QPT A;  1PIL A;  3MFI A;  2Z2Y B;  2WSC C;  3VVU A;  3QT8 A;  1BLU A;  2AGO A;  4FZV A;  2BRK A;  5L38 A;  5LJ3 Y;  2YPY A;  4WTO B;  2MZR A;  3DU5 A;  2V67 A;  3ZZU A;  4O4R A;  4USK A;  2ZJP Q;  1YHQ S;  4NXM J;  3A3N B;  2DXF A;  4HDG A;  1B3T A;  1B0V A;  1RWV B;  1RWU A;  2GFF A;  2ABY A;  4USH A;  2H3E B;  1PIE A;  4A8Y A;  3QT6 A;  2QN6 B;  4TQR A;  4HDH A;  5SZT A;  3QZ7 A;  3F73 A;  2IC3 A;  2LQB A;  2WW8 A;  3M7V A;  1FVS A;  2ZBQ A;  3HKZ D;  4NLW A;  4QCL A;  4NA3 A;  4DV7 F;  3H90 A;  4FKX A;  4U95 A;  5IM0 A;  4LF9 J;  3WQP A;  1R8P A;  1U6Z A;  1U2R A;  2MPU A;  8ATC B;  2X1F A;  3E8O A;  3US5 A;  3EGN A;  3W5Y A;  1FRH A;  1SKU B;  2GAG C;  3BGR A;  2QTW A;  4HAC B;  4MK7 A;  2KG1 A;  4DR1 F;  4QYZ K;  5KFS A;  3Q24 A;  3CC4 S;  1HBM A;  1EET A;  3IM9 A;  3D1O A;  2YKN A;  1WTF A;  5ITH A;  3HKW A;  1CJU B;  1URN A;  3IRX A;  3MFH A;  4O3R A;  1DFD A;  2OUG A;  3CUN A;  1Y9O A;  2UV8 G;  2DH9 A;  3EXY A;  5I3U B;  3HHL A;  3FC9 A;  4MYT A;  2N7Y A;  3DLE B;  3M8P A;  4USU A;  1NK7 A;  4FXV A;  3L7O A;  3U02 A;  4JI5 F;  4NYZ A;  1HBM B;  3RBD A;  3RAX A;  4RL1 A;  1EET B;  4ZPW R;  4F4W A;  2E5I A;  5AE2 A;  4CIO A;  2FHJ D;  3IGN A;  1UVN A;  1QSL A;  1C0U B;  1YWX A;  2QMU B;  4J91 A;  1G1X A;  3UNY A;  1SKR A;  3U1N A;  4LFA J;  5J2P A;  3R1H A;  1JK9 B;  2I1R A;  2RQ4 A;  2H65 B;  1T02 A;  1NND A;  2Z30 B;  4PEO A;  2OGU A;  3TUI C;  4F67 A;  5KFV A;  3DLJ A;  4EK2 A;  2WTF A;  4DS4 A;  3B54 A;  1S5Z A;  4OYX A;  2PO4 A;  1JLQ B;  3IWX A;  4Y2K A;  4FDF A;  4L6V 3;  2E1M C;  3CJ4 A;  3BSA A;  3QSI A;  3H25 A;  1VS3 A;  2UXC F;  3I87 A;  1TV6 A;  5KT2 A;  1FTC A;  4WK3 A;  3HD1 A;  2ACM A;  3ZZT A;  2AZ3 A;  2B6A A;  2V2Q A;  5J2N B;  4R5P B;  4X84 A;  1TR0 A;  3RUB L;  1N34 F;  3R3T A;  1RT5 B;  4F0K A;  2XG8 A;  2YNI A;  1YSJ A;  3S01 A;  1DHM A;  2OPP B;  1AA1 B;  2WOM B;  4R0E A;  1QAJ A;  4LRD A;  4OZJ A;  3I5C A;  2WSE C;  2Z56 B;  3TZZ A;  5KFK A;  4U7C A;  4LF4 F;  2HBQ B;  5KFT A;  1RWO B;  2GZO A;  1SUQ B;  2RE1 A;  2V4J A;  4O3O A;  3K8V A;  4LBI A;  3D1H A;  3G4S S;  2XS2 A;  4M95 A;  3BKF A;  3CJ3 A;  3D28 A;  5LMN F;  3QO9 B;  1PGZ A;  1RT5 A;  2IM2 A;  1EQM A;  5KFI A;  4IFV A;  1M5K C;  3ET6 B;  1F9F A;  3GYN A;  1FJC A;  3RB6 A;  2VL1 A;  1VQK S;  1PBU A;  4YEA A;  3CF5 Q;  3PXG a;  3VWS A;  1TFW A;  4M5D A;  2DHS A;  3FJ2 A;  5D77 A;  2HS3 A;  1S12 A;  1S9G B;  3OXL A;  2ZWO A;  1GAO A;  4MKV A;  4RU2 A;  1PC4 A;  2UVW A;  1J27 A;  1FJ7 A;  4PQA A;  3KWM A;  1VOM A;  1N52 B;  4GVB B;  3RGI A;  5DDR C;  2ZE2 B;  1CLF A;  1TKZ B;  2E5L F;  1NDL A;  1NH7 A;  2AP6 A;  3H59 A;  4B3S J;  1KTQ A;  3DMJ B;  5DET A;  4ED7 A;  5T7L B;  3KLH A;  3CSK A;  1YZ7 A;  2LU2 A;  2AJ4 A;  1CJK A;  1TU0 B;  5GMK a;  1S77 D;  1RJJ A;  5IT9 U;  1NO8 A;  2OPQ A;  2NPI A;  2BW7 A;  2RIJ A;  4KGM A;  1EP4 A;  4ALZ A;  3ZTS A;  4DPT A;  1Q7L B;  2A10 A;  3ITH B;  3QLH A;  1EB0 A;  2HHS A;  1AFI A;  4PPZ A;  2B56 A;  2FC8 A;  2JDJ A;  1LXJ A;  4B3T J;  1SL1 A;  2XHC A;  2QLF B;  2ACY A;  3OVA A;  3BYR A;  1KD1 T;  3DMJ A;  2MHN A;  4USJ C;  3OLB A;  3BKT A;  3G6Y A;  3V6K A;  3AH6 A;  3RRK A;  5D3G B;  1HBU A;  1VQS A;  2Q43 A;  3K5O A;  4Q8E A;  3MF5 A;  1D9D A;  1NM2 A;  4NAS A;  4PYA A;  3TVY A;  2MZJ A;  1SH2 A;  2LEP A;  5HVF A;  4ECQ A;  1NJW A;  1ZM2 A;  3GSD A;  5K9F A;  3DXB A;  2CQG A;  4I2P B;  2VOD A;  3QRQ A;  2L48 A;  4PCQ A;  3PRD A;  1DTT B;  4L73 A;  4OHX A;  5SUH A;  1LFP A;  3DDK A;  4PZV A;  2VFT A;  3GJS B;  3SZ2 A;  2QLX A;  4WFZ A;  1DAX A;  3CJ0 A;  3MM7 A;  4OV1 A;  2F7V A;  5E3C A;  5HBM B;  3TYT A;  3CCT A;  1TUW A;  2DPJ A;  4R8U A;  3ZZ0 A;  4MKY A;  1SJ4 P;  1KRP A;  4B3R J;  3JTP A;  3O6Q A;  3W2V B;  3IN5 A;  4OZ2 A;  3KUE A;  1VQM S;  3QRR A;  5EGY A;  3NGU A;  4MMO A;  3ILI A;  1HNI A;  2OSR A;  2WRM A;  1X4E A;  2UV8 A;  1XR5 A;  1X5T A;  4CRJ A;  3NGR A;  4Z7C A;  4AL6 A;  2CVE A;  4IRD A;  4GRS A;  2IBK A;  1WWH A;  2PFF B;  3G2X A;  1KTV A;  3VTI A;  4YUD A;  3OXG A;  2IDE A;  3O8W A;  4DV5 J;  4ANE A;  2ALY B;  3IA0 A;  1RBL A;  3NGS A;  4DL4 A;  1PO6 A;  4WFN Q;  3NNH A;  2JEJ A;  4JI5 J;  4GO5 X;  5IV4 A;  3Q8S B;  3ILJ A;  1TTH B;  1Q53 A;  5HQ8 A;  2YQ1 A;  1FKP A;  4FP9 A;  3HZG A;  4Z7Y A;  2HMI A;  1E6Y A;  2ATC B;  1RBO B;  1C0U A;  2GS8 A;  2CJ9 A;  1RAA B;  3C46 A;  4DI6 A;  4XTT A;  3HHD A;  3I82 A;  3K58 A;  3BO4 A;  3UD5 A;  1RAF B;  1SB6 A;  4CQ1 A;  1CUL B;  3K0J A;  4ZA1 A;  2BV3 A;  3NOG A;  3BRE A;  1JKH B;  1WG5 A;  4BC7 A;  2XSJ B;  1HIY A;  3W7B A;  4JI1 F;  1VQ9 S;  2OFH X;  5AXN A;  4LF1 A;  1HQE B;  4OMF G;  1XNR F;  1HI1 A;  1GXL A;  4XAK A;  2VB6 A;  2ZH5 A;  2C22 A;  4URS A;  1M1G A;  4FNH A;  3CJT A;  5LM7 E;  2DKO B;  5FDL A;  2VG7 A;  2B6A B;  3NCP A;  5A6W A;  2V8H A;  1PJ7 A;  1ACM B;  1RU2 A;  3O2I A;  5F3T A;  2ZHA A;  1PCA A;  1RP5 A;  1YZ6 A;  5ETP A;  2DY1 A;  3P6Y C;  2UVR A;  3CJ8 A;  5GAE I;  2PMH A;  4RW9 A;  5E5N A;  4F7V A;  4TNO A;  1O8B A;  2RD5 C;  2V4J B;  4CH7 A;  3MD3 A;  2X1A A;  3T41 A;  2R7O A;  1KLN A;  1N5Y A;  1F60 B;  1SI9 A;  2V4Q A;  3A8K A;  1M1H A;  3DFE A;  3GR1 A;  3VGT A;  3J7A 1;  4QIE A;  2JL9 A;  4HT7 A;  5GAD I;  1X7V A;  2GIR A;  5CYM A;  1RAG B;  1UFL A;  1ZM9 A;  1X4D A;  2QZ8 A;  1RHU B;  2FJB B;  3MAA B;  4I1T A;  4Q2L A;  2G9O A;  2ZIT A;  3DRS B;  2XZD B;  3LP2 B;  3MM8 A;  2GHV C;  4EWT A;  2CYY A;  3PCO B;  3VAG A;  4DR2 J;  1RKJ A;  1IKY B;  2BAN B;  2BJ3 A;  2D69 A;  3HF5 A;  4HHJ A;  1J5E F;  2BOP A;  4JI2 J;  1YLX A;  1PSD A;  5DO2 A;  2ASJ A;  4DR7 J;  1JLB B;  3Q8U A;  5F8H A;  1FRJ A;  1N0U A;  1U2F A;  4DL3 A;  3PV8 A;  2C2R A;  1NK9 A;  1T05 B;  4HR2 A;  3NEK A;  4IH6 A;  1I5O B;  4NLX A;  1RHJ B;  2Z4P A;  5H9F K;  3T1H F;  1IN0 A;  2M52 A;  3V81 B;  2J0S D;  2NXJ A;  4B9T A;  5ETL A;  2YPZ A;  2QE5 A;  2R2T A;  1HYS B;  3T5J A;  3KTQ A;  2DR6 A;  2R8G A;  5HAN A;  1KQF B;  4CLF A;  4I2Q A;  3IFE A;  1NPK A;  2DBB A;  3M8Z A;  2QA4 S;  4OYO A;  4AYB D;  4PRF A;  3R1L A;  4X2B A;  3JQM A;  3LGH A;  4KE5 A;  3PW7 A;  4CLZ A;  2Q6B A;  5BR8 J;  1IWA A;  5JJB A;  4HTJ A;  3NRB A;  1KHV A;  2BJ7 A;  2NRE A;  4DR6 F;  3MM6 B;  4CLT A;  3HVT B;  2YBV A;  4O0I A;  4DXL A;  1MW7 A;  3IG1 B;  2YWW A;  4RWX A;  2BJE A;  3UN2 A;  2CUY A;  2CJA A;  4J9S A;  4JYA J;  2GQC A;  5A6P A;  2ZH1 A;  4RW7 B;  3THP A;  4KHM A;  4J7C A;  5ETM A;  3W63 A;  4GC6 A;  1H6K X;  1TEL A;  4C8N A;  4RJV A;  5CH7 B;  3NMR A;  3EM1 A;  3RR7 A;  4OL8 A;  1T9T A;  2CXE A;  5I4M A;  5L1J A;  4NPO A;  2XZT B;  3LP1 A;  2F4F A;  5KFN A;  2YNH A;  1UET A;  4LF9 F;  5LMU J;  4V19 J;  4NRU A;  1RAB B;  2W9B A;  2CFX A;  2B5J B;  1D1U A;  3FVY A;  3FZB A;  1Y5N B;  2UUW A;  4K0K J;  2ZWP A;  3CCR S;  1FEH A;  2H5J B;  2O3D A;  3OLA A;  1FO1 A;  3MAH A;  4B9L A;  3H40 A;  4I69 A;  1N6Q A;  2CZ4 A;  5HAO A;  4ZDN A;  1HD0 A;  5KFP A;  3A12 A;  5KT5 A;  2ZEJ A;  4ZVR B;  2QFI A;  1CVJ A;  1UVJ A;  3FBF A;  2EK6 A;  4KAI A;  3B6B A;  4MT1 A;  4U8V A;  3J80 Y;  1T9Y A;  3TAN A;  1VQN S;  3NS5 A;  4QW9 A;  5DG8 A;  4Q8F A;  2ZD1 A;  4JI3 F;  2C28 A;  4YY3 F;  3W1Y C;  3NKY A;  3V4I B;  1WC3 A;  5ETR A;  2HHT A;  1MMD A;  4A47 A;  1FKO B;  4CLU A;  2E9T A;  2RU9 A;  4LSL B;  3C15 B;  2AX0 A;  4DN9 A;  3P3D A;  4WCE Q;  1B4S A;  2V50 A;  3NGD A;  2QLJ B;  4MTP A;  2DNL A;  2R7Q A;  2IVM A;  3M1V B;  3AJD A;  3MMA B;  4L72 B;  1I51 B;  3TQ1 A;  5CD4 A;  4TVA B;  5D4N A;  4O4G B;  4F4A A;  3TAR A;  2PI5 A;  3MR7 A;  1FFS B;  4ZN1 A;  2W4P A;  1FKO A;  1FT8 A;  2KFZ A;  2CPX A;  3MMC B;  4YB1 P;  2FGC A;  4AXI A;  4DPO A;  1WG1 A;  3B8H A;  4QR0 A;  3OR1 A;  4DV0 J;  1Q86 T;  1CPZ A;  2GJI A;  4WKY A;  3JSR A;  4QBU A;  2DRA A;  1RWN B;  1RUS A;  3D7S B;  3MMA A;  1H2V Z;  3ZTO A;  1LWF B;  5FLX Y;  4K4T A;  3ICL A;  3MEK A;  1HKA A;  3M6U A;  2O66 A;  3TNV A;  2DY9 A;  3KG1 A;  4DJB A;  4JV1 A;  3UDC A;  5I42 B;  4EUV A;  3MI7 X;  3GIK A;  1Q78 A;  3W8G A;  4DL7 A;  2BJ1 A;  5GAH U;  2XMU A;  4ICL B;  3AJ2 A;  2BEF A;  3G9C A;  3DOM B;  5B7W A;  1HQU A;  1OQ3 A;  3I9Z A;  4WE1 A;  2R7T A;  3Q8R B;  3DM2 A;  1EKR A;  4LT6 A;  2PA8 D;  1M1K T;  2KZZ A;  4DQQ A;  2G1D A;  2AJ0 A;  3M30 B;  2L9N A;  2VG5 B;  3UDV A;  5HSP A;  4UST A;  2KO1 A;  2QL5 B;  2RRA A;  5E7O B;  2WB4 A;  2Z57 B;  4NCB A;  2NZ4 A;  4GVL A;  1WC6 A;  4Y2M A;  1UVL A;  4GKK J;  4QWB A;  2FLL A;  4ETX A;  2R7W A;  4WE1 B;  1RA7 A;  1VQL S;  1X5O A;  1JLC A;  1NEE A;  1X4H A;  2CJX B;  3JYT B;  3TJA A;  1UVK A;  4CP5 A;  1Q1K A;  1UA1 A;  2AV5 A;  3AFG A;  1M5S A;  3WBZ A;  3LGN A;  4BCA A;  5D0R A;  2MYF A;  1SQG A;  1M5O C;  5J1E B;  3Q2S C;  3Q2T C;  1Q7Y T;  4PWD A;  2D1C A;  1QUV A;  4CCH A;  4OJH A;  3SYZ A;  4QZV B;  1FNX H;  1PC5 A;  3MDF A;  2HPU A;  3MCS A;  3F44 A;  2BE9 B;  3B4M A;  4TLR A;  2OEL A;  4Y00 A;  4F4X A;  1Q79 A;  3HZE A;  3FSI A;  1Z1Z A;  2OIH A;  2FY1 A;  2R8I A;  2E1R A;  3EVO A;  1MNE A;  3ULH A;  1TKX B;  4ZCI A;  4HVZ A;  4KFB A;  4PXE A;  2Z0G A;  3M32 B;  2DEI A;  1WEL A;  3GP9 A;  4UUX A;  1W2I A;  1N5T A;  3CTR A;  2HHW A;  2GJF A;  2UUB J;  1MG7 A;  2OTL S;  1YGY A;  5AT1 B;  1N88 A;  2DR5 A;  1OIA A;  1U1Q A;  2WVC A;  1SH3 A;  2CNO B;  5D15 A;  2C2O B;  1TMJ A;  2YWE A;  3FZ2 A;  2RVJ A;  4H4K C;  3LW5 C;  4KR0 B;  2I6W A;  4YFU A;  4C8L A;  2FVQ A;  1FF2 A;  1ZA2 B;  1XEZ A;  1K1Q A;  2I38 A;  3J81 Y;  1SKS A;  1Y3K A;  3PHE A;  4U9R A;  3VVT A;  7AT1 B;  2DNN A;  1WF1 A;  1UTA A;  2GMH A;  3OR2 A;  4RW8 A;  4TYB A;  3VAL A;  4NLG A;  1FXL A;  1GNK A;  2MQP A;  3NP5 A;  4KB7 A;  4NA2 A;  1S6P B;  1VHF A;  5F8G A;  2K3I A;  3BH6 B;  4LF5 J;  4I6W A;  2GQ2 A;  1YJ9 S;  4I68 A;  5IV3 A;  2XI3 A;  5G4D A;  2LQJ A;  3DOL A;  3OXF A;  3JXO A;  1W2B R;  4UQG A;  3FNN A;  8RUC A;  4J9L A;  1EZZ B;  3EPG A;  4ZVG A;  1CC8 A;  2QIF A;  2HS0 A;  3HHE A;  3PJX A;  3G8T A;  1LXN A;  4LBP A;  3OFH A;  4B9U A;  3IXQ A;  4WP9 A;  2RDD A;  4ZVE A;  5DQH A;  3MR2 A;  1QLN A;  3ZFV A;  1R0A B;  2MQM A;  2AF6 A;  2VH7 A;  4LBH A;  1KHW A;  1PKU A;  1I94 J;  5LMN J;  4DCO B;  1HWK A;  2XMV A;  5DDO C;  1IKV B;  2O01 C;  2BKP A;  2MSS A;  5I3U A;  3IRW P;  5LL6 d;  3TUJ C;  2UXD J;  4M5J A;  3CD0 A;  3AXM A;  2PC6 A;  3GTY X;  4FVC A;  1KQG B;  1VBY A;  2EC0 A;  3I0R A;  1QUP A;  4LSN A;  3W2W A;  2A2C A;  3DC2 A;  5L1K A;  1WHW A;  1A7G E;  3GJQ B;  1R0A A;  1S97 A;  3D6T B;  2DNQ A;  2M9K A;  4NXM F;  2B51 A;  2A0F B;  4DL5 A;  1G2E A;  2I5J A;  4DV6 J;  2YWF A;  1X0P A;  1UZD A;  3M6X A;  3NXZ A;  4DR3 J;  1QSY A;  4H4O A;  2NLW A;  2OEJ A;  2W9A A;  3EZU A;  3TX8 A;  4OLO A;  5KFA A;  3PX6 A;  1XMO J;  4FF4 A;  2ZKU A;  5C42 B;  1N5V A;  1HW8 A;  1Q8K A;  1L5U A;  3QZ8 A;  2HBZ B;  4NZ0 A;  3TQE A;  1XNQ F;  4NLD A;  4ES2 A;  1S4E A;  1SJQ A;  3LP0 A;  4EO6 A;  3BO2 A;  4A8S A;  3QGI A;  2GCF A;  1HWL A;  1RTD B;  2DO4 A;  3LF0 A;  2OML A;  2RU3 A;  1VRU B;  3MPW A;  3GWC A;  2YX7 A;  1ZOT A;  4FPR A;  3IGV A;  5KFH A;  2MKK A;  2ZM6 J;  1LWF A;  2HVD A;  2IAJ B;  4C11 A;  3BSC A;  2G2O A;  4WYL A;  5F8I A;  4Q43 A;  3UD3 P;  4JYA F;  3TRG A;  1RBA A;  5DG7 A;  3GFH A;  2A3J A;  4QWD A;  2V8P A;  1R8C A;  3DOM A;  1SUQ A;  1LW2 A;  2MLY A;  3CXC R;  2DB1 A;  5IXU A;  4DR6 J;  3D54 A;  1CQN A;  2IRX A;  4ERD A;  2OFG X;  2EKY A;  2QL9 B;  1VIX A;  1BQM B;  1IKW A;  3NOC A;  1F6T A;  4R25 A;  4ZP9 A;  5BR8 F;  3J7Y U;  4YN3 B;  3QSY B;  4C97 A;  2JEF A;  4JV0 A;  2UP1 A;  1KFS A;  1RZM A;  2IJF A;  1WC4 A;  2IMO A;  3UD4 P;  3D68 A;  3PEJ A;  4ID5 B;  1D9F A;  1UMJ A;  3CCS S;  1VQ7 S;  2LDI A;  3KHR A;  3W5Z A;  2IPO B;  2BW2 A;  2CQH A;  1K73 T;  3P49 B;  3F41 A;  2HFZ A;  3N4W A;  2H5E A;  1LOU A;  1U0H A;  2XSF A;  2YNI B;  3CO0 P;  1DQ9 A;  1V5I B;  4B17 A;  5GME A;  3U1L A;  3EIC A;  2HQF A;  1LW0 A;  3H8Y A;  3JB9 k;  4DR4 J;  5F8N A;  4RLE A;  1GMV A;  2HUR A;  3LAN A;  5C25 A;  4DV2 F;  2LKZ A;  4KYZ A;  3LAK A;  1VK3 A;  4DFK A;  3WIV A;  4JI3 J;  2YVS A;  5DDP C;  2ZC3 A;  1IJE B;  1T3N A;  5AXK A;  1YBU A;  4DL2 A;  1X9M A;  1EHW A;  1J5E J;  1KVI A;  4ES3 A;  3B82 A;  3HJF A;  2V5H G;  3CMQ A;  4ZHR A;  5MAO A;  4DSJ A;  2FJA B;  2WON B;  4CLS A;  4EBC A;  2P9E A;  2LQ5 A;  2B4O A;  3GON A;  3ZNJ 1;  4N5S A;  2W25 A;  3N6L A;  5C25 B;  3W9J A;  2KZM A;  4Y65 A;  3T3F A;  2EKN A;  5J2N A;  3R2D J;  3PVX A;  4C6A A;  2IYG A;  1T9U A;  1TQL A;  1S76 D;  4X66 F;  2W24 A;  4NLV A;  2YNF A;  4LR9 A;  2GNK A;  3G82 B;  2AEF A;  2X3D A;  4M63 A;  3NLC A;  1TL1 B;  5E33 A;  1QE1 A;  3ZC4 A;  4AD6 A;  2K7J A;  2DNZ A;  2H48 B;  3MWB A;  3X1L B;  2A6O A;  3K57 A;  4DMZ A;  1WD6 A;  2CWX A;  3UDE A;  2ZUA A;  3KNG A;  2QA4 G;  4A8K A;  5F9L A;  2FC9 A;  3MM7 B;  1R3N A;  3POT A;  4USM A;  2AYB A;  2RT3 A;  2ZNZ A;  2NXC A;  3AD9 C;  3PNI A;  4CO0 A;  1NHV A;  1Y5L B;  1X60 A;  3T1Y F;  1WEY A;  1YTY A;  1IR1 A;  1MN9 A;  4QIV A;  5JVH Q;  3JAM U;  3C19 A;  5F0W A;  4LVN P;  2E1P A;  1LWX A;  2V94 A;  2ZOG A;  3H5Y A;  2M5Y A;  3CCV S;  1TL7 A;  3MOZ A;  5KFW A;  3M2V B;  2DNM A;  2IY5 B;  3TVK A;  2WSF C;  4NLP A;  2BE2 A;  2CAJ A;  1GEH A;  3K5M A;  2OPS B;  2WVB A;  3C14 A;  1U24 A;  1RHQ B;  3H0P A;  5DM6 Q;  4FN5 A;  4DOZ A;  1VQY A;  3FCV A;  2ZVS A;  5EWG A;  3T1Y J;  2B43 A;  3DGP A;  4HAC A;  1NPR A;  3IMQ J;  1HBN B;  3AB2 B;  4CO3 A;  5ADZ A;  3GMG A;  5KG4 A;  1HNZ J;  2H4W B;  2PEH A;  3JSB A;  2E5L J;  3D1Q A;  2BE2 B;  2DNY A;  1S6O A;  3TOQ A;  3W2W B;  3BGL A;  3HJV A;  4ER8 A;  5IC4 B;  2IFX A;  3FUY A;  3MD1 A;  3R5G A;  2YWH A;  2RDJ A;  2DT9 A;  4LF6 F;  3KJV A;  4QIW D;  1MRO A;  2ZBR A;  2ZOF A;  1VRQ C;  1ELO A;  1T3O A;  1YRU A;  1IKX A;  4CO2 A;  3RB0 A;  2AQ4 A;  4PG6 A;  2Y8W A;  1XNQ J;  2E5H A;  2MY8 A;  2D7S A;  5DZ7 A;  1SKW A;  1HLW A;  2XCA A;  2K1R B;  1SJR A;  3IAS 9;  2AEM A;  3QPI A;  4TKT A;  4YP3 A;  3M9N B;  5DGA A;  3BPS P;  3GQC A;  1D3W A;  4HHU A;  4KQZ A;  4PAB A;  1L3T A;  4G3I A;  2XS5 A;  3MEC A;  4IQM A;  1VFJ A;  4DV6 F;  4DSI A;  3LP0 B;  5J1N A;  1HPZ B;  1IKX B;  1KNZ A;  5B0F A;  2D3Z A;  5KFQ A;  5FLX U;  4NXN F;  2DGS A;  5B09 A;  4W98 A;  2CKW A;  1Z4U A;  4ZVQ B;  5L46 A;  3SV4 A;  5ETN A;  5EN1 A;  2L9D A;  2MJU A;  5B08 A;  5ETO A;  5IT4 A;  2RHQ B;  4M5N A;  5THW A;  3T19 A;  5LXY A;  3NS7 B;  1WNE A;  1TAQ A;  5CAB A;  2VU5 A;  1F1B B;  1R31 A;  4LF7 F;  4PG4 A;  1C1C B;  1WJ9 A;  3ISZ A;  4RNH A;  4KGZ B;  2UVU A;  3DLE A;  3CIM A;  3P8B B;  1CUL A;  1N5Y B;  3SCL E;  3M6W A;  4P6Q A;  4NMX A;  4BC9 A;  4DR7 F;  4WWS A;  1RAE B;  3D0I E;  6FD1 A;  3WX8 A;  1KBR A;  5GAH I;  2UUC J;  1JWW A;  5A8R A;  4OHY A;  4DQS A;  1JNR B;  4PWU A;  1I3O B;  4QR2 A;  2F4V J;  5ETV A;  3DRS A;  1BC6 A;  4NWB A;  2OPR A;  1FA0 A;  2F3J A;  2VG7 B;  3T9Z A;  3PFE A;  2CPD A;  3NMA A;  1MWQ A;  3PYE A;  4KIA A;  3FDS A;  3HFV A;  3HI9 A;  4IFV B;  5A2Q Y;  1UP1 A;  1H3D A;  4DZD A;  2HHH J;  4RW9 B;  5C7P A;  5HN0 A;  2HWT A;  2YTC A;  3PDN A;  4ZVO B;  1S7I A;  1UKU A;  2JEI A;  4I6A A;  4Y2C A;  3G71 S;  3T6B A;  2FZG B;  4G65 A;  1Y5I B;  3QJL A;  2VOP A;  2HFO A;  3EVM A;  3SQG A;  5KTQ A;  1NSQ A;  2JVO A;  5F9N A;  2OPP A;  1N36 J;  1OPZ A;  2LEC A;  3KJF B;  4CLL A;  3FSY A;  2GGP B;  2EG2 A;  4NLU A;  3NCR A;  2XO7 A;  5HRO A;  4AQY J;  2OEM A;  3PFO A;  4DUZ J;  1RCO B;  2ATL A;  3CCL S;  1NJI T;  1N32 F;  1QD1 A;  3ITH A;  3QLH B;  4QYR A;  4F25 A;  2VON A;  4ZVH A;  2PGC A;  2GX8 A;  1YDL A;  3M6V A;  5DRK A;  1U2C A;  1WSR A;  4AXJ A;  1NSK L;  1RTZ A;  2ZBI A;  3PRB A;  5IWA F;  4LF4 J;  1TL1 A;  2J0Q D;  1FD8 A;  1UAW A;  2W4D A;  4B3M F;  2HHQ A;  1PYO B;  2XGP A;  2F63 A;  5E3A A;  4CZC A;  2MDA A;  1GH8 A;  4B3M J;  4N41 A;  3DRR A;  2XLK A;  1U0S A;  1HYS A;  2W2N P;  2K8G A;  2ZBP A;  2ZNY A;  4E8U A;  4DV0 F;  3I4H X;  2GVZ A;  4Z37 A;  5KFJ A;  4TU8 A;  4DR5 F;  3PW4 A;  3QAU A;  2NQP A;  3P4U B;  4HKQ A;  3OUY A;  1FE0 A;  1RE1 B;  2BVZ A;  1VC6 A;  2YNH B;  2YX1 A;  3PM9 A;  1CJK B;  1SIZ A;  1YQH A;  2MKY A;  5D78 A;  1HMV A;  4ES1 A;  5AJ3 J;  4XIU A;  2AHO B;  4DV5 F;  2FLN A;  4Y2A A;  5HP1 B;  2ZKT A;  3DGV A;  4PXC A;  2VQE F;  4C8Z A;  2IA6 A;  2VBW A;  3IO1 A;  1BQX A;  1CC7 A;  3UE2 A;  4C48 A;  1SVD A;  2F5G A;  3KUG A;  3G86 A;  5DZ6 A;  3TUZ C;  4YHH J;  2XLJ A;  3Q22 A;  1GX5 A;  1VBX A;  1YJT A;  2E7V A;  1MML A;  1SIW B;  2Z2L A;  2E9R X;  3W2V A;  2BKN A;  4RW7 A;  2D9O A;  3TAM A;  1H98 A;  4MJK A;  4OYP A;  5CHC B;  3MCO A;  4ZMM A;  3JTN A;  3VR1 A;  3KNA A;  2QFJ A;  3QT5 A;  3THT A;  2RKI B;  3AOA A;  3IP0 A;  1Q8B A;  1XIQ A;  2DD8 S;  1IBC B;  4ILL A;  3RRH A;  2A6M A;  2DNG A;  3A1Y G;  5G0R B;  2C3Y A;  2XHW A;  1H74 A;  1OYD A;  2E66 A;  3D5M A;  4KT0 C;  3U7J A;  1FTR A;  3CCZ A;  3KJV B;  2FJW A;  2Q66 A;  1EKS A;  2JNJ A;  1UCN A;  1TK0 A;  4F50 A;  3N6N A;  4M5K A;  4YR3 A;  5D8H B;  1N5S A;  3BKU A;  1UJ5 A;  5KT3 A;  2HFS A;  3EDQ B;  2EPI A;  3GE9 A;  3L7U A;  4C3M A;  2XZW A;  3TP2 A;  3HHK A;  2GAH C;  1WC1 A;  1X4G A;  2DRD A;  3BGF A;  5E0O A;  4R8U B;  4DR4 F;  3VCD A;  3DXS X;  3HX9 A;  3DDI A;  1KOH A;  3IS9 B;  2B7C B;  1VC0 A;  2DHX A;  2DH7 A;  2V69 A;  2DNR A;  3SIP B;  2N3O A;  3PIO Q;  2CNN B;  2LVW A;  2NSC A;  2PMZ D;  2W2O P;  3W61 A;  4ED6 A;  2XNQ A;  3RAQ A;  1LK5 A;  5A2Q U;  1Q95 G;  4LSZ B;  2QT7 A;  2J9C A;  1HR0 F;  1YK9 A;  1C0T B;  4Y3C A;  4ELT A;  2OSQ A;  2ZOM A;  5K20 B;  2BQU A;  2HHV A;  4LSL A;  2VD3 A;  3B78 A;  1D9A A;  3IS9 A;  1S9E A;  2RRB A;  2FD2 A;  3N6M A;  4YB7 A;  2FVR A;  4NLS A;  4BWM A;  1ZAW A;  3DLG B;  1WDD A;  3FQL A;  3MEE A;  4KV8 B;  5EX3 A;  5D0G A;  3SSQ A;  2WVF A;  2VHG A;  4P2F A;  1RT1 A;  5FDL B;  3JSM A;  1APS A;  3G8Q A;  4K59 A;  4RKU C;  4IG3 A;  1FI4 A;  2W9C A;  2MKJ A;  3CDW A;  4RNF A;  3W64 A;  4GKJ J;  2JEG A;  3MMC A;  5B0E A;  2DHH A;  4HLB A;  2APO A;  3MPU B;  3GR0 A;  1X5P A;  1T94 A;  1WKL A;  2W2M P;  3T5H A;  3DNC A;  4LIW A;  2AD9 A;  3DLG A;  4V19 X;  1HNW F;  1VQ8 S;  4CM0 A;  1FE4 A;  4EYI B;  5KT4 A;  2AYG A;  3DI6 B;  3M2U B;  4RPF A;  2HLT A;  5IZH A;  5U47 A;  2W9C B;  5J1E A;  3D3B J;  2R7S A;  1ZPV A;  4MFB B;  1F5A A;  3FBE A;  3HT0 A;  3JQK A;  4LQ9 A;  3K5P A;  1B7F A;  2Q79 A;  3JSY A;  2Z8Q A;  3ISN C;  3Q89 A;  3SSR A;  1R6Y A;  2MLZ A;  4TLQ A;  1SJ3 P;  1Y4Z B;  4IDK A;  3LPY A;  4UUW A;  4EZ9 A;  3BM7 A;  1O6X A;  3M2U A;  2JC1 A;  2B9W A;  4IOB A;  4LR7 A;  4PG5 A;  1U1R A;  4EI2 A;  4GC7 A;  1JB0 C;  2KFY A;  2HQ3 A;  4HT5 A;  4KC5 A;  1B0P A;  1CS4 A;  1JXL A;  2BQ3 A;  4DX5 A;  2XY6 A;  1AFJ A;  2CPY A;  2F65 A;  2XMT A;  1CJV A;  3UN3 A; 
#chains in the Genus database with same CATH homology
 1N32 J;  1IBL J;  3J81 U;  4DV2 J;  1XMQ J;  4YY3 J;  4JI8 J;  2UU9 J;  1I94 J;  4X65 J;  4B3M J;  3W1Y C;  5LMN J;  1FJG J;  3JAM U;  4KHP J;  2UXD J;  4DV7 J;  5AJ3 J;  4JI4 J;  4KY3 A;  4NXN J;  4JI0 J;  4DV4 J;  3T1Y J;  5LM7 E;  4DR5 J;  4DV6 J;  4JI6 J;  4YHH J;  4DR3 J;  3J80 U;  1IBK J;  3IMQ J;  1HNZ J;  2ZM6 J;  5LMU J;  4DV1 J;  2E5L J;  4DV0 J;  2UXB J;  4V1A k;  4PWW A;  1XMO J;  4LF9 J;  4X62 J;  1XNQ J;  4X64 J;  2UXC J;  4LFC J;  2KVQ E;  3R2D J;  2MQ8 A;  4LFB J;  4X66 J;  4HHU A;  4B3S J;  4OX9 J;  5IT9 U;  4DR2 J;  1IBM J;  5FLX U;  4JI7 J;  4JI2 J;  4DR7 J;  4JV5 J;  2MTL A;  4GKK J;  4DR6 J;  4B3T J;  4DUY J;  1N34 J;  2VQE J;  4NXM J;  4NEY A;  3OTO J;  2MEW A;  1XNR J;  5A2Q U;  4NEZ A;  3J7A N;  4LF8 J;  2UUC J;  4JI1 J;  2UUA J;  5BR8 J;  2F4V J;  3T1H J;  4KYZ A;  5IWA J;  4JI3 J;  1J5E J;  4GKJ J;  1HR0 J;  2UUB J;  4JYA J;  4B3R J;  2HHH J;  4RJV A;  2KL8 A;  4DR4 J;  4LF7 J;  4DV3 J;  3D3B J;  3D3C J;  1N36 J;  1N33 J;  4LF5 J;  4DR1 J;  1HNX J;  4AQY J;  4DUZ J;  4DV5 J;  4K0K J;  1HNW J;  4LFA J;  4LF6 J;  2VQF J;  4JI5 J;  3R2C J;  4LF4 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...