4RJVA

Crystal structure of a de novo designed ferredoxin fold, northeast structural genomics consortium (nesg) target or461
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
MEMDIRFRGDDDEALARALLKMVVRAVSFGAQVRFTDDGNDLEIRITGVPEQVLKELAKEAERLAKEFGITVTRTIRGSLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR461
rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords OR461
total genus 24
structure length 83
sequence length 83
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4rjvA00
4NEYA 3JAMU 4LFBJ 1N32J 1I94J 4LFAJ 3J80U 2UUCJ 2UUAJ 4NXMJ 4V1Ak 4PWWA 1IBMJ 3J81U 1XMQJ 4DV7J 5IT9U 1HNXJ 4KYZA 2HHHJ 4DV0J 5LMUJ 4JI7J 3IMQJ 4DR2J 4JI2J 4DR7J 4X66J 1HNWJ 4JI5J 5LMNJ 2ZM6J 1FJGJ 4JI4J 4NXNJ 4DR3J 2KL8A 4LFCJ 4KHPJ 4B3SJ 4DV2J 2UXBJ 2MTLA 4DV3J 4RJVA 2VQEJ 3T1HJ 4DR1J 2MQ8A 2UUBJ 2F4VJ 4JI8J 4DV5J 5AJ3J 4DUYJ 2UXCJ 2UU9J 1XMOJ 5IWAJ 4YY3J 4K0KJ 4JI3J 1N33J 4X62J 2KVQE 4JI0J 4HHUA 1J5EJ 1HR0J 1XNQJ 4LF5J 3R2CJ 4JI6J 4LF9J 3OTOJ 4KY3A 4LF6J 4YHHJ 5FLXU 4B3TJ 1N34J 4DV4J 3T1YJ 4B3MJ 4DR5J 3R2DJ 3D3CJ 5A2QU 4LF7J 4DR6J 4JV5J 2MEWA 4LF4J 4LF8J 4JYAJ 4NEZA 4B3RJ 4GKJJ 2UXDJ 3W1YC 1HNZJ 4OX9J 4DR4J 3J7AN 1XNRJ 1IBLJ 4JI1J 4X64J 4DV1J 3D3BJ 4GKKJ 4DV6J 5LM7E 1IBKJ 2VQFJ 4DUZJ 4AQYJ 1N36J 4X65J 5BR8J 2E5LJ
chains in the Genus database with same CATH superfamily
1FKPB 2IVYA 3UPFA 3FBFA 2J76E 1TL7A 4PQUA 4LSNA 4WFNQ 4C3LA 2XMVA 3KK2B 3KG0A 4HHHA 1R8CA 1Q53A 2O01C 1GNKA 2KKHA 3IP0A 1ZAVA 1X9WA 2AMCB 4OL8A 2G2ZA 4NRUA 2V2VA 1RA6A 4DX7A 1BQNA 4TYAA 1S9GA 2LMIA 1VIXA 1WHWA 2V9WA 2HRUA 3PHEA 5IT9U 2W4CA 3IWXA 3PKMA 1BHNA 4FF1A 2XBPA 2R7WA 1F1BB 4DR2J 2L41A 3Q23A 4E0DA 4H4KA 4OYZA 1NKCA 1IBCB 4QJVA 4RWWA 4A8QA 4Y6IA 2WVDA 1H38A 4M1KA 5D0RA 2RB7A 1JLBB 2DNKA 2OD4A 1LXJA 2IRUA 3PYDA 1RJJA 3ZFVA 3T19A 4EU0A 2HNZA 1S4FA 3FCHA 3NY0A 4PQUB 4WPAA 3VHQA 4LR9A 2CWXA 2LQ9A 3H5UA 3S7RA 2ILZA 2V8VA 3ILJA 4NYPA 1H98A 4OZLA 2V34A 5KTQA 2Z58B 3GG1A 4P2SA 3WC2A 1NK4A 1DURA 2DY1A 3V81A 2ZKUA 4OHXA 2MQ8A 2UV8A 3GFHA 3OR1B 3R97A 4LF5F 3RBDA 1HKAA 2OGUA 4KBIA 3I9ZA 2BKPA 1SBRA 3W5YA 1SJFA 2LA6A 2XYGB 2A6MA 3PV8A 5A8RA 2VDIA 2C28A 4DS5A 3K7RA 3FZ2A 4X62J 2C2EA 2YNHA 3QWPA 4OYOA 5KFLA 4CRJA 4QWAA 3TI0A 2J0XA 2B4UA 1P9YA 4ZPCA 3PO5A 3R2CJ 3RW6A 1U7LA 4RBTA 2APOA 4A8XA 2XWYA 3ZO7A 3FEZA 4WZQA 3HZEA 4USMA 3CJKA 1U24A 1WOOA 3L4BC 2DGWA 3N4WA 2NUHA 3AOAA 4NLQA 1WEZA 4B08A 1YJRA 4ID5B 4LREA 4NZ7A 5DZ7A 4DV2F 3TANA 3UFCX 2GO9A 5JMNA 2Y1LB 3C6TA 3RBXA 1FJEB 4I7FB 4DR3F 1HQEB 2P6SA 1LWFB 5F8LA 3LWMA 4UTGA 3BEGB 2MY8A 3K5NA 2I2YA 2GIRA 2CQDA 4FYXB 2IVFB 4RL1A 1KS2A 5DGAA 4HYKA 2LEBA 4IQXA 2CQ0A 1KQFB 3JTNA 1GK8A 1HQ2A 3R5CA 4CLLA 4ELTA 1UL3A 1MMLA 1XQIA 4DUYF 4LF4J 2DR6A 2EXUA 3OVSA 3EX7B 2L9DA 4DX5A 1AT1B 1RHUB 4TY9A 3R27A 5I3UB 3M8PB 5BYRA 4EWTA 2CJKA 4ZLNA 2H65B 2F65A 4DR4J 4HEA9 3AOCA 1DLOB 1RWPB 3CJ5A 3OFHA 1X9SA 4FS2A 4WKYA 5EDWA 3J7AN 1FDDA 5HVFA 3TVYA 3MR6A 3V4IA 4QYRA 1HHSA 3BPDA 3DOLA 3VAFA 3C15B 2MYFA 1RYRA 3BKFA 4GKKJ 1WHVA 1FVQA 1K1SA 1S6PA 2GAGC 2YQ0A 1JLGB 4ID5A 1RI7A 4I4BA 3DRXA 1TK8A 1MROA 1FESA 3J7Z5 3KYLA 3SSRA 1CJVA 4DBQA 4X65J 1QD1A 2IC3B 3CDWA 3CCVS 2XG8A 3M30A 4YOEA 1ZM3A 2VJVA 5IOLA 5KG0A 2GGPA 2MKCA 2E5LF 3CCJS 4IO9Q 3VF0B 2E5GA 4PUOA 2KTQA 5KFVA 2EG2A 3VAHA 2RRNA 3KJQB 3IBCB 4ANCA 4ILMA 3SIPB 3UN3A 2PDAA 1HBUA 2DGXA 1R89A 3MM9A 2XULA 3KJVA 1FJGF 1TQLA 4OYIA 2EFVA 2MLXA 3IXQA 1WI8A 3ICLA 1B4SA 2CPZA 2VFTA 5KFSA 4CTAB 4DMZA 3Q22A 3HVTA 3VAJA 1UKUA 2N3OA 4PXBA 4EUVA 5KT6A 4NXMJ 3TA0A 5AT1B 2V69A 1RWNB 3P5BP 4PQAA 4Q5VA 1RBLA 2Z57B 4NLVA 3CXCR 4BLGA 5DRKA 2XZDB 3KXDA 4QCLA 2JEIA 3IR5B 5CHCB 4FN5A 4HKQA 5DDOC 5HAOA 1RCOB 3GLJA 4XPCA 4O0NA 1KQSR 1Z1ZA 1DQ9A 1WOPA 2YX4A 4WK1A 3NNCA 4WKRA 4NXMF 1CVJA 5J1EB 2KT5A 5DQHA 1UVLA 4B9NA 3BQ0A 4F3MA 3PRBA 5CCMA 2XCAA 4I68A 4Q0BB 1U1PA 5A76A 1FDNA 3M2VA 1S79A 1QJHA 2FGCA 3IRXA 1ICEB 2HS4A 1RTIA 2CQBA 3HSDA 3PXGa 4R5PA 2XMUA 3CCES 1NH8A 2W9BA 4LR8A 1G7CB 1NU4A 4O3PA 3EDRB 3PKYA 2XO6A 4ED8A 3DRSB 4PAAA 2CZ9A 1XNQF 1CLFA 3TZXA 4CP5A 3NOGA 1S1WB 3AD7C 5HVGA 2X1GA 1NDCA 3DYAA 1G3OA 3JQMA 4K8RA 2DIUA 4C0HA 4MYUA 2N7CA 3TAQA 4FDFA 2VC0A 1FE4A 2BJ7A 2ZC3A 3G2XA 2CNKB 2DXEA 4B02A 4ZVHA 4DSFA 1UA1A 5CA5A 2YPYA 4XTTA 1REVB 3EUNA 1AUDA 1TMJA 5HSPA 4F4ZA 1KRPA 4ETXA 2B56A 2L48A 2MZJA 1NDLA 1RWUA 4ZITA 3KHGA 3RRKA 4FVCA 1JLBA 1S57A 2XNQA 1B0TA 3PG9A 3M9MB 2W9CB 4ED7A 4LF9J 2LFVA 4IFYB 5D3GB 1K1QA 5FLXY 4X4RA 1N32F 3H2LA 3QZ7A 3QIDA 1NK7A 3I4HX 2DH7A 2V4JB 4JP8A 2YPZA 5F0WA 2N3LA 1EETB 4LBPA 3K8WA 5KG7A 1KBRA 1LWEA 1MMDA 5FLXU 2GW8A 4UOFA 2LECA 1ZM9A 2Y1IA 3TP2A 1FT8A 4CIOA 5E5NA 2VHGA 3M32B 4B3MJ 4X4NA 4ZCIA 4CZCA 4KQZA 5F8IA 2C2DA 4R0JA 4MH8A 2OJ3A 2E9RX 1EARA 1JXEA 1NLKL 3OFFA 1RT3B 5ETQA 2MLZA 2NYHA 2RS8A 5A0YB 5F8GA 4M5IA 3VGTA 1CPZA 4QR2A 1UFWA 1VRUB 1Y0HA 3PJXA 4UQTA 2J6SA 1C0TA 4WZMA 3ADAC 2L08A 2R7OA 1K9MT 2QYGA 4BHQA 4J9KA 2XM3A 4HT7A 1XJWB 3MMBA 5DLGA 2FLLA 4WXWA 3DLEB 5BXIA 3B78A 2Z8QA 3KJNB 4N76A 3CJ4A 3OTEA 4D3HA 3QQCD 5T41A 1FKPA 4X4PA 3BO4A 4RW9A 2DGSA 4EBEA 1SKRA 2CYYA 1JLQB 2YWKA 2IMWP 2UUCF 1PAUB 3OV7A 2WK4A 3IA0A 3MGJA 2DPJA 4QIFA 3SYZA 3DLEA 5CYMB 1V5IB 1TELA 4ERDA 3CD0A 1NRKA 4PXEA 2OPPA 1VC6A 5E0OA 2R2RA 3C16B 3U27A 1GMUA 2MQPA 3PW0A 1VR6A 2E5LJ 3DLBA 2DGTA 1FXLA 1XMBA 1U0HA 1VBYA 5D8HB 1DRZA 3CJ2A 2V50A 2R8IA 4F4KA 3WHIA 1NK8A 1YHQS 4PG5A 2QV6A 3MM5B 2EPIA 1VQYA 2OPQB 2AV5A 4P10A 4WTOB 1HQUA 3MPUB 3WDOA 4ID8A 4GKKF 2QRRA 4G1IA 1SKUB 4UF4A 2ZH2A 3QO9B 3QJLA 1QUVA 2WOMA 3G6YA 2C2OB 2VL1A 2BW7A 3KDNA 2X3GA 1EETA 3MD3A 3NBPA 1BY9A 1QE1A 2ZD1A 2V4JA 5DO2A 2GJ2A 5E33A 5GAGI 2KT3A 3BB5A 5HQLA 3EICA 3NAIA 1TKZB 5HMWA 3CJ3A 1O8BA 3BPSP 5J2MA 4LF8F 1G6BA 2HWIA 3U1MA 1TMMA 1FKOB 3ZTRA 2LQ8A 1VQNS 2RVJA 1ELOA 2HFNA 3IMQJ 1L3SA 2XLKA 4F02A 2HHWA 1YJ7A 5HK4A 1A6LA 3J7YU 3BGRB 1HNWJ 1S76D 3DRPB 1F5AA 1S0NA 2FVSA 5E3RA 2DNHA 2ALYB 2YVSA 4YB6A 2EFPA 2FJDB 2OPSB 3KJFB 2A1BA 4MT1A 4LFCJ 2CUYA 2C3MA 4LJMA 5EX3A 3PJ9A 2PIIA 3NCPA 3KLFA 2VKRA 1S1TA 4PR6A 3RJMB 3TARA 3CJ0A 2FDNA 2CADA 2YH1A 3A8IA 1VJWA 3BS9A 4YMEA 1YZ7A 1R0AB 2ZZNA 2IPOB 2K1RB 3DNCA 4EO8A 2AX1A 1VK3A 3C14B 3R5DA 5LOQA 2AX0A 4ZS6A 2NSBA 3K0JA 1HBOB 4IKAA 4F2SA 4K4ZA 1RLCL 4M5DB 1NO8A 3MEEA 5DM7Q 1KVIA 3VALA 4Y65A 1KLNA 2WW4A 4MKBA 5A8KA 4IG0B 4JB8B 5MAOA 3UW1A 2LLZA 1TKXB 2JLEA 1IBLF 4IG0A 2FPHX 4ZPBA 4YY3J 3C6UB 1UPPA 1F5CA 2XWXA 2XLIA 2CAJA 1GXLA 3P3DA 2YNIB 5BJRA 1HWIA 1S6UA 4NYOA 1ZYQA 2UXDF 4DCJB 1NJYA 1N0UA 3Q89A 4OJ1A 3W8GA 4JYAF 1HPZA 2KFNA 1Y00A 4OI3A 3N79A 3OTCA 3OL9A 3R5JB 2HEKA 3WX4A 4OZ5A 1K73T 2M5YA 3CF5Q 2AQ4A 2LXFA 5L46A 5FJ4A 2BE2B 1DTTB 1G1XA 5HO4A 2H3EB 3D68A 1NK0A 4ECYA 4C8KA 2CQ4A 5F8MA 3FVYA 4X2BA 2X7IA 1GFWB 1FRHA 5CZVA 5DG7A 2B3TB 3LUYA 1JJCB 3HPOA 2UZAA 2C3UA 4B3RJ 3L7PA 2V8PA 2UXDJ 2C22A 1RTHA 2J9DE 2RNEA 8RUCA 5HBMA 3E8OA 3ZZOA 1FVSA 1EX8A 1V3ZA 2QO3A 3LW5C 3MR7A 4M5HA 2K1RA 4UUWA 3UN5A 6AT1B 3G8TA 4QYZJ 3DRRA 2E5HA 2HIYA 3HFZB 1RHMB 3CMES 4RUBA 3L3CA 2BXJA 4CLFA 3R7BB 4LBIA 1GEHA 1FE0A 4X4SA 5K8PA 4F7VA 1KDNA 3UN2A 4G1QB 2W2MP 2UV8G 2HS0A 5F8NA 2QFIA 5U47A 2M4MA 2UXBF 3MDFA 4RUCA 4DL0C 1S97A 1ZH5A 2NQPA 4YR0A 1DBDA 1NAQA 3H0PA 5DG8A 4U7CA 3CNQP 4LFCF 3HT3A 2BACA 3SMZA 5DDQC 4AQYF 1BWVA 4P75A 3KLVA 2WB1D 4ED1A 2YWEA 3U02A 2X1AA 2EWHA 1GH8A 3M6UA 4PG4A 4A8SA 2ALZA 4USTA 2D7SA 3L95X 5KFIA 2PO4A 5KFTA 1O0PA 1WF2A 3D6TB 4L76A 4PWUA 3OW2R 3G86A 1PJ7A 4X66F 5EX0A 2ADBA 3EGWB 3PX4A 6FD1A 3NCQA 3KLGB 3THVA 2VPWB 2OMOA 2QX0A 4C11A 2WCXA 1T05B 1H0HB 4B9TA 2BBEA 1JLQA 5E3QA 1MSWD 1EHWA 3MPYA 3RZAA 5F9NA 1HYSB 3GE9A 2P9EA 2M88A 2Y1RI 3Q8SB 3CC7S 2V8DA 2ZJQQ 3LF0A 4KV8B 1PJ5A 4X66J 2HWHA 2V6AA 1LEOA 1HWUA 2E9TA 1WC6A 1KWMA 1AZSA 1WC4A 3SSSA 1C0TB 1T3OA 5DLFA 3KDOA 3ISZA 5IS2A 2GJFA 1SXLA 2AJ0A 2HPUA 4USKA 2ZH1A 2OLWA 4FF3A 2VFUA 3FFIA 4USWA 5D78A 4DFPA 2KXNB 1E6YA 1RE1B 1YRUA 5JXSA 5KOWA 4WFAQ 2X1BA 4DL4A 3V81B 2Y9HA 4C0OC 5CYQB 3ISNC 4LSLA 1JJ2R 2VBYA 1QAIA 2IIHA 1U1MA 4D3GA 5K9FA 4DG1A 3KLGA 1XBWA 2IBKA 4DQRA 4DPWA 2V9KA 4N41A 4JI8J 4UZCA 4KGXB 1TAQA 4WP9A 3PO4A 4F8RA 4U9RA 3QRPA 2XYPB 3MUMP 3B54A 4K0KJ 1F3FA 5I3PA 2GQCA 4OYPA 3U1NA 2OHDA 5BYSA 5THWA 2V4QA 2HVEA 2UUWA 3DOMA 5SUHA 3G4SS 4JI0J 2HG4A 3DRSA 3W2WB 1WSVA 2MLYA 3T1HF 2HHTA 1UCNA 2RUGA 3GYGA 1T02A 3DM2A 5IM0B 4XAKA 3ZTQA 1MN9A 4LT6A 4WK3A 4HTIA 4C11B 4QPXA 2RF2A 4NLYA 2HQCA 4ED0A 1T05A 3C19A 2ZWOA 2KYXA 3NGDA 4PYDA 3RU0A 2E7WA 3KLIA 3BJYA 4O4GB 2BR0A 2GQQA 1BQMB 1FI4A 2ZFHA 3T1YJ 1SJ4P 1JJHA 4YEAA 5B0FA 3HHDA 5K8OA 5AE3A 3KK2A 2QIFA 3OL7A 3I9V9 3MCSA 3FCVA 1RT4A 3LP2B 4R8UA 4EI2A 1PIEA 2HQ3A 3QNWB 5KT5A 5LMUF 3N6NA 3TO8A 4IDKA 1CULB 4UUXA 1DTTA 4KH0B 4DFMA 4LIRA 2Y3YA 3DC2A 1UJ6A 4P2XA 4OX9J 1Q79A 2JFDA 4ZPTR 1Q1KA 3CCWA 2AJ4A 3R1HA 1UJ4A 1YZ6A 2B4VA 2YKNB 1WORA 2W01A 4WCEQ 1HPZB 2KN4A 4PXCA 4JOUA 4U7UK 1DTQA 4P71A 1VRTB 3K5LA 3RTVA 4OJHA 3UQSA 1RT1A 3UDCA 4G1QA 2RDIA 3R5AA 1W26A 2VQFJ 4MK7A 2R7XA 2ACMA 1YKWA 2MSSA 4WFYA 1R8BA 1S4EA 3QGIA 5E3PA 4EEYA 1NM2A 4C98A 4ZIVA 3T3FA 1YJ9S 2DK2A 3QT7A 2KJVA 4ECRA 4PZVA 4R0EA 2F3JA 3W9IA 1NHUA 3Q2SC 3MURP 2C2MB 3BSNA 3D28A 1URRA 2WBRA 1S72S 2YNIA 4ECUA 2RE1A 4FNHA 5ETSA 4EBDA 1JLGA 4G6VB 5IV4A 4UZBA 1NB7A 1R8HA 3D54A 1GT8A 1MMNA 3GCXP 2X51A 4HH0A 4QR0A 4CLPA 4TQSA 1RHRB 1N32J 2A10A 3OQ2A 5L1LA 3NMRA 1M5HA 3KMSA 1X60A 2IAJA 3LANA 1VQ8S 1DLOA 1FRJA 1K44A 2CPIA 5F8JA 4EMDA 2KFYA 1RAJA 3W5ZA 4B3OB 1WACA 1IKXA 4TY8A 5K20B 1PJ6A 4ZLPA 2HFOA 1U8SA 4FYVB 1FJCA 1Y3JA 3IR6B 2MMYA 2GV1A 3LALA 4AD6A 4GC6A 5KFXA 2EBEA 2EG1A 3MM7B 2VPYB 4ZP6A 4ZDNA 4ANDA 1HFEL 4JI7J 1WNEA 1H2TZ 2M2BA 1VQOS 3BYRA 2YBVA 3IS9A 3A3OB 4ZP8A 2ZVSA 4DQQA 5HL7Q 5KG5A 2CJQA 1WKLA 3LP1A 1OSDA 5HMZA 1CULA 1U48A 1QSYA 1U09A 4RUAA 4NLWA 1VHFA 4GO5X 3ULHA 2H5JB 2VG6B 3CMAS 2IM1A 5A6PA 3FKBA 1RT4B 3LP2A 3HHNB 1CQMA 2CRLA 4ILLA 5KFQA 5I3QA 1UVMA 1CS4B 4MFBA 2V5HG 2EEYA 3GFZA 4I6AA 2HQDA 2OSQA 3ET6B 3QO9A 4J37A 4MYTA 5ETVA 3A13A 1JLFA 1SC4B 2I1RA 3K17A 1VRTA 5G4DA 2D3ZA 4CI0B 4DPOA 4LF9F 3SCIE 2HQFA 3L7OA 4E98A 3GIMA 2DGQA 3PR5B 2J6TA 3BSCA 2YKNA 1UA0A 1X4AA 4MIAA 2HHVA 1J5EF 2W2OP 2WOMB 1WSRA 2LDYA 4NPOA 3RUBL 4AXIA 3N0VA 3M8PA 1RBOB 2LKZA 3V6DA 4QQBA 3I0SB 3MUVP 3DI6B 4RNNA 3M2RA 3G8QA 2J0WA 1RKJA 1RA7A 2N82B 5CQGA 4CO3A 3W2WA 3I32A 3CDAA 4IR1A 1VISA 4J9UE 2C3YA 2I8EA 3OT9A 3DLGB 4QPTA 4URQU 1HNZF 3EVMA 1IJFB 3CCLS 1FK9B 2PA8D 3UDVA 3IBWA 3CCTA 3TUJC 4K4TA 2O67A 4AL6A 1V5VA 2F8MA 1VQ6S 2J7UA 3BGRA 4F2RA 1KVKA 1WHYA 3KLIB 5GMKa 2ZUAA 1I51B 4ILRA 3GFYA 3Q8UA 3G96A 3EPIA 1QAJA 4DL5A 1VBKA 2OPRB 3I6PA 2R9LA 4NXNF 2IMOA 4F0KA 2F9DA 3D3CJ 2A6OA 2H4WB 1QTMA 2CQGA 1U8WA 3HJVA 2GHVC 5D77A 4JUZA 2J8SA 4OI0A 4ZJOA 1O6XA 2QL5B 2G1DA 3HHEA 3QT8A 2JC1A 4USUA 1BD6A 1GX6A 2DGUA 3C66A 4M8LA 2XMMA 1C4AA 4DPUA 1NKBA 1SC6A 3W60A 5IZHA 4O3SA 4Y28C 4JI0F 3PY8A 4PG8A 1BGXT 1UJ5A 1X8DA 2E5IA 3K8VA 4QIWD 4UOHA 1IBMF 2P9GA 3KUGA 4K4YA 2PI4A 3Q83A 4IFYA 3W62A 3CCMS 3BV8A 3IGNA 5B0CA 2OTLS 5D3GA 1DJ0A 4ENOA 3OJSA 1FRKA 3I0RB 4A8YA 4TU9A 4CO4A 3AY0A 1SI9A 3PACA 2R7RA 5LM7E 4OJ3A 1IBKJ 1HA1A 4NASA 3AD9C 4DWIA 1TL7B 2JWNA 3L9ZA 4DLGA 3RB3A 2UUBF 3T6BA 1YWXA 4NLGA 2CA9A 2PA3A 4GRSA 1CQNA 1VYAA 4NCGB 4C8LA 4KO0B 1UWBA 4M5GA 2U1AA 5F41A 2ATCB 1TZ0A 2VPZB 4RW9B 4NCGA 5KFJA 4IFVB 2CPJA 1X0PA 3EMTA 3GPAA 4DEZA 3Q8YA 3O5TB 4FBUA 4KPYA 2NR0A 1Y11A 4DZ6A 2OD6A 4LFBJ 4O44A 4I0WA 3R8YA 3SQGA 3MUTP 1RTDA 3DLHA 3DU6A 4NOHA 1I94J 2BMBA 2BKOA 3GONA 1NJZA 2QE5A 3A8KA 3HHKA 4G65A 5DDPC 1LXNA 2HRYA 3DYAB 1EIYB 2GZOA 1JXVA 4JI2F 1C1CA 4KPCA 3MPDA 3H7HB 5BYQA 4RUHA 4JV0A 4ZLLA 1B99A 5EWGA 3J7ZT 5EWEA 2B9EA 1RZMA 1FXRA 3DMJB 1ZBTA 3FCWA 1L5UA 1VOMA 3HD2A 3V4MA 1JLAA 2ZBRA 2M8DB 2CXEA 2C2NA 4DHVA 5GAHI 3G6VA 2B43A 4CO2A 1KLMA 5DZ6A 4FF2A 3AJ1A 4AT1B 3H8YA 1NB2A 1Q4RA 7AT1B 5ETMA 2ZM6J 3GQCA 2BM0A 2XYHB 3WQPA 2XS2A 3T1YF 2W2PP 1RB0A 3GILA 5L1KA 1RYSA 1M5PC 4B3TF 2B0GA 3N28A 2WONA 5DQGA 4USJC 1Q0NA 5E2QA 5C42B 3NGRA 1MN7A 1FNXH 1Q8LA 1OY9A 1YBUA 2GA7A 3ITHA 1UP1A 1SKSA 2QFJA 4Z37A 1TK5A 5BR8F 1FFSB 4B17A 3HMJG 1YITS 4ELVA 1I6JA 2K7KA 2JLFA 3T1HJ 4DR1J 2HLUA 1QAXA 5KFFA 3DLGA 4IOAQ 3AXKA 4Q43A 2UP1A 4AL7A 3MECA 2XS7A 2B5JA 3CO9A 1HI1A 2HK3A 3M2VB 2YQ3A 3NG8A 2H4YB 4RR5A 1M5SA 4OLOA 4BWJA 2ZH3A 4K2JA 5L9NA 4Y00A 4R5PB 4CLZA 1Q81T 3SSQA 1CC7A 5C25B 3KTQA 4DR4F 2VFSA 1MU2B 2ASLA 1MROB 4N7TA 4ZMMA 1X4GA 1ZS6A 5KFBA 4AXJA 3O3LA 1ZETA 2IJFA 1HR0J 3C6UA 5KT2A 3UCZP 3EVOA 1H3DA 1NXIA 4LF5J 2PFFB 4KRWA 4B3RF 2OMLA 3NKYA 5KFZA 4K4XA 3TAPA 3DXBA 1X5PA 1CJVB 4LF4F 1T95A 3PM9A 4QIVA 2WB4A 4NWBA 2PN6A 1CS4A 2J8AA 4KY3A 2ZH8A 3AAWB 1T8EA 4IOCQ 1TKTA 1LK7A 2VG6A 4LUBA 4LBHA 3H5SA 2Z2MA 2XHCA 4LVOP 1N34F 5HI7A 4ZHRA 3FEYB 3VV2B 2FVRA 4I2QA 3PYFA 3M8QA 4EGLA 3HX9A 4QBUA 5ADZA 2NZCA 4CM0A 4KHRA 1NDKA 1T3NA 4FXWA 4ZVSB 2Q66A 2PEBA 4ECVA 2G4BA 1LWXA 3HLUA 4IH5A 4LRFA 3EDQB 2RDJA 2CVEA 3T6JA 1Y5NB 1X4EA 3HCXA 4TY8B 2KM8B 4R25A 3ZTSA 1YVFA 1UZHA 1ZA1B 1WF0A 2OEJA 4X62F 2XGQA 3HFVA 3UR3C 4YY3F 4NX9A 4C8MA 1FEHA 4HDGA 3LAKA 1XNRJ 2YKPA 4IG3B 5AJ3F 5GAEI 1ZAXA 2VJUA 2AF6A 5C24A 3BDPA 4F4WA 1NKEA 1FTCA 2H5IB 3M6VA 3RR7A 3D0GE 3V2UC 4OLPA 4LRCA 3HFKA 4ZVGA 4DF4A 2K3KA 2HZAA 2JLGA 1N36J 4RNOA 2GNKA 5HQ8A 2GMLA 5BR8J 3RB0A 2DO0A 3MFHA 3K59A 2CDRB 3HKZD 3EYZA 1U1LA 2OO4A 1L3UA 2WBMA 2NXUA 3NWRA 5HJXA 1EQMA 1S1TB 2MZSA 1CJTA 1UEKA 2F5GA 4ZP7A 4ZPWR 2K8GA 5LJ5Y 1N36F 3CC2S 1AA1B 1YJVA 2V4RA 2ILYA 5LSLA 2MKSA 2OPSA 3Q8PB 3AQOA 2I6WA 1PILA 3NGTA 4OYBA 1TR0A 4O3NA 3UI3A 2A2DA 3OUYA 1IKYA 4OIXA 1VMBA 1N56A 4WFBQ 4X64F 2JJ4D 3KNGA 2K7JA 1WEYA 2QZ8A 4HL9A 1XNRF 5D0HA 2CQ1A 4KSEB 4L75A 3ZZRA 5B0BA 2NYIA 3ZNJ1 3BO3A 1F3VA 3DGPB 4DR2F 1VBZA 4RNHA 1WEXA 3UCUP 3JB9k 2G0JA 4NLOA 4DV7F 3SI8A 2W7OA 1HQUB 2MZTA 5K14B 3QYYA 4R8UB 2HNZB 1YBTA 1N6QA 4DPTA 1VLYA 1FERA 2OKQA 1TVRA 3NBPB 4RO0A 2EBGA 4KGZB 2DXDA 1NK9A 2AEMA 1Q8BA 3V5RA 4N5SA 2PMHA 4I1TA 2B9XA 1N88A 4ZCKA 2CPDA 2D3O1 4AYBD 1RP5A 3I5CA 2ZKTA 2QA4G 3CWJA 4NCAA 4LFBF 4MAKA 1ZPVA 2Q1LA 4P6QA 5A0YA 5IV3A 3DLLQ 3CJSA 1LWCB 1RT5B 2HGNA 3K5PA 5KFYA 1Q16B 3R3TA 3UDLA 3RRGA 2XI3A 3MI7X 2EFQA 5G0RA 4F04B 5A8RB 2MGZB 3GJQB 4X4QA 1S0VA 4JI6F 2AJFE 3CCUS 4F50A 2XLJA 1RTDB 3AB4B 4Q7AA 2ASYA 3TOQA 2GVDB 5C42A 1HR0F 1RT2B 3FNNA 4PABA 1YIJS 3MMBB 4EYHB 2OP5A 2FJWA 4PCQA 3CJQA 1UWAA 2JSXA 1NPKA 4FNIA 4XPEA 2Y8YA 3OL8A 5FD1A 1RAGB 2R8HA 4JI3J 4UQGA 2KYZA 4DN0A 3UD5A 3TEHB 3VAKA 1KLMB 2JEFA 3UNYA 1U02A 1TTHB 1XN9A 4ED4A 2HNYB 2RU9A 4F36A 4U7UD 1K0VA 5H9EJ 2QN6B 4DR1F 3PZPA 1S6QB 2D3UA 2C3PA 2VQEF 2H48B 2CNOB 2B9YA 3DHXA 4DV3F 1QVFR 5DETA 3AXMA 1RXOB 2Q6BA 2CDQA 2VV5A 5KFMA 2VUGA 2YWWA 2WSCC 3QJPA 3QMQA 1VK8A 2B8QA 1RADB 3IGVA 1X4DA 4I67A 3W65A 1REGX 1V3RA 3ZC4A 4ES1A 2JL9A 2M8HA 4DR5F 1N34J 1J5OB 4B3TJ 1WD6A 1VGYA 3CIMA 4DUTA 3OJUA 1TL3B 1FX2A 2EVZA 3MEKA 4MTPA 4ANEA 4XIUA 4C8OA 4W4MA 2MQMA 3CCSS 2EI5A 2ZEJA 4HLBA 5D4PA 1U25A 2EFGA 3UR0A 5CYJA 2VD3A 2CPFA 3LGNA 4LF8J 4JYAJ 5ETTA 3HVAA 2HIQA 1RAEB 4P72A 3LWLA 1HNXF 1SV5B 1NNDA 1FHTA 1FRLA 2BEFA 2QMWA 1YGYA 4B9VA 1H7XA 2ZBIA 1XMOF 4CO5A 3J81Y 1IBLJ 3M2UB 5L39A 2ZOGA 1M0SA 1OIAA 3H5YA 4RW8A 4WF9Q 4KFBB 2D9PA 1JLEA 2BE9B 5D6GA 3NL0A 3THPA 1U6BA 3GV8B 1XEZA 1VQPS 2GVZA 2ZNZA 1JKHB 1C1BB 3A3NB 3AFGA 3NP5A 1HW9A 1LW0B 2AZ3A 1LFPA 4X84A 5IQQA 4C6AA 1F5BA 1Q8IA 3M2RB 2FGOA 4LSZB 1PCAA 4CLWA 1UW4A 1JNZB 5DGBA 3KLEA 4A8FA 5JVHQ 3DDKA 4CNYA 1NJXA 3DLKB 1GAOA 3ET6A 3EZUA 4MIBA 3H5XA 2GAHC 3BBFA 3JAMU 4U67Q 4ZCMA 1RAHB 4A8WA 3RBZA 4K59A 1IWAA 1ZTWA 2YQ1A 1HHQA 4CLYA 2W25A 2VA2A 4DUZF 1SQGA 2WVBA 2AKWB 1F60B 3MEGB 3ZZPA 4Q8EA 3M30B 4DV1F 3CPWR 4RW6B 1FJ7A 3KG1A 2CJYB 2E9ZA 2PC6A 3IO1A 3HDSA 2OEKA 2CVIA 4V1Ak 5J2NB 3NLCA 3H25A 3QJJA 2RQKA 3VCDA 1P8GA 5CXTA 1D0EA 3MTJA 1IJEB 2MKKA 2OFGX 1XMQJ 2W1BA 3QLHB 2MKIA 1B7FA 3FQLA 3DXSX 4RBVA 2HHHJ 1VQ9S 2HYIB 4H4OB 3G6XA 3SZ2A 1DFDA 2V8HA 1SL0A 2GCFA 1U6FA 2W4DA 4JI2J 2B7CB 2B9WA 2DISA 4L3KA 4WE1A 2VG7B 4M5JA 1VI7A 4DDFA 1V6HA 4JI5J 1W2BR 2VPXB 3PJWA 2DHAA 3PW4A 2GMJA 1X0FA 4CLTA 4JI4J 3N01A 4B3MF 2Y1JA 2ZZMA 3OVBA 2BZ2A 1U1KA 1N5SA 2N4DA 1KQKA 1NEEA 4KHPJ 1SPBP 4X4OA 1ZZFA 4IH7A 4LRDA 3I56S 3V6JA 1FWPA 1VLOA 1RU2A 5C24B 1TKXA 2DB1A 2YNGB 3O44A 3JSMA 1APSA 4IR9A 1P1LA 1C0UA 1JWWA 3OPKA 2FJXA 2FZKB 2FTRA 2PGCA 3DCAA 3TX0A 2RHSB 4NLSA 2QLWA 3CULA 2NZ4A 3D66A 3DOLB 1P6TA 1R0AA 3CB4A 3PNIA 3IM9A 2ZVIA 3G9CA 4OZ2A 2UXCJ 3GFXA 4RW7A 3T5KA 2YKAA 3OSNA 1XERA 2XMAA 5HROA 2GVZB 1YJWS 1UFKA 3S1TA 2MB0B 2DNNA 1IM6A 2VG7A 4HHUA 1KHWA 3FBBA 3OFGA 4N47A 1B3TA 2MKHA 2XMWA 3D1OA 1WC0A 2UVVA 4RX6A 4RNMA 2RS2A 3A3PB 4ITSA 1Y4ZB 2GIFA 3K5MA 1JKHA 2EK6A 3C6TB 3CCQS 4WBFA 5KT3A 2C2RA 5GADU 3KHRA 4LF6J 3K2YA 4KKOB 3TW0A 4L72B 1WTBA 2O1PA 2ZHBA 4DV4J 1HD0A 2CG8A 3KKFA 3DU5A 1H2VZ 4O23A 3EPGA 4OHYA 2ZM6F 4ZLJA 1BQXA 4PG6A 5LJ3Y 4WYWA 1PYOB 3SDEB 5DJBA 2R2UA 3UE2A 1S1XA 4ZN1A 3UD4P 3WBZA 2HHHF 5C5JA 4ECSA 1YG0A 1S59A 2QG9B 3SXLA 1C1BA 2BM1A 1RT3A 4K2XA 1N8RT 3M6XA 1W7WA 2MPUA 1RTJB 1CSJA 1SJ1A 2ZWPA 3O2IA 1SQFA 3B4DA 4O0IA 2OFHX 4F4YA 2QMUB 2AD9A 2G1HA 5J2PA 2WZ1A 3PEHA 1WWHA 2DNMA 3K89A 1NSQA 2MY7A 4DV1J 1HW8A 2IM3A 3NS5A 5L8RC 5HP1A 2DR8A 3B82A 2NS1B 2MKYA 2V68A 4DUZJ 3TZZA 1PSDA 5KFAA 2GHPA 1FWLA 3ZZTA 4HTJA 1WTFA 2Z2YB 4A48A 4TLQA 4ZIWA 3Q8VA 2RMLA 2AGOA 4KAIA 3CJ8A 3P4UB 3P6YC 1X31C 3I82A 3SQGB 3WIUA 2P6TA 2CPYA 2QC3A 3JS9A 4OYMA 3ENAA 4RNFA 2ZE2A 2DVIA 2PSZA 4C8YA 2LQ5A 1Y5LB 1R31A 1LKZA 3J80U 2UUCJ 2MSTA 3R7NB 2DCLA 2VASA 3M9OB 1TL1A 2DRBA 2DR9A 5F3TA 3VVUA 5SZTA 2Z4PA 3PDNA 2KI2A 2WRMA 3HP6A 2YXLA 3JAMY 2DH9A 2RF2B 1C4CA 1SCJB 4I2PA 4L73A 4OX7A 5ITHA 4OYXA 2W2QP 3VQTA 3MR2A 5KFKA 1DY3A 2ASDA 2Z2ZA 1HI8A 4K5SA 2XQCA 3RRHA 2QGFB 4K4VA 2CG4A 1TVRB 3GTYX 3PHTA 5F0UA 1GTEA 1SKWA 2R8GA 3KOAA 4F25A 3OLBA 1UVIA 1N5QA 4C4WA 3NGKA 3DOKB 1NZ8A 2DNPA 3R5GA 1XR6A 1IM4A 4Q0BA 4N8OA 3VAGA 4WIIA 2AGQA 1ZM2A 2CZVC 1IR2A 3TA1A 2VOPA 1S7HA 2O5DA 2Y0BB 4ZPAA 1JX4A 3MMAB 5C2CA 5DDRC 3NS7B 3SDEA 1NHKL 5HN0A 1KP6A 4CNZA 4B9SA 4K50A 4OHVA 1R6VA 1ULRA 4OYWA 2LYVA 3VAIA 1ITPA 4ICLB 3IAM9 5IC6B 5LSRA 2OPRA 3VZHA 2VQEJ 1WJ9A 1B70B 3KG4A 2ZUGA 3GSDA 2C2KB 2KM8C 1RTJA 2IYGA 4DV6F 2CIMA 5HMXA 4DFKA 3TZYA 1ROFA 2HW3A 1PO6A 1YK9A 2ZH7A 5A2QY 3G87A 4NLDA 4JI1F 4LF1A 5KG2A 4AL5A 4IRCA 1KONA 3BGFA 4P7VA 3V6DB 2KHDA 2BQ3A 4WJBA 4OI4A 4GC7A 2GHWA 2NLWA 3W9JA 1YJTA 2Q43A 3SBMA 2V2QA 2MQLA 1XNQJ 4DCOB 1W2IA 5K14A 2IJNA 5JUMA 1RSCA 1G2EA 1R8PA 4EZ6A 2F63A 3LTOA 3IM8A 3MOZA 3NOCA 5KFEA 2OH2A 2MHNA 5ETNA 5IFMA 1DQAA 3CTRA 2BJ9A 3JSRA 3QAUA 4TNOA 4P74A 5KFGA 2UVWA 4Y2KA 3FUYA 2ROGA 3VQSA 4ATNA 4IRDA 4FF4A 4DPYA 1Q78A 4NE9C 2YKMB 1YI2S 2RU3A 3TVZA 1JLFB 1FRMA 4DLEA 4K5RA 3TQ1A 1PGZA 4OV1A 4ZVEA 3BH6B 1RHKB 3POTA 4YR2A 3BDEA 2QL9B 2LA4A 5D4OA 4JI5F 4DR6J 1N5YA 3KHHA 2Z0GA 2L9WA 2VF3A 2DNZA 1ZOTA 2IA6A 1CJTB 3HVTB 2PT0A 4F3QA 3Q0AA 4JI7F 4NLRA 2MQQA 2BJ8A 2BJ3A 1SUQA 1JLCB 3M6WA 3BO2A 1CG2A 3KJVB 4C8ZA 1N5TA 3NGUA 1EJ7L 1XMQF 1HNVA 1LK5A 1S49A 2B4PA 3ENWA 2E1MC 4AFFA 3J7YI 4HI1A 1N5YB 4U8YA 4H4OA 3QATA 3H2VE 4RW7B 2XNRA 1QAYA 1S1VA 3RAQA 1YRXA 1Q7LB 2YNGA 4X64J 2C1EB 2QLFB 2L3MA 3IR7B 3BREA 4FYYB 4IG3A 4TXSA 1T9XA 2HMIA 4M5DA 4MFBB 3LO3A 1K8AT 4NMXA 3PX0A 1NBEB 3CJKB 1JJ4A 1FD2A 3HF5A 3G82A 2R7QA 4I56A 2YX7A 1T03A 1Z2ZA 1X7VA 2CQIA 2DHSA 3MM8A 1H73A 3PYEA 4Q2MA 5K8NA 3I55S 3Q8QB 2FVQA 2R2SA 1F0XA 2EC2A 4MK9A 3TZWA 4ED3A 3IFEA 3SFUA 3CEDA 3TAMB 3QSYB 2JEJA 1MU2A 4CYUB 1S6PB 2JH3A 3HJFA 1WELA 2AJ1A 5HANA 1SUQB 3EGZA 1JXLA 2XMJA 4DQPA 4HR2A 2B5JB 4BC7A 2VODA 4ZJLA 3FSYA 1D9DA 2Z30B 3BM7A 1VBXA 1URNA 3O6QA 2W8KA 1QVGR 5I3UA 4DSLA 1I1GA 4LF2A 3IC1A 2RUSA 2CFXA 3CJTA 3D0IE 3QSIA 5HATA 5KG6A 1JIHA 4IDKB 3M9NB 4ECZA 1HNXJ 2BW2A 5I4MA 3AA8A 2MXYA 4DS4A 4DR7J 1QE1B 1O51A 2HBZB 2ZD1B 4FKXA 3FEXB 1U4BA 1JLAB 3HVWA 3IG1B 3ILLA 1OSCA 1S6OA 1PBUA 1JNRB 4NZ6A 4IH6A 4ZKAA 3H4BA 1T7PA 3DLKA 3RB6A 2QEXS 2FHJD 5F3ZA 4JV2A 1PKUA 2CNNB 1HL6A 2E7XA 2KRBA 1WUUA 3LQVA 5I42A 3OSPA 3X1LB 2VG5B 4RW4A 2OPQA 2FHOB 2HZVA 4CM2A 3MEEB 1XTZA 4KT0C 2IM0A 1PC5A 2LU1A 5GVQA 1YRTA 4C3KA 5E41A 1AFJA 2UXBJ 1TL3A 1U0HB 3SCLE 1VJQA 2HVZA 2AYEA 3D67A 1BQMA 4ZCLA 3CO0P 3D2WA 3E01A 5ETKA 1KOOA 2ROEA 1FO1A 2KO1A 4M5LA 4OYAA 1TP7A 2XSFA 3ISND 3TRGA 4ZVFA 3OLAA 1B0PA 3D7SB 3DOMB 1PYSB 1HIYA 3W66A 2KB2A 3QRRA 2WONB 2HHUA 3BR9A 4DV5J 2MKJA 3OFEA 3QIPB 4DSKA 6FDRA 1S9EA 4UOGA 3HULA 2JZ5A 5AJ3J 2R3VA 2CPHA 1KFDA 3Q8RB 1S0MA 2FLPA 4NYZA 5GAGU 4ECTA 3QBCA 3PW7A 2ZE2B 4YDXA 2MZQA 2BUNA 1YQHA 4ZP9A 2QA2A 4JV5J 3KHLA 3T41A 1S7IA 2LDIA 3DN9A 4E2FB 4C9DA 2JX2A 4EZ9A 3DOKA 1E6YB 1OMSA 3OXGA 1KEKA 4WU2A 2XY7A 4O3OA 1D1UA 1SH0A 5B0AA 1YJNS 5KAKA 1OPIA 2PE8A 3H42A 1XR5A 2AYGA 1MWZA 3M8WA 3H59A 3GJSB 3DKDA 3CGIA 4ZVRB 2B7BB 1IKVB 1RAFB 1J5OA 3KNAA 1U2FA 1J27A 2ZDPA 4YHHF 2ZBPA 2IBOA 1HNWF 3NNAA 3MCOA 3B6BA 3QGHA 1S9FA 1TV6A 3I5AA 2IHR1 4FKYA 4O3RA 2HFUA 3A4TA 5K8MA 4V19X 4YB7A 4PKDB 5J1PA 4GKJJ 2RKIA 1NSAA 4ZJQA 3QFHA 3HZGA 5KFRA 1S0OA 4Q44A 3GIIA 1AROP 3DDIA 1OQ3A 3ONQA 2RD5C 2DRAA 1CJKB 1FCAA 2D74B 1FTRA 4J7CA 1RKIA 2XSJB 3GMGA 4HT5A 3OTBA 4OHZA 2F4FA 2M3DA 1HYSA 1S48A 2NSCA 3MPWA 1GXTA 4HACB 4KGKA 4WXOA 2MGZA 4WP3A 3D3BJ 3GR0A 1FNOA 4KGMA 2DXFA 4BC9A 4DV6J 3UO0A 4PPDA 2O66A 5ETRA 1T9YA 3BYPA 5KFDA 5E3AA 3MOJB 1RT7B 2J0SD 3M8YA 1CJUA 1PC4A 3NEKA 2HBYB 1WG4A 3NCRA 4J9PA 1NSKL 1HWLA 1I3OB 2OTJS 3MR3A 2RAQA 4LQ9A 4MJKA 4I64A 4M5MA 3SCJE 2GQ2A 3M7VA 1R43A 3KMQA 1R0CB 4Y0FA 2XI2A 1IBKF 3I4PA 3I87A 4OZ0A 2VICA 1X4CA 1QY7A 3CUNA 2HGMA 4ZPVR 3RBEA 2LCWA 1HWJA 3S8SA 5J1NA 2DO4A 3SEOA 1S1XB 1SL1A 3MAHA 5HJYA 2HHPA 3M1VA 1CEZA 4ECWA 1RWKB 1IBMJ 4DQSA 1K47A 2DGOA 1KSPA 3DRRB 4OFZA 1VHIA 1IKWA 5KT4A 1UAWA 2L9NA 5I42B 1OY6A 1KHVA 2FHMA 4KYZA 3VGVA 5HMYA 4U8VA 4J9SA 2HSEB 4WFXA 5J1EA 4DV0J 3AD8C 2P8IA 1I5OB 3L09A 2XZTB 3UDEA 3DFEA 2M52A 5D0EA 4DJBA 1KR4A 1RWXB 3MAQA 3SV3A 3P5TL 5ETOA 1HARA 2JHEA 1I94F 3KFWX 4LFAF 2AWZA 2YTCA 4LQ3A 4NXNJ 5L1JA 1UZDA 1O5JA 4KKOA 3K58A 1SIZA 1M1KT 4CYUA 4M95A 1V9OA 2DRDA 1HLWA 5L38A 4I2QB 4DN9A 4B3SJ 4N8NA 3V6HA 1BXNA 2XMKA 2HVIA 3FK4A 2CQCA 5FDLB 2LXUA 5T14A 1U2CA 3MM9B 5D4LA 2AJ2A 2E44A 1AYEA 3H90A 1BWEA 1XWLA 2ERRA 2UUBJ 4B3OA 1L3KA 3CJRA 2HQIA 3MPVA 1CBKA 2XY5A 3GJRB 1ZPWX 5DQIA 2I0XA 3GIRA 4H4MA 7FD1A 2A0FB 3H98A 2ZITA 3QT6A 3S01A 5LXYA 3T5JA 2HHQA 4TYBA 1HNIA 2MQNA 3M8ZA 1VQMS 2GX8A 2YWGA 5DG9A 1WI6A 4J9OA 1NJIT 2ZBQA 2G2OA 3IG1A 3LGHA 1EP4A 3IS9B 1J5EJ 3THTA 1QUPA 3TX8A 4XK8C 3QGGA 5T7LB 4A8OA 4XO0A 3ZZZA 1L3VA 3JTOA 5KFWA 3I96A 2ZZTA 3UVJB 2LEAA 4CQ1A 1EKRA 3V4IB 1U2RA 1A0OB 3QRQA 1FX4A 2V0NA 1KQGB 1TK0A 2M70A 4OZ3A 4CH0S 3CCZA 3R6LB 3NGSA 1U49A 2HNDB 3T9ZA 4DPXA 1RWVB 3MM7A 2WW8A 2QT7A 1SH2A 4ER8A 5HLFA 1FFWB 2FYXA 2HWTA 3PEJA 3QLHA 4KB7A 1D3WA 3SFGA 2QA1A 2KH9A 4J90A 2D69A 3D0HE 3LPEA 3FRYA 1Y10A 3N6LA 2ZHAA 3HD1A 2ZDOA 1F9EB 3BN4A 3UCGA 3AODA 1X5OA 2JC0A 2IAJB 2RQCA 1RISA 4KE5A 1LWFA 4GVLA 1QSSA 1U26A 2R7UA 3MEGA 3DDNA 2NPFA 4RBUA 3W1YC 1S99A 2YNHB 3C8YA 1RWWB 2QLBB 4W90B 2XO7A 1UETA 2CNLB 3DGVA 3RGIA 3DM2B 1RT1B 3H20A 2KXHA 2HMIB 2I38A 1H72C 4L3NA 4IQMA 2DTJA 3MD1A 1VQLS 3CSKA 4TVAB 3Q86A 2YKOA 1P1TA 4KTQA 1VQ7S 2EC0A 1XR7A 4NLUA 4ZVUB 5E3CA 1NPRA 2XY6A 2RIJA 2IVMA 1JLEB 2E1PA 3JSYA 4NRTA 2BKNA 4QZVB 2XS5A 4PWDA 3LOUA 3TR5A 2YY3A 3FMBA 4UT4A 2P5VA 2W7PA 5CH7B 4KH1B 2W8LA 4YFUA 3M2UA 4DSEA 1HHTP 3TUIC 1M90T 2NCKL 5B09A 4O44B 3VVTA 4TU8A 1Z4UA 2CJAA 4YDDB 1U47A 3R6GB 4DXLA 1RWMB 3P96A 2VQFF 3T9NA 3AJDA 2NXCA 1UWBB 3DMJA 3NRBA 1SL2A 2MDAA 2UUAJ 1GX5A 2XSJA 2FB0A 5KFOA 5KT7A 4QWEA 2FJVA 2FLOA 4DG1B 1MWQA 2R7TA 3CIZA 1FXDA 8AT1B 1VC5A 3I0RA 2IDLA 2JNJA 3MF5A 3J81U 2POKA 4A8MP 1S12A 3LGMA 1RABB 2JVOA 3FQKA 3PIOQ 4K4WA 1WG5A 2FZCB 3X3UA 4ECXA 2V8GA 2HQGA 3IWLA 5AXMA 2AU0A 3RW7A 1C1CB 1BUXA 2CPEA 3GP9A 4M63A 4AE5A 4Y2AA 1TU0B 2ABYA 4DZDA 5IM0A 3PX6A 2Q3PA 3ZTOA 3JYTA 1BLUA 5LMNJ 4UOCA 2CQPA 3CD5A 1S6QA 1FJGJ 1N0VC 4B9UA 2WVFA 2OPPB 5KG3A 4ZVOB 1B64A 1GXUA 3HO1A 1N6QB 1WKJA 1NMEB 4KHMA 4J9VA 4XDCA 5J2QB 1TL1B 3FGVA 4ZVTB 1F9HA 5AE2A 1HD1A 4QOTA 4OMFG 3HHLA 1HBNA 1RDRA 2HBRB 1U1OA 4OI2A 2A3JA 3DGPA 1AB8A 3D1HA 1WG1A 2EW9A 2QMXA 2XHWA 2QLJB 3MMJA 5KFPA 1IXKA 3OR2B 2RRAA 2AW0A 2W7AA 3RAXA 5HVHA 2XC9A 2V94A 5G0RB 2DHXA 2BANA 4KIAA 3M4XA 1VRUA 3HSJA 2FC8A 3K57A 1D9AA 4MKVA 1FNMA 1VFJA 2A2CA 2GVDA 2F4VF 4C2MA 4J9RA 3QAEA 3F0NA 1RBAA 2JDJA 3SV4A 2NUUG 4I6WA 2QYCA 4ZK7M 3L7UA 4J5OA 3MCNA 2HBQB 3W61A 3HM9A 2BQRA 3TJ9A 5IT9Y 1LWCA 1RT5A 2QSFA 4YQWA 2RQMA 2QLXA 4YHHJ 3DRYA 2YWFA 4ZVQB 5EGYA 3H4DA 2AP6A 1SJ3P 1M5VC 1ACMB 3HXMA 1VDHA 2VG5A 4LVNP 4RW4B 2OAUA 2W9BB 3VZIA 2ZJRQ 2W9AA 4CH1A 3Q24A 2DR5A 4DR5J 4G1PA 5DM6Q 2CWKA 2FZGB 1N4LA 4L74A 4EFAC 1WDTA 3O1LA 1RQ0A 4LSNB 3EZOA 4NI2B 4XDDA 2DNOA 5LXRA 3OTOF 3UD3P 3IAS9 3MAAB 4NA3A 2DH8A 3JQKA 1Q95G 3QT5A 3VR1A 5CD4H 3BSAA 3CDEA 5GAHU 3QIPA 4MK8A 4C97A 4DX8H 4ED2A 3GWCA 4TQRA 2F7VA 1WDDA 2WTFA 4WU3A 3MEDB 3PW5A 1X9MA 2DNQA 5A6WA 3CMQA 3KK3B 2KHCA 1FEEA 1ZM4A 3JQJA 1E6VB 4X4VA 4TU7A 3EXYA 5J2PB 5T7LA 1H6KX 5ETLA 5IXUA 3ETOA 2Q6CA 1OWXA 3IRXB 4AQYJ 1QM9A 2EK1A 1VQ4S 1S1UB 2E29A 4DU7A 4BDPA 3UNGC 1A7GE 2DT9A 1H7WA 3JSMB 2BE7D 3GV7B 4UW2A 1NH7A 3D6MB 3ELHA 1X5SA 3G82B 2V63A 3SQOP 4J9QA 2HFZA 4DL6A 2BQUA 3FSXA 1EP4B 4QYZK 2B6AA 3PRDA 4A4JA 4ETZA 1SJRA 5EUHA 3F73A 5FIIA 3MMCA 1KNZA 3VGUA 4HI2A 1HBMA 3JSBA 4FPIA 1T94A 1T03B 2FUG9 1TL4A 2BE2A 3P49B 2AT1B 3S6EA 3MECB 3W5XA 1FKAF 4J9MA 1OYDA 3GU0A 4KR0B 1WOSA 3U7JA 3J81j 1HBOA 2HNDA 1RHJB 2B4OA 3EXCX 4PWWA 4WE1B 3ZXWA 4CO1A 2EFNA 5KFNA 3E51A 3GIKA 4OX9F 1FFGB 2BABA 1QSLA 2WVCA 2E7VA 1R3NA 4P2MA 4ZHRB 1OPZA 4WWSA 2HRTA 9RUBA 3D4JA 3EGNA 5HLFB 4H54A 2BRKA 1L3TA 3F56A 3HVRA 3Q2TC 1R7IA 4GKJF 3ENVA 1GMWD 3CW2C 3IBFB 2VKZG 4J91A 4ZN3A 3BR8A 1SVDA 1EKSA 3ENQA 5J2NA 1FKOA 4OX6A 1U1NA 3FRZA 3OBIA 3TNVA 4DL3A 1KD1T 5AXLA 3ZZUA 2H1YA 4N56A 2BJDA 4PUOB 1VQ5S 2IRYA 2J9DA 1IKWB 2AEJA 2RHQB 4DQIA 3KWMA 3TYTA 2DY9A 5LL6d 4YUDA 1TKTB 4DR3J 1QLNA 4NL5A 3KLHA 1H74A 2MHEA 2JFKA 2Z56B 5GMEA 2IY5B 1U1RA 4USHA 2XB2D 1HNIB 4RW6A 1BMQB 1XK8A 1YLXA 1HQEA 4DV3J 4RU9A 1Y5IB 1Q8KA 2OELA 4YP3A 3I31A 3P8BB 3MEDA 5K5MA 2CJBA 4EBCA 1Q7YT 1ZAWA 3MHYA 2MJUA 2K2PA 4Y34A 2BJ1A 3BGLA 4JI3F 1E6VA 5KG4A 4U6PA 3C16A 4J9LA 4BS2A 2LU2A 4K7QA 3HHLC 3R1LA 2K3IA 3W2VB 2MQOA 4BCAA 4MKYA 4CO0A 2VZ9A 2IM2A 3PTWA 1IR0A 3MZIA 4LRAA 4YS2A 2KG1A 4EYIB 3UWTA 4QIEA 2PI5A 1Y7PA 3AT1B 3BZQA 2VIHA 4JI6J 1UVKA 4IO1A 2FY8A 3WC0A 1T9WA 2JVRA 1YSJA 4TN2A 1RT7A 3OTOJ 2CQ3A 1YX2A 4FYDA 1S10A 1PBAA 2FJEB 3GSIA 2DHHA 4RWXA 1IUJA 4DR6F 1N54B 1DAXA 3WIVA 1PG5B 5IQ6A 5CD4A 2F40A 1TKZA 4DFJA 2E1CA 4O4GA 2RDDA 3PIPQ 4PPZA 5CABA 4CCHA 2AIRB 1NDPA 3OD2A 3VWSA 3GYXB 3EE3A 2XMTA 4YN3B 3T1AA 4OZNA 2I5JA 2G13A 3BKTA 3DLJA 2U2FA 4QU6A 4ALZA 1RGVA 2BANB 1TL5A 3M32A 5D0GA 4FS1A 1AZSB 2ZOMA 3OVAA 1A9NB 4MIWA 2G2YA 1F2HA 4USVA 3M8RA 5IT4A 2M0GB 3MCMA 5CYMA 5EHHA 1M5OC 2FHKA 2A18A 2J5AA 4DX6A 4F3OA 2H9ZA 5E7OB 1MW7A 4IFVA 2W9CA 4RW8B 5MLCV 2DGVA 3BGOP 3F41A 3EVWA 3HHLB 2LQBA 3W7BA 1AFIA 2E66A 1FF2A 3QFWA 5CYQA 1AXQA 5D15A 4YB5A 5KFCA 3GV5B 5EN1A 3IN5A 2H54B 1UTAA 3A12A 1MNEA 1CJKA 2BX6A 3IWNC 1U0SA 3BKUA 2FHJA 4NLPA 3TVKA 4FYWB 2MZ1A 2COLA 1KOHA 4A8KA 4JV1A 3CDUA 2W24A 4OV6A 1HWKA 3BGUA 4NEYA 4WYLA 3TQEA 3ZTPA 3PFOA 3PCOB 2PD1A 5CZXA 1TV6B 3AA9A 1RT2A 4FZVA 5LSOA 4AUKA 2J7WA 4NMLA 2IYIA 4BBYA 2QL7B 3CVKA 3OXFA 2ZH6A 2QTWA 2ZOFA 5CCLA 3MR5A 2IRXA 5L9XA 5LMNF 4PWDB 4F0MA 3DHWC 1WC1A 4QU7A 1S9GB 3KK1B 4YR3A 1HI0P 4P9SA 4KV8A 2GJIA 2NPIA 3H2UB 3WZ0A 3F44A 2MJNA 4F4XA 1X5TA 3FBEA 3PYGA 2Q79A 1V3SA 1JQGA 2KVIA 3HT0A 5C2GA 1RLDA 2VBZA 1G4CA 1SC3B 5HQMA 2HNYA 1GMVA 2R42A 3KUHA 1X4BA 3ZZYA 3J80Y 3VAMA 1BC6A 4PRFA 2B8PA 2QSWA 3CE8A 4JV5F 2RH3A 4WFZA 3FJ2A 4IOBA 5AXKA 1KVJA 1JMTA 3BBBA 2CJ9A 3D5MA 3W8PA 1RCXB 1FK9A 1SB6A 2G9OA 2RQ4A 1DHMA 1EZZB 3FMWA 3CD7A 3NAHA 2KL8A 4LRBA 1GQEA 1S1WA 1KTVA 2M9KA 4OQJA 2F9JA 2KDOA 2AZ1A 2FD2A 4PXDA 2ZBCA 4A46A 5RUBA 1DZ5A 2Y8WA 4CTAA 4Q8FA 2VU5A 4RPFA 2VC1A 5IT0A 1MWYA 3DI6A 1Q5VA 1WKKA 4F4AA 3T5HA 1HBUB 1IKXB 4CLKA 2ZNYA 3K5OA 4EK2A 2J7KA 4TLRA 4F0HA 2BA9A 2FC9A 2DKOB 2W4PA 3MM6B 3CCRS 5LT5A 2F4VJ 4RLEA 2F1FA 1TUGB 2GGPB 1AUSL 2BOPA 2VFVA 2VOOA 4ED5A 1R8AA 3MM8B 4WIQA 2FIUA 4C48A 1EB0A 1JK9B 2KZMA 5IWAJ 1N33J 4USIA 3N5FA 5B0DA 2B6AB 2KVQE 2DHGA 5L1IA 1UEUA 5HBMB 2X3DA 2HAFA 1DQ8A 2VBWA 4NZ0A 3PW2A 3C15A 2HVDA 3TWZA 2AYMA 5B0GA 4ES3A 1R27B 2LXIA 2HHSA 1YJUA 2NXEA 2DBBA 2DNYA 3LP0B 3LP1B 1S1UA 1SH3A 3GJTB 2ASJA 3PR4A 2N7YA 3C2PA 1LQ9A 2GMHA 2ZHOA 3BF4A 1F6TA 4ED6A 1TKDA 5KFUA 1UMJA 1W25A 1FD8A 4CT8A 1OO0B 4ZPDA 1TUWA 4HDHA 2WHOA 5KFHA 1TUVA 5A2QU 3KLFB 1KFSA 2J0QD 3TUPA 1OYEA 1HNVB 1RAOA 2CZ4A 4FVMA 3ZZ0A 1MG7A 2MEWA 2R4FA 3TAMA 4PEOA 3V6KA 4ELUA 1GMWA 4DL2A 2RRBA 1SJQA 1K0TA 4QR1A 4URGA 2OIHA 4NEZA 2BVZA 3KUEA 3HKWA 2OEMA 1NCLA 4O4RA 3ETMA 5AXNA 1HNZJ 1IQZA 3FBCA 4OI1A 1PYTA 1TAUA 4GVBA 4KGVB 1Z2LA 3HHLD 4DU8A 4F26A 5EWFA 1NJWA 5C25A 4PG7A 2UU9F 3LAMA 2GS8A 2YNFA 4CT9A 1S77D 3EWGA 2FLNA 5FDLA 2DCUB 1U6ZA 2B51A 2VDHA 2YNFB 1UPMB 1VQSA 3MMCB 2RJZA 5H9FJ 2NXNA 2R8KA 1UVJA 2EFOA 4OI6A 1SQEA 3R9LA 2P2CB 2FJBB 5M2PA 2CPXA 2DNLA 1RAAB 3VGSA 2V2KA 2FJAB 1DTQB 2F8HA 3NNHA 1S1VB 1UW9A 2HZCA 3H40A 3ITHB 2HS3A 3CDBA 5CAAA 1RHQB 1QTNB 3C46A 1RT6B 3P45B 3TJ8A 3M8QB 4C3MA 1QDUB 1JLCA 1H2UX 4LFAJ 3KLEB 1NUEA 1Y9OA 4ICLA 3G71S 4YB1P 1CJUB 2HFSA 3OR2A 4MKAA 3GG0A 3O8WA 1RACB 2KRRA 3MAAA 7FDRA 1U45A 5JJBA 4U96A 3CC4S 2C42A 2HVHA 2DYAA 4I6YA 3A1YG 4FPRA 4DOZA 4C7QA 1Q82T 1SV5A 3QWUA 2BDPA 5J2MB 1FDBA 4Y2CA 3B4MA 2RT3A 3EGVA 1HMVB 3OTDA 2F8EX 1FRIA 5GADI 5IC4B 4NI2A 3FFIB 2IA0A 2UUAF 3M1VB 4M5KA 4CLSA 2V2ZA 4P73A 4EO6A 3IRWP 3GZ7A 1YTYA 3PVXA 2DR7A 2SXLA 1GTHA 1KTQA 2ACYA 3NWGA 5C7PA 3D6HB 4A47A 4X4TA 3MM5A 4C0BA 1N48A 3LPYA 3MM6A 2KZZA 1VRQC 3AOBA 2CJXB 5B0EA 3RYLA 2E1RA 1IKVA 1P27B 2QJ3A 3B8HA 1D8ZA 3ILIA 2ZH4A 1D8YA 3RR8A 3GR1A 2MTLA 4LF6F 2HFVA 2VONA 2G0IA 2CQ2A 4X65F 2LQJA 4KJIA 2AJQA 1LWEB 4RJVA 1OQ6A 4M94A 1B0VA 2XEXA 3BH7B 4I2PB 2EKNA 2D41A 2GFFA 1MLAA 5F8HA 3BSOA 4X4UA 3NS6A 1VC0A 3OR1A 2OI2A 3FDSA 3BQ2A 3VTIA 3RB4A 4Y3CA 3R5BA 3QPIA 3U1LA 2H5EA 4LSLB 4RZRA 4DUYJ 3AB2B 4KO0A 2UU9J 5JVGQ 2UXCF 4B9MA 2MZRA 1YBAA 2HAIA 2RSQA 1BE4A 1AW0A 2R8JA 3HSGA 1M1GA 2H51B 1RU1A 2ATLA 2FY1A 1NPPA 3AQPA 1NHVA 4V19J 2HK2A 4Y2IA 4G3IA 3W9HA 3JYTB 1EAYC 3D6FB 1Q5YA 2D1CA 5D4NA 3AHPA 2AEFA 2PMZD 5J2QA 3C3LA 1KKHA 3LA0A 3TEGA 1BQNB 1WC5A 3GCWP 4QWBA 2ZH5A 2ZJPQ 2YKQA 2DJWA 5HP1B 2UVRA 4K4SA 2GIQA 4FXDA 2GC8A 1F9FA 2AHOB 2ROPA 3E2EA 4HH1A 2DEJA 5DS7A 4DV4F 1N52B 3M8SA 3G6ES 2G0CA 2VH7A 2I5JB 1SC1B 1NSPA 2BV3A 4TKTA 4DSIA 2WSEC 2JOQA 1IWGA 2KT2A 5GMDA 1FA0A 2BRLA 4L6V3 3WX8A 4DL7A 4RU2A 1IQTA 1C2PA 2NXJA 2E5JA 3ZNUA 1F2GA 1TFWA 4URSA 3FZBA 4I69A 1IVZA 3TJAA 2YWHA 3D9BA 3HI9A 5KOXA 3OHBA 4QWCA 2WAQD 5GAEU 2BJEA 2HHXA 4NCBA 5M2RA 1LW2B 3OHAA 3OL6A 1Q86T 2HLTA 1REVA 5IWAF 3HK2A 2J6UA 4CH7A 4K0KF 1N33F 2DPIA 2HKEA 2IJRA 3W63A 1VCTA 1WHXA 2IFXA 2DEIA 3E01B 4WTYA 1S9EB 1R6YA 2J9CA 3EJMA 2PEHA 1OJ4A 1LNQA 2C2ZB 1J2VA 4NLXA 1RUSA 4CWBA 1T9TA 4QW8A 4WP8A 3RG6A 2AGPA 1NK5A 2R7VA 1NK6A 1T0TV 2DNRA 3AJ2A 3M05A 3MXHP 4ZOSA 3TUZC 4LIWA 2CQHA 3OUYB 1M5KC 3I0SA 5F9LA 3EM1A 4W98A 5ETPA 4S0MA 1RT6A 4B3SF 1RTIB 2X1FA 4KHPF 1FRXA 1X4FA 4ECQA 2KFZA 3AH6A 1RWOB 1Y3KA 2E1AA 3FC9A 5M2UA 3PRVA 4JI4F 4F67A 5H9FK 4Y2MA 1M1HA 1HMVA 2HGLA 2PFDA 2RILA 4H4MB 4BWMA 1N5VA 2K06A 4IRKA 4GVBB 4W92B 1UVNA 2I9SA 3FSIA 5B7WA 1C0UB 3C14A 4QWDA 1RTHB 4Z7YA 4DV0F 4LMZA 1ZZNA 4JBCA 4DV7J 4ES2A 2VBXA 4IUFA 2BYCA 1IKYB 4Z2XA 2YH0A 4HHJA 5LMUJ 5A8WA 1T9UA 2ADCA 2DD8S 2C3OA 4KC5A 1T9VA 2KXFA 5A8WB 5HROB 1DARA 2KU7A 2FVCA 3W2VA 4CLUA 1RTZA 2DIVA 3MTKA 5H1SV 1X4HA 3NXZA 4OX8A 1D9FA 3PFEA 1FDAA 1OY8A 3D1QA 4NLTA 3UVJA 1LV5A 2IC3A 2VB6A 4LR7A 1RK8A 4UY85 1T11A 4OZJA 2AYBA 1LOUA 4K4UA 2VA3A 4DV2J 2R7SA 4FXVA 2OSRA 1P9QC 4P7TA 1EQ0A 2N4CA 4B9LA 1WC3A 3GYNA 4I7FA 2XCPA 4MMOA 1HBMB 5H9EK 2V67A 4O3QA 2LVWA 4FBTA 4DF8A 4NA1A 3GIJA 4FP9A 4M5NA 4OZ1A 3E3XA 1OS5A 2OUGA 3KLHB 4QW9A 3LP0A 4U95A 1IR1A 2DITA 2P9CA 4QIGA 1RAIB 3N5BA 3I5BA 2D3OR 1XMOJ 2GO8A 4RKUC 3W64A 5A8KB 5AE1A 2J9EA 2QA4S 4GMKA 2ZH9A 4CDIA 1XIQA 2LEPA 4JI8F 2O3DA 3N9UC 4Q45A 4HVZA 2CKWA 4NA2A 4PYAA 2NREA 3HSZA 3W3SA 3BBCA 3TA2A 9ATCB 3LH2S 4P52A 2Y0SD 2R2TA 3POTB 2PMWA 1B7YB 2DNGA 2HURA 1KC8T 1CC8A 1WF1A 1LW0A 3DRPA 4C8NA 2YKMA 3JXOA 4DCPB 2FQQB 3MWBA 4LF7F 4KFBA 3JTPA 4H4KC 3KK1A 3RAMA 3CT9A 1U1QA 2W2NP 2EKYA 3QZ8A 2LP4A 3BN7A 3R2DJ 1YDLA 3QGPA 4IYQA 2KJWA 4ZA1A 4LF7J 3OXLA 1ZTTA 1JB0C 2M7SA 3A8JA 2XGPA 2FVPA 8ATCB 4DR7F 4E8UA 4GO7X 4OJGA 2RKIB 1PAEX 4DSJA 4Z7CA 3BQ1A 1TFYA 1R0BG 2WSFC 2IDEA 1IN0A 1LFWA 2XZWA 3NMAA 2WVEA 3G8SA 2XTJP 3T5LA 2VFRA 4P2FA 1D09B 2BOAA 1NZAA 1S5ZA 1XC9A 1ZA2B 1SIWB 2UUTA 5KG1A 2JRSA 3A8EA 4J9NA 4OHWA 4JI1J 1UFLA 4DV5F 1VQKS 4UY8T 3GB0A 3KK3A 5B08A 2UVUA 1KN6A 3R7SB 4N77A 4ZVPB 2D9OA 3J7A1 4DI6A 2YX1A 3N6MA 1LW2A 1VIOA 3US5A 3SCKE 1VS3A 4Q2LA 2JEGA 3MMAA 2KG0A 1FWKA 3CD6S 1HBNB 3ILOA 3EZ5A 3MFIA 2ZC4A 4HACA 2Z2LA 1UEVA
chains in the Genus database with same CATH topology
4NEYA 3JAMU 4LFBJ 1N32J 1I94J 4LFAJ 3J80U 2UUCJ 2UUAJ 4NXMJ 4V1Ak 4PWWA 1IBMJ 3J81U 1XMQJ 4DV7J 5IT9U 1HNXJ 4KYZA 2HHHJ 4DV0J 5LMUJ 4JI7J 3IMQJ 4DR2J 4JI2J 4DR7J 4X66J 1HNWJ 4JI5J 5LMNJ 2ZM6J 1FJGJ 4JI4J 4NXNJ 4DR3J 2KL8A 4LFCJ 4KHPJ 4B3SJ 4DV2J 2UXBJ 2MTLA 4DV3J 4RJVA 2VQEJ 3T1HJ 4DR1J 2MQ8A 2UUBJ 2F4VJ 4JI8J 4DV5J 5AJ3J 4DUYJ 2UXCJ 2UU9J 1XMOJ 5IWAJ 4YY3J 4K0KJ 4JI3J 1N33J 4X62J 2KVQE 4JI0J 4HHUA 1J5EJ 1HR0J 1XNQJ 4LF5J 3R2CJ 4JI6J 4LF9J 3OTOJ 4KY3A 4LF6J 4YHHJ 5FLXU 4B3TJ 1N34J 4DV4J 3T1YJ 4B3MJ 4DR5J 3R2DJ 3D3CJ 5A2QU 4LF7J 4DR6J 4JV5J 2MEWA 4LF4J 4LF8J 4JYAJ 4NEZA 4B3RJ 4GKJJ 2UXDJ 3W1YC 1HNZJ 4OX9J 4DR4J 3J7AN 1XNRJ 1IBLJ 4JI1J 4X64J 4DV1J 3D3BJ 4GKKJ 4DV6J 5LM7E 1IBKJ 2VQFJ 4DUZJ 4AQYJ 1N36J 4X65J 5BR8J 2E5LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEY A;  3JAM U;  4LFB J;  1N32 J;  1I94 J;  4LFA J;  3J80 U;  2UUC J;  2UUA J;  4NXM J;  4V1A k;  4PWW A;  1IBM J;  3J81 U;  1XMQ J;  4DV7 J;  5IT9 U;  1HNX J;  4KYZ A;  2HHH J;  4DV0 J;  5LMU J;  4JI7 J;  3IMQ J;  4DR2 J;  4JI2 J;  4DR7 J;  4X66 J;  1HNW J;  4JI5 J;  5LMN J;  2ZM6 J;  1FJG J;  4JI4 J;  4NXN J;  4DR3 J;  2KL8 A;  4LFC J;  4KHP J;  4B3S J;  4DV2 J;  2UXB J;  2MTL A;  4DV3 J;  4RJV A;  2VQE J;  3T1H J;  4DR1 J;  2MQ8 A;  2UUB J;  2F4V J;  4JI8 J;  4DV5 J;  5AJ3 J;  4DUY J;  2UXC J;  2UU9 J;  1XMO J;  5IWA J;  4YY3 J;  4K0K J;  4JI3 J;  1N33 J;  4X62 J;  2KVQ E;  4JI0 J;  4HHU A;  1J5E J;  1HR0 J;  1XNQ J;  4LF5 J;  3R2C J;  4JI6 J;  4LF9 J;  3OTO J;  4KY3 A;  4LF6 J;  4YHH J;  5FLX U;  4B3T J;  1N34 J;  4DV4 J;  3T1Y J;  4B3M J;  4DR5 J;  3R2D J;  3D3C J;  5A2Q U;  4LF7 J;  4DR6 J;  4JV5 J;  2MEW A;  4LF4 J;  4LF8 J;  4JYA J;  4NEZ A;  4B3R J;  4GKJ J;  2UXD J;  3W1Y C;  1HNZ J;  4OX9 J;  4DR4 J;  3J7A N;  1XNR J;  1IBL J;  4JI1 J;  4X64 J;  4DV1 J;  3D3B J;  4GKK J;  4DV6 J;  5LM7 E;  1IBK J;  2VQF J;  4DUZ J;  4AQY J;  1N36 J;  4X65 J;  5BR8 J;  2E5L J; 
#chains in the Genus database with same CATH topology
 1FKP B;  2IVY A;  3UPF A;  3FBF A;  2J76 E;  1TL7 A;  4PQU A;  4LSN A;  4WFN Q;  4C3L A;  2XMV A;  3KK2 B;  3KG0 A;  4HHH A;  1R8C A;  1Q53 A;  2O01 C;  1GNK A;  2KKH A;  3IP0 A;  1ZAV A;  1X9W A;  2AMC B;  4OL8 A;  2G2Z A;  4NRU A;  2V2V A;  1RA6 A;  4DX7 A;  1BQN A;  4TYA A;  1S9G A;  2LMI A;  1VIX A;  1WHW A;  2V9W A;  2HRU A;  3PHE A;  5IT9 U;  2W4C A;  3IWX A;  3PKM A;  1BHN A;  4FF1 A;  2XBP A;  2R7W A;  1F1B B;  4DR2 J;  2L41 A;  3Q23 A;  4E0D A;  4H4K A;  4OYZ A;  1NKC A;  1IBC B;  4QJV A;  4RWW A;  4A8Q A;  4Y6I A;  2WVD A;  1H38 A;  4M1K A;  5D0R A;  2RB7 A;  1JLB B;  2DNK A;  2OD4 A;  1LXJ A;  2IRU A;  3PYD A;  1RJJ A;  3ZFV A;  3T19 A;  4EU0 A;  2HNZ A;  1S4F A;  3FCH A;  3NY0 A;  4PQU B;  4WPA A;  3VHQ A;  4LR9 A;  2CWX A;  2LQ9 A;  3H5U A;  3S7R A;  2ILZ A;  2V8V A;  3ILJ A;  4NYP A;  1H98 A;  4OZL A;  2V34 A;  5KTQ A;  2Z58 B;  3GG1 A;  4P2S A;  3WC2 A;  1NK4 A;  1DUR A;  2DY1 A;  3V81 A;  2ZKU A;  4OHX A;  2MQ8 A;  2UV8 A;  3GFH A;  3OR1 B;  3R97 A;  4LF5 F;  3RBD A;  1HKA A;  2OGU A;  4KBI A;  3I9Z A;  2BKP A;  1SBR A;  3W5Y A;  1SJF A;  2LA6 A;  2XYG B;  2A6M A;  3PV8 A;  5A8R A;  2VDI A;  2C28 A;  4DS5 A;  3K7R A;  3FZ2 A;  4X62 J;  2C2E A;  2YNH A;  3QWP A;  4OYO A;  5KFL A;  4CRJ A;  4QWA A;  3TI0 A;  2J0X A;  2B4U A;  1P9Y A;  4ZPC A;  3PO5 A;  3R2C J;  3RW6 A;  1U7L A;  4RBT A;  2APO A;  4A8X A;  2XWY A;  3ZO7 A;  3FEZ A;  4WZQ A;  3HZE A;  4USM A;  3CJK A;  1U24 A;  1WOO A;  3L4B C;  2DGW A;  3N4W A;  2NUH A;  3AOA A;  4NLQ A;  1WEZ A;  4B08 A;  1YJR A;  4ID5 B;  4LRE A;  4NZ7 A;  5DZ7 A;  4DV2 F;  3TAN A;  3UFC X;  2GO9 A;  5JMN A;  2Y1L B;  3C6T A;  3RBX A;  1FJE B;  4I7F B;  4DR3 F;  1HQE B;  2P6S A;  1LWF B;  5F8L A;  3LWM A;  4UTG A;  3BEG B;  2MY8 A;  3K5N A;  2I2Y A;  2GIR A;  2CQD A;  4FYX B;  2IVF B;  4RL1 A;  1KS2 A;  5DGA A;  4HYK A;  2LEB A;  4IQX A;  2CQ0 A;  1KQF B;  3JTN A;  1GK8 A;  1HQ2 A;  3R5C A;  4CLL A;  4ELT A;  1UL3 A;  1MML A;  1XQI A;  4DUY F;  4LF4 J;  2DR6 A;  2EXU A;  3OVS A;  3EX7 B;  2L9D A;  4DX5 A;  1AT1 B;  1RHU B;  4TY9 A;  3R27 A;  5I3U B;  3M8P B;  5BYR A;  4EWT A;  2CJK A;  4ZLN A;  2H65 B;  2F65 A;  4DR4 J;  4HEA 9;  3AOC A;  1DLO B;  1RWP B;  3CJ5 A;  3OFH A;  1X9S A;  4FS2 A;  4WKY A;  5EDW A;  3J7A N;  1FDD A;  5HVF A;  3TVY A;  3MR6 A;  3V4I A;  4QYR A;  1HHS A;  3BPD A;  3DOL A;  3VAF A;  3C15 B;  2MYF A;  1RYR A;  3BKF A;  4GKK J;  1WHV A;  1FVQ A;  1K1S A;  1S6P A;  2GAG C;  2YQ0 A;  1JLG B;  4ID5 A;  1RI7 A;  4I4B A;  3DRX A;  1TK8 A;  1MRO A;  1FES A;  3J7Z 5;  3KYL A;  3SSR A;  1CJV A;  4DBQ A;  4X65 J;  1QD1 A;  2IC3 B;  3CDW A;  3CCV S;  2XG8 A;  3M30 A;  4YOE A;  1ZM3 A;  2VJV A;  5IOL A;  5KG0 A;  2GGP A;  2MKC A;  2E5L F;  3CCJ S;  4IO9 Q;  3VF0 B;  2E5G A;  4PUO A;  2KTQ A;  5KFV A;  2EG2 A;  3VAH A;  2RRN A;  3KJQ B;  3IBC B;  4ANC A;  4ILM A;  3SIP B;  3UN3 A;  2PDA A;  1HBU A;  2DGX A;  1R89 A;  3MM9 A;  2XUL A;  3KJV A;  1FJG F;  1TQL A;  4OYI A;  2EFV A;  2MLX A;  3IXQ A;  1WI8 A;  3ICL A;  1B4S A;  2CPZ A;  2VFT A;  5KFS A;  4CTA B;  4DMZ A;  3Q22 A;  3HVT A;  3VAJ A;  1UKU A;  2N3O A;  4PXB A;  4EUV A;  5KT6 A;  4NXM J;  3TA0 A;  5AT1 B;  2V69 A;  1RWN B;  3P5B P;  4PQA A;  4Q5V A;  1RBL A;  2Z57 B;  4NLV A;  3CXC R;  4BLG A;  5DRK A;  2XZD B;  3KXD A;  4QCL A;  2JEI A;  3IR5 B;  5CHC B;  4FN5 A;  4HKQ A;  5DDO C;  5HAO A;  1RCO B;  3GLJ A;  4XPC A;  4O0N A;  1KQS R;  1Z1Z A;  1DQ9 A;  1WOP A;  2YX4 A;  4WK1 A;  3NNC A;  4WKR A;  4NXM F;  1CVJ A;  5J1E B;  2KT5 A;  5DQH A;  1UVL A;  4B9N A;  3BQ0 A;  4F3M A;  3PRB A;  5CCM A;  2XCA A;  4I68 A;  4Q0B B;  1U1P A;  5A76 A;  1FDN A;  3M2V A;  1S79 A;  1QJH A;  2FGC A;  3IRX A;  1ICE B;  2HS4 A;  1RTI A;  2CQB A;  3HSD A;  3PXG a;  4R5P A;  2XMU A;  3CCE S;  1NH8 A;  2W9B A;  4LR8 A;  1G7C B;  1NU4 A;  4O3P A;  3EDR B;  3PKY A;  2XO6 A;  4ED8 A;  3DRS B;  4PAA A;  2CZ9 A;  1XNQ F;  1CLF A;  3TZX A;  4CP5 A;  3NOG A;  1S1W B;  3AD7 C;  5HVG A;  2X1G A;  1NDC A;  3DYA A;  1G3O A;  3JQM A;  4K8R A;  2DIU A;  4C0H A;  4MYU A;  2N7C A;  3TAQ A;  4FDF A;  2VC0 A;  1FE4 A;  2BJ7 A;  2ZC3 A;  3G2X A;  2CNK B;  2DXE A;  4B02 A;  4ZVH A;  4DSF A;  1UA1 A;  5CA5 A;  2YPY A;  4XTT A;  1REV B;  3EUN A;  1AUD A;  1TMJ A;  5HSP A;  4F4Z A;  1KRP A;  4ETX A;  2B56 A;  2L48 A;  2MZJ A;  1NDL A;  1RWU A;  4ZIT A;  3KHG A;  3RRK A;  4FVC A;  1JLB A;  1S57 A;  2XNQ A;  1B0T A;  3PG9 A;  3M9M B;  2W9C B;  4ED7 A;  4LF9 J;  2LFV A;  4IFY B;  5D3G B;  1K1Q A;  5FLX Y;  4X4R A;  1N32 F;  3H2L A;  3QZ7 A;  3QID A;  1NK7 A;  3I4H X;  2DH7 A;  2V4J B;  4JP8 A;  2YPZ A;  5F0W A;  2N3L A;  1EET B;  4LBP A;  3K8W A;  5KG7 A;  1KBR A;  1LWE A;  1MMD A;  5FLX U;  2GW8 A;  4UOF A;  2LEC A;  1ZM9 A;  2Y1I A;  3TP2 A;  1FT8 A;  4CIO A;  5E5N A;  2VHG A;  3M32 B;  4B3M J;  4X4N A;  4ZCI A;  4CZC A;  4KQZ A;  5F8I A;  2C2D A;  4R0J A;  4MH8 A;  2OJ3 A;  2E9R X;  1EAR A;  1JXE A;  1NLK L;  3OFF A;  1RT3 B;  5ETQ A;  2MLZ A;  2NYH A;  2RS8 A;  5A0Y B;  5F8G A;  4M5I A;  3VGT A;  1CPZ A;  4QR2 A;  1UFW A;  1VRU B;  1Y0H A;  3PJX A;  4UQT A;  2J6S A;  1C0T A;  4WZM A;  3ADA C;  2L08 A;  2R7O A;  1K9M T;  2QYG A;  4BHQ A;  4J9K A;  2XM3 A;  4HT7 A;  1XJW B;  3MMB A;  5DLG A;  2FLL A;  4WXW A;  3DLE B;  5BXI A;  3B78 A;  2Z8Q A;  3KJN B;  4N76 A;  3CJ4 A;  3OTE A;  4D3H A;  3QQC D;  5T41 A;  1FKP A;  4X4P A;  3BO4 A;  4RW9 A;  2DGS A;  4EBE A;  1SKR A;  2CYY A;  1JLQ B;  2YWK A;  2IMW P;  2UUC F;  1PAU B;  3OV7 A;  2WK4 A;  3IA0 A;  3MGJ A;  2DPJ A;  4QIF A;  3SYZ A;  3DLE A;  5CYM B;  1V5I B;  1TEL A;  4ERD A;  3CD0 A;  1NRK A;  4PXE A;  2OPP A;  1VC6 A;  5E0O A;  2R2R A;  3C16 B;  3U27 A;  1GMU A;  2MQP A;  3PW0 A;  1VR6 A;  2E5L J;  3DLB A;  2DGT A;  1FXL A;  1XMB A;  1U0H A;  1VBY A;  5D8H B;  1DRZ A;  3CJ2 A;  2V50 A;  2R8I A;  4F4K A;  3WHI A;  1NK8 A;  1YHQ S;  4PG5 A;  2QV6 A;  3MM5 B;  2EPI A;  1VQY A;  2OPQ B;  2AV5 A;  4P10 A;  4WTO B;  1HQU A;  3MPU B;  3WDO A;  4ID8 A;  4GKK F;  2QRR A;  4G1I A;  1SKU B;  4UF4 A;  2ZH2 A;  3QO9 B;  3QJL A;  1QUV A;  2WOM A;  3G6Y A;  2C2O B;  2VL1 A;  2BW7 A;  3KDN A;  2X3G A;  1EET A;  3MD3 A;  3NBP A;  1BY9 A;  1QE1 A;  2ZD1 A;  2V4J A;  5DO2 A;  2GJ2 A;  5E33 A;  5GAG I;  2KT3 A;  3BB5 A;  5HQL A;  3EIC A;  3NAI A;  1TKZ B;  5HMW A;  3CJ3 A;  1O8B A;  3BPS P;  5J2M A;  4LF8 F;  1G6B A;  2HWI A;  3U1M A;  1TMM A;  1FKO B;  3ZTR A;  2LQ8 A;  1VQN S;  2RVJ A;  1ELO A;  2HFN A;  3IMQ J;  1L3S A;  2XLK A;  4F02 A;  2HHW A;  1YJ7 A;  5HK4 A;  1A6L A;  3J7Y U;  3BGR B;  1HNW J;  1S76 D;  3DRP B;  1F5A A;  1S0N A;  2FVS A;  5E3R A;  2DNH A;  2ALY B;  2YVS A;  4YB6 A;  2EFP A;  2FJD B;  2OPS B;  3KJF B;  2A1B A;  4MT1 A;  4LFC J;  2CUY A;  2C3M A;  4LJM A;  5EX3 A;  3PJ9 A;  2PII A;  3NCP A;  3KLF A;  2VKR A;  1S1T A;  4PR6 A;  3RJM B;  3TAR A;  3CJ0 A;  2FDN A;  2CAD A;  2YH1 A;  3A8I A;  1VJW A;  3BS9 A;  4YME A;  1YZ7 A;  1R0A B;  2ZZN A;  2IPO B;  2K1R B;  3DNC A;  4EO8 A;  2AX1 A;  1VK3 A;  3C14 B;  3R5D A;  5LOQ A;  2AX0 A;  4ZS6 A;  2NSB A;  3K0J A;  1HBO B;  4IKA A;  4F2S A;  4K4Z A;  1RLC L;  4M5D B;  1NO8 A;  3MEE A;  5DM7 Q;  1KVI A;  3VAL A;  4Y65 A;  1KLN A;  2WW4 A;  4MKB A;  5A8K A;  4IG0 B;  4JB8 B;  5MAO A;  3UW1 A;  2LLZ A;  1TKX B;  2JLE A;  1IBL F;  4IG0 A;  2FPH X;  4ZPB A;  4YY3 J;  3C6U B;  1UPP A;  1F5C A;  2XWX A;  2XLI A;  2CAJ A;  1GXL A;  3P3D A;  2YNI B;  5BJR A;  1HWI A;  1S6U A;  4NYO A;  1ZYQ A;  2UXD F;  4DCJ B;  1NJY A;  1N0U A;  3Q89 A;  4OJ1 A;  3W8G A;  4JYA F;  1HPZ A;  2KFN A;  1Y00 A;  4OI3 A;  3N79 A;  3OTC A;  3OL9 A;  3R5J B;  2HEK A;  3WX4 A;  4OZ5 A;  1K73 T;  2M5Y A;  3CF5 Q;  2AQ4 A;  2LXF A;  5L46 A;  5FJ4 A;  2BE2 B;  1DTT B;  1G1X A;  5HO4 A;  2H3E B;  3D68 A;  1NK0 A;  4ECY A;  4C8K A;  2CQ4 A;  5F8M A;  3FVY A;  4X2B A;  2X7I A;  1GFW B;  1FRH A;  5CZV A;  5DG7 A;  2B3T B;  3LUY A;  1JJC B;  3HPO A;  2UZA A;  2C3U A;  4B3R J;  3L7P A;  2V8P A;  2UXD J;  2C22 A;  1RTH A;  2J9D E;  2RNE A;  8RUC A;  5HBM A;  3E8O A;  3ZZO A;  1FVS A;  1EX8 A;  1V3Z A;  2QO3 A;  3LW5 C;  3MR7 A;  4M5H A;  2K1R A;  4UUW A;  3UN5 A;  6AT1 B;  3G8T A;  4QYZ J;  3DRR A;  2E5H A;  2HIY A;  3HFZ B;  1RHM B;  3CME S;  4RUB A;  3L3C A;  2BXJ A;  4CLF A;  3R7B B;  4LBI A;  1GEH A;  1FE0 A;  4X4S A;  5K8P A;  4F7V A;  1KDN A;  3UN2 A;  4G1Q B;  2W2M P;  2UV8 G;  2HS0 A;  5F8N A;  2QFI A;  5U47 A;  2M4M A;  2UXB F;  3MDF A;  4RUC A;  4DL0 C;  1S97 A;  1ZH5 A;  2NQP A;  4YR0 A;  1DBD A;  1NAQ A;  3H0P A;  5DG8 A;  4U7C A;  3CNQ P;  4LFC F;  3HT3 A;  2BAC A;  3SMZ A;  5DDQ C;  4AQY F;  1BWV A;  4P75 A;  3KLV A;  2WB1 D;  4ED1 A;  2YWE A;  3U02 A;  2X1A A;  2EWH A;  1GH8 A;  3M6U A;  4PG4 A;  4A8S A;  2ALZ A;  4UST A;  2D7S A;  3L95 X;  5KFI A;  2PO4 A;  5KFT A;  1O0P A;  1WF2 A;  3D6T B;  4L76 A;  4PWU A;  3OW2 R;  3G86 A;  1PJ7 A;  4X66 F;  5EX0 A;  2ADB A;  3EGW B;  3PX4 A;  6FD1 A;  3NCQ A;  3KLG B;  3THV A;  2VPW B;  2OMO A;  2QX0 A;  4C11 A;  2WCX A;  1T05 B;  1H0H B;  4B9T A;  2BBE A;  1JLQ A;  5E3Q A;  1MSW D;  1EHW A;  3MPY A;  3RZA A;  5F9N A;  1HYS B;  3GE9 A;  2P9E A;  2M88 A;  2Y1R I;  3Q8S B;  3CC7 S;  2V8D A;  2ZJQ Q;  3LF0 A;  4KV8 B;  1PJ5 A;  4X66 J;  2HWH A;  2V6A A;  1LEO A;  1HWU A;  2E9T A;  1WC6 A;  1KWM A;  1AZS A;  1WC4 A;  3SSS A;  1C0T B;  1T3O A;  5DLF A;  3KDO A;  3ISZ A;  5IS2 A;  2GJF A;  1SXL A;  2AJ0 A;  2HPU A;  4USK A;  2ZH1 A;  2OLW A;  4FF3 A;  2VFU A;  3FFI A;  4USW A;  5D78 A;  4DFP A;  2KXN B;  1E6Y A;  1RE1 B;  1YRU A;  5JXS A;  5KOW A;  4WFA Q;  2X1B A;  4DL4 A;  3V81 B;  2Y9H A;  4C0O C;  5CYQ B;  3ISN C;  4LSL A;  1JJ2 R;  2VBY A;  1QAI A;  2IIH A;  1U1M A;  4D3G A;  5K9F A;  4DG1 A;  3KLG A;  1XBW A;  2IBK A;  4DQR A;  4DPW A;  2V9K A;  4N41 A;  4JI8 J;  4UZC A;  4KGX B;  1TAQ A;  4WP9 A;  3PO4 A;  4F8R A;  4U9R A;  3QRP A;  2XYP B;  3MUM P;  3B54 A;  4K0K J;  1F3F A;  5I3P A;  2GQC A;  4OYP A;  3U1N A;  2OHD A;  5BYS A;  5THW A;  2V4Q A;  2HVE A;  2UUW A;  3DOM A;  5SUH A;  3G4S S;  4JI0 J;  2HG4 A;  3DRS A;  3W2W B;  1WSV A;  2MLY A;  3T1H F;  2HHT A;  1UCN A;  2RUG A;  3GYG A;  1T02 A;  3DM2 A;  5IM0 B;  4XAK A;  3ZTQ A;  1MN9 A;  4LT6 A;  4WK3 A;  4HTI A;  4C11 B;  4QPX A;  2RF2 A;  4NLY A;  2HQC A;  4ED0 A;  1T05 A;  3C19 A;  2ZWO A;  2KYX A;  3NGD A;  4PYD A;  3RU0 A;  2E7W A;  3KLI A;  3BJY A;  4O4G B;  2BR0 A;  2GQQ A;  1BQM B;  1FI4 A;  2ZFH A;  3T1Y J;  1SJ4 P;  1JJH A;  4YEA A;  5B0F A;  3HHD A;  5K8O A;  5AE3 A;  3KK2 A;  2QIF A;  3OL7 A;  3I9V 9;  3MCS A;  3FCV A;  1RT4 A;  3LP2 B;  4R8U A;  4EI2 A;  1PIE A;  2HQ3 A;  3QNW B;  5KT5 A;  5LMU F;  3N6N A;  3TO8 A;  4IDK A;  1CUL B;  4UUX A;  1DTT A;  4KH0 B;  4DFM A;  4LIR A;  2Y3Y A;  3DC2 A;  1UJ6 A;  4P2X A;  4OX9 J;  1Q79 A;  2JFD A;  4ZPT R;  1Q1K A;  3CCW A;  2AJ4 A;  3R1H A;  1UJ4 A;  1YZ6 A;  2B4V A;  2YKN B;  1WOR A;  2W01 A;  4WCE Q;  1HPZ B;  2KN4 A;  4PXC A;  4JOU A;  4U7U K;  1DTQ A;  4P71 A;  1VRT B;  3K5L A;  3RTV A;  4OJH A;  3UQS A;  1RT1 A;  3UDC A;  4G1Q A;  2RDI A;  3R5A A;  1W26 A;  2VQF J;  4MK7 A;  2R7X A;  2ACM A;  1YKW A;  2MSS A;  4WFY A;  1R8B A;  1S4E A;  3QGI A;  5E3P A;  4EEY A;  1NM2 A;  4C98 A;  4ZIV A;  3T3F A;  1YJ9 S;  2DK2 A;  3QT7 A;  2KJV A;  4ECR A;  4PZV A;  4R0E A;  2F3J A;  3W9I A;  1NHU A;  3Q2S C;  3MUR P;  2C2M B;  3BSN A;  3D28 A;  1URR A;  2WBR A;  1S72 S;  2YNI A;  4ECU A;  2RE1 A;  4FNH A;  5ETS A;  4EBD A;  1JLG A;  4G6V B;  5IV4 A;  4UZB A;  1NB7 A;  1R8H A;  3D54 A;  1GT8 A;  1MMN A;  3GCX P;  2X51 A;  4HH0 A;  4QR0 A;  4CLP A;  4TQS A;  1RHR B;  1N32 J;  2A10 A;  3OQ2 A;  5L1L A;  3NMR A;  1M5H A;  3KMS A;  1X60 A;  2IAJ A;  3LAN A;  1VQ8 S;  1DLO A;  1FRJ A;  1K44 A;  2CPI A;  5F8J A;  4EMD A;  2KFY A;  1RAJ A;  3W5Z A;  4B3O B;  1WAC A;  1IKX A;  4TY8 A;  5K20 B;  1PJ6 A;  4ZLP A;  2HFO A;  1U8S A;  4FYV B;  1FJC A;  1Y3J A;  3IR6 B;  2MMY A;  2GV1 A;  3LAL A;  4AD6 A;  4GC6 A;  5KFX A;  2EBE A;  2EG1 A;  3MM7 B;  2VPY B;  4ZP6 A;  4ZDN A;  4AND A;  1HFE L;  4JI7 J;  1WNE A;  1H2T Z;  2M2B A;  1VQO S;  3BYR A;  2YBV A;  3IS9 A;  3A3O B;  4ZP8 A;  2ZVS A;  4DQQ A;  5HL7 Q;  5KG5 A;  2CJQ A;  1WKL A;  3LP1 A;  1OSD A;  5HMZ A;  1CUL A;  1U48 A;  1QSY A;  1U09 A;  4RUA A;  4NLW A;  1VHF A;  4GO5 X;  3ULH A;  2H5J B;  2VG6 B;  3CMA S;  2IM1 A;  5A6P A;  3FKB A;  1RT4 B;  3LP2 A;  3HHN B;  1CQM A;  2CRL A;  4ILL A;  5KFQ A;  5I3Q A;  1UVM A;  1CS4 B;  4MFB A;  2V5H G;  2EEY A;  3GFZ A;  4I6A A;  2HQD A;  2OSQ A;  3ET6 B;  3QO9 A;  4J37 A;  4MYT A;  5ETV A;  3A13 A;  1JLF A;  1SC4 B;  2I1R A;  3K17 A;  1VRT A;  5G4D A;  2D3Z A;  4CI0 B;  4DPO A;  4LF9 F;  3SCI E;  2HQF A;  3L7O A;  4E98 A;  3GIM A;  2DGQ A;  3PR5 B;  2J6T A;  3BSC A;  2YKN A;  1UA0 A;  1X4A A;  4MIA A;  2HHV A;  1J5E F;  2W2O P;  2WOM B;  1WSR A;  2LDY A;  4NPO A;  3RUB L;  4AXI A;  3N0V A;  3M8P A;  1RBO B;  2LKZ A;  3V6D A;  4QQB A;  3I0S B;  3MUV P;  3DI6 B;  4RNN A;  3M2R A;  3G8Q A;  2J0W A;  1RKJ A;  1RA7 A;  2N82 B;  5CQG A;  4CO3 A;  3W2W A;  3I32 A;  3CDA A;  4IR1 A;  1VIS A;  4J9U E;  2C3Y A;  2I8E A;  3OT9 A;  3DLG B;  4QPT A;  4URQ U;  1HNZ F;  3EVM A;  1IJF B;  3CCL S;  1FK9 B;  2PA8 D;  3UDV A;  3IBW A;  3CCT A;  3TUJ C;  4K4T A;  2O67 A;  4AL6 A;  1V5V A;  2F8M A;  1VQ6 S;  2J7U A;  3BGR A;  4F2R A;  1KVK A;  1WHY A;  3KLI B;  5GMK a;  2ZUA A;  1I51 B;  4ILR A;  3GFY A;  3Q8U A;  3G96 A;  3EPI A;  1QAJ A;  4DL5 A;  1VBK A;  2OPR B;  3I6P A;  2R9L A;  4NXN F;  2IMO A;  4F0K A;  2F9D A;  3D3C J;  2A6O A;  2H4W B;  1QTM A;  2CQG A;  1U8W A;  3HJV A;  2GHV C;  5D77 A;  4JUZ A;  2J8S A;  4OI0 A;  4ZJO A;  1O6X A;  2QL5 B;  2G1D A;  3HHE A;  3QT8 A;  2JC1 A;  4USU A;  1BD6 A;  1GX6 A;  2DGU A;  3C66 A;  4M8L A;  2XMM A;  1C4A A;  4DPU A;  1NKB A;  1SC6 A;  3W60 A;  5IZH A;  4O3S A;  4Y28 C;  4JI0 F;  3PY8 A;  4PG8 A;  1BGX T;  1UJ5 A;  1X8D A;  2E5I A;  3K8V A;  4QIW D;  4UOH A;  1IBM F;  2P9G A;  3KUG A;  4K4Y A;  2PI4 A;  3Q83 A;  4IFY A;  3W62 A;  3CCM S;  3BV8 A;  3IGN A;  5B0C A;  2OTL S;  5D3G A;  1DJ0 A;  4ENO A;  3OJS A;  1FRK A;  3I0R B;  4A8Y A;  4TU9 A;  4CO4 A;  3AY0 A;  1SI9 A;  3PAC A;  2R7R A;  5LM7 E;  4OJ3 A;  1IBK J;  1HA1 A;  4NAS A;  3AD9 C;  4DWI A;  1TL7 B;  2JWN A;  3L9Z A;  4DLG A;  3RB3 A;  2UUB F;  3T6B A;  1YWX A;  4NLG A;  2CA9 A;  2PA3 A;  4GRS A;  1CQN A;  1VYA A;  4NCG B;  4C8L A;  4KO0 B;  1UWB A;  4M5G A;  2U1A A;  5F41 A;  2ATC B;  1TZ0 A;  2VPZ B;  4RW9 B;  4NCG A;  5KFJ A;  4IFV B;  2CPJ A;  1X0P A;  3EMT A;  3GPA A;  4DEZ A;  3Q8Y A;  3O5T B;  4FBU A;  4KPY A;  2NR0 A;  1Y11 A;  4DZ6 A;  2OD6 A;  4LFB J;  4O44 A;  4I0W A;  3R8Y A;  3SQG A;  3MUT P;  1RTD A;  3DLH A;  3DU6 A;  4NOH A;  1I94 J;  2BMB A;  2BKO A;  3GON A;  1NJZ A;  2QE5 A;  3A8K A;  3HHK A;  4G65 A;  5DDP C;  1LXN A;  2HRY A;  3DYA B;  1EIY B;  2GZO A;  1JXV A;  4JI2 F;  1C1C A;  4KPC A;  3MPD A;  3H7H B;  5BYQ A;  4RUH A;  4JV0 A;  4ZLL A;  1B99 A;  5EWG A;  3J7Z T;  5EWE A;  2B9E A;  1RZM A;  1FXR A;  3DMJ B;  1ZBT A;  3FCW A;  1L5U A;  1VOM A;  3HD2 A;  3V4M A;  1JLA A;  2ZBR A;  2M8D B;  2CXE A;  2C2N A;  4DHV A;  5GAH I;  3G6V A;  2B43 A;  4CO2 A;  1KLM A;  5DZ6 A;  4FF2 A;  3AJ1 A;  4AT1 B;  3H8Y A;  1NB2 A;  1Q4R A;  7AT1 B;  5ETM A;  2ZM6 J;  3GQC A;  2BM0 A;  2XYH B;  3WQP A;  2XS2 A;  3T1Y F;  2W2P P;  1RB0 A;  3GIL A;  5L1K A;  1RYS A;  1M5P C;  4B3T F;  2B0G A;  3N28 A;  2WON A;  5DQG A;  4USJ C;  1Q0N A;  5E2Q A;  5C42 B;  3NGR A;  1MN7 A;  1FNX H;  1Q8L A;  1OY9 A;  1YBU A;  2GA7 A;  3ITH A;  1UP1 A;  1SKS A;  2QFJ A;  4Z37 A;  1TK5 A;  5BR8 F;  1FFS B;  4B17 A;  3HMJ G;  1YIT S;  4ELV A;  1I6J A;  2K7K A;  2JLF A;  3T1H J;  4DR1 J;  2HLU A;  1QAX A;  5KFF A;  3DLG A;  4IOA Q;  3AXK A;  4Q43 A;  2UP1 A;  4AL7 A;  3MEC A;  2XS7 A;  2B5J A;  3CO9 A;  1HI1 A;  2HK3 A;  3M2V B;  2YQ3 A;  3NG8 A;  2H4Y B;  4RR5 A;  1M5S A;  4OLO A;  4BWJ A;  2ZH3 A;  4K2J A;  5L9N A;  4Y00 A;  4R5P B;  4CLZ A;  1Q81 T;  3SSQ A;  1CC7 A;  5C25 B;  3KTQ A;  4DR4 F;  2VFS A;  1MU2 B;  2ASL A;  1MRO B;  4N7T A;  4ZMM A;  1X4G A;  1ZS6 A;  5KFB A;  4AXJ A;  3O3L A;  1ZET A;  2IJF A;  1HR0 J;  3C6U A;  5KT2 A;  3UCZ P;  3EVO A;  1H3D A;  1NXI A;  4LF5 J;  2PFF B;  4KRW A;  4B3R F;  2OML A;  3NKY A;  5KFZ A;  4K4X A;  3TAP A;  3DXB A;  1X5P A;  1CJV B;  4LF4 F;  1T95 A;  3PM9 A;  4QIV A;  2WB4 A;  4NWB A;  2PN6 A;  1CS4 A;  2J8A A;  4KY3 A;  2ZH8 A;  3AAW B;  1T8E A;  4IOC Q;  1TKT A;  1LK7 A;  2VG6 A;  4LUB A;  4LBH A;  3H5S A;  2Z2M A;  2XHC A;  4LVO P;  1N34 F;  5HI7 A;  4ZHR A;  3FEY B;  3VV2 B;  2FVR A;  4I2Q A;  3PYF A;  3M8Q A;  4EGL A;  3HX9 A;  4QBU A;  5ADZ A;  2NZC A;  4CM0 A;  4KHR A;  1NDK A;  1T3N A;  4FXW A;  4ZVS B;  2Q66 A;  2PEB A;  4ECV A;  2G4B A;  1LWX A;  3HLU A;  4IH5 A;  4LRF A;  3EDQ B;  2RDJ A;  2CVE A;  3T6J A;  1Y5N B;  1X4E A;  3HCX A;  4TY8 B;  2KM8 B;  4R25 A;  3ZTS A;  1YVF A;  1UZH A;  1ZA1 B;  1WF0 A;  2OEJ A;  4X62 F;  2XGQ A;  3HFV A;  3UR3 C;  4YY3 F;  4NX9 A;  4C8M A;  1FEH A;  4HDG A;  3LAK A;  1XNR J;  2YKP A;  4IG3 B;  5AJ3 F;  5GAE I;  1ZAX A;  2VJU A;  2AF6 A;  5C24 A;  3BDP A;  4F4W A;  1NKE A;  1FTC A;  2H5I B;  3M6V A;  3RR7 A;  3D0G E;  3V2U C;  4OLP A;  4LRC A;  3HFK A;  4ZVG A;  4DF4 A;  2K3K A;  2HZA A;  2JLG A;  1N36 J;  4RNO A;  2GNK A;  5HQ8 A;  2GML A;  5BR8 J;  3RB0 A;  2DO0 A;  3MFH A;  3K59 A;  2CDR B;  3HKZ D;  3EYZ A;  1U1L A;  2OO4 A;  1L3U A;  2WBM A;  2NXU A;  3NWR A;  5HJX A;  1EQM A;  1S1T B;  2MZS A;  1CJT A;  1UEK A;  2F5G A;  4ZP7 A;  4ZPW R;  2K8G A;  5LJ5 Y;  1N36 F;  3CC2 S;  1AA1 B;  1YJV A;  2V4R A;  2ILY A;  5LSL A;  2MKS A;  2OPS A;  3Q8P B;  3AQO A;  2I6W A;  1PIL A;  3NGT A;  4OYB A;  1TR0 A;  4O3N A;  3UI3 A;  2A2D A;  3OUY A;  1IKY A;  4OIX A;  1VMB A;  1N56 A;  4WFB Q;  4X64 F;  2JJ4 D;  3KNG A;  2K7J A;  1WEY A;  2QZ8 A;  4HL9 A;  1XNR F;  5D0H A;  2CQ1 A;  4KSE B;  4L75 A;  3ZZR A;  5B0B A;  2NYI A;  3ZNJ 1;  3BO3 A;  1F3V A;  3DGP B;  4DR2 F;  1VBZ A;  4RNH A;  1WEX A;  3UCU P;  3JB9 k;  2G0J A;  4NLO A;  4DV7 F;  3SI8 A;  2W7O A;  1HQU B;  2MZT A;  5K14 B;  3QYY A;  4R8U B;  2HNZ B;  1YBT A;  1N6Q A;  4DPT A;  1VLY A;  1FER A;  2OKQ A;  1TVR A;  3NBP B;  4RO0 A;  2EBG A;  4KGZ B;  2DXD A;  1NK9 A;  2AEM A;  1Q8B A;  3V5R A;  4N5S A;  2PMH A;  4I1T A;  2B9X A;  1N88 A;  4ZCK A;  2CPD A;  2D3O 1;  4AYB D;  1RP5 A;  3I5C A;  2ZKT A;  2QA4 G;  3CWJ A;  4NCA A;  4LFB F;  4MAK A;  1ZPV A;  2Q1L A;  4P6Q A;  5A0Y A;  5IV3 A;  3DLL Q;  3CJS A;  1LWC B;  1RT5 B;  2HGN A;  3K5P A;  5KFY A;  1Q16 B;  3R3T A;  3UDL A;  3RRG A;  2XI3 A;  3MI7 X;  2EFQ A;  5G0R A;  4F04 B;  5A8R B;  2MGZ B;  3GJQ B;  4X4Q A;  1S0V A;  4JI6 F;  2AJF E;  3CCU S;  4F50 A;  2XLJ A;  1RTD B;  3AB4 B;  4Q7A A;  2ASY A;  3TOQ A;  2GVD B;  5C42 A;  1HR0 F;  1RT2 B;  3FNN A;  4PAB A;  1YIJ S;  3MMB B;  4EYH B;  2OP5 A;  2FJW A;  4PCQ A;  3CJQ A;  1UWA A;  2JSX A;  1NPK A;  4FNI A;  4XPE A;  2Y8Y A;  3OL8 A;  5FD1 A;  1RAG B;  2R8H A;  4JI3 J;  4UQG A;  2KYZ A;  4DN0 A;  3UD5 A;  3TEH B;  3VAK A;  1KLM B;  2JEF A;  3UNY A;  1U02 A;  1TTH B;  1XN9 A;  4ED4 A;  2HNY B;  2RU9 A;  4F36 A;  4U7U D;  1K0V A;  5H9E J;  2QN6 B;  4DR1 F;  3PZP A;  1S6Q B;  2D3U A;  2C3P A;  2VQE F;  2H48 B;  2CNO B;  2B9Y A;  3DHX A;  4DV3 F;  1QVF R;  5DET A;  3AXM A;  1RXO B;  2Q6B A;  2CDQ A;  2VV5 A;  5KFM A;  2VUG A;  2YWW A;  2WSC C;  3QJP A;  3QMQ A;  1VK8 A;  2B8Q A;  1RAD B;  3IGV A;  1X4D A;  4I67 A;  3W65 A;  1REG X;  1V3R A;  3ZC4 A;  4ES1 A;  2JL9 A;  2M8H A;  4DR5 F;  1N34 J;  1J5O B;  4B3T J;  1WD6 A;  1VGY A;  3CIM A;  4DUT A;  3OJU A;  1TL3 B;  1FX2 A;  2EVZ A;  3MEK A;  4MTP A;  4ANE A;  4XIU A;  4C8O A;  4W4M A;  2MQM A;  3CCS S;  2EI5 A;  2ZEJ A;  4HLB A;  5D4P A;  1U25 A;  2EFG A;  3UR0 A;  5CYJ A;  2VD3 A;  2CPF A;  3LGN A;  4LF8 J;  4JYA J;  5ETT A;  3HVA A;  2HIQ A;  1RAE B;  4P72 A;  3LWL A;  1HNX F;  1SV5 B;  1NND A;  1FHT A;  1FRL A;  2BEF A;  2QMW A;  1YGY A;  4B9V A;  1H7X A;  2ZBI A;  1XMO F;  4CO5 A;  3J81 Y;  1IBL J;  3M2U B;  5L39 A;  2ZOG A;  1M0S A;  1OIA A;  3H5Y A;  4RW8 A;  4WF9 Q;  4KFB B;  2D9P A;  1JLE A;  2BE9 B;  5D6G A;  3NL0 A;  3THP A;  1U6B A;  3GV8 B;  1XEZ A;  1VQP S;  2GVZ A;  2ZNZ A;  1JKH B;  1C1B B;  3A3N B;  3AFG A;  3NP5 A;  1HW9 A;  1LW0 B;  2AZ3 A;  1LFP A;  4X84 A;  5IQQ A;  4C6A A;  1F5B A;  1Q8I A;  3M2R B;  2FGO A;  4LSZ B;  1PCA A;  4CLW A;  1UW4 A;  1JNZ B;  5DGB A;  3KLE A;  4A8F A;  5JVH Q;  3DDK A;  4CNY A;  1NJX A;  3DLK B;  1GAO A;  3ET6 A;  3EZU A;  4MIB A;  3H5X A;  2GAH C;  3BBF A;  3JAM U;  4U67 Q;  4ZCM A;  1RAH B;  4A8W A;  3RBZ A;  4K59 A;  1IWA A;  1ZTW A;  2YQ1 A;  1HHQ A;  4CLY A;  2W25 A;  2VA2 A;  4DUZ F;  1SQG A;  2WVB A;  2AKW B;  1F60 B;  3MEG B;  3ZZP A;  4Q8E A;  3M30 B;  4DV1 F;  3CPW R;  4RW6 B;  1FJ7 A;  3KG1 A;  2CJY B;  2E9Z A;  2PC6 A;  3IO1 A;  3HDS A;  2OEK A;  2CVI A;  4V1A k;  5J2N B;  3NLC A;  3H25 A;  3QJJ A;  2RQK A;  3VCD A;  1P8G A;  5CXT A;  1D0E A;  3MTJ A;  1IJE B;  2MKK A;  2OFG X;  1XMQ J;  2W1B A;  3QLH B;  2MKI A;  1B7F A;  3FQL A;  3DXS X;  4RBV A;  2HHH J;  1VQ9 S;  2HYI B;  4H4O B;  3G6X A;  3SZ2 A;  1DFD A;  2V8H A;  1SL0 A;  2GCF A;  1U6F A;  2W4D A;  4JI2 J;  2B7C B;  2B9W A;  2DIS A;  4L3K A;  4WE1 A;  2VG7 B;  4M5J A;  1VI7 A;  4DDF A;  1V6H A;  4JI5 J;  1W2B R;  2VPX B;  3PJW A;  2DHA A;  3PW4 A;  2GMJ A;  1X0F A;  4CLT A;  4JI4 J;  3N01 A;  4B3M F;  2Y1J A;  2ZZM A;  3OVB A;  2BZ2 A;  1U1K A;  1N5S A;  2N4D A;  1KQK A;  1NEE A;  4KHP J;  1SPB P;  4X4O A;  1ZZF A;  4IH7 A;  4LRD A;  3I56 S;  3V6J A;  1FWP A;  1VLO A;  1RU2 A;  5C24 B;  1TKX A;  2DB1 A;  2YNG B;  3O44 A;  3JSM A;  1APS A;  4IR9 A;  1P1L A;  1C0U A;  1JWW A;  3OPK A;  2FJX A;  2FZK B;  2FTR A;  2PGC A;  3DCA A;  3TX0 A;  2RHS B;  4NLS A;  2QLW A;  3CUL A;  2NZ4 A;  3D66 A;  3DOL B;  1P6T A;  1R0A A;  3CB4 A;  3PNI A;  3IM9 A;  2ZVI A;  3G9C A;  4OZ2 A;  2UXC J;  3GFX A;  4RW7 A;  3T5K A;  2YKA A;  3OSN A;  1XER A;  2XMA A;  5HRO A;  2GVZ B;  1YJW S;  1UFK A;  3S1T A;  2MB0 B;  2DNN A;  1IM6 A;  2VG7 A;  4HHU A;  1KHW A;  3FBB A;  3OFG A;  4N47 A;  1B3T A;  2MKH A;  2XMW A;  3D1O A;  1WC0 A;  2UVV A;  4RX6 A;  4RNM A;  2RS2 A;  3A3P B;  4ITS A;  1Y4Z B;  2GIF A;  3K5M A;  1JKH A;  2EK6 A;  3C6T B;  3CCQ S;  4WBF A;  5KT3 A;  2C2R A;  5GAD U;  3KHR A;  4LF6 J;  3K2Y A;  4KKO B;  3TW0 A;  4L72 B;  1WTB A;  2O1P A;  2ZHB A;  4DV4 J;  1HD0 A;  2CG8 A;  3KKF A;  3DU5 A;  1H2V Z;  4O23 A;  3EPG A;  4OHY A;  2ZM6 F;  4ZLJ A;  1BQX A;  4PG6 A;  5LJ3 Y;  4WYW A;  1PYO B;  3SDE B;  5DJB A;  2R2U A;  3UE2 A;  1S1X A;  4ZN1 A;  3UD4 P;  3WBZ A;  2HHH F;  5C5J A;  4ECS A;  1YG0 A;  1S59 A;  2QG9 B;  3SXL A;  1C1B A;  2BM1 A;  1RT3 A;  4K2X A;  1N8R T;  3M6X A;  1W7W A;  2MPU A;  1RTJ B;  1CSJ A;  1SJ1 A;  2ZWP A;  3O2I A;  1SQF A;  3B4D A;  4O0I A;  2OFH X;  4F4Y A;  2QMU B;  2AD9 A;  2G1H A;  5J2P A;  2WZ1 A;  3PEH A;  1WWH A;  2DNM A;  3K89 A;  1NSQ A;  2MY7 A;  4DV1 J;  1HW8 A;  2IM3 A;  3NS5 A;  5L8R C;  5HP1 A;  2DR8 A;  3B82 A;  2NS1 B;  2MKY A;  2V68 A;  4DUZ J;  3TZZ A;  1PSD A;  5KFA A;  2GHP A;  1FWL A;  3ZZT A;  4HTJ A;  1WTF A;  2Z2Y B;  4A48 A;  4TLQ A;  4ZIW A;  3Q8V A;  2RML A;  2AGO A;  4KAI A;  3CJ8 A;  3P4U B;  3P6Y C;  1X31 C;  3I82 A;  3SQG B;  3WIU A;  2P6T A;  2CPY A;  2QC3 A;  3JS9 A;  4OYM A;  3ENA A;  4RNF A;  2ZE2 A;  2DVI A;  2PSZ A;  4C8Y A;  2LQ5 A;  1Y5L B;  1R31 A;  1LKZ A;  3J80 U;  2UUC J;  2MST A;  3R7N B;  2DCL A;  2VAS A;  3M9O B;  1TL1 A;  2DRB A;  2DR9 A;  5F3T A;  3VVU A;  5SZT A;  2Z4P A;  3PDN A;  2KI2 A;  2WRM A;  3HP6 A;  2YXL A;  3JAM Y;  2DH9 A;  2RF2 B;  1C4C A;  1SCJ B;  4I2P A;  4L73 A;  4OX7 A;  5ITH A;  4OYX A;  2W2Q P;  3VQT A;  3MR2 A;  5KFK A;  1DY3 A;  2ASD A;  2Z2Z A;  1HI8 A;  4K5S A;  2XQC A;  3RRH A;  2QGF B;  4K4V A;  2CG4 A;  1TVR B;  3GTY X;  3PHT A;  5F0U A;  1GTE A;  1SKW A;  2R8G A;  3KOA A;  4F25 A;  3OLB A;  1UVI A;  1N5Q A;  4C4W A;  3NGK A;  3DOK B;  1NZ8 A;  2DNP A;  3R5G A;  1XR6 A;  1IM4 A;  4Q0B A;  4N8O A;  3VAG A;  4WII A;  2AGQ A;  1ZM2 A;  2CZV C;  1IR2 A;  3TA1 A;  2VOP A;  1S7H A;  2O5D A;  2Y0B B;  4ZPA A;  1JX4 A;  3MMA B;  5C2C A;  5DDR C;  3NS7 B;  3SDE A;  1NHK L;  5HN0 A;  1KP6 A;  4CNZ A;  4B9S A;  4K50 A;  4OHV A;  1R6V A;  1ULR A;  4OYW A;  2LYV A;  3VAI A;  1ITP A;  4ICL B;  3IAM 9;  5IC6 B;  5LSR A;  2OPR A;  3VZH A;  2VQE J;  1WJ9 A;  1B70 B;  3KG4 A;  2ZUG A;  3GSD A;  2C2K B;  2KM8 C;  1RTJ A;  2IYG A;  4DV6 F;  2CIM A;  5HMX A;  4DFK A;  3TZY A;  1ROF A;  2HW3 A;  1PO6 A;  1YK9 A;  2ZH7 A;  5A2Q Y;  3G87 A;  4NLD A;  4JI1 F;  4LF1 A;  5KG2 A;  4AL5 A;  4IRC A;  1KON A;  3BGF A;  4P7V A;  3V6D B;  2KHD A;  2BQ3 A;  4WJB A;  4OI4 A;  4GC7 A;  2GHW A;  2NLW A;  3W9J A;  1YJT A;  2Q43 A;  3SBM A;  2V2Q A;  2MQL A;  1XNQ J;  4DCO B;  1W2I A;  5K14 A;  2IJN A;  5JUM A;  1RSC A;  1G2E A;  1R8P A;  4EZ6 A;  2F63 A;  3LTO A;  3IM8 A;  3MOZ A;  3NOC A;  5KFE A;  2OH2 A;  2MHN A;  5ETN A;  5IFM A;  1DQA A;  3CTR A;  2BJ9 A;  3JSR A;  3QAU A;  4TNO A;  4P74 A;  5KFG A;  2UVW A;  4Y2K A;  3FUY A;  2ROG A;  3VQS A;  4ATN A;  4IRD A;  4FF4 A;  4DPY A;  1Q78 A;  4NE9 C;  2YKM B;  1YI2 S;  2RU3 A;  3TVZ A;  1JLF B;  1FRM A;  4DLE A;  4K5R A;  3TQ1 A;  1PGZ A;  4OV1 A;  4ZVE A;  3BH6 B;  1RHK B;  3POT A;  4YR2 A;  3BDE A;  2QL9 B;  2LA4 A;  5D4O A;  4JI5 F;  4DR6 J;  1N5Y A;  3KHH A;  2Z0G A;  2L9W A;  2VF3 A;  2DNZ A;  1ZOT A;  2IA6 A;  1CJT B;  3HVT B;  2PT0 A;  4F3Q A;  3Q0A A;  4JI7 F;  4NLR A;  2MQQ A;  2BJ8 A;  2BJ3 A;  1SUQ A;  1JLC B;  3M6W A;  3BO2 A;  1CG2 A;  3KJV B;  4C8Z A;  1N5T A;  3NGU A;  1EJ7 L;  1XMQ F;  1HNV A;  1LK5 A;  1S49 A;  2B4P A;  3ENW A;  2E1M C;  4AFF A;  3J7Y I;  4HI1 A;  1N5Y B;  4U8Y A;  4H4O A;  3QAT A;  3H2V E;  4RW7 B;  2XNR A;  1QAY A;  1S1V A;  3RAQ A;  1YRX A;  1Q7L B;  2YNG A;  4X64 J;  2C1E B;  2QLF B;  2L3M A;  3IR7 B;  3BRE A;  4FYY B;  4IG3 A;  4TXS A;  1T9X A;  2HMI A;  4M5D A;  4MFB B;  3LO3 A;  1K8A T;  4NMX A;  3PX0 A;  1NBE B;  3CJK B;  1JJ4 A;  1FD2 A;  3HF5 A;  3G82 A;  2R7Q A;  4I56 A;  2YX7 A;  1T03 A;  1Z2Z A;  1X7V A;  2CQI A;  2DHS A;  3MM8 A;  1H73 A;  3PYE A;  4Q2M A;  5K8N A;  3I55 S;  3Q8Q B;  2FVQ A;  2R2S A;  1F0X A;  2EC2 A;  4MK9 A;  3TZW A;  4ED3 A;  3IFE A;  3SFU A;  3CED A;  3TAM B;  3QSY B;  2JEJ A;  1MU2 A;  4CYU B;  1S6P B;  2JH3 A;  3HJF A;  1WEL A;  2AJ1 A;  5HAN A;  1SUQ B;  3EGZ A;  1JXL A;  2XMJ A;  4DQP A;  4HR2 A;  2B5J B;  4BC7 A;  2VOD A;  4ZJL A;  3FSY A;  1D9D A;  2Z30 B;  3BM7 A;  1VBX A;  1URN A;  3O6Q A;  2W8K A;  1QVG R;  5I3U A;  4DSL A;  1I1G A;  4LF2 A;  3IC1 A;  2RUS A;  2CFX A;  3CJT A;  3D0I E;  3QSI A;  5HAT A;  5KG6 A;  1JIH A;  4IDK B;  3M9N B;  4ECZ A;  1HNX J;  2BW2 A;  5I4M A;  3AA8 A;  2MXY A;  4DS4 A;  4DR7 J;  1QE1 B;  1O51 A;  2HBZ B;  2ZD1 B;  4FKX A;  3FEX B;  1U4B A;  1JLA B;  3HVW A;  3IG1 B;  3ILL A;  1OSC A;  1S6O A;  1PBU A;  1JNR B;  4NZ6 A;  4IH6 A;  4ZKA A;  3H4B A;  1T7P A;  3DLK A;  3RB6 A;  2QEX S;  2FHJ D;  5F3Z A;  4JV2 A;  1PKU A;  2CNN B;  1HL6 A;  2E7X A;  2KRB A;  1WUU A;  3LQV A;  5I42 A;  3OSP A;  3X1L B;  2VG5 B;  4RW4 A;  2OPQ A;  2FHO B;  2HZV A;  4CM2 A;  3MEE B;  1XTZ A;  4KT0 C;  2IM0 A;  1PC5 A;  2LU1 A;  5GVQ A;  1YRT A;  4C3K A;  5E41 A;  1AFJ A;  2UXB J;  1TL3 A;  1U0H B;  3SCL E;  1VJQ A;  2HVZ A;  2AYE A;  3D67 A;  1BQM A;  4ZCL A;  3CO0 P;  3D2W A;  3E01 A;  5ETK A;  1KOO A;  2ROE A;  1FO1 A;  2KO1 A;  4M5L A;  4OYA A;  1TP7 A;  2XSF A;  3ISN D;  3TRG A;  4ZVF A;  3OLA A;  1B0P A;  3D7S B;  3DOM B;  1PYS B;  1HIY A;  3W66 A;  2KB2 A;  3QRR A;  2WON B;  2HHU A;  3BR9 A;  4DV5 J;  2MKJ A;  3OFE A;  3QIP B;  4DSK A;  6FDR A;  1S9E A;  4UOG A;  3HUL A;  2JZ5 A;  5AJ3 J;  2R3V A;  2CPH A;  1KFD A;  3Q8R B;  1S0M A;  2FLP A;  4NYZ A;  5GAG U;  4ECT A;  3QBC A;  3PW7 A;  2ZE2 B;  4YDX A;  2MZQ A;  2BUN A;  1YQH A;  4ZP9 A;  2QA2 A;  4JV5 J;  3KHL A;  3T41 A;  1S7I A;  2LDI A;  3DN9 A;  4E2F B;  4C9D A;  2JX2 A;  4EZ9 A;  3DOK A;  1E6Y B;  1OMS A;  3OXG A;  1KEK A;  4WU2 A;  2XY7 A;  4O3O A;  1D1U A;  1SH0 A;  5B0A A;  1YJN S;  5KAK A;  1OPI A;  2PE8 A;  3H42 A;  1XR5 A;  2AYG A;  1MWZ A;  3M8W A;  3H59 A;  3GJS B;  3DKD A;  3CGI A;  4ZVR B;  2B7B B;  1IKV B;  1RAF B;  1J5O A;  3KNA A;  1U2F A;  1J27 A;  2ZDP A;  4YHH F;  2ZBP A;  2IBO A;  1HNW F;  3NNA A;  3MCO A;  3B6B A;  3QGH A;  1S9F A;  1TV6 A;  3I5A A;  2IHR 1;  4FKY A;  4O3R A;  2HFU A;  3A4T A;  5K8M A;  4V19 X;  4YB7 A;  4PKD B;  5J1P A;  4GKJ J;  2RKI A;  1NSA A;  4ZJQ A;  3QFH A;  3HZG A;  5KFR A;  1S0O A;  4Q44 A;  3GII A;  1ARO P;  3DDI A;  1OQ3 A;  3ONQ A;  2RD5 C;  2DRA A;  1CJK B;  1FCA A;  2D74 B;  1FTR A;  4J7C A;  1RKI A;  2XSJ B;  3GMG A;  4HT5 A;  3OTB A;  4OHZ A;  2F4F A;  2M3D A;  1HYS A;  1S48 A;  2NSC A;  3MPW A;  1GXT A;  4HAC B;  4KGK A;  4WXO A;  2MGZ A;  4WP3 A;  3D3B J;  3GR0 A;  1FNO A;  4KGM A;  2DXF A;  4BC9 A;  4DV6 J;  3UO0 A;  4PPD A;  2O66 A;  5ETR A;  1T9Y A;  3BYP A;  5KFD A;  5E3A A;  3MOJ B;  1RT7 B;  2J0S D;  3M8Y A;  1CJU A;  1PC4 A;  3NEK A;  2HBY B;  1WG4 A;  3NCR A;  4J9P A;  1NSK L;  1HWL A;  1I3O B;  2OTJ S;  3MR3 A;  2RAQ A;  4LQ9 A;  4MJK A;  4I64 A;  4M5M A;  3SCJ E;  2GQ2 A;  3M7V A;  1R43 A;  3KMQ A;  1R0C B;  4Y0F A;  2XI2 A;  1IBK F;  3I4P A;  3I87 A;  4OZ0 A;  2VIC A;  1X4C A;  1QY7 A;  3CUN A;  2HGM A;  4ZPV R;  3RBE A;  2LCW A;  1HWJ A;  3S8S A;  5J1N A;  2DO4 A;  3SEO A;  1S1X B;  1SL1 A;  3MAH A;  5HJY A;  2HHP A;  3M1V A;  1CEZ A;  4ECW A;  1RWK B;  1IBM J;  4DQS A;  1K47 A;  2DGO A;  1KSP A;  3DRR B;  4OFZ A;  1VHI A;  1IKW A;  5KT4 A;  1UAW A;  2L9N A;  5I42 B;  1OY6 A;  1KHV A;  2FHM A;  4KYZ A;  3VGV A;  5HMY A;  4U8V A;  4J9S A;  2HSE B;  4WFX A;  5J1E A;  4DV0 J;  3AD8 C;  2P8I A;  1I5O B;  3L09 A;  2XZT B;  3UDE A;  3DFE A;  2M52 A;  5D0E A;  4DJB A;  1KR4 A;  1RWX B;  3MAQ A;  3SV3 A;  3P5T L;  5ETO A;  1HAR A;  2JHE A;  1I94 F;  3KFW X;  4LFA F;  2AWZ A;  2YTC A;  4LQ3 A;  4NXN J;  5L1J A;  1UZD A;  1O5J A;  4KKO A;  3K58 A;  1SIZ A;  1M1K T;  4CYU A;  4M95 A;  1V9O A;  2DRD A;  1HLW A;  5L38 A;  4I2Q B;  4DN9 A;  4B3S J;  4N8N A;  3V6H A;  1BXN A;  2XMK A;  2HVI A;  3FK4 A;  2CQC A;  5FDL B;  2LXU A;  5T14 A;  1U2C A;  3MM9 B;  5D4L A;  2AJ2 A;  2E44 A;  1AYE A;  3H90 A;  1BWE A;  1XWL A;  2ERR A;  2UUB J;  4B3O A;  1L3K A;  3CJR A;  2HQI A;  3MPV A;  1CBK A;  2XY5 A;  3GJR B;  1ZPW X;  5DQI A;  2I0X A;  3GIR A;  4H4M A;  7FD1 A;  2A0F B;  3H98 A;  2ZIT A;  3QT6 A;  3S01 A;  5LXY A;  3T5J A;  2HHQ A;  4TYB A;  1HNI A;  2MQN A;  3M8Z A;  1VQM S;  2GX8 A;  2YWG A;  5DG9 A;  1WI6 A;  4J9O A;  1NJI T;  2ZBQ A;  2G2O A;  3IG1 A;  3LGH A;  1EP4 A;  3IS9 B;  1J5E J;  3THT A;  1QUP A;  3TX8 A;  4XK8 C;  3QGG A;  5T7L B;  4A8O A;  4XO0 A;  3ZZZ A;  1L3V A;  3JTO A;  5KFW A;  3I96 A;  2ZZT A;  3UVJ B;  2LEA A;  4CQ1 A;  1EKR A;  3V4I B;  1U2R A;  1A0O B;  3QRQ A;  1FX4 A;  2V0N A;  1KQG B;  1TK0 A;  2M70 A;  4OZ3 A;  4CH0 S;  3CCZ A;  3R6L B;  3NGS A;  1U49 A;  2HND B;  3T9Z A;  4DPX A;  1RWV B;  3MM7 A;  2WW8 A;  2QT7 A;  1SH2 A;  4ER8 A;  5HLF A;  1FFW B;  2FYX A;  2HWT A;  3PEJ A;  3QLH A;  4KB7 A;  1D3W A;  3SFG A;  2QA1 A;  2KH9 A;  4J90 A;  2D69 A;  3D0H E;  3LPE A;  3FRY A;  1Y10 A;  3N6L A;  2ZHA A;  3HD1 A;  2ZDO A;  1F9E B;  3BN4 A;  3UCG A;  3AOD A;  1X5O A;  2JC0 A;  2IAJ B;  2RQC A;  1RIS A;  4KE5 A;  1LWF A;  4GVL A;  1QSS A;  1U26 A;  2R7U A;  3MEG A;  3DDN A;  2NPF A;  4RBU A;  3W1Y C;  1S99 A;  2YNH B;  3C8Y A;  1RWW B;  2QLB B;  4W90 B;  2XO7 A;  1UET A;  2CNL B;  3DGV A;  3RGI A;  3DM2 B;  1RT1 B;  3H20 A;  2KXH A;  2HMI B;  2I38 A;  1H72 C;  4L3N A;  4IQM A;  2DTJ A;  3MD1 A;  1VQL S;  3CSK A;  4TVA B;  3Q86 A;  2YKO A;  1P1T A;  4KTQ A;  1VQ7 S;  2EC0 A;  1XR7 A;  4NLU A;  4ZVU B;  5E3C A;  1NPR A;  2XY6 A;  2RIJ A;  2IVM A;  1JLE B;  2E1P A;  3JSY A;  4NRT A;  2BKN A;  4QZV B;  2XS5 A;  4PWD A;  3LOU A;  3TR5 A;  2YY3 A;  3FMB A;  4UT4 A;  2P5V A;  2W7P A;  5CH7 B;  4KH1 B;  2W8L A;  4YFU A;  3M2U A;  4DSE A;  1HHT P;  3TUI C;  1M90 T;  2NCK L;  5B09 A;  4O44 B;  3VVT A;  4TU8 A;  1Z4U A;  2CJA A;  4YDD B;  1U47 A;  3R6G B;  4DXL A;  1RWM B;  3P96 A;  2VQF F;  3T9N A;  3AJD A;  2NXC A;  1UWB B;  3DMJ A;  3NRB A;  1SL2 A;  2MDA A;  2UUA J;  1GX5 A;  2XSJ A;  2FB0 A;  5KFO A;  5KT7 A;  4QWE A;  2FJV A;  2FLO A;  4DG1 B;  1MWQ A;  2R7T A;  3CIZ A;  1FXD A;  8AT1 B;  1VC5 A;  3I0R A;  2IDL A;  2JNJ A;  3MF5 A;  3J81 U;  2POK A;  4A8M P;  1S12 A;  3LGM A;  1RAB B;  2JVO A;  3FQK A;  3PIO Q;  4K4W A;  1WG5 A;  2FZC B;  3X3U A;  4ECX A;  2V8G A;  2HQG A;  3IWL A;  5AXM A;  2AU0 A;  3RW7 A;  1C1C B;  1BUX A;  2CPE A;  3GP9 A;  4M63 A;  4AE5 A;  4Y2A A;  1TU0 B;  2ABY A;  4DZD A;  5IM0 A;  3PX6 A;  2Q3P A;  3ZTO A;  3JYT A;  1BLU A;  5LMN J;  4UOC A;  2CQP A;  3CD5 A;  1S6Q A;  1FJG J;  1N0V C;  4B9U A;  2WVF A;  2OPP B;  5KG3 A;  4ZVO B;  1B64 A;  1GXU A;  3HO1 A;  1N6Q B;  1WKJ A;  1NME B;  4KHM A;  4J9V A;  4XDC A;  5J2Q B;  1TL1 B;  3FGV A;  4ZVT B;  1F9H A;  5AE2 A;  1HD1 A;  4QOT A;  4OMF G;  3HHL A;  1HBN A;  1RDR A;  2HBR B;  1U1O A;  4OI2 A;  2A3J A;  3DGP A;  1AB8 A;  3D1H A;  1WG1 A;  2EW9 A;  2QMX A;  2XHW A;  2QLJ B;  3MMJ A;  5KFP A;  1IXK A;  3OR2 B;  2RRA A;  2AW0 A;  2W7A A;  3RAX A;  5HVH A;  2XC9 A;  2V94 A;  5G0R B;  2DHX A;  2BAN A;  4KIA A;  3M4X A;  1VRU A;  3HSJ A;  2FC8 A;  3K57 A;  1D9A A;  4MKV A;  1FNM A;  1VFJ A;  2A2C A;  2GVD A;  2F4V F;  4C2M A;  4J9R A;  3QAE A;  3F0N A;  1RBA A;  2JDJ A;  3SV4 A;  2NUU G;  4I6W A;  2QYC A;  4ZK7 M;  3L7U A;  4J5O A;  3MCN A;  2HBQ B;  3W61 A;  3HM9 A;  2BQR A;  3TJ9 A;  5IT9 Y;  1LWC A;  1RT5 A;  2QSF A;  4YQW A;  2RQM A;  2QLX A;  4YHH J;  3DRY A;  2YWF A;  4ZVQ B;  5EGY A;  3H4D A;  2AP6 A;  1SJ3 P;  1M5V C;  1ACM B;  3HXM A;  1VDH A;  2VG5 A;  4LVN P;  4RW4 B;  2OAU A;  2W9B B;  3VZI A;  2ZJR Q;  2W9A A;  4CH1 A;  3Q24 A;  2DR5 A;  4DR5 J;  4G1P A;  5DM6 Q;  2CWK A;  2FZG B;  1N4L A;  4L74 A;  4EFA C;  1WDT A;  3O1L A;  1RQ0 A;  4LSN B;  3EZO A;  4NI2 B;  4XDD A;  2DNO A;  5LXR A;  3OTO F;  3UD3 P;  3IAS 9;  3MAA B;  4NA3 A;  2DH8 A;  3JQK A;  1Q95 G;  3QT5 A;  3VR1 A;  5CD4 H;  3BSA A;  3CDE A;  5GAH U;  3QIP A;  4MK8 A;  4C97 A;  4DX8 H;  4ED2 A;  3GWC A;  4TQR A;  2F7V A;  1WDD A;  2WTF A;  4WU3 A;  3MED B;  3PW5 A;  1X9M A;  2DNQ A;  5A6W A;  3CMQ A;  3KK3 B;  2KHC A;  1FEE A;  1ZM4 A;  3JQJ A;  1E6V B;  4X4V A;  4TU7 A;  3EXY A;  5J2P B;  5T7L A;  1H6K X;  5ETL A;  5IXU A;  3ETO A;  2Q6C A;  1OWX A;  3IRX B;  4AQY J;  1QM9 A;  2EK1 A;  1VQ4 S;  1S1U B;  2E29 A;  4DU7 A;  4BDP A;  3UNG C;  1A7G E;  2DT9 A;  1H7W A;  3JSM B;  2BE7 D;  3GV7 B;  4UW2 A;  1NH7 A;  3D6M B;  3ELH A;  1X5S A;  3G82 B;  2V63 A;  3SQO P;  4J9Q A;  2HFZ A;  4DL6 A;  2BQU A;  3FSX A;  1EP4 B;  4QYZ K;  2B6A A;  3PRD A;  4A4J A;  4ETZ A;  1SJR A;  5EUH A;  3F73 A;  5FII A;  3MMC A;  1KNZ A;  3VGU A;  4HI2 A;  1HBM A;  3JSB A;  4FPI A;  1T94 A;  1T03 B;  2FUG 9;  1TL4 A;  2BE2 A;  3P49 B;  2AT1 B;  3S6E A;  3MEC B;  3W5X A;  1FKA F;  4J9M A;  1OYD A;  3GU0 A;  4KR0 B;  1WOS A;  3U7J A;  3J81 j;  1HBO A;  2HND A;  1RHJ B;  2B4O A;  3EXC X;  4PWW A;  4WE1 B;  3ZXW A;  4CO1 A;  2EFN A;  5KFN A;  3E51 A;  3GIK A;  4OX9 F;  1FFG B;  2BAB A;  1QSL A;  2WVC A;  2E7V A;  1R3N A;  4P2M A;  4ZHR B;  1OPZ A;  4WWS A;  2HRT A;  9RUB A;  3D4J A;  3EGN A;  5HLF B;  4H54 A;  2BRK A;  1L3T A;  3F56 A;  3HVR A;  3Q2T C;  1R7I A;  4GKJ F;  3ENV A;  1GMW D;  3CW2 C;  3IBF B;  2VKZ G;  4J91 A;  4ZN3 A;  3BR8 A;  1SVD A;  1EKS A;  3ENQ A;  5J2N A;  1FKO A;  4OX6 A;  1U1N A;  3FRZ A;  3OBI A;  3TNV A;  4DL3 A;  1KD1 T;  5AXL A;  3ZZU A;  2H1Y A;  4N56 A;  2BJD A;  4PUO B;  1VQ5 S;  2IRY A;  2J9D A;  1IKW B;  2AEJ A;  2RHQ B;  4DQI A;  3KWM A;  3TYT A;  2DY9 A;  5LL6 d;  4YUD A;  1TKT B;  4DR3 J;  1QLN A;  4NL5 A;  3KLH A;  1H74 A;  2MHE A;  2JFK A;  2Z56 B;  5GME A;  2IY5 B;  1U1R A;  4USH A;  2XB2 D;  1HNI B;  4RW6 A;  1BMQ B;  1XK8 A;  1YLX A;  1HQE A;  4DV3 J;  4RU9 A;  1Y5I B;  1Q8K A;  2OEL A;  4YP3 A;  3I31 A;  3P8B B;  3MED A;  5K5M A;  2CJB A;  4EBC A;  1Q7Y T;  1ZAW A;  3MHY A;  2MJU A;  2K2P A;  4Y34 A;  2BJ1 A;  3BGL A;  4JI3 F;  1E6V A;  5KG4 A;  4U6P A;  3C16 A;  4J9L A;  4BS2 A;  2LU2 A;  4K7Q A;  3HHL C;  3R1L A;  2K3I A;  3W2V B;  2MQO A;  4BCA A;  4MKY A;  4CO0 A;  2VZ9 A;  2IM2 A;  3PTW A;  1IR0 A;  3MZI A;  4LRA A;  4YS2 A;  2KG1 A;  4EYI B;  3UWT A;  4QIE A;  2PI5 A;  1Y7P A;  3AT1 B;  3BZQ A;  2VIH A;  4JI6 J;  1UVK A;  4IO1 A;  2FY8 A;  3WC0 A;  1T9W A;  2JVR A;  1YSJ A;  4TN2 A;  1RT7 A;  3OTO J;  2CQ3 A;  1YX2 A;  4FYD A;  1S10 A;  1PBA A;  2FJE B;  3GSI A;  2DHH A;  4RWX A;  1IUJ A;  4DR6 F;  1N54 B;  1DAX A;  3WIV A;  1PG5 B;  5IQ6 A;  5CD4 A;  2F40 A;  1TKZ A;  4DFJ A;  2E1C A;  4O4G A;  2RDD A;  3PIP Q;  4PPZ A;  5CAB A;  4CCH A;  2AIR B;  1NDP A;  3OD2 A;  3VWS A;  3GYX B;  3EE3 A;  2XMT A;  4YN3 B;  3T1A A;  4OZN A;  2I5J A;  2G13 A;  3BKT A;  3DLJ A;  2U2F A;  4QU6 A;  4ALZ A;  1RGV A;  2BAN B;  1TL5 A;  3M32 A;  5D0G A;  4FS1 A;  1AZS B;  2ZOM A;  3OVA A;  1A9N B;  4MIW A;  2G2Y A;  1F2H A;  4USV A;  3M8R A;  5IT4 A;  2M0G B;  3MCM A;  5CYM A;  5EHH A;  1M5O C;  2FHK A;  2A18 A;  2J5A A;  4DX6 A;  4F3O A;  2H9Z A;  5E7O B;  1MW7 A;  4IFV A;  2W9C A;  4RW8 B;  5MLC V;  2DGV A;  3BGO P;  3F41 A;  3EVW A;  3HHL B;  2LQB A;  3W7B A;  1AFI A;  2E66 A;  1FF2 A;  3QFW A;  5CYQ A;  1AXQ A;  5D15 A;  4YB5 A;  5KFC A;  3GV5 B;  5EN1 A;  3IN5 A;  2H54 B;  1UTA A;  3A12 A;  1MNE A;  1CJK A;  2BX6 A;  3IWN C;  1U0S A;  3BKU A;  2FHJ A;  4NLP A;  3TVK A;  4FYW B;  2MZ1 A;  2COL A;  1KOH A;  4A8K A;  4JV1 A;  3CDU A;  2W24 A;  4OV6 A;  1HWK A;  3BGU A;  4NEY A;  4WYL A;  3TQE A;  3ZTP A;  3PFO A;  3PCO B;  2PD1 A;  5CZX A;  1TV6 B;  3AA9 A;  1RT2 A;  4FZV A;  5LSO A;  4AUK A;  2J7W A;  4NML A;  2IYI A;  4BBY A;  2QL7 B;  3CVK A;  3OXF A;  2ZH6 A;  2QTW A;  2ZOF A;  5CCL A;  3MR5 A;  2IRX A;  5L9X A;  5LMN F;  4PWD B;  4F0M A;  3DHW C;  1WC1 A;  4QU7 A;  1S9G B;  3KK1 B;  4YR3 A;  1HI0 P;  4P9S A;  4KV8 A;  2GJI A;  2NPI A;  3H2U B;  3WZ0 A;  3F44 A;  2MJN A;  4F4X A;  1X5T A;  3FBE A;  3PYG A;  2Q79 A;  1V3S A;  1JQG A;  2KVI A;  3HT0 A;  5C2G A;  1RLD A;  2VBZ A;  1G4C A;  1SC3 B;  5HQM A;  2HNY A;  1GMV A;  2R42 A;  3KUH A;  1X4B A;  3ZZY A;  3J80 Y;  3VAM A;  1BC6 A;  4PRF A;  2B8P A;  2QSW A;  3CE8 A;  4JV5 F;  2RH3 A;  4WFZ A;  3FJ2 A;  4IOB A;  5AXK A;  1KVJ A;  1JMT A;  3BBB A;  2CJ9 A;  3D5M A;  3W8P A;  1RCX B;  1FK9 A;  1SB6 A;  2G9O A;  2RQ4 A;  1DHM A;  1EZZ B;  3FMW A;  3CD7 A;  3NAH A;  2KL8 A;  4LRB A;  1GQE A;  1S1W A;  1KTV A;  2M9K A;  4OQJ A;  2F9J A;  2KDO A;  2AZ1 A;  2FD2 A;  4PXD A;  2ZBC A;  4A46 A;  5RUB A;  1DZ5 A;  2Y8W A;  4CTA A;  4Q8F A;  2VU5 A;  4RPF A;  2VC1 A;  5IT0 A;  1MWY A;  3DI6 A;  1Q5V A;  1WKK A;  4F4A A;  3T5H A;  1HBU B;  1IKX B;  4CLK A;  2ZNY A;  3K5O A;  4EK2 A;  2J7K A;  4TLR A;  4F0H A;  2BA9 A;  2FC9 A;  2DKO B;  2W4P A;  3MM6 B;  3CCR S;  5LT5 A;  2F4V J;  4RLE A;  2F1F A;  1TUG B;  2GGP B;  1AUS L;  2BOP A;  2VFV A;  2VOO A;  4ED5 A;  1R8A A;  3MM8 B;  4WIQ A;  2FIU A;  4C48 A;  1EB0 A;  1JK9 B;  2KZM A;  5IWA J;  1N33 J;  4USI A;  3N5F A;  5B0D A;  2B6A B;  2KVQ E;  2DHG A;  5L1I A;  1UEU A;  5HBM B;  2X3D A;  2HAF A;  1DQ8 A;  2VBW A;  4NZ0 A;  3PW2 A;  3C15 A;  2HVD A;  3TWZ A;  2AYM A;  5B0G A;  4ES3 A;  1R27 B;  2LXI A;  2HHS A;  1YJU A;  2NXE A;  2DBB A;  2DNY A;  3LP0 B;  3LP1 B;  1S1U A;  1SH3 A;  3GJT B;  2ASJ A;  3PR4 A;  2N7Y A;  3C2P A;  1LQ9 A;  2GMH A;  2ZHO A;  3BF4 A;  1F6T A;  4ED6 A;  1TKD A;  5KFU A;  1UMJ A;  1W25 A;  1FD8 A;  4CT8 A;  1OO0 B;  4ZPD A;  1TUW A;  4HDH A;  2WHO A;  5KFH A;  1TUV A;  5A2Q U;  3KLF B;  1KFS A;  2J0Q D;  3TUP A;  1OYE A;  1HNV B;  1RAO A;  2CZ4 A;  4FVM A;  3ZZ0 A;  1MG7 A;  2MEW A;  2R4F A;  3TAM A;  4PEO A;  3V6K A;  4ELU A;  1GMW A;  4DL2 A;  2RRB A;  1SJQ A;  1K0T A;  4QR1 A;  4URG A;  2OIH A;  4NEZ A;  2BVZ A;  3KUE A;  3HKW A;  2OEM A;  1NCL A;  4O4R A;  3ETM A;  5AXN A;  1HNZ J;  1IQZ A;  3FBC A;  4OI1 A;  1PYT A;  1TAU A;  4GVB A;  4KGV B;  1Z2L A;  3HHL D;  4DU8 A;  4F26 A;  5EWF A;  1NJW A;  5C25 A;  4PG7 A;  2UU9 F;  3LAM A;  2GS8 A;  2YNF A;  4CT9 A;  1S77 D;  3EWG A;  2FLN A;  5FDL A;  2DCU B;  1U6Z A;  2B51 A;  2VDH A;  2YNF B;  1UPM B;  1VQS A;  3MMC B;  2RJZ A;  5H9F J;  2NXN A;  2R8K A;  1UVJ A;  2EFO A;  4OI6 A;  1SQE A;  3R9L A;  2P2C B;  2FJB B;  5M2P A;  2CPX A;  2DNL A;  1RAA B;  3VGS A;  2V2K A;  2FJA B;  1DTQ B;  2F8H A;  3NNH A;  1S1V B;  1UW9 A;  2HZC A;  3H40 A;  3ITH B;  2HS3 A;  3CDB A;  5CAA A;  1RHQ B;  1QTN B;  3C46 A;  1RT6 B;  3P45 B;  3TJ8 A;  3M8Q B;  4C3M A;  1QDU B;  1JLC A;  1H2U X;  4LFA J;  3KLE B;  1NUE A;  1Y9O A;  4ICL A;  3G71 S;  4YB1 P;  1CJU B;  2HFS A;  3OR2 A;  4MKA A;  3GG0 A;  3O8W A;  1RAC B;  2KRR A;  3MAA A;  7FDR A;  1U45 A;  5JJB A;  4U96 A;  3CC4 S;  2C42 A;  2HVH A;  2DYA A;  4I6Y A;  3A1Y G;  4FPR A;  4DOZ A;  4C7Q A;  1Q82 T;  1SV5 A;  3QWU A;  2BDP A;  5J2M B;  1FDB A;  4Y2C A;  3B4M A;  2RT3 A;  3EGV A;  1HMV B;  3OTD A;  2F8E X;  1FRI A;  5GAD I;  5IC4 B;  4NI2 A;  3FFI B;  2IA0 A;  2UUA F;  3M1V B;  4M5K A;  4CLS A;  2V2Z A;  4P73 A;  4EO6 A;  3IRW P;  3GZ7 A;  1YTY A;  3PVX A;  2DR7 A;  2SXL A;  1GTH A;  1KTQ A;  2ACY A;  3NWG A;  5C7P A;  3D6H B;  4A47 A;  4X4T A;  3MM5 A;  4C0B A;  1N48 A;  3LPY A;  3MM6 A;  2KZZ A;  1VRQ C;  3AOB A;  2CJX B;  5B0E A;  3RYL A;  2E1R A;  1IKV A;  1P27 B;  2QJ3 A;  3B8H A;  1D8Z A;  3ILI A;  2ZH4 A;  1D8Y A;  3RR8 A;  3GR1 A;  2MTL A;  4LF6 F;  2HFV A;  2VON A;  2G0I A;  2CQ2 A;  4X65 F;  2LQJ A;  4KJI A;  2AJQ A;  1LWE B;  4RJV A;  1OQ6 A;  4M94 A;  1B0V A;  2XEX A;  3BH7 B;  4I2P B;  2EKN A;  2D41 A;  2GFF A;  1MLA A;  5F8H A;  3BSO A;  4X4U A;  3NS6 A;  1VC0 A;  3OR1 A;  2OI2 A;  3FDS A;  3BQ2 A;  3VTI A;  3RB4 A;  4Y3C A;  3R5B A;  3QPI A;  3U1L A;  2H5E A;  4LSL B;  4RZR A;  4DUY J;  3AB2 B;  4KO0 A;  2UU9 J;  5JVG Q;  2UXC F;  4B9M A;  2MZR A;  1YBA A;  2HAI A;  2RSQ A;  1BE4 A;  1AW0 A;  2R8J A;  3HSG A;  1M1G A;  2H51 B;  1RU1 A;  2ATL A;  2FY1 A;  1NPP A;  3AQP A;  1NHV A;  4V19 J;  2HK2 A;  4Y2I A;  4G3I A;  3W9H A;  3JYT B;  1EAY C;  3D6F B;  1Q5Y A;  2D1C A;  5D4N A;  3AHP A;  2AEF A;  2PMZ D;  5J2Q A;  3C3L A;  1KKH A;  3LA0 A;  3TEG A;  1BQN B;  1WC5 A;  3GCW P;  4QWB A;  2ZH5 A;  2ZJP Q;  2YKQ A;  2DJW A;  5HP1 B;  2UVR A;  4K4S A;  2GIQ A;  4FXD A;  2GC8 A;  1F9F A;  2AHO B;  2ROP A;  3E2E A;  4HH1 A;  2DEJ A;  5DS7 A;  4DV4 F;  1N52 B;  3M8S A;  3G6E S;  2G0C A;  2VH7 A;  2I5J B;  1SC1 B;  1NSP A;  2BV3 A;  4TKT A;  4DSI A;  2WSE C;  2JOQ A;  1IWG A;  2KT2 A;  5GMD A;  1FA0 A;  2BRL A;  4L6V 3;  3WX8 A;  4DL7 A;  4RU2 A;  1IQT A;  1C2P A;  2NXJ A;  2E5J A;  3ZNU A;  1F2G A;  1TFW A;  4URS A;  3FZB A;  4I69 A;  1IVZ A;  3TJA A;  2YWH A;  3D9B A;  3HI9 A;  5KOX A;  3OHB A;  4QWC A;  2WAQ D;  5GAE U;  2BJE A;  2HHX A;  4NCB A;  5M2R A;  1LW2 B;  3OHA A;  3OL6 A;  1Q86 T;  2HLT A;  1REV A;  5IWA F;  3HK2 A;  2J6U A;  4CH7 A;  4K0K F;  1N33 F;  2DPI A;  2HKE A;  2IJR A;  3W63 A;  1VCT A;  1WHX A;  2IFX A;  2DEI A;  3E01 B;  4WTY A;  1S9E B;  1R6Y A;  2J9C A;  3EJM A;  2PEH A;  1OJ4 A;  1LNQ A;  2C2Z B;  1J2V A;  4NLX A;  1RUS A;  4CWB A;  1T9T A;  4QW8 A;  4WP8 A;  3RG6 A;  2AGP A;  1NK5 A;  2R7V A;  1NK6 A;  1T0T V;  2DNR A;  3AJ2 A;  3M05 A;  3MXH P;  4ZOS A;  3TUZ C;  4LIW A;  2CQH A;  3OUY B;  1M5K C;  3I0S A;  5F9L A;  3EM1 A;  4W98 A;  5ETP A;  4S0M A;  1RT6 A;  4B3S F;  1RTI B;  2X1F A;  4KHP F;  1FRX A;  1X4F A;  4ECQ A;  2KFZ A;  3AH6 A;  1RWO B;  1Y3K A;  2E1A A;  3FC9 A;  5M2U A;  3PRV A;  4JI4 F;  4F67 A;  5H9F K;  4Y2M A;  1M1H A;  1HMV A;  2HGL A;  2PFD A;  2RIL A;  4H4M B;  4BWM A;  1N5V A;  2K06 A;  4IRK A;  4GVB B;  4W92 B;  1UVN A;  2I9S A;  3FSI A;  5B7W A;  1C0U B;  3C14 A;  4QWD A;  1RTH B;  4Z7Y A;  4DV0 F;  4LMZ A;  1ZZN A;  4JBC A;  4DV7 J;  4ES2 A;  2VBX A;  4IUF A;  2BYC A;  1IKY B;  4Z2X A;  2YH0 A;  4HHJ A;  5LMU J;  5A8W A;  1T9U A;  2ADC A;  2DD8 S;  2C3O A;  4KC5 A;  1T9V A;  2KXF A;  5A8W B;  5HRO B;  1DAR A;  2KU7 A;  2FVC A;  3W2V A;  4CLU A;  1RTZ A;  2DIV A;  3MTK A;  5H1S V;  1X4H A;  3NXZ A;  4OX8 A;  1D9F A;  3PFE A;  1FDA A;  1OY8 A;  3D1Q A;  4NLT A;  3UVJ A;  1LV5 A;  2IC3 A;  2VB6 A;  4LR7 A;  1RK8 A;  4UY8 5;  1T11 A;  4OZJ A;  2AYB A;  1LOU A;  4K4U A;  2VA3 A;  4DV2 J;  2R7S A;  4FXV A;  2OSR A;  1P9Q C;  4P7T A;  1EQ0 A;  2N4C A;  4B9L A;  1WC3 A;  3GYN A;  4I7F A;  2XCP A;  4MMO A;  1HBM B;  5H9E K;  2V67 A;  4O3Q A;  2LVW A;  4FBT A;  4DF8 A;  4NA1 A;  3GIJ A;  4FP9 A;  4M5N A;  4OZ1 A;  3E3X A;  1OS5 A;  2OUG A;  3KLH B;  4QW9 A;  3LP0 A;  4U95 A;  1IR1 A;  2DIT A;  2P9C A;  4QIG A;  1RAI B;  3N5B A;  3I5B A;  2D3O R;  1XMO J;  2GO8 A;  4RKU C;  3W64 A;  5A8K B;  5AE1 A;  2J9E A;  2QA4 S;  4GMK A;  2ZH9 A;  4CDI A;  1XIQ A;  2LEP A;  4JI8 F;  2O3D A;  3N9U C;  4Q45 A;  4HVZ A;  2CKW A;  4NA2 A;  4PYA A;  2NRE A;  3HSZ A;  3W3S A;  3BBC A;  3TA2 A;  9ATC B;  3LH2 S;  4P52 A;  2Y0S D;  2R2T A;  3POT B;  2PMW A;  1B7Y B;  2DNG A;  2HUR A;  1KC8 T;  1CC8 A;  1WF1 A;  1LW0 A;  3DRP A;  4C8N A;  2YKM A;  3JXO A;  4DCP B;  2FQQ B;  3MWB A;  4LF7 F;  4KFB A;  3JTP A;  4H4K C;  3KK1 A;  3RAM A;  3CT9 A;  1U1Q A;  2W2N P;  2EKY A;  3QZ8 A;  2LP4 A;  3BN7 A;  3R2D J;  1YDL A;  3QGP A;  4IYQ A;  2KJW A;  4ZA1 A;  4LF7 J;  3OXL A;  1ZTT A;  1JB0 C;  2M7S A;  3A8J A;  2XGP A;  2FVP A;  8ATC B;  4DR7 F;  4E8U A;  4GO7 X;  4OJG A;  2RKI B;  1PAE X;  4DSJ A;  4Z7C A;  3BQ1 A;  1TFY A;  1R0B G;  2WSF C;  2IDE A;  1IN0 A;  1LFW A;  2XZW A;  3NMA A;  2WVE A;  3G8S A;  2XTJ P;  3T5L A;  2VFR A;  4P2F A;  1D09 B;  2BOA A;  1NZA A;  1S5Z A;  1XC9 A;  1ZA2 B;  1SIW B;  2UUT A;  5KG1 A;  2JRS A;  3A8E A;  4J9N A;  4OHW A;  4JI1 J;  1UFL A;  4DV5 F;  1VQK S;  4UY8 T;  3GB0 A;  3KK3 A;  5B08 A;  2UVU A;  1KN6 A;  3R7S B;  4N77 A;  4ZVP B;  2D9O A;  3J7A 1;  4DI6 A;  2YX1 A;  3N6M A;  1LW2 A;  1VIO A;  3US5 A;  3SCK E;  1VS3 A;  4Q2L A;  2JEG A;  3MMA A;  2KG0 A;  1FWK A;  3CD6 S;  1HBN B;  3ILO A;  3EZ5 A;  3MFI A;  2ZC4 A;  4HAC A;  2Z2L A;  1UEV A; 
#chains in the Genus database with same CATH homology
 4NEY A;  3JAM U;  4LFB J;  1N32 J;  1I94 J;  4LFA J;  3J80 U;  2UUC J;  2UUA J;  4NXM J;  4V1A k;  4PWW A;  1IBM J;  3J81 U;  1XMQ J;  4DV7 J;  5IT9 U;  1HNX J;  4KYZ A;  2HHH J;  4DV0 J;  5LMU J;  4JI7 J;  3IMQ J;  4DR2 J;  4JI2 J;  4DR7 J;  4X66 J;  1HNW J;  4JI5 J;  5LMN J;  2ZM6 J;  1FJG J;  4JI4 J;  4NXN J;  4DR3 J;  2KL8 A;  4LFC J;  4KHP J;  4B3S J;  4DV2 J;  2UXB J;  2MTL A;  4DV3 J;  4RJV A;  2VQE J;  3T1H J;  4DR1 J;  2MQ8 A;  2UUB J;  2F4V J;  4JI8 J;  4DV5 J;  5AJ3 J;  4DUY J;  2UXC J;  2UU9 J;  1XMO J;  5IWA J;  4YY3 J;  4K0K J;  4JI3 J;  1N33 J;  4X62 J;  2KVQ E;  4JI0 J;  4HHU A;  1J5E J;  1HR0 J;  1XNQ J;  4LF5 J;  3R2C J;  4JI6 J;  4LF9 J;  3OTO J;  4KY3 A;  4LF6 J;  4YHH J;  5FLX U;  4B3T J;  1N34 J;  4DV4 J;  3T1Y J;  4B3M J;  4DR5 J;  3R2D J;  3D3C J;  5A2Q U;  4LF7 J;  4DR6 J;  4JV5 J;  2MEW A;  4LF4 J;  4LF8 J;  4JYA J;  4NEZ A;  4B3R J;  4GKJ J;  2UXD J;  3W1Y C;  1HNZ J;  4OX9 J;  4DR4 J;  3J7A N;  1XNR J;  1IBL J;  4JI1 J;  4X64 J;  4DV1 J;  3D3B J;  4GKK J;  4DV6 J;  5LM7 E;  1IBK J;  2VQF J;  4DUZ J;  4AQY J;  1N36 J;  4X65 J;  5BR8 J;  2E5L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...