4RJVA

Crystal structure of a de novo designed ferredoxin fold, northeast structural genomics consortium (nesg) target or461
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
MEMDIRFRGDDDEALARALLKMVVRAVSFGAQVRFTDDGNDLEIRITGVPEQVLKELAKEAERLAKEFGITVTRTIRGSLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OR461
publication title Northeast Structural Genomics Consortium Target OR461
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 24
structure length 83
sequence length 83
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4rjvA00
4JI3J 4RJVA 4KY3A 4DV3J 4JV5J 1IBMJ 5LM7E 4DUZJ 4DR7J 4DV6J 3W1YC 2UUBJ 4DR1J 3IMQJ 4NXMJ 2MEWA 1HNWJ 4JI8J 4LF9J 4DR6J 2UXBJ 3J7AN 1XMQJ 4DR3J 4DV7J 1J5EJ 3D3BJ 5LMNJ 4LF4J 1IBLJ 2UXDJ 4LFCJ 2E5LJ 4LF5J 4YHHJ 1HR0J 5A2QU 1N32J 3R2DJ 4DV4J 1XNRJ 2VQEJ 4JI6J 2VQFJ 2KVQE 4KYZA 4PWWA 4GKKJ 1HNZJ 4X66J 4B3RJ 4JI2J 4DV5J 1N34J 4LF6J 4JI1J 4X62J 5BR8J 2UUAJ 5AJ3J 1HNXJ 5LMUJ 1N36J 4LF8J 3T1YJ 1IBKJ 2UUCJ 3J80U 4JI5J 4JI7J 4OX9J 2UXCJ 4B3TJ 1FJGJ 3OTOJ 4X64J 4B3MJ 1XMOJ 2MQ8A 2UU9J 4K0KJ 4JI4J 3R2CJ 4DV1J 2KL8A 4NEZA 5IT9U 2MTLA 3T1HJ 3JAMU 1XNQJ 4NXNJ 4B3SJ 4DR5J 5FLXU 4DR2J 4LFBJ 4V1Ak 4YY3J 1N33J 5IWAJ 4AQYJ 4JYAJ 4LF7J 2F4VJ 1I94J 4DV2J 4JI0J 4DR4J 4KHPJ 4LFAJ 4DV0J 4DUYJ 4NEYA 4HHUA 2ZM6J 3J81U 4X65J 4GKJJ 2HHHJ 3D3CJ
chains in the Genus database with same CATH superfamily
3UN2A 2VBZA 4KE5A 3PIOQ 1I51B 3VAGA 2EXUA 3QYYA 3M6WA 3OJUA 2R2UA 1F2HA 4LSZB 1T95A 2CJQA 2V94A 2EFNA 3MR6A 3KK1A 2E9RX 1JLGB 3L3CA 3I0SB 3OW2R 4ZVTB 2KFZA 3GFHA 3MM6B 3V6DB 2UUCF 3SFGA 2VG5B 2AU0A 3AT1B 5B0EA 4QYZJ 1DTTA 1ZM9A 4WTOB 2QA4G 2AJQA 3DM2A 2E1AA 3C14B 2MKIA 3HD2A 3ADAC 2UXCJ 1KFSA 2A2CA 2OD4A 2PMHA 4U67Q 2D9OA 2HBZB 3G8TA 3D9BA 2Q6BA 2WBMA 2XEXA 4WKYA 4KC5A 5JUMA 1U26A 1DTQB 2GVDB 4RO0A 4FZVA 3GIRA 3NWGA 4N56A 1TUWA 2OFGX 4CT8A 3HHEA 2R7VA 3NGDA 3BBCA 3MPDA 3TQEA 4M5DB 1SUQA 1N5TA 1RTZA 1Q53A 1AUDA 3FQLA 3BREA 1U47A 3U27A 2VA3A 1X5PA 3N0VA 2AJ0A 5GAHU 4Q5VA 2ZOMA 4OX6A 3DLBA 2QIFA 4LVOP 3M2VB 3KJVB 5A8KB 2EBGA 1S97A 5SZTA 2V4JB 4KKOB 1UFLA 4CDIA 2KG1A 3UFCX 4UT4A 3GE9A 2HGMA 5HQMA 3BKUA 5IV4A 3G6XA 4B3RJ 2GGPA 2W2QP 4DV5J 3V5RA 4ICLA 1DARA 2F8HA 2R7SA 2C2ZB 2WAQD 2NR0A 4IG0B 4CQ1A 4X4PA 3A1YG 5CYMA 1ZTWA 2R3VA 2GS8A 2D69A 2GIRA 2CVIA 4C2MA 1ZA2B 2D3ZA 1Q95G 4I4BA 4P74A 2LA6A 2XMWA 3O6QA 2FJBB 1ZYQA 1FFGB 5KT6A 3V81B 2QC3A 1OQ6A 1IKYB 4RNFA 5IV3A 5H9EJ 4DPUA 3C46A 2Z8QA 1NSQA 1M1GA 1RBOB 2D3OR 4ED1A 3D0IE 2G2YA 2M8HA 4CP5A 3THTA 1DAXA 4A8MP 4DG1A 2IJNA 2FHJD 3CCSS 2C1EB 1QE1B 1R31A 1ZM2A 4DR3J 4RLEA 2OI2A 4CLFA 2YPYA 3Q22A 4ALZA 1WHXA 3TEHB 1RT7B 1TL1B 1R0BG 3DLKA 5LXYA 4HACB 5D4PA 1BQMA 2FZKB 4UY85 3OV7A 2GMLA 2W4PA 5BR8J 1WC4A 4DPTA 5ITHA 4HEA9 5KFIA 2IBKA 4OX9F 1JXLA 1YRTA 1NHUA 1N54B 5DQGA 2CPIA 4YB6A 1LW0A 1S7HA 1U7LA 4H4KA 1RYRA 4F04B 4J9QA 2VF3A 4ANCA 3CC2S 3RAQA 2EG1A 1ROFA 2KG0A 5D6GA 1SXLA 4USKA 4CZCA 3U1NA 5I3QA 5KFLA 4FPIA 3EWGA 4CRJA 3TRGA 5D0GA 2OFHX 1QJHA 4DF8A 3OBIA 2NZCA 4X84A 4ID5B 3HK2A 1B0VA 1S1UB 3C6TB 4IH7A 2WHOA 3HSZA 1HNWJ 2UXBJ 2LECA 4TYAA 5ETRA 4HT5A 4NI2B 2MQPA 3VZHA 5U47A 1T3OA 3KK2B 3RRHA 4O3OA 1WC3A 1Q78A 2GMHA 2J9DE 2YNIA 4IR9A 1GTEA 3D6MB 2KFNA 4P73A 2RUGA 3LP2B 3W65A 1FE4A 2YNGA 3T5LA 3KNAA 1AB8A 1DQAA 3P49B 5LSLA 1FK9B 4GC7A 5KFUA 1MWZA 1YBTA 4F7VA 5G0RA 3VV2B 5IC6B 3DMJB 2JFKA 5KFWA 2Z58B 1OYEA 1S9EB 3BGRA 2ZBPA 2ZUGA 3CMQA 2Z56B 2J6TA 1RHJB 2ZNYA 1X9SA 2OSRA 4WZQA 3HVTA 4RBUA 1U6FA 1M5KC 1CBKA 3HPOA 1DY3A 3AODA 1S6QB 3LGNA 2KJWA 2JEGA 5KG6A 3Q2TC 5KG2A 4M63A 1LW2B 3TZYA 4ZVRB 1PAEX 1HNIA 3J81j 1TL5A 1FFWB 3KJQB 2E29A 1UW9A 2NPFA 1N34J 1N88A 4U6PA 5AJ3F 3Q8QB 4JI5J 5DJBA 3ITHA 1U24A 2WSFC 2R2RA 2EFGA 1BQNB 1WOOA 2LDYA 2M5YA 3TANA 2PFDA 3H8YA 3JQMA 3QSYB 1C4CA 4GVBB 4HDGA 3ZZUA 1MN9A 3SIPB 2ZNZA 2VZ9A 2HLTA 5G4DA 4TLRA 1IM4A 2X1FA 5E5NA 2QT7A 1M0SA 4F2RA 4UQTA 4DL4A 2E1CA 4FVCA 3M8SA 2JDJA 3HVAA 1HWIA 3OXGA 1S0VA 1JXEA 1U0HB 2X7IA 4MMOA 4A8KA 2Y8YA 4IQXA 1IR1A 5A8WB 1TKTA 1I5OB 2HFSA 2RHQB 3PEJA 4IH5A 3E51A 2V2VA 3MM5B 2XO7A 1XC9A 4I6AA 4ED6A 5EWGA 1REGX 1S9GB 1TELA 1YBUA 2ABYA 1S1VA 2FJEB 1C0UA 3BN4A 2C2EA 2VJUA 4QQBA 2Q3PA 2YKQA 5K9FA 2ZD1A 4DWIA 1HHSA 3SSRA 1HBNB 4BC7A 4MFBB 4OYAA 2CQHA 2ZH4A 1RCXB 1M5VC 4DX8H 4Q45A 3P45B 1TK5A 4I6YA 4PRFA 1J5EJ 1JXVA 2P6SA 1HNXF 8AT1B 5CYQA 1XNRJ 4Q2LA 1X9MA 2I9SA 5HMWA 3ONQA 4S0MA 3OFHA 3GP9A 2V9WA 2NPIA 4DL0C 3KLVA 4QPTA 2YWGA 4FNIA 3VALA 1J27A 1QTMA 4B9SA 5F8NA 3CCTA 1KHVA 3MGJA 3OL7A 1F9HA 2FZCB 3OD2A 5C42B 1PGZA 2CYYA 3W64A 4LRFA 1MU2B 3Q2SC 1KOOA 4AQYF 1IM6A 4OHYA 3TNVA 1RXOB 2JLGA 1MSWD 5AE1A 1J5OB 4LFAJ 1CS4A 2E5GA 4DDFA 4UOFA 1M5OC 1N5YB 2OLWA 4DBQA 1N4LA 3MEGB 2F5GA 2IC3A 2VL1A 3NP5A 2O66A 1KVKA 1VGYA 5GMEA 4V19J 1F5AA 5J2QB 2J0QD 1XJWB 4LF4J 1VLYA 2C28A 1VBYA 4IRKA 2CQ2A 2XGQA 2QFJA 1IBKF 2E5IA 1RT6B 5ETLA 2K8GA 4C9DA 4B3MF 1HWLA 2ILYA 4OV1A 2R7XA 2W4DA 4PPZA 3EZOA 5CCMA 3HHLA 3MM8A 3BSAA 1FVSA 3I31A 3O1LA 4F4ZA 3MFHA 1CSJA 3SV3A 2M70A 1YVFA 3J7Z5 3B82A 2DR8A 4RW7B 4ELVA 1KSPA 4BDPA 1Q8IA 2BQ3A 4OI6A 3BV8A 2I5JA 5IM0A 3W2VA 4M5NA 2DGVA 4OHWA 1R8CA 3QIPB 2BZ2A 3ZZYA 2VFTA 1IKWA 2DXDA 4F4YA 3BSNA 2EKNA 2NXCA 2R42A 3DHWC 2K2PA 1SV5B 3CPWR 2FVRA 2LKZA 1FNXH 4N41A 2UXDJ 4LFCJ 2G0JA 1WOPA 1HFEL 3CWJA 3OR1B 4USTA 4KGKA 2RDDA 1T9YA 3MTJA 3HM9A 2BJ1A 2AZ3A 2VD3A 3EXYA 4ATNA 4DSKA 1RU1A 5HROB 3AB4B 2ADBA 2HVEA 4LSNB 1OWXA 1WTBA 5KG1A 2VICA 4L3NA 1XTZA 1Y5NB 3TUZC 4KFBA 5HI7A 3CO0P 4I2QA 2RSQA 4DJBA 2MTLA 4JV0A 2FGCA 5GAGI 3LWLA 2XLKA 1HIYA 3DRRA 4CLKA 4DR4J 4FYDA 4K7QA 1ZAVA 2F7VA 3M8PB 3FKBA 1R3NA 3W1YC 1EAYC 4MK8A 4L6V3 4CLYA 2OH2A 2FZGB 1KQFB 3HKZD 3K5LA 1EQMA 1WUUA 3T6BA 2CJKA 2JJ4D 5MAOA 4NLSA 4PWUA 3RBXA 1QDUB 3IAM9 3DC2A 3CCES 1V5VA 5L8RC 1B7FA 4JI6F 2E9ZA 1SH3A 1Z4UA 3VR1A 3KWMA 3ZZTA 5D3GA 1VBXA 3OSPA 2ZFHA 2DISA 3UCGA 3KLGA 3LAMA 3TAPA 2CNOB 4QYZK 5LMUF 3H2LA 5DDRC 2HEKA 1T11A 4LR8A 4JI4F 2C2NA 1RQ0A 5KFOA 3Q0AA 5GMKa 2C3YA 3SQOP 2QL7B 2GHPA 3UE2A 2WZ1A 5KT3A 1B0TA 2MKYA 4W98A 1VR6A 1YX2A 4CLTA 3W9IA 3OTCA 5E3RA 5J2MA 1P1TA 2O01C 1U1RA 2R8GA 3OXFA 4RPFA 3EZ5A 2VFVA 2ZHAA 3CJ0A 3HSGA 4TN2A 3M1VB 5HSPA 5DM7Q 2OHDA 2C3UA 2V63A 1FKPB 4G6VB 4PG8A 4NYZA 2VFUA 1WEXA 1RZMA 5E3AA 2CQPA 1XWLA 1ACMB 5DZ6A 2G1HA 3T41A 2E9TA 3IRXA 2QRRA 2W1BA 3ZZZA 1U45A 4LIRA 4R8UB 2DXFA 1ZM3A 2PGCA 1NB7A 1HHQA 1KC8T 3KG1A 3G6VA 5DRKA 3UR0A 3MF5A 1CC8A 4LSLA 2VH7A 1B70B 2QTWA 2OPQA 1OJ4A 3T1YJ 3V4IB 4W92B 5D77A 3QRRA 3R7NB 3QT5A 1TK8A 2YQ0A 5DDQC 3AOCA 3K58A 1WDTA 3M8QA 5L9NA 1HHTP 5DDOC 3EDQB 2QMUB 1WDDA 4YY3J 2V34A 1YWXA 1VC6A 1EZZB 3PRBA 5K14B 4TQRA 1AFIA 4DR6F 3A8KA 2VG6B 1K1SA 3NAIA 8RUCA 3KMQA 2OMOA 3ISND 4KY3A 5IQ6A 5F0UA 4DV3J 4NMLA 3A12A 2DNKA 2RD5C 4P2MA 5L1JA 3ETOA 5H9EK 4C11A 1WF1A 3P8BB 4ILMA 2WVEA 1HQUB 3QT6A 3IBFB 5LMNJ 4HI2A 5KFHA 1X9WA 1VQMS 2BEFA 4ZVQB 2GJFA 2OTLS 2RIJA 3OT9A 3QQCD 3UDLA 4G1QB 4YMEA 1EJ7L 3D0GE 1WNEA 2OAUA 1JLCB 5D0HA 4DSEA 2B6AA 4F0KA 4LJMA 1HQ2A 1OPZA 2NUHA 5HLFB 3BKTA 1FERA 2HQCA 2NS1B 2BABA 3DRSA 2YQ3A 3MAAA 3HVRA 2AYGA 3E01A 5A0YA 2FIUA 2BOPA 2N3LA 4J9KA 4JI0J 5HN0A 4X4OA 3OTDA 3MM9A 5H9FJ 4KO0A 4LIWA 4FDFA 2EFQA 2KHDA 1FXRA 4WPAA 1HI1A 2FYXA 2DCUB 1U2CA 4TVAB 3C15A 2HNDA 3H98A 4KJIA 2HMIA 1S79A 3NNAA 3G82A 3VGVA 5KOWA 2DGSA 4WP3A 3Q86A 1NM2A 2QN6B 4K0KF 2ROGA 1LFWA 4WU2A 2FC8A 2DR6A 2EI5A 2OEMA 1RTHB 1UW4A 1RWMB 2EG2A 1VS3A 5KT2A 3QPIA 1RT5A 1CJVA 4QWCA 4UQGA 2MQ8A 4ELTA 2B5JA 4N7TA 3RRGA 2DH7A 1PJ6A 5C5JA 2LXIA 5EUHA 3K8WA 3KNGA 1X4HA 2J0SD 1UVIA 3NS7B 1TP7A 3LPYA 3KHGA 3G4SS 4A8SA 1YJVA 1R0CB 5DETA 2I38A 3O2IA 4DR1J 1RYSA 3QJPA 3DLEB 3H59A 1KOHA 2YKAA 2JC1A 1U1MA 3DRPA 3CMES 1N5VA 5LJ5Y 3JSYA 3PW5A 3NGUA 2QL9B 3LP0B 1RTDB 1GH8A 4F4KA 4PR6A 4OHVA 4QR2A 2HNZB 2DNMA 1X4BA 2HS3A 3KLEB 4GKKJ 4CH7A 1SKUB 1NCLA 3C2PA 3CD6S 1X5OA 5DGAA 3OVSA 2V2ZA 2J76E 1RHRB 3VQTA 3QO9A 1Q81T 2RF2B 3GSDA 4IUFA 4PQUB 1VBKA 1VQ7S 3BGUA 3QWPA 4MAKA 3ILLA 4HHJA 3GJRB 2J9EA 3NXZA 2QMWA 2ZZNA 3G8SA 1B3TA 2E7WA 2KXNB 1TFWA 3H4DA 3MMAB 4U8VA 2DY1A 1SCJB 2DYAA 1X4GA 3J7A1 5E3CA 3HMJG 1S49A 4FBTA 1W25A 2LFVA 3C6UA 3IMQJ 4WZMA 5EX0A 3OJSA 1FWKA 2CQGA 3PYGA 4ECXA 3TQ1A 3R8YA 1FT8A 2JVRA 1WG4A 5KOXA 2YNFB 3RZAA 1XN9A 1RU2A 1D0EA 1NAQA 3EICA 2YKPA 2R8KA 2FJVA 5B0GA 4B3OB 1NDLA 3CDUA 2DNYA 2DVIA 1FTRA 2UP1A 2GO9A 1MMLA 3R6LB 2DJWA 4OLOA 2HAFA 2HWHA 1NPRA 2CQDA 3I82A 4ZVEA 4DZ6A 5L39A 1VRTB 1QVGR 2UXCF 1RT2A 3B4DA 4L75A 7FD1A 4NA2A 2J9DA 1NDPA 3EJMA 3RAXA 2DITA 2MYFA 3R6GB 3TARA 2ALYB 1DQ9A 2J5AA 1KWMA 2XS2A 2H5JB 3FQKA 2RDIA 3IRWP 5CABA 2BANA 3OTEA 2QG9B 2NZ4A 3KLHB 2H65B 1YRXA 1WKJA 3LGMA 2HBRB 1RWXB 4NXMJ 4ZHRA 3J7AN 2E1PA 3CIMA 3PFEA 2HFZA 2MSSA 1X0PA 2KTQA 1K9MT 3K5OA 4ZVHA 2RRBA 3BS9A 1N32J 1SPBP 3UVJB 5KFSA 3ILIA 1B4SA 4B02A 1G1XA 3FFIB 3F73A 3Q8RB 4DV5F 2BXJA 5IQQA 1TKZB 4ZJOA 1XNQF 2CPJA 2KT3A 2WOMB 4IYQA 2HK2A 3QFHA 2CDQA 2UVWA 4NLPA 4JYAF 3AA9A 5ETQA 1UETA 1K1QA 3UN3A 3UDEA 1GX6A 2EC2A 1RWPB 5L38A 2XZWA 3UNGC 3KFWX 5T41A 2VBXA 3KJVA 5IWAJ 4TNOA 2P2CB 4H4MA 4DSIA 4KGXB 1YKWA 2XS7A 2BX6A 3GWCA 2DKOB 5D4NA 4C3LA 1UVNA 2HRYA 3AQOA 4KKOA 2ASYA 2C3MA 2IVFB 5I3UA 2XHCA 4EO8A 3EXCX 2J6UA 4LVNP 3M05A 2FJXA 1NDCA 3PJWA 1SJRA 4URQU 4P7TA 4ECQA 1X4AA 2XZDB 2W8KA 1SIWB 5IOLA 4DR3F 5KFKA 1REVA 2E5LJ 3BGOP 4WIIA 2BQRA 4RW9B 5J1PA 4ZJLA 3AAWB 3IS9B 4ECRA 1RAGB 1U09A 4RBVA 3K7RA 3HFVA 2GIQA 3DLGA 3LA0A 2XYPB 4JI1J 1P9QC 2MHNA 2BKPA 1W26A 2F63A 1K0TA 1N0UA 4O3SA 2G1DA 2U1AA 2KDOA 3SYZA 3KK3A 2RB7A 4E2FB 2BRLA 1YRUA 4Z2XA 1T0TV 5SUHA 2UUWA 3FUYA 4KPCA 1KONA 4UZBA 1FESA 1FRMA 5L9XA 4GC6A 2YKOA 3K59A 5L1IA 1H2VZ 1TMMA 4ED4A 2ZH6A 4ER8A 2ZDPA 2ZH8A 1E6VA 2CG4A 1Y3KA 4USUA 2ROPA 3OUYA 3FMBA 5A6PA 1HNWF 1F0XA 2DK2A 1APSA 2VODA 4YHHJ 1P8GA 2KKHA 3ZNJ1 1LEOA 4ZN3A 5K8PA 4X4SA 2R9LA 2LVWA 2XCPA 4HH0A 3BH7B 4USJC 2JFDA 3CCRS 2DH8A 1WORA 1KLNA 4OJ3A 4LFBF 4J9OA 4L73A 1NZAA 5IT0A 5B0DA 1TFYA 1TQLA 2PA3A 1XQIA 3P3DA 2Z30B 3KUGA 1S12A 4L76A 1PKUA 2C3PA 4LR9A 3C6TA 4RW4A 4AL5A 4DR2J 3MMCA 2YKNB 3Q24A 4KV8A 4OJ1A 4HTJA 1F3VA 1N6QB 3PYEA 2BACA 3DFEA 1IVZA 3I0RA 2XGPA 1S76D 3OVAA 3M8WA 2M3DA 2J7UA 4CI0B 3N4WA 3JYTB 5BJRA 2OEJA 2OKQA 2ZJRQ 3MUVP 3IFEA 4IFYB 2YBVA 1HR0J 1QTNB 1UA1A 3IBCB 1V5IB 2J9CA 4W90B 3BYRA 4WXWA 2KXFA 4RW8B 5A8RB 2LQ5A 3DMJA 3R3TA 1N34F 4ZLLA 3W2WB 4OQJA 4TXSA 3G6ES 4EI2A 1TL7A 2HQ3A 4WJBA 2XMAA 5HJYA 4JI5F 4OZNA 3AB2B 2DNHA 3NCPA 1DZ5A 4ZK7M 2FPHX 4M5HA 3PX6A 3WIUA 1G7CB 4UOGA 4TY9A 3JAMU 2DNOA 4C0OC 1VQNS 3IR5B 3KLFA 3MAHA 2I8EA 3DGVA 1AROP 3EZUA 1YJ7A 3US5A 3TO8A 3NS5A 2FTRA 1RAAB 4URGA 4O23A 1SQEA 3F44A 2CZ4A 2QYCA 5L1KA 1W2IA 1O5JA 2IDEA 1UAWA 2KXHA 4L3KA 3QT8A 1FDDA 1MMDA 3MD3A 4KT0C 3CCZA 1EHWA 1M5PC 2ZH9A 2RRAA 4QR0A 4B08A 3POTB 2YX7A 4K4YA 2QSFA 3IC1A 4PUOB 2U2FA 1RAHB 4NLQA 4J90A 3OL9A 2HHTA 1LNQA 3SCLE 2RVJA 4RUHA 2V5HG 2HQDA 1M5SA 3JQJA 3J7YU 2PN6A 4ZVSB 4M5GA 1V3ZA 3RGIA 2JRSA 1L5UA 4QW9A 4J9LA 1S1WA 2AGQA 4OI4A 4PXBA 1NPPA 3AFGA 3MEDA 1WD6A 3I9ZA 4OZJA 5DG8A 2KH9A 1EKRA 3A8IA 3BQ2A 4OYWA 2OPRA 3AY0A 3U1LA 2EK6A 5HO4A 1RT4A 4OZLA 3MMBB 3FCVA 3G9CA 4MKAA 1H73A 3W66A 4A8FA 5HK4A 3AOAA 4DL2A 3UW1A 5KTQA 4NA1A 1TVRB 4N8OA 2L41A 3CJ2A 3OQ2A 1S7IA 1C0TA 1VQPS 5KG0A 3FDSA 2HS0A 1RAJA 1M1HA 3JQKA 3QBCA 3Q8SB 5F8IA 3CTRA 2QA4S 2R8IA 3KJFB 5RUBA 4ECTA 1J5EF 4IO1A 1H7XA 4B9LA 4X4UA 5KFDA 1S99A 1WG5A 1WI6A 5KT4A 3WZ0A 5A2QU 1U2FA 1FRLA 2DR5A 1XNRF 3PX4A 3JTNA 4H54A 2B43A 3HULA 1RBLA 1QUPA 3SDEA 4EFAC 3NBPB 2CPFA 2DO0A 4DCOB 1VRUA 2V68A 1RWKB 1YJUA 2Z2MA 3P6YC 2CPHA 2PIIA 2RH3A 3OTBA 1HBNA 5CXTA 1U1PA 1N48A 1XR5A 3HLUA 4ZMMA 2QSWA 1NPKA 3RW6A 3TAQA 4OI0A 5F41A 1I94J 2WSCC 2MZJA 3NMRA 2EVZA 4DFKA 4LFAF 1EARA 1FJ7A 3GG0A 4NCGB 4H4OA 5KFTA 1HBMA 4P9SA 4DR7J 4L74A 4CO0A 3HHKA 1YZ6A 5H9FK 1KD1T 2EKYA 3DYAB 4FVMA 1KLMB 3TAMA 1PYOB 2XTJP 2XLIA 1U1OA 4K8RA 1FE0A 3BO2A 1HBUB 1VMBA 5C24B 2IDLA 3N6MA 2HAIA 4LF4F 1Y00A 2LQBA 1BWEA 4LF2A 2NQPA 2P5VA 2BE9B 2RHSB 4V19X 1S6UA 5IS2A 2F9JA 1JIHA 1D9FA 1CJKA 3R5JB 4ZS6A 3DI6B 3MURP 1J5OA 1C2PA 1IKVB 2HURA 3CCVS 2DPJA 4EZ9A 4DSJA 5D8HB 2IM2A 3HSDA 3T6JA 3K0JA 2N7YA 2OJ3A 3HT0A 1Z2ZA 3A13A 3HSJA 1O51A 4A8YA 2HPUA 4ANDA 4A8QA 1NK6A 2BM1A 3J80Y 4J9RA 3PCOB 4USVA 3LF0A 4J37A 3IXQA 4K4SA 2JX2A 3CW2C 1QLNA 3CJRA 4EYHB 4KTQA 2AEFA 3P4UB 1CULA 3M2UA 3TUIC 3NWRA 4OHZA 1D8YA 1LWCB 1YJTA 3UD3P 3LPEA 3U02A 1VQYA 2EPIA 4X66F 3M2RA 2CQ0A 3FMWA 5T7LA 2W4CA 3PO4A 4LF1A 2PDAA 4A48A 2K1RB 2UXDF 3KDNA 2PEBA 2B4UA 2DIVA 5F0WA 2XY7A 4DV4J 2C2DA 1WJ9A 2XY6A 4K50A 3EE3A 2IY5B 1X4EA 2DGWA 2HZAA 2CQ4A 3BEGB 2DY9A 5HVFA 4RW7A 2HZVA 2ILZA 1UFKA 4OYIA 5EHHA 3NMAA 2HVIA 4AXJA 2XWYA 2RILA 2FLLA 3OFGA 4U95A 4ETZA 4KIAA 4TYBA 4FS2A 4DFMA 1R7IA 4RX6A 1SV5A 3CJSA 4QCLA 4DR4F 1UEVA 4DHVA 2ZH2A 1Y9OA 3CNQP 1VQSA 3IWNC 1DTTB 1RSCA 3DM2B 3DOLA 2XI3A 5FDLA 5C25A 3PYFA 3A3NB 3LH2S 2D7SA 3FBEA 3BR8A 2BDPA 2ZOFA 4RL1A 2MHEA 3DGPB 2VBWA 4DUTA 1S1TA 1SUQB 3V4MA 2I0XA 2UUCJ 2Y1JA 1N5SA 1VQ4S 4R5PA 3P5TL 1PJ7A 2EW9A 4PYAA 3R5BA 1NUEA 3ZFVA 1TKDA 3OLBA 2UUBF 4EBDA 4JV2A 2XSFA 4NOHA 4DLGA 2Q66A 3SQGA 2MKSA 3KHHA 2NYIA 2DRDA 2QO3A 2VDHA 4Y34A 3L4BC 2J0WA 2AW0A 2KHCA 1NO8A 2DNGA 2LXFA 2IM0A 4Q8EA 2F40A 1Q1KA 1V6HA 1VQ8S 3GONA 2ZZMA 2GGPB 4ICLB 2MKJA 2XNQA 5C7PA 2N3OA 3I4HX 1KS2A 4C0BA 5CYMB 2HHWA 4RKUC 2QEXS 1S5ZA 2YPZA 3VAFA 2CA9A 2E44A 3JSRA 3QZ7A 4K4TA 4RU2A 2HW3A 2WVBA 2XC9A 3JSMA 3NLCA 1UMJA 4EMDA 4C7QA 4X62J 5KFZA 4NLDA 1UTAA 4DL5A 3TOQA 3N6NA 2HWIA 3CJ3A 1F1BB 2IRYA 2OD6A 4DG1B 1UEUA 4FYWB 2Z2YB 2IVMA 4YY3F 3FRYA 2BKNA 3Q8VA 1GTHA 3S01A 2ZBQA 8ATCB 3QGIA 3OHAA 3TVKA 2BJ3A 3DLKB 4DV3F 1NK7A 3QFWA 1P1LA 1F2GA 1BQMB 2R2TA 4CLSA 2A3JA 1AXQA 2HFOA 1CQMA 4J9UE 3TUPA 4WU3A 2DTJA 1C1CA 1PAUB 1CLFA 3H5YA 5LMNF 3MCSA 1LW0B 4Q2MA 1LWEA 1C4AA 3ISNC 1H0HB 5D4OA 4CLWA 4A8WA 2ASLA 3DHXA 1R8AA 3SV4A 1RLDA 1GXUA 2WVFA 5AXLA 3MR5A 1VQ5S 2CWXA 3K17A 4G1PA 2HG4A 5KFEA 4QIWD 4J9PA 1QVFR 4DV1J 2LDIA 4KGMA 4DQQA 3VGSA 2DRBA 1SVDA 2WB4A 3RUBL 3R27A 1EIYB 5IXUA 4YB7A 2D3UA 1DLOA 3RTVA 3V6JA 1NJIT 4JI0F 1HQUA 3I5BA 5HP1A 3D6FB 4HHUA 2A6MA 2PE8A 1YBAA 1OPIA 2OMLA 1GXTA 3AA8A 2XMKA 2DB1A 2YNIB 1FNOA 2VPYB 2WVCA 4QJVA 1RTJA 5CH7B 2DGXA 1FKOA 4AD6A 3KDOA 1JLCA 2YWFA 5F3TA 2HFVA 5E33A 2YNGB 3DRYA 4I7FA 1NNDA 2W9CA 3VAJA 2RKIA 3R2DJ 3N01A 1KDNA 2AX1A 1A7GE 1UA0A 2WONB 5G0RB 3PX0A 1UWBA 2LA4A 4WE1A 3PW2A 2DIUA 2RS8A 1VBZA 2WRMA 1PO6A 4MK7A 4TKTA 3BGRB 3H5SA 1JLQA 5E3PA 2BJ9A 3K57A 1N5QA 2D9PA 4C8OA 3CXCR 3HVTB 4QR1A 1U48A 4YS2A 3EUNA 1S6OA 3MD1A 1RB0A 2G2OA 3X1LB 2W8LA 2J6SA 2JH3A 9ATCB 5IT9Y 1HNIB 4CO2A 4OZ2A 5KFJA 4ZCKA 2V2QA 4I6WA 2M7SA 2VQEF 2R7RA 1SIZA 2YWKA 2HVDA 2A6OA 1WSVA 5HL7Q 2YKMA 4QWAA 2AMCB 4CH0S 2PA8D 3PR4A 4WK1A 3GZ7A 4RW6A 1N52B 3PYDA 1HMVA 3CJ5A 3FCWA 2BVZA 4HTIA 4GKKF 1JJCB 3M4XA 4XDDA 3SXLA 3CJ4A 2J8AA 3QWUA 4KPYA 3O5TB 1WHWA 2L08A 3CE8A 4C3KA 1VRQC 4O4GA 4B9VA 2HFNA 3CJ8A 3CJQA 1K44A 1TK0A 4TY8A 3MUTP 1LK7A 3EMTA 2RT3A 4JOUA 5KG3A 3KG0A 2XYHB 2J8SA 3CUNA 1GMVA 4M5JA 3PHEA 4WCEQ 3CF5Q 5DO2A 3OXLA 3ICLA 1B7YB 2HHQA 5F9NA 4X4RA 1JLBA 2AJFE 2FY1A 4CLUA 2AD9A 2E66A 1HARA 4WWSA 4DV6J 2K7KA 3KLEA 1B0PA 1YI2S 1TKTB 2EFOA 1HPZA 4ES3A 1PG5B 2AYBA 3R5CA 1SBRA 4JI8J 2VDIA 1NMEB 2CZVC 1BXNA 4KAIA 3HCXA 1F5BA 3UCZP 5ETKA 2CDRB 3B6BA 1LXNA 4P72A 5B7WA 4BS2A 5K8NA 4M5MA 1TU0B 5B0BA 2VASA 4BCAA 2ZVIA 1WEZA 2ZD1B 4MKVA 3CCQS 4Y65A 1EETA 2H54B 2JVOA 4ZCLA 4ZCIA 1JJ2R 2Q43A 4NLUA 4DQSA 5HATA 2WK4A 3FK4A 4DUZF 3C8YA 4DF4A 3A3OB 3ILJA 1YJNS 2KFYA 1T7PA 4A46A 2GAGC 2BE2A 2DNLA 5CYQB 3GFXA 1R8HA 5EDWA 4O3QA 5LM7E 2D1CA 1VLOA 3FNNA 3V6HA 5DM6Q 1C1BA 3DLHA 4F02A 4O3NA 3EDRB 2DBBA 1T3NA 1SC1B 4WBFA 2GFFA 4ED3A 4DX6A 1FHTA 2LLZA 4P6QA 1XIQA 1UCNA 3N5FA 2KVQE 3PHTA 3CVKA 5DZ7A 1R8PA 3QATA 4DFPA 5KFAA 6AT1B 2XQCA 3DOKA 2AV5A 1HNXJ 2HBQB 3MPVA 4ECUA 1UKUA 1NXIA 1ZM4A 1OY8A 2P6TA 2IVYA 2ZE2A 9RUBA 1RKIA 1B64A 2GCFA 2IC3B 1VIOA 3EGWB 4P2FA 3HT3A 5IWAF 4IRCA 2PMZD 1JLEB 1ZETA 2CJAA 3EYZA 2CPZA 5D15A 4O44A 3H25A 1XMQF 3MEEA 2OEKA 2N4DA 3TVYA 3KXDA 3W8PA 2F1FA 3FC9A 4FYXB 1NHKL 1PJ5A 3BDEA 2VC0A 3W5YA 2IM1A 3MZIA 4DFJA 3HHLB 2AP6A 2MEWA 2DGUA 1XEZA 1U0SA 4QBUA 1VQ9S 3MM8B 3I5CA 3PKMA 1KTVA 2QGFB 2HHSA 2PD1A 4K4XA 2V69A 2E5LF 2N7CA 3SCIE 1HWUA 2NSCA 1U6ZA 2Y1LB 4DSFA 1WKLA 4DL6A 2BJ8A 3NGSA 2MLXA 4EBCA 4EGLA 3A8JA 1N0VC 1F9FA 2VFSA 5KFPA 1V3RA 3T9ZA 1O6XA 2I5JB 2V4RA 1IBKJ 3W2VB 3J80U 1SH0A 3BM7A 1L3TA 3MM7A 3LO3A 4B3MJ 1DURA 1IKWB 2Y9HA 1IBMF 1LWFA 4QZVB 1KEKA 3ZTPA 1RJJA 4PCQA 3HP6A 1EP4A 2O67A 1U2RA 2Q79A 3GJQB 2V8GA 3HFKA 3IR6B 3S8SA 2EWHA 2GO8A 2EC0A 1PC5A 3C66A 1UVJA 3VGTA 4ZVFA 1VCTA 4FF1A 1F60B 5KFYA 4CYUA 4C3MA 1XERA 3AD9C 4ED0A 4LBIA 2VA2A 2HNYB 5CAAA 4I2QB 3ETMA 1U1NA 2XHWA 2NXUA 4P2SA 3I5AA 4OYZA 3CC7S 1WC5A 1AW0A 2B51A 3OPKA 4NCBA 1HNZJ 1FI4A 1FVQA 3DRRB 2KYXA 2PI5A 4EEYA 3PKYA 3HD1A 1WSRA 3NY0A 1DHMA 1FRJA 1SJ4P 1BY9A 5HVHA 2XM3A 1SKRA 1XMOJ 1RUSA 1SJ1A 1S10A 1S1XA 3T1HJ 2OPPA 2HBYB 5F3ZA 4DR2F 5M2UA 4TU7A 4DX7A 3S7RA 4OYPA 3GR1A 3MTKA 4NLXA 4PG5A 2IHR1 3CCWA 4P10A 2WW4A 3C3LA 5D3GB 1WHYA 4ZP9A 1CVJA 1LXJA 4J5OA 4OLPA 4DQRA 4PKDB 2ZWPA 3WQPA 3M30A 4DL3A 3I9V9 5E2QA 2UUAF 3T3FA 1TUGB 3TJ9A 2UV8A 5J1EA 1Q0NA 2N82B 1WC1A 1M5HA 5IT4A 4TLQA 1NLKL 5J2MB 3H5XA 1HNVB 5ETTA 3F56A 1SJFA 2CQBA 3HXMA 4WIQA 2HZCA 4CNYA 2QZ8A 5DS7A 2VG7A 4CTAA 5D0EA 1XK8A 4MTPA 4ECYA 2UV8G 1WEYA 4ZJQA 2IA0A 1FO1A 1JX4A 1UPMB 1E6YB 4Z7CA 1ZTTA 1R6YA 1BMQB 1NBEB 2RUSA 4DS4A 2KI2A 2XSJA 2LP4A 3IGNA 3QT7A 4F0MA 2K7JA 4X65J 2FVQA 5KFQA 4LBHA 4IFVA 2W9BA 4PEOA 4DI6A 2E1MC 2FHJA 3WBZA 2VPXB 2R7OA 3W7BA 3NCQA 2LEBA 4RU9A 3M32A 3LOUA 1NH7A 2HRTA 3GMGA 4LSLB 2V9KA 2GMJA 2MJUA 3GPAA 1X31C 2OPQB 3DCAA 3B4MA 4MKYA 1KHWA 3PR5B 4QPXA 4GMKA 3AD7C 1RTIA 3M8QB 2D41A 3UDVA 3K5NA 5GAGU 5GVQA 1A0OB 3BZQA 3M7VA 4DV2F 4KRWA 2H5EA 1MNEA 4G3IA 1PC4A 3FEYB 3BGLA 2R2SA 2GHWA 4YFUA 1TL3A 4PPDA 4C11B 4C8ZA 2QLJB 3PW4A 1T9VA 1NK4A 1U1QA 2HLUA 4UUWA 2X3GA 2HQIA 3HDSA 4OI1A 1AT1B 3E3XA 2KVIA 1VQOS 4M8LA 4DCJB 1WELA 4OV6A 1CQNA 4UW2A 5E41A 3GIKA 3PW7A 4NLRA 3CT9A 4OZ5A 1BQXA 2YTCA 4ZOSA 4DR6J 2B6AB 2GVZA 1UPPA 2R8JA 1HW9A 4OX8A 3TZWA 3GCWP 4DLEA 2NYHA 3SZ2A 4YDXA 1G2EA 4JI7F 3DRSB 2A1BA 5GAEI 5LSRA 4OZ0A 2XLJA 4OI3A 3MAAB 1JK9B 4KYZA 1R0AA 3KLIB 2VUGA 3E01B 5A0YB 4NXNF 3K5MA 4I68A 3ENVA 3CD5A 3TJAA 4LR7A 3WC2A 2VIHA 1WKKA 4OX7A 4KO0B 4ES2A 1NKCA 4IRDA 1VYAA 1KVIA 1TKXA 4DPWA 1R8BA 1YDLA 1RP5A 4K4VA 2B0GA 1GMUA 2B8QA 4WTYA 2CIMA 4NMXA 3FZBA 2ZWOA 1DFDA 3P96A 4RR5A 5GADU 3C15B 1I94F 2HNDB 4QWEA 5DLFA 4D3GA 2HMIB 3FCHA 4KHPJ 4YUDA 3G82B 4FF4A 1T05A 3D1QA 5CYJA 1IBLF 2BQUA 2XBPA 3UN5A 4DR7F 4WYWA 4JV5J 3O3LA 3G96A 2AT1B 2KN4A 2B4OA 4C6AA 3MMJA 1L3SA 3IP0A 2PEHA 5KG7A 2B9WA 2I2YA 2M88A 2L9DA 1RT5B 1CJVB 1KQSR 1DJ0A 2BOAA 2B5JB 3HF5A 1IWGA 1VK3A 2CXEA 1EB0A 3ELHA 4C8MA 3MXHP 1PSDA 2HGLA 4B9NA 3DOMA 3VAMA 4QYRA 4DR5F 1NEEA 5B0FA 3JTOA 3N28A 4RWWA 5AXNA 2YH0A 4KB7A 5KG4A 3ZZOA 4NA3A 2IMWP 4M5IA 4WFZA 2CNLB 3BGFA 4K0KJ 3CDWA 3WDOA 1Y11A 4EU0A 2NSBA 3EVOA 4NEZA 1TTHB 2NXJA 4YQWA 5IT9U 1MLAA 1RWNB 3DRPB 1U8WA 1N33J 4W4MA 3DLJA 4G1IA 2Z0GA 4UTGA 4LF9F 1KNZA 4U7CA 2V2KA 2YVSA 1WC6A 4CH1A 2QA1A 3SMZA 3IGVA 1TV6A 1JMTA 2IAJA 3HHDA 3MHYA 3W61A 4AE5A 2FD2A 2DHXA 2FJDB 4U7UD 1RT3B 3TX8A 4MIWA 1S72S 2E1RA 2VPZB 1RACB 1Q7YT 2GA7A 3J81Y 1FJCA 4PWDA 1VC0A 1IKVA 3OR2A 4NZ7A 2L9WA 1Z2LA 3QO9B 2NLWA 5I42A 3ZTRA 3NS6A 2W24A 2RQMA 1HD1A 3T5KA 4FPRA 2WW8A 2V8VA 2FY8A 1LFPA 4YR2A 4Y6IA 2H51B 1HWJA 4C8NA 4M5KA 3Q83A 1VHIA 3OSNA 4NLTA 2MGZA 3KMSA 2P8IA 4DV0F 4ID8A 3C6UB 1ZZNA 1MWYA 3JAMY 1XR7A 2ZC3A 3BB5A 2RJZA 2Y1RI 1M90T 3Q8UA 2VONA 5D0RA 5D78A 4USIA 3I56S 1HBOA 2DRAA 2RQ4A 3D28A 2FHOB 3CJKA 2F65A 4OIXA 4GKJJ 3G8QA 2XS5A 4Q0BB 4PXDA 3D6TB 4ES1A 4F36A 1RA6A 4I1TA 2R7QA 4IDKA 3IN5A 1YG0A 4M1KA 4LF6F 1RT2B 4DV7J 4ZKAA 5CZXA 1JKHA 5K5MA 3VAKA 4I56A 4ZVUB 4B9MA 2GX8A 2QYGA 1FJGF 2HHXA 4PG6A 5ETVA 1QSSA 3TUJC 2GAHC 4GO7X 3TX0A 2JSXA 1GFWB 2W01A 4WFAQ 1HA1A 3QSIA 4OYMA 1SL1A 3ZZ0A 2ZUAA 1RAEB 4LT6A 2BANB 2P9GA 3FEZA 2L3MA 2DNQA 2BMBA 1SJ3P 3QGGA 1X5SA 3EM1A 4X64J 1KTQA 2ROEA 3PV8A 3FBCA 4ZHRB 2V8PA 4BC9A 5AE3A 5F8LA 2YNHA 5EN1A 1ZPVA 3VVTA 3MECB 2R4FA 1FRIA 4WF9Q 3MPUB 3ULHA 1FDAA 2LU2A 4NLOA 5J2PA 1G4CA 1G3OA 4CO4A 3NOGA 4PAAA 3DGPA 2FLNA 4FBUA 4EO6A 1JLFA 2GNKA 2HRUA 3GYNA 5CD4H 3M6VA 3QNWB 3NL0A 3NNHA 5HBMA 3R97A 1VQKS 3M6UA 3WIVA 5A2QY 2JL9A 3BF4A 1DRZA 1N36F 4LF8F 2PT0A 2VBYA 1OO0B 3UQSA 2AZ1A 5F9LA 4RNOA 4ED2A 1YZ7A 4H4MB 3LP1A 4X62F 1Y0HA 1MWQA 4K4UA 5E3QA 4ILRA 4C8YA 2ZJQQ 5I3UB 3GV8B 1RCOB 2DHAA 1FF2A 1EQ0A 5FD1A 2IIHA 1AZSA 1XNQJ 2ASDA 3UPFA 2X51A 1XR6A 5C2GA 5J2NA 2IBOA 4JYAJ 1REVB 5LL6d 4ECZA 3O8WA 4NE9C 3RB3A 2GW8A 4RJVA 2AQ4A 3BO3A 4Y2KA 2HWTA 3DLGB 1UJ5A 1SC6A 2XI2A 2C2KB 4WP9A 2P9EA 3PFOA 3GJSB 3HX9A 2YXLA 5KFCA 1TAQA 3TI0A 5DQIA 1HQEA 4HR2A 1FNMA 3JB9k 4R25A 3L7PA 1NJWA 1KQKA 2XB2D 3KK3B 2A2DA 5I4MA 5ETSA 3A8EA 1D9AA 2DNNA 4E0DA 4LF7F 4O0NA 2MY7A 1VIXA 4HL9A 2G13A 1E6VB 2UU9J 2VKRA 1VJWA 4DV1F 2KL8A 1NSPA 3OUYB 4ZCMA 4Q44A 2MZQA 3WX8A 5JVHQ 4C97A 2MQNA 2AYEA 4OL8A 1IQZA 4URSA 4OHXA 4N47A 4I69A 2CNNB 2O3DA 4JI3J 3THPA 4XDCA 5HQLA 2VV5A 1IKXA 2GZOA 1VFJA 2RDJA 1U1LA 2BV3A 1D3WA 3D6HB 3G6YA 4K59A 2EBEA 1N8RT 3CO9A 3OFEA 4HKQA 1WF2A 2LXUA 2F8MA 3HI9A 3D5MA 4B3TF 4RW4B 5GAHI 3MMCB 1MMNA 2JEJA 2NXNA 4KV8B 3RB4A 3ISZA 3T1AA 3GCXP 3I0RB 2BJEA 1UEKA 6FDRA 2NUUG 3PNIA 3CCJS 2F4VF 3HHLD 3ZNUA 2OPSA 2QA2A 2ZH3A 2FVCA 1IJFB 4DUYF 1VJQA 2V50A 5MLCV 3ET6A 1ZPWX 4Y2CA 1X4DA 4LFBJ 3W60A 4ZPCA 2MZ1A 1NSKL 4LRBA 1T03A 4WFXA 3PRDA 4XPCA 2Z2ZA 5B0CA 1ZH5A 2PFFB 1HYSA 1KP6A 3L09A 2HHHJ 3L7UA 2JNJA 5ETMA 1ICEB 1RADB 3R1LA 2GHVC 5CQGA 2R7UA 1T9TA 2WONA 2V6AA 3K8VA 3IG1A 1MROA 4CWBA 3FZ2A 1D8ZA 1RGVA 2HFUA 1TL7B 4MH8A 4UF4A 4NRUA 4F3QA 3VVUA 3A4TA 1OIAA 2LMIA 4GVLA 1H6KX 2V0NA 5FIIA 3MR2A 2POKA 4ZLJA 2BM0A 4OZ3A 4PQAA 1AA1B 2C2RA 4FXDA 1RI7A 3PXGa 2ZITA 5HMYA 3KLFB 3GJTB 2ZBIA 4ZPWR 2VFRA 3KHLA 1X4FA 4BHQA 2A0FB 2KRRA 2CVEA 1JLGA 2WBRA 4K2JA 2V67A 3I0SA 3MR3A 1SJQA 3MM6A 3W8GA 3V6DA 2ASJA 4O4RA 2CJ9A 2VG5A 1NK9A 3PACA 3QGPA 3F41A 1FWLA 1IUJA 5E7OB 3C16B 2F3JA 3QJJA 2VOPA 2DGQA 3GSIA 1VK8A 5CZVA 2BE7D 1PYSB 3C14A 1RK8A 2B9YA 3TWZA 2M9KA 1W7WA 1EX8A 2BW7A 5JJBA 4DV6F 3LUYA 1KFDA 1NJXA 4JI8F 4U8YA 1IR0A 1GQEA 2GVDA 1DTQA 5A76A 4EUVA 4AL6A 4B3RF 1HW8A 2OTJS 1S0NA 4Z7YA 1S1WB 1QAIA 4M5DA 3MEDB 2AEJA 2HVZA 3JS9A 4N8NA 1LKZA 1KQGB 4ZVGA 2OPRB 1AUSL 1RT4B 1LV5A 2ZH7A 3M2VA 3I96A 3D7SB 2RS2A 5A8KA 1Y5IB 4LUBA 1VISA 1NK5A 2PI4A 2V4JA 4TU8A 1C0TB 2DH9A 3MCOA 2YQ1A 4WFYA 4J9VA 4FF3A 1SH2A 5K20B 2GJ2A 4U9RA 3KHRA 2LQ8A 2Z2LA 1RT1B 1YQHA 3PVXA 4M94A 2CNKB 4IG0A 4PABA 4M5LA 2EFVA 1L3UA 2DEIA 2CFXA 3SDEB 2IJFA 1IN0A 2MQLA 1IWAA 1LQ9A 5FJ4A 4YN3B 4DMZA 3OHBA 3PIPQ 3W5ZA 3DXSX 5DG7A 1VRUB 5ETNA 3K89A 5BR8F 4LF5J 5I3PA 1U4BA 1OSCA 3V81A 1BWVA 3Q89A 1IKYA 4WYLA 1LWXA 5F8MA 2X1GA 1HD0A 1FFSB 2IYIA 1SI9A 4PG4A 1QSYA 3VAIA 4C8KA 2WSEC 3JTPA 3ZZPA 4B9UA 2MB0B 1MW7A 4I2PB 1MG7A 1QE1A 3A3PB 3THVA 1FTCA 4H4OB 3SSQA 4TQSA 1HBMB 1ZAXA 2HSEB 5AE2A 3CSKA 1UVMA 4P71A 1FA0A 1RT7A 1TL1A 3TAMB 4DZDA 2GC8A 4HACA 1X60A 1ULRA 1YJ9S 2COLA 1IR2A 1FX4A 1S57A 4ZPTR 3PRVA 2UXBF 2ZM6J 5D4LA 1UVLA 2VU5A 4ZIWA 5LJ3Y 1D9DA 2MZTA 2EFPA 1RWWB 4HDHA 3H40A 3RAMA 4ECSA 4MIBA 1CJKB 1S6PB 1FCAA 2DNZA 4PYDA 2CUYA 4AT1B 2B9EA 1Q8BA 2VOOA 4KGZB 3PY8A 1VQLS 4FKXA 1M1KT 4Y3CA 3NEKA 2G4BA 2GV1A 2BUNA 3GU0A 5B0AA 1WWHA 4ID5A 1JLEA 1S1UA 1IQTA 2DEJA 2ZDOA 1H98A 2WVDA 3L7OA 1CULB 3M2UB 4LMZA 1L3VA 4FKYA 5LSOA 4NLVA 2C42A 4NI2A 3D68A 4ANEA 1A9NB 2H9ZA 1F6TA 4F3OA 2XO6A 4J7CA 4X4TA 2AKWB 3K5PA 3KK2A 4B3SJ 2XNRA 1BD6A 1WI8A 3M2RB 3HZEA 4K5RA 2UZAA 5T7LB 4QIEA 2XMTA 2J7KA 3J81U 3VAHA 4X2BA 3LP2A 4MYUA 2E5HA 1F3FA 1VDHA 5DG9A 2XY5A 2KT5A 2EEYA 3IAS9 3TJ8A 1ZS6A 1FK9A 4QIVA 1OYDA 4MKBA 3VF0B 1Q8KA 1Q82T 2ZZTA 2VJVA 3RR7A 3M9NB 2XCAA 1SKWA 3Q8YA 1S9EA 3DXBA 4A8OA 5M2RA 1S9FA 2E5JA 4OI2A 2ZKUA 4DXLA 3R1HA 1HNZF 1URRA 4X66J 3NNCA 3R7BB 1Q5VA 1GNKA 4IH6A 3RR8A 4F50A 1FRXA 3PJXA 1S6QA 2CPYA 3DLLQ 1XMOF 2N4CA 4WKRA 2MKHA 3DOLB 1SL2A 3VQSA 1LW2A 3AHPA 2LYVA 3T1HF 5FDLB 1CJUB 4ELUA 2W7AA 5C25B 3GQCA 2MZRA 1Q7LB 4AXIA 1S77D 1S0MA 1R43A 3RW7A 3UCUP 2HNYA 1P9YA 2JOQA 5FLXY 2Y0BB 2OELA 2MSTA 4K4WA 5KFBA 4F4XA 1BQNA 2VC1A 1GX5A 5LXRA 4ERDA 1S1TB 1RHQB 1TL4A 4DL7A 3LALA 4GO5X 2LEPA 3H42A 2MPUA 2I1RA 4R5PB 2MQOA 3CC4S 3TEGA 1UVKA 3CDEA 4GVBA 1RWOB 1YTYA 3NRBA 3IO1A 3DU6A 5EWFA 4UY8T 1X5TA 6FD1A 3SQGB 3BYPA 3FSYA 2APOA 3QLHB 4F8RA 2IM3A 4CLPA 1RAIB 2D3O1 3ENQA 3OTOJ 2CRLA 2VB6A 1H38A 3O44A 4BLGA 3D67A 2Y1IA 4FXWA 1U0HA 1JNRB 2AHOB 2A10A 2O1PA 1NK0A 3CULA 5HAOA 1VOMA 5A8WA 2ZC4A 3IWXA 2ZHBA 1FJEB 1HI8A 3I55S 1GT8A 4UZCA 3MM5A 4X65F 1U02A 5M2PA 3M6XA 1RHUB 4O3RA 1AFJA 2UUBJ 1CEZA 3JSMB 2O5DA 3NKYA 1GAOA 1HNVA 1NB2A 3SCKE 1S9GA 2CAJA 3Q8PB 3Q23A 5BYQA 2ERRA 3RYLA 2V8DA 4FF2A 3ZTSA 5IC4B 3LW5C 1KKHA 2PSZA 4MFBA 1J2VA 1E6YA 2DGTA 5GADI 5CD4A 2XYGB 2J7WA 2K3IA 4HI1A 2DHHA 4IG3B 1Z1ZA 2CQIA 1JJ4A 2W2OP 4CM0A 4B9TA 4C4WA 2JC0A 4WFBQ 4LRDA 1NKBA 2YX1A 4Y28C 2KO1A 2RMLA 2JZ5A 4JV1A 1EKSA 4Y0FA 2I6WA 3T9NA 1HLWA 2IRUA 1RWVB 2MJNA 1C1CB 3BDPA 2H4WB 2X3DA 4ZLNA 5ETPA 4GRSA 1LWEB 4QW8A 1FRHA 2HKEA 2W25A 4YR0A 1JLAB 4USWA 3BR9A 5HMZA 3HJVA 3UDCA 5C42A 1MU2A 3CD7A 3M8RA 2FVSA 3TA2A 1QAXA 1CJTB 3G71S 1U25A 4EZ6A 4J9NA 1N5YA 2VQFJ 2KZZA 3I6PA 1B99A 3R5AA 4CLZA 4JI2J 1DLOB 1RKJA 4MYTA 3MEGA 2ZJPQ 5HP1B 1UWAA 2KM8C 4HH1A 2ZH5A 4ZP7A 1KVJA 4LQ3A 5J2QA 2OO4A 2MQQA 3FBFA 5IFMA 4DQIA 2E7XA 5F8JA 1RT6A 1RTJB 1BGXT 1FKOB 2QLWA 5K8OA 1KBRA 1MN7A 1LOUA 3EVWA 3GV7B 4CNZA 2Y0SD 4I7FB 1NH8A 5KFNA 2W9CB 3CDBA 4KHPF 2RKIB 2AYMA 2NXEA 2ACMA 4LFCF 4JV5F 1UWBB 4KHRA 2MZSA 4F26A 2B4VA 3KLIA 4WE1B 2G9OA 2BJ7A 2PMWA 2A18A 1LK5A 3HFZB 3IBWA 4CIOA 3W9JA 5HANA 1JLQB 3IWLA 3D3BJ 3ZO7A 2KYZA 3T5HA 1HL6A 2HIYA 4P7VA 1T9WA 7AT1B 3GG1A 2HGNA 3QIPA 4LREA 1T9UA 3QMQA 4E98A 3GIJA 5F8GA 4QOTA 4ZDNA 5HJXA 3GLJA 3KK1B 3KOAA 1PYTA 2XZTB 3W5XA 2OSQA 4U96A 4MIAA 3UWTA 4C48A 4X4VA 3BH6B 1OS5A 3WHIA 2W7PA 3OR1A 4DOZA 4WXOA 1Q8LA 3QRPA 2ZH1A 3UO0A 2YKMB 1N33F 3TP2A 1ZOTA 2J0XA 2FJWA 2HVHA 4KBIA 4RW6B 3EGVA 2LEAA 5HROA 3BKFA 1HMVB 4LSNA 3G87A 3F0NA 1K8AT 5KG5A 4XO0A 1NJZA 4OJGA 2V4QA 3H2UB 3AOBA 3AJ1A 4ZP8A 3G2XA 1QM9A 2QX0A 1G6BA 3LWMA 4F4AA 3SEOA 4FN5A 3OL8A 1Y5LB 4H4KC 4O4GB 2ZBRA 3GB0A 2QLXA 2AJ1A 3QJLA 1TAUA 1ZBTA 1Q79A 3MAQA 2QJ3A 4TY8B 3WX4A 2YH1A 1JQGA 2VQEJ 1QD1A 3M8PA 1H3DA 4NPOA 4DN0A 3S1TA 2DCLA 2K06A 4OYOA 4CM2A 4LRAA 1JLBB 3L95X 1R27B 3BO4A 4JB8B 1KR4A 4CCHA 4UUXA 2AJ2A 1GXLA 3PZPA 4O3PA 4ZLPA 1RABB 2OP5A 1GMWD 1CC7A 4CT9A 1RT3A 2CG8A 2JEFA 1HPZB 5EWEA 2G0IA 2FC9A 2M4MA 1R89A 3NG8A 2VHGA 5BYSA 1OMSA 4J9SA 3KKFA 2XMVA 3B78A 1PBUA 3MCNA 4GKJF 2GQCA 4QIFA 3D3CJ 2CJBA 3RU0A 2HQGA 1UZHA 3QGHA 3MR7A 3W63A 2KJVA 3AJDA 1EETB 4QU7A 1Y10A 4DV7F 4UOHA 3T1YF 4RNHA 2CADA 1V9OA 5AXKA 3SBMA 3MPYA 3M1VA 2FHMA 4KGVB 5KFFA 3BN7A 1D1UA 2M2BA 1FKPA 1UZDA 4I0WA 4HLBA 3GTYX 2DD8S 1VHFA 4A4JA 3W62A 4IOAQ 2BE2B 1QAJA 3VCDA 4X64F 4Q0BA 2V8HA 4R8UA 4P2XA 3J7ZT 1YIJS 2B7BB 1C1BB 3D1OA 2FQQB 3VHQA 4F3MA 4Y00A 1SL0A 4I67A 1RE1B 4FNHA 4CO1A 4N77A 3V4IA 2DHGA 3QAEA 2R7WA 4DUZJ 3ILOA 3OFFA 2L9NA 2B7CB 4K5SA 3DOKB 2CPDA 1R6VA 4ZPDA 4J9MA 2UVUA 2HK3A 3TYTA 3EGNA 5K14A 1U1KA 3DDKA 3ZTOA 2VG6A 3DU5A 2ZE2B 4DPYA 3HO1A 3I4PA 3DRXA 3MOJB 2CQ1A 1PILA 3CCLS 2MMYA 3H90A 1IJEB 3M8ZA 4FP9A 2DNRA 2DHSA 4NYOA 4NX9A 5LT5A 4O44B 3MECA 3MCMA 3KTQA 3LANA 3MEEB 4FS1A 3MWBA 1DBDA 2FHKA 4OX9J 1OY6A 3ENWA 4DX5A 1XBWA 2JLEA 4O0IA 2DXEA 1RHKB 4JBCA 5DDPC 2RE1A 4G1QA 3RBZA 3HVWA 1OQ3A 3HKWA 2WB1D 2C2OB 4NEYA 4ED8A 4YDDB 4EYIB 3R7SB 1KN6A 5HLFA 2LCWA 1NKEA 4F0HA 1X0FA 4HYKA 3HZGA 3PDNA 2HHUA 2H4YB 2G0CA 2AX0A 2DT9A 1XMQJ 3EX7B 2CQCA 1V3SA 5CA5A 3MEKA 1CG2A 1BUXA 3MM7B 1K73T 2XULA 1WC0A 1NZ8A 2Q1LA 1TR0A 3D4JA 4KQZA 4OMFG 3RBDA 4ZA1A 5B09A 2KZMA 1LWFB 1UJ6A 3N9UC 1JWWA 3I87A 4AFFA 3CD0A 3SI8A 2DGOA 3M9MB 1EP4B 2Q6CA 2RQCA 2JEIA 4Y2MA 2UU9F 4FYYB 2CWKA 3CIZA 1T94A 3BSCA 3AJ2A 2QE5A 2CJXB 2CZ9A 4CYUB 4DR1F 1WACA 2CPEA 3PJ9A 1QUVA 2H3EB 2XMUA 4MK9A 1RTHA 2IYGA 2M8DB 2ZVSA 2B9XA 3ITHB 4JI3F 3N5BA 1IBMJ 4YEAA 3D1HA 4A8XA 1X8DA 2RQKA 2YWHA 1Q5YA 2L48A 5KFRA 5ADZA 4YR3A 2B3TB 1ELOA 4C0HA 2HQFA 1S1XB 4RUBA 4ZVPB 2OPPB 1SQGA 1WHVA 2ZHOA 3DLEA 4X4QA 5KFVA 4IOCQ 1SC4B 5CCLA 5AJ3J 2W2MP 3LTOA 2X1AA 3W3SA 3LP0A 3FVYA 3KUHA 3SSSA 1RTDA 4Y2IA 2BKOA 2DR9A 3SCJE 2HNZA 3M30B 2FLOA 1H2UX 1RWUA 5FLXU 1GMWA 3UNYA 2XG8A 3LAKA 4BWJA 3IM9A 5DGBA 7FDRA 3HHLC 5J1EB 4ZVOB 1XMBA 1YHQS 4USHA 3CDAA 3BQ0A 2HHHF 1RHMB 2KRBA 2B56A 2CQ3A 1VC5A 3MUMP 5BXIA 1FEEA 2RF2A 2ATLA 4PQUA 1W2BR 2OGUA 2H1YA 3AD8C 4DU8A 1S1VB 1C0UB 2VG7B 4CTAB 2IA6A 1I3OB 3D66A 3SFUA 4MT1A 1X7VA 3MMAA 2VKZG 3K2YA 2MDAA 5AXMA 2ALZA 3BPSP 4YOEA 1IXKA 1U6BA 3DDNA 1S4EA 2MKKA 2R7TA 2ZBCA 4PWWA 2DPIA 1U8SA 2MQMA 2CJYB 2OUGA 2XSJB 1PCAA 4NYPA 1AYEA 2UUAJ 3NGRA 4N76A 2YNFA 2W9BB 4IFVB 2ACYA 4OFZA 4XAKA 3M32B 4B3OA 3MDFA 1I6JA 4V1Ak 2PO4A 4NXMF 1Y3JA 1RISA 4IQMA 1GK8A 1JB0C 3EPIA 1RTIB 1VRTA 3RB6A 4YP3A 3DN9A 1FDNA 1WF0A 2CKWA 2GQ2A 1N32F 3GIIA 4KR0B 4PXEA 5JXSA 3M9OB 1ZA1B 2D74B 3EVMA 4MJKA 3NGTA 4QWDA 1S0OA 1FDBA 3CGIA 4ILLA 4IR1A 1CS4B 1FEHA 4KH0B 5AT1B 2RRNA 4F2SA 2AGOA 1HKAA 1TL3B 1RBAA 2AWZA 4R0EA 3KLHA 3FJ2A 2W7OA 3TZXA 3C16A 3FEXB 3LGHA 3VTIA 3PTWA 2BYCA 3E2EA 4XTTA 4RBTA 3FGVA 2AF6A 2LQ9A 3FSXA 4NASA 3ZXWA 3D54A 1UP1A 4YB5A 1P27B 3R2CJ 1URNA 3UVJA 2K3KA 1UL3A 4DPXA 1S4FA 3H7HB 1JNZB 4A47A 2GVZB 2WCXA 3FFIA 1JJHA 4AQYJ 1TKZA 1NJYA 2WOMA 3R9LA 4F67A 4DV2J 3T19A 1ITPA 1UFWA 3CCUS 3QRQA 3EGZA 4DSLA 1S59A 3E8OA 4WFNQ 1R0AB 3RB0A 4DCPB 2HHVA 3ZZRA 1YJWS 1HI0P 5JVGQ 2UVRA 1NRKA 2QL5B 2W9AA 5KAKA 4USMA 3U7JA 2JWNA 4JI1F 2ZEJA 3OVBA 4DU7A 5HVGA 4LF5F 1TKXB 5K8MA 5IM0B 4B17A 1FWPA 3BSOA 3WC0A 2HHPA 3RRKA 4LQ9A 2E7VA 3BQ1A 4XPEA 4PG7A 3U1MA 4AUKA 2QV6A 4ECWA 1VI7A 2SXLA 1RT1A 5DLGA 2FJAB 3TVZA 1T05B 1VQ6S 3AH6A 4JI7J 2M0GB 3GYGA 4C8LA 4RW9A 1O8BA 4KH1B 4EK2A 4TU9A 3IS9A 4WP8A 3PEHA 5LOQA 1F5CA 4NXNJ 5BYRA 3CCMS 4ZIVA 1H74A 3GILA 1N56A 4BWMA 3QIDA 3ZC4A 3RBEA 2ZM6F 2B4PA 4IKAA 1PIEA 4ITSA 3D0HE 4U7UK 4YHHF 3GR0A 4KFBB 4CO5A 4L72B 4Q43A 4EWTA 3H2VE 3GYXB 3DOMB 3HHNB 3UD5A 1PBAA 4I2PA 1QY7A 4YB1P 1RAOA 5ETOA 2JLFA 3N79A 1IBLJ 4DEZA 1X4CA 4DN9A 2YWEA 4NZ6A 2AGPA 2M52A 5GMDA 3TA1A 1T8EA 2HIQA 3DDIA 2NREA 2YY3A 2MKCA 2MLYA 4OJHA 5J1NA 1TV6B 2IAJB 2RU3A 1DQ8A 3KUEA 4HT7A 4ZN1A 3BBFA 5HMXA 1GEHA 4B3SF 2IRXA 1S6PA 4DR5J 2KU7A 1YITS 4DQPA 5T14A 2R8HA 3HJFA 4PWDB 5B08A 5KT7A 3KLGB 3OR2B 3J7YI 3N6LA 3KJNB 4KHMA 3NCRA 5I42B 3VWSA 2C3OA 1Q4RA 2Z57B 1HR0F 2VPWB 5GAEU 4XK8C 3C19A 4PXCA 5THWA 5KFGA 1QSLA 3PO5A 3H4BA 4NLWA 3VZIA 4DPOA 2H48B 4ED7A 4LF9J 5C2CA 1HWKA 2YKNA 1RLCL 2MGZB 3TZZA 2DNPA 1N6QA 2QFIA 1BLUA 5IZHA 4JI6J 2JHEA 1ZAWA 3JYTA 1Y7PA 4NRTA 2UUTA 4P75A 1HBOB 2GQQA 4QU6A 4J91A 4Z37A 2AEMA 2FLPA 4RWXA 3CJKB 5LMUJ 3UD4P 3IRXB 3L9ZA 3JSBA 4IFYA 3B54A 3MPWA 3TW0A 2CPXA 4IO9Q 4JI4J 4ED5A 2BW2A 4AYBD 4UOCA 3R5GA 1BE4A 4EBEA 1CPZA 4IDKB 2C22A 4OYXA 4RW8A 5A8RA 1RDRA 2MY8A 3S6EA 3GIMA 4ZPAA 3W2WA 1JKHB 1F9EB 4DV0J 1S48A 3H20A 4OYBA 3X3UA 2C2MB 3GFZA 4K2XA 2QLBB 2GIFA 4P52A 2RNEA 3H5UA 2W2PP 1NK8A 2IFXA 2ZOGA 1WOSA 2XMJA 3UR3C 4PZVA 1YGYA 5E0OA 1Y4ZB 4LBPA 5KFMA 1CJUA 4NZ0A 4G65A 4KSEB 4C98A 4ZITA 3BJYA 2YNHB 5KFXA 4LF6J 2RU9A 4K4ZA 4QIGA 2WTFA 4D3HA 5J2PB 3OLAA 3OTOF 1FJGJ 2KT2A 3POTA 3AXKA 2BJDA 1H2TZ 4PUOA 3TR5A 3M8YA 2OIHA 1FXLA 1JLFB 1SKSA 1NSAA 3FRZA 5HBMB 4ZPBA 5L46A 2BRKA 4RUCA 3QAUA 4HVZA 3LQVA 4DS5A 1SQFA 2HYIB 2XWXA 3R5DA 3V6KA 2KM8B 1NU4A 3IM8A 5KT5A 3LP1B 1TZ0A 3NGKA 3AXMA 3QLHA 3AQPA 1Q16B 4F25A 1I1GA 2FB0A 4CLLA 2FGOA 3JXOA 3MMBA 3MM9B 4R0JA 1FX2A 2HS4A 4JUZA 4AL7A 4ENOA 1AZSB 1TVRA 5J2NB 4ZP6A 1K47A 4X4NA 1WG1A 2F8EX 1N36J 4LF8J 3MI7X 1ZZFA 1BHNA 4I64A 4RZRA 2AIRB 1YJRA 1FKAF 3NAHA 4F4WA 2QLFB 5A6WA 2DR7A 4ETXA 1YSJA 3UI3A 3CJTA 1P6TA 1TMJA 4BBYA 4RNMA 1BC6A 3V2UC 1HQEB 1NHVA 2G2ZA 3H0PA 3NBPA 5H1SV 3CB4A 2QMXA 1IBCB 4ZPVR 5L1LA 2KB2A 3DKDA 4WK3A 2Z4PA 1KRPA 2MLZA 5F8HA 3PM9A 3GFYA 2YWWA 3DNCA 4Q8FA 3VGUA 4FXVA 5DQHA 2NCKL 2W2NP 4IG3A 4QWBA 1WTFA 2BR0A 2IMOA 2DO4A 2ADCA 3T5JA 5EX3A 3QZ8A 2ATCB 1Q86T 1T9XA 2EK1A 3BBBA 4NCGA 4NCAA 1FXDA 2VQFF 3TA0A 4CO3A 1K0VA 1L3KA 3PG9A 1A6LA 2B8PA 2H5IB 3ZTQA 2X1BA 4JI2F 1RA7A 4JP8A 3DYAA 2YX4A 3W9HA 2IPOB 1KLMA 2LQJA 5HQ8A 1HBUA 5C24A 1OSDA 2FVPA 3B8HA 1D09B 1FD8A 4RUAA 1IKXB 1JLAA 5EGYA 1QAYA 2UVVA 3OL6A 1NDKA 3MFIA 4NLGA 4LF7J 3ENAA 3BPDA 3DI6A 1CJTA 4OZ1A 3PW0A 2FUG9 3I32A 2BBEA 2ZKTA 3KG4A 3CMAS 4DV4F 4HHHA 5JMNA 4M95A 2FDNA 2F4FA 3FSIA 3FBBA 2BA9A 3CEDA 2IJRA 2OPSB 1TUVA 1H7WA 3IA0A 3KYLA 3ET6B 4FYVB 2P9CA 2PC6A 1OY9A 1FD2A 1UJ4A 1LWCA 4RNNA 2GJIA 3IR7B 4Y2AA 1T03B 2RAQA 3NOCA 2MXYA 4NWBA 1SC3B 1HYSB 1YLXA 2Y8WA 3D2WA 4NLYA 1H72C 2K1RA 4B3TJ 4Q7AA 3P5BP 4ECVA 4LRCA 1RAFB 3IG1B 1MROB 1U49A 1YK9A 3G86A 1FRKA 4IOBA 3RJMB 5CHCB 3MOZA 2F4VJ 2LU1A 4E8UA 3GV5B 4NL5A 1O0PA 3EPGA 2Y3YA 4DUYJ 2F9DA 4XIUA 3RG6A 1T02A 2XMMA 2AJ4A 1SB6A 4N5SA
chains in the Genus database with same CATH topology
4JI3J 4RJVA 4KY3A 4DV3J 4JV5J 1IBMJ 5LM7E 4DUZJ 4DR7J 4DV6J 3W1YC 2UUBJ 4DR1J 3IMQJ 4NXMJ 2MEWA 1HNWJ 4JI8J 4LF9J 4DR6J 2UXBJ 3J7AN 1XMQJ 4DR3J 4DV7J 1J5EJ 3D3BJ 5LMNJ 4LF4J 1IBLJ 2UXDJ 4LFCJ 2E5LJ 4LF5J 4YHHJ 1HR0J 5A2QU 1N32J 3R2DJ 4DV4J 1XNRJ 2VQEJ 4JI6J 2VQFJ 2KVQE 4KYZA 4PWWA 4GKKJ 1HNZJ 4X66J 4B3RJ 4JI2J 4DV5J 1N34J 4LF6J 4JI1J 4X62J 5BR8J 2UUAJ 5AJ3J 1HNXJ 5LMUJ 1N36J 4LF8J 3T1YJ 1IBKJ 2UUCJ 3J80U 4JI5J 4JI7J 4OX9J 2UXCJ 4B3TJ 1FJGJ 3OTOJ 4X64J 4B3MJ 1XMOJ 2MQ8A 2UU9J 4K0KJ 4JI4J 3R2CJ 4DV1J 2KL8A 4NEZA 5IT9U 2MTLA 3T1HJ 3JAMU 1XNQJ 4NXNJ 4B3SJ 4DR5J 5FLXU 4DR2J 4LFBJ 4V1Ak 4YY3J 1N33J 5IWAJ 4AQYJ 4JYAJ 4LF7J 2F4VJ 1I94J 4DV2J 4JI0J 4DR4J 4KHPJ 4LFAJ 4DV0J 4DUYJ 4NEYA 4HHUA 2ZM6J 3J81U 4X65J 4GKJJ 2HHHJ 3D3CJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 J;  4RJV A;  4KY3 A;  4DV3 J;  4JV5 J;  1IBM J;  5LM7 E;  4DUZ J;  4DR7 J;  4DV6 J;  3W1Y C;  2UUB J;  4DR1 J;  3IMQ J;  4NXM J;  2MEW A;  1HNW J;  4JI8 J;  4LF9 J;  4DR6 J;  2UXB J;  3J7A N;  1XMQ J;  4DR3 J;  4DV7 J;  1J5E J;  3D3B J;  5LMN J;  4LF4 J;  1IBL J;  2UXD J;  4LFC J;  2E5L J;  4LF5 J;  4YHH J;  1HR0 J;  5A2Q U;  1N32 J;  3R2D J;  4DV4 J;  1XNR J;  2VQE J;  4JI6 J;  2VQF J;  2KVQ E;  4KYZ A;  4PWW A;  4GKK J;  1HNZ J;  4X66 J;  4B3R J;  4JI2 J;  4DV5 J;  1N34 J;  4LF6 J;  4JI1 J;  4X62 J;  5BR8 J;  2UUA J;  5AJ3 J;  1HNX J;  5LMU J;  1N36 J;  4LF8 J;  3T1Y J;  1IBK J;  2UUC J;  3J80 U;  4JI5 J;  4JI7 J;  4OX9 J;  2UXC J;  4B3T J;  1FJG J;  3OTO J;  4X64 J;  4B3M J;  1XMO J;  2MQ8 A;  2UU9 J;  4K0K J;  4JI4 J;  3R2C J;  4DV1 J;  2KL8 A;  4NEZ A;  5IT9 U;  2MTL A;  3T1H J;  3JAM U;  1XNQ J;  4NXN J;  4B3S J;  4DR5 J;  5FLX U;  4DR2 J;  4LFB J;  4V1A k;  4YY3 J;  1N33 J;  5IWA J;  4AQY J;  4JYA J;  4LF7 J;  2F4V J;  1I94 J;  4DV2 J;  4JI0 J;  4DR4 J;  4KHP J;  4LFA J;  4DV0 J;  4DUY J;  4NEY A;  4HHU A;  2ZM6 J;  3J81 U;  4X65 J;  4GKJ J;  2HHH J;  3D3C J; 
#chains in the Genus database with same CATH topology
 3UN2 A;  2VBZ A;  4KE5 A;  3PIO Q;  1I51 B;  3VAG A;  2EXU A;  3QYY A;  3M6W A;  3OJU A;  2R2U A;  1F2H A;  4LSZ B;  1T95 A;  2CJQ A;  2V94 A;  2EFN A;  3MR6 A;  3KK1 A;  2E9R X;  1JLG B;  3L3C A;  3I0S B;  3OW2 R;  4ZVT B;  2KFZ A;  3GFH A;  3MM6 B;  3V6D B;  2UUC F;  3SFG A;  2VG5 B;  2AU0 A;  3AT1 B;  5B0E A;  4QYZ J;  1DTT A;  1ZM9 A;  4WTO B;  2QA4 G;  2AJQ A;  3DM2 A;  2E1A A;  3C14 B;  2MKI A;  3HD2 A;  3ADA C;  2UXC J;  1KFS A;  2A2C A;  2OD4 A;  2PMH A;  4U67 Q;  2D9O A;  2HBZ B;  3G8T A;  3D9B A;  2Q6B A;  2WBM A;  2XEX A;  4WKY A;  4KC5 A;  5JUM A;  1U26 A;  1DTQ B;  2GVD B;  4RO0 A;  4FZV A;  3GIR A;  3NWG A;  4N56 A;  1TUW A;  2OFG X;  4CT8 A;  3HHE A;  2R7V A;  3NGD A;  3BBC A;  3MPD A;  3TQE A;  4M5D B;  1SUQ A;  1N5T A;  1RTZ A;  1Q53 A;  1AUD A;  3FQL A;  3BRE A;  1U47 A;  3U27 A;  2VA3 A;  1X5P A;  3N0V A;  2AJ0 A;  5GAH U;  4Q5V A;  2ZOM A;  4OX6 A;  3DLB A;  2QIF A;  4LVO P;  3M2V B;  3KJV B;  5A8K B;  2EBG A;  1S97 A;  5SZT A;  2V4J B;  4KKO B;  1UFL A;  4CDI A;  2KG1 A;  3UFC X;  4UT4 A;  3GE9 A;  2HGM A;  5HQM A;  3BKU A;  5IV4 A;  3G6X A;  4B3R J;  2GGP A;  2W2Q P;  4DV5 J;  3V5R A;  4ICL A;  1DAR A;  2F8H A;  2R7S A;  2C2Z B;  2WAQ D;  2NR0 A;  4IG0 B;  4CQ1 A;  4X4P A;  3A1Y G;  5CYM A;  1ZTW A;  2R3V A;  2GS8 A;  2D69 A;  2GIR A;  2CVI A;  4C2M A;  1ZA2 B;  2D3Z A;  1Q95 G;  4I4B A;  4P74 A;  2LA6 A;  2XMW A;  3O6Q A;  2FJB B;  1ZYQ A;  1FFG B;  5KT6 A;  3V81 B;  2QC3 A;  1OQ6 A;  1IKY B;  4RNF A;  5IV3 A;  5H9E J;  4DPU A;  3C46 A;  2Z8Q A;  1NSQ A;  1M1G A;  1RBO B;  2D3O R;  4ED1 A;  3D0I E;  2G2Y A;  2M8H A;  4CP5 A;  3THT A;  1DAX A;  4A8M P;  4DG1 A;  2IJN A;  2FHJ D;  3CCS S;  2C1E B;  1QE1 B;  1R31 A;  1ZM2 A;  4DR3 J;  4RLE A;  2OI2 A;  4CLF A;  2YPY A;  3Q22 A;  4ALZ A;  1WHX A;  3TEH B;  1RT7 B;  1TL1 B;  1R0B G;  3DLK A;  5LXY A;  4HAC B;  5D4P A;  1BQM A;  2FZK B;  4UY8 5;  3OV7 A;  2GML A;  2W4P A;  5BR8 J;  1WC4 A;  4DPT A;  5ITH A;  4HEA 9;  5KFI A;  2IBK A;  4OX9 F;  1JXL A;  1YRT A;  1NHU A;  1N54 B;  5DQG A;  2CPI A;  4YB6 A;  1LW0 A;  1S7H A;  1U7L A;  4H4K A;  1RYR A;  4F04 B;  4J9Q A;  2VF3 A;  4ANC A;  3CC2 S;  3RAQ A;  2EG1 A;  1ROF A;  2KG0 A;  5D6G A;  1SXL A;  4USK A;  4CZC A;  3U1N A;  5I3Q A;  5KFL A;  4FPI A;  3EWG A;  4CRJ A;  3TRG A;  5D0G A;  2OFH X;  1QJH A;  4DF8 A;  3OBI A;  2NZC A;  4X84 A;  4ID5 B;  3HK2 A;  1B0V A;  1S1U B;  3C6T B;  4IH7 A;  2WHO A;  3HSZ A;  1HNW J;  2UXB J;  2LEC A;  4TYA A;  5ETR A;  4HT5 A;  4NI2 B;  2MQP A;  3VZH A;  5U47 A;  1T3O A;  3KK2 B;  3RRH A;  4O3O A;  1WC3 A;  1Q78 A;  2GMH A;  2J9D E;  2YNI A;  4IR9 A;  1GTE A;  3D6M B;  2KFN A;  4P73 A;  2RUG A;  3LP2 B;  3W65 A;  1FE4 A;  2YNG A;  3T5L A;  3KNA A;  1AB8 A;  1DQA A;  3P49 B;  5LSL A;  1FK9 B;  4GC7 A;  5KFU A;  1MWZ A;  1YBT A;  4F7V A;  5G0R A;  3VV2 B;  5IC6 B;  3DMJ B;  2JFK A;  5KFW A;  2Z58 B;  1OYE A;  1S9E B;  3BGR A;  2ZBP A;  2ZUG A;  3CMQ A;  2Z56 B;  2J6T A;  1RHJ B;  2ZNY A;  1X9S A;  2OSR A;  4WZQ A;  3HVT A;  4RBU A;  1U6F A;  1M5K C;  1CBK A;  3HPO A;  1DY3 A;  3AOD A;  1S6Q B;  3LGN A;  2KJW A;  2JEG A;  5KG6 A;  3Q2T C;  5KG2 A;  4M63 A;  1LW2 B;  3TZY A;  4ZVR B;  1PAE X;  1HNI A;  3J81 j;  1TL5 A;  1FFW B;  3KJQ B;  2E29 A;  1UW9 A;  2NPF A;  1N34 J;  1N88 A;  4U6P A;  5AJ3 F;  3Q8Q B;  4JI5 J;  5DJB A;  3ITH A;  1U24 A;  2WSF C;  2R2R A;  2EFG A;  1BQN B;  1WOO A;  2LDY A;  2M5Y A;  3TAN A;  2PFD A;  3H8Y A;  3JQM A;  3QSY B;  1C4C A;  4GVB B;  4HDG A;  3ZZU A;  1MN9 A;  3SIP B;  2ZNZ A;  2VZ9 A;  2HLT A;  5G4D A;  4TLR A;  1IM4 A;  2X1F A;  5E5N A;  2QT7 A;  1M0S A;  4F2R A;  4UQT A;  4DL4 A;  2E1C A;  4FVC A;  3M8S A;  2JDJ A;  3HVA A;  1HWI A;  3OXG A;  1S0V A;  1JXE A;  1U0H B;  2X7I A;  4MMO A;  4A8K A;  2Y8Y A;  4IQX A;  1IR1 A;  5A8W B;  1TKT A;  1I5O B;  2HFS A;  2RHQ B;  3PEJ A;  4IH5 A;  3E51 A;  2V2V A;  3MM5 B;  2XO7 A;  1XC9 A;  4I6A A;  4ED6 A;  5EWG A;  1REG X;  1S9G B;  1TEL A;  1YBU A;  2ABY A;  1S1V A;  2FJE B;  1C0U A;  3BN4 A;  2C2E A;  2VJU A;  4QQB A;  2Q3P A;  2YKQ A;  5K9F A;  2ZD1 A;  4DWI A;  1HHS A;  3SSR A;  1HBN B;  4BC7 A;  4MFB B;  4OYA A;  2CQH A;  2ZH4 A;  1RCX B;  1M5V C;  4DX8 H;  4Q45 A;  3P45 B;  1TK5 A;  4I6Y A;  4PRF A;  1J5E J;  1JXV A;  2P6S A;  1HNX F;  8AT1 B;  5CYQ A;  1XNR J;  4Q2L A;  1X9M A;  2I9S A;  5HMW A;  3ONQ A;  4S0M A;  3OFH A;  3GP9 A;  2V9W A;  2NPI A;  4DL0 C;  3KLV A;  4QPT A;  2YWG A;  4FNI A;  3VAL A;  1J27 A;  1QTM A;  4B9S A;  5F8N A;  3CCT A;  1KHV A;  3MGJ A;  3OL7 A;  1F9H A;  2FZC B;  3OD2 A;  5C42 B;  1PGZ A;  2CYY A;  3W64 A;  4LRF A;  1MU2 B;  3Q2S C;  1KOO A;  4AQY F;  1IM6 A;  4OHY A;  3TNV A;  1RXO B;  2JLG A;  1MSW D;  5AE1 A;  1J5O B;  4LFA J;  1CS4 A;  2E5G A;  4DDF A;  4UOF A;  1M5O C;  1N5Y B;  2OLW A;  4DBQ A;  1N4L A;  3MEG B;  2F5G A;  2IC3 A;  2VL1 A;  3NP5 A;  2O66 A;  1KVK A;  1VGY A;  5GME A;  4V19 J;  1F5A A;  5J2Q B;  2J0Q D;  1XJW B;  4LF4 J;  1VLY A;  2C28 A;  1VBY A;  4IRK A;  2CQ2 A;  2XGQ A;  2QFJ A;  1IBK F;  2E5I A;  1RT6 B;  5ETL A;  2K8G A;  4C9D A;  4B3M F;  1HWL A;  2ILY A;  4OV1 A;  2R7X A;  2W4D A;  4PPZ A;  3EZO A;  5CCM A;  3HHL A;  3MM8 A;  3BSA A;  1FVS A;  3I31 A;  3O1L A;  4F4Z A;  3MFH A;  1CSJ A;  3SV3 A;  2M70 A;  1YVF A;  3J7Z 5;  3B82 A;  2DR8 A;  4RW7 B;  4ELV A;  1KSP A;  4BDP A;  1Q8I A;  2BQ3 A;  4OI6 A;  3BV8 A;  2I5J A;  5IM0 A;  3W2V A;  4M5N A;  2DGV A;  4OHW A;  1R8C A;  3QIP B;  2BZ2 A;  3ZZY A;  2VFT A;  1IKW A;  2DXD A;  4F4Y A;  3BSN A;  2EKN A;  2NXC A;  2R42 A;  3DHW C;  2K2P A;  1SV5 B;  3CPW R;  2FVR A;  2LKZ A;  1FNX H;  4N41 A;  2UXD J;  4LFC J;  2G0J A;  1WOP A;  1HFE L;  3CWJ A;  3OR1 B;  4UST A;  4KGK A;  2RDD A;  1T9Y A;  3MTJ A;  3HM9 A;  2BJ1 A;  2AZ3 A;  2VD3 A;  3EXY A;  4ATN A;  4DSK A;  1RU1 A;  5HRO B;  3AB4 B;  2ADB A;  2HVE A;  4LSN B;  1OWX A;  1WTB A;  5KG1 A;  2VIC A;  4L3N A;  1XTZ A;  1Y5N B;  3TUZ C;  4KFB A;  5HI7 A;  3CO0 P;  4I2Q A;  2RSQ A;  4DJB A;  2MTL A;  4JV0 A;  2FGC A;  5GAG I;  3LWL A;  2XLK A;  1HIY A;  3DRR A;  4CLK A;  4DR4 J;  4FYD A;  4K7Q A;  1ZAV A;  2F7V A;  3M8P B;  3FKB A;  1R3N A;  3W1Y C;  1EAY C;  4MK8 A;  4L6V 3;  4CLY A;  2OH2 A;  2FZG B;  1KQF B;  3HKZ D;  3K5L A;  1EQM A;  1WUU A;  3T6B A;  2CJK A;  2JJ4 D;  5MAO A;  4NLS A;  4PWU A;  3RBX A;  1QDU B;  3IAM 9;  3DC2 A;  3CCE S;  1V5V A;  5L8R C;  1B7F A;  4JI6 F;  2E9Z A;  1SH3 A;  1Z4U A;  3VR1 A;  3KWM A;  3ZZT A;  5D3G A;  1VBX A;  3OSP A;  2ZFH A;  2DIS A;  3UCG A;  3KLG A;  3LAM A;  3TAP A;  2CNO B;  4QYZ K;  5LMU F;  3H2L A;  5DDR C;  2HEK A;  1T11 A;  4LR8 A;  4JI4 F;  2C2N A;  1RQ0 A;  5KFO A;  3Q0A A;  5GMK a;  2C3Y A;  3SQO P;  2QL7 B;  2GHP A;  3UE2 A;  2WZ1 A;  5KT3 A;  1B0T A;  2MKY A;  4W98 A;  1VR6 A;  1YX2 A;  4CLT A;  3W9I A;  3OTC A;  5E3R A;  5J2M A;  1P1T A;  2O01 C;  1U1R A;  2R8G A;  3OXF A;  4RPF A;  3EZ5 A;  2VFV A;  2ZHA A;  3CJ0 A;  3HSG A;  4TN2 A;  3M1V B;  5HSP A;  5DM7 Q;  2OHD A;  2C3U A;  2V63 A;  1FKP B;  4G6V B;  4PG8 A;  4NYZ A;  2VFU A;  1WEX A;  1RZM A;  5E3A A;  2CQP A;  1XWL A;  1ACM B;  5DZ6 A;  2G1H A;  3T41 A;  2E9T A;  3IRX A;  2QRR A;  2W1B A;  3ZZZ A;  1U45 A;  4LIR A;  4R8U B;  2DXF A;  1ZM3 A;  2PGC A;  1NB7 A;  1HHQ A;  1KC8 T;  3KG1 A;  3G6V A;  5DRK A;  3UR0 A;  3MF5 A;  1CC8 A;  4LSL A;  2VH7 A;  1B70 B;  2QTW A;  2OPQ A;  1OJ4 A;  3T1Y J;  3V4I B;  4W92 B;  5D77 A;  3QRR A;  3R7N B;  3QT5 A;  1TK8 A;  2YQ0 A;  5DDQ C;  3AOC A;  3K58 A;  1WDT A;  3M8Q A;  5L9N A;  1HHT P;  5DDO C;  3EDQ B;  2QMU B;  1WDD A;  4YY3 J;  2V34 A;  1YWX A;  1VC6 A;  1EZZ B;  3PRB A;  5K14 B;  4TQR A;  1AFI A;  4DR6 F;  3A8K A;  2VG6 B;  1K1S A;  3NAI A;  8RUC A;  3KMQ A;  2OMO A;  3ISN D;  4KY3 A;  5IQ6 A;  5F0U A;  4DV3 J;  4NML A;  3A12 A;  2DNK A;  2RD5 C;  4P2M A;  5L1J A;  3ETO A;  5H9E K;  4C11 A;  1WF1 A;  3P8B B;  4ILM A;  2WVE A;  1HQU B;  3QT6 A;  3IBF B;  5LMN J;  4HI2 A;  5KFH A;  1X9W A;  1VQM S;  2BEF A;  4ZVQ B;  2GJF A;  2OTL S;  2RIJ A;  3OT9 A;  3QQC D;  3UDL A;  4G1Q B;  4YME A;  1EJ7 L;  3D0G E;  1WNE A;  2OAU A;  1JLC B;  5D0H A;  4DSE A;  2B6A A;  4F0K A;  4LJM A;  1HQ2 A;  1OPZ A;  2NUH A;  5HLF B;  3BKT A;  1FER A;  2HQC A;  2NS1 B;  2BAB A;  3DRS A;  2YQ3 A;  3MAA A;  3HVR A;  2AYG A;  3E01 A;  5A0Y A;  2FIU A;  2BOP A;  2N3L A;  4J9K A;  4JI0 J;  5HN0 A;  4X4O A;  3OTD A;  3MM9 A;  5H9F J;  4KO0 A;  4LIW A;  4FDF A;  2EFQ A;  2KHD A;  1FXR A;  4WPA A;  1HI1 A;  2FYX A;  2DCU B;  1U2C A;  4TVA B;  3C15 A;  2HND A;  3H98 A;  4KJI A;  2HMI A;  1S79 A;  3NNA A;  3G82 A;  3VGV A;  5KOW A;  2DGS A;  4WP3 A;  3Q86 A;  1NM2 A;  2QN6 B;  4K0K F;  2ROG A;  1LFW A;  4WU2 A;  2FC8 A;  2DR6 A;  2EI5 A;  2OEM A;  1RTH B;  1UW4 A;  1RWM B;  2EG2 A;  1VS3 A;  5KT2 A;  3QPI A;  1RT5 A;  1CJV A;  4QWC A;  4UQG A;  2MQ8 A;  4ELT A;  2B5J A;  4N7T A;  3RRG A;  2DH7 A;  1PJ6 A;  5C5J A;  2LXI A;  5EUH A;  3K8W A;  3KNG A;  1X4H A;  2J0S D;  1UVI A;  3NS7 B;  1TP7 A;  3LPY A;  3KHG A;  3G4S S;  4A8S A;  1YJV A;  1R0C B;  5DET A;  2I38 A;  3O2I A;  4DR1 J;  1RYS A;  3QJP A;  3DLE B;  3H59 A;  1KOH A;  2YKA A;  2JC1 A;  1U1M A;  3DRP A;  3CME S;  1N5V A;  5LJ5 Y;  3JSY A;  3PW5 A;  3NGU A;  2QL9 B;  3LP0 B;  1RTD B;  1GH8 A;  4F4K A;  4PR6 A;  4OHV A;  4QR2 A;  2HNZ B;  2DNM A;  1X4B A;  2HS3 A;  3KLE B;  4GKK J;  4CH7 A;  1SKU B;  1NCL A;  3C2P A;  3CD6 S;  1X5O A;  5DGA A;  3OVS A;  2V2Z A;  2J76 E;  1RHR B;  3VQT A;  3QO9 A;  1Q81 T;  2RF2 B;  3GSD A;  4IUF A;  4PQU B;  1VBK A;  1VQ7 S;  3BGU A;  3QWP A;  4MAK A;  3ILL A;  4HHJ A;  3GJR B;  2J9E A;  3NXZ A;  2QMW A;  2ZZN A;  3G8S A;  1B3T A;  2E7W A;  2KXN B;  1TFW A;  3H4D A;  3MMA B;  4U8V A;  2DY1 A;  1SCJ B;  2DYA A;  1X4G A;  3J7A 1;  5E3C A;  3HMJ G;  1S49 A;  4FBT A;  1W25 A;  2LFV A;  3C6U A;  3IMQ J;  4WZM A;  5EX0 A;  3OJS A;  1FWK A;  2CQG A;  3PYG A;  4ECX A;  3TQ1 A;  3R8Y A;  1FT8 A;  2JVR A;  1WG4 A;  5KOX A;  2YNF B;  3RZA A;  1XN9 A;  1RU2 A;  1D0E A;  1NAQ A;  3EIC A;  2YKP A;  2R8K A;  2FJV A;  5B0G A;  4B3O B;  1NDL A;  3CDU A;  2DNY A;  2DVI A;  1FTR A;  2UP1 A;  2GO9 A;  1MML A;  3R6L B;  2DJW A;  4OLO A;  2HAF A;  2HWH A;  1NPR A;  2CQD A;  3I82 A;  4ZVE A;  4DZ6 A;  5L39 A;  1VRT B;  1QVG R;  2UXC F;  1RT2 A;  3B4D A;  4L75 A;  7FD1 A;  4NA2 A;  2J9D A;  1NDP A;  3EJM A;  3RAX A;  2DIT A;  2MYF A;  3R6G B;  3TAR A;  2ALY B;  1DQ9 A;  2J5A A;  1KWM A;  2XS2 A;  2H5J B;  3FQK A;  2RDI A;  3IRW P;  5CAB A;  2BAN A;  3OTE A;  2QG9 B;  2NZ4 A;  3KLH B;  2H65 B;  1YRX A;  1WKJ A;  3LGM A;  2HBR B;  1RWX B;  4NXM J;  4ZHR A;  3J7A N;  2E1P A;  3CIM A;  3PFE A;  2HFZ A;  2MSS A;  1X0P A;  2KTQ A;  1K9M T;  3K5O A;  4ZVH A;  2RRB A;  3BS9 A;  1N32 J;  1SPB P;  3UVJ B;  5KFS A;  3ILI A;  1B4S A;  4B02 A;  1G1X A;  3FFI B;  3F73 A;  3Q8R B;  4DV5 F;  2BXJ A;  5IQQ A;  1TKZ B;  4ZJO A;  1XNQ F;  2CPJ A;  2KT3 A;  2WOM B;  4IYQ A;  2HK2 A;  3QFH A;  2CDQ A;  2UVW A;  4NLP A;  4JYA F;  3AA9 A;  5ETQ A;  1UET A;  1K1Q A;  3UN3 A;  3UDE A;  1GX6 A;  2EC2 A;  1RWP B;  5L38 A;  2XZW A;  3UNG C;  3KFW X;  5T41 A;  2VBX A;  3KJV A;  5IWA J;  4TNO A;  2P2C B;  4H4M A;  4DSI A;  4KGX B;  1YKW A;  2XS7 A;  2BX6 A;  3GWC A;  2DKO B;  5D4N A;  4C3L A;  1UVN A;  2HRY A;  3AQO A;  4KKO A;  2ASY A;  2C3M A;  2IVF B;  5I3U A;  2XHC A;  4EO8 A;  3EXC X;  2J6U A;  4LVN P;  3M05 A;  2FJX A;  1NDC A;  3PJW A;  1SJR A;  4URQ U;  4P7T A;  4ECQ A;  1X4A A;  2XZD B;  2W8K A;  1SIW B;  5IOL A;  4DR3 F;  5KFK A;  1REV A;  2E5L J;  3BGO P;  4WII A;  2BQR A;  4RW9 B;  5J1P A;  4ZJL A;  3AAW B;  3IS9 B;  4ECR A;  1RAG B;  1U09 A;  4RBV A;  3K7R A;  3HFV A;  2GIQ A;  3DLG A;  3LA0 A;  2XYP B;  4JI1 J;  1P9Q C;  2MHN A;  2BKP A;  1W26 A;  2F63 A;  1K0T A;  1N0U A;  4O3S A;  2G1D A;  2U1A A;  2KDO A;  3SYZ A;  3KK3 A;  2RB7 A;  4E2F B;  2BRL A;  1YRU A;  4Z2X A;  1T0T V;  5SUH A;  2UUW A;  3FUY A;  4KPC A;  1KON A;  4UZB A;  1FES A;  1FRM A;  5L9X A;  4GC6 A;  2YKO A;  3K59 A;  5L1I A;  1H2V Z;  1TMM A;  4ED4 A;  2ZH6 A;  4ER8 A;  2ZDP A;  2ZH8 A;  1E6V A;  2CG4 A;  1Y3K A;  4USU A;  2ROP A;  3OUY A;  3FMB A;  5A6P A;  1HNW F;  1F0X A;  2DK2 A;  1APS A;  2VOD A;  4YHH J;  1P8G A;  2KKH A;  3ZNJ 1;  1LEO A;  4ZN3 A;  5K8P A;  4X4S A;  2R9L A;  2LVW A;  2XCP A;  4HH0 A;  3BH7 B;  4USJ C;  2JFD A;  3CCR S;  2DH8 A;  1WOR A;  1KLN A;  4OJ3 A;  4LFB F;  4J9O A;  4L73 A;  1NZA A;  5IT0 A;  5B0D A;  1TFY A;  1TQL A;  2PA3 A;  1XQI A;  3P3D A;  2Z30 B;  3KUG A;  1S12 A;  4L76 A;  1PKU A;  2C3P A;  4LR9 A;  3C6T A;  4RW4 A;  4AL5 A;  4DR2 J;  3MMC A;  2YKN B;  3Q24 A;  4KV8 A;  4OJ1 A;  4HTJ A;  1F3V A;  1N6Q B;  3PYE A;  2BAC A;  3DFE A;  1IVZ A;  3I0R A;  2XGP A;  1S76 D;  3OVA A;  3M8W A;  2M3D A;  2J7U A;  4CI0 B;  3N4W A;  3JYT B;  5BJR A;  2OEJ A;  2OKQ A;  2ZJR Q;  3MUV P;  3IFE A;  4IFY B;  2YBV A;  1HR0 J;  1QTN B;  1UA1 A;  3IBC B;  1V5I B;  2J9C A;  4W90 B;  3BYR A;  4WXW A;  2KXF A;  4RW8 B;  5A8R B;  2LQ5 A;  3DMJ A;  3R3T A;  1N34 F;  4ZLL A;  3W2W B;  4OQJ A;  4TXS A;  3G6E S;  4EI2 A;  1TL7 A;  2HQ3 A;  4WJB A;  2XMA A;  5HJY A;  4JI5 F;  4OZN A;  3AB2 B;  2DNH A;  3NCP A;  1DZ5 A;  4ZK7 M;  2FPH X;  4M5H A;  3PX6 A;  3WIU A;  1G7C B;  4UOG A;  4TY9 A;  3JAM U;  2DNO A;  4C0O C;  1VQN S;  3IR5 B;  3KLF A;  3MAH A;  2I8E A;  3DGV A;  1ARO P;  3EZU A;  1YJ7 A;  3US5 A;  3TO8 A;  3NS5 A;  2FTR A;  1RAA B;  4URG A;  4O23 A;  1SQE A;  3F44 A;  2CZ4 A;  2QYC A;  5L1K A;  1W2I A;  1O5J A;  2IDE A;  1UAW A;  2KXH A;  4L3K A;  3QT8 A;  1FDD A;  1MMD A;  3MD3 A;  4KT0 C;  3CCZ A;  1EHW A;  1M5P C;  2ZH9 A;  2RRA A;  4QR0 A;  4B08 A;  3POT B;  2YX7 A;  4K4Y A;  2QSF A;  3IC1 A;  4PUO B;  2U2F A;  1RAH B;  4NLQ A;  4J90 A;  3OL9 A;  2HHT A;  1LNQ A;  3SCL E;  2RVJ A;  4RUH A;  2V5H G;  2HQD A;  1M5S A;  3JQJ A;  3J7Y U;  2PN6 A;  4ZVS B;  4M5G A;  1V3Z A;  3RGI A;  2JRS A;  1L5U A;  4QW9 A;  4J9L A;  1S1W A;  2AGQ A;  4OI4 A;  4PXB A;  1NPP A;  3AFG A;  3MED A;  1WD6 A;  3I9Z A;  4OZJ A;  5DG8 A;  2KH9 A;  1EKR A;  3A8I A;  3BQ2 A;  4OYW A;  2OPR A;  3AY0 A;  3U1L A;  2EK6 A;  5HO4 A;  1RT4 A;  4OZL A;  3MMB B;  3FCV A;  3G9C A;  4MKA A;  1H73 A;  3W66 A;  4A8F A;  5HK4 A;  3AOA A;  4DL2 A;  3UW1 A;  5KTQ A;  4NA1 A;  1TVR B;  4N8O A;  2L41 A;  3CJ2 A;  3OQ2 A;  1S7I A;  1C0T A;  1VQP S;  5KG0 A;  3FDS A;  2HS0 A;  1RAJ A;  1M1H A;  3JQK A;  3QBC A;  3Q8S B;  5F8I A;  3CTR A;  2QA4 S;  2R8I A;  3KJF B;  5RUB A;  4ECT A;  1J5E F;  4IO1 A;  1H7X A;  4B9L A;  4X4U A;  5KFD A;  1S99 A;  1WG5 A;  1WI6 A;  5KT4 A;  3WZ0 A;  5A2Q U;  1U2F A;  1FRL A;  2DR5 A;  1XNR F;  3PX4 A;  3JTN A;  4H54 A;  2B43 A;  3HUL A;  1RBL A;  1QUP A;  3SDE A;  4EFA C;  3NBP B;  2CPF A;  2DO0 A;  4DCO B;  1VRU A;  2V68 A;  1RWK B;  1YJU A;  2Z2M A;  3P6Y C;  2CPH A;  2PII A;  2RH3 A;  3OTB A;  1HBN A;  5CXT A;  1U1P A;  1N48 A;  1XR5 A;  3HLU A;  4ZMM A;  2QSW A;  1NPK A;  3RW6 A;  3TAQ A;  4OI0 A;  5F41 A;  1I94 J;  2WSC C;  2MZJ A;  3NMR A;  2EVZ A;  4DFK A;  4LFA F;  1EAR A;  1FJ7 A;  3GG0 A;  4NCG B;  4H4O A;  5KFT A;  1HBM A;  4P9S A;  4DR7 J;  4L74 A;  4CO0 A;  3HHK A;  1YZ6 A;  5H9F K;  1KD1 T;  2EKY A;  3DYA B;  4FVM A;  1KLM B;  3TAM A;  1PYO B;  2XTJ P;  2XLI A;  1U1O A;  4K8R A;  1FE0 A;  3BO2 A;  1HBU B;  1VMB A;  5C24 B;  2IDL A;  3N6M A;  2HAI A;  4LF4 F;  1Y00 A;  2LQB A;  1BWE A;  4LF2 A;  2NQP A;  2P5V A;  2BE9 B;  2RHS B;  4V19 X;  1S6U A;  5IS2 A;  2F9J A;  1JIH A;  1D9F A;  1CJK A;  3R5J B;  4ZS6 A;  3DI6 B;  3MUR P;  1J5O A;  1C2P A;  1IKV B;  2HUR A;  3CCV S;  2DPJ A;  4EZ9 A;  4DSJ A;  5D8H B;  2IM2 A;  3HSD A;  3T6J A;  3K0J A;  2N7Y A;  2OJ3 A;  3HT0 A;  1Z2Z A;  3A13 A;  3HSJ A;  1O51 A;  4A8Y A;  2HPU A;  4AND A;  4A8Q A;  1NK6 A;  2BM1 A;  3J80 Y;  4J9R A;  3PCO B;  4USV A;  3LF0 A;  4J37 A;  3IXQ A;  4K4S A;  2JX2 A;  3CW2 C;  1QLN A;  3CJR A;  4EYH B;  4KTQ A;  2AEF A;  3P4U B;  1CUL A;  3M2U A;  3TUI C;  3NWR A;  4OHZ A;  1D8Y A;  1LWC B;  1YJT A;  3UD3 P;  3LPE A;  3U02 A;  1VQY A;  2EPI A;  4X66 F;  3M2R A;  2CQ0 A;  3FMW A;  5T7L A;  2W4C A;  3PO4 A;  4LF1 A;  2PDA A;  4A48 A;  2K1R B;  2UXD F;  3KDN A;  2PEB A;  2B4U A;  2DIV A;  5F0W A;  2XY7 A;  4DV4 J;  2C2D A;  1WJ9 A;  2XY6 A;  4K50 A;  3EE3 A;  2IY5 B;  1X4E A;  2DGW A;  2HZA A;  2CQ4 A;  3BEG B;  2DY9 A;  5HVF A;  4RW7 A;  2HZV A;  2ILZ A;  1UFK A;  4OYI A;  5EHH A;  3NMA A;  2HVI A;  4AXJ A;  2XWY A;  2RIL A;  2FLL A;  3OFG A;  4U95 A;  4ETZ A;  4KIA A;  4TYB A;  4FS2 A;  4DFM A;  1R7I A;  4RX6 A;  1SV5 A;  3CJS A;  4QCL A;  4DR4 F;  1UEV A;  4DHV A;  2ZH2 A;  1Y9O A;  3CNQ P;  1VQS A;  3IWN C;  1DTT B;  1RSC A;  3DM2 B;  3DOL A;  2XI3 A;  5FDL A;  5C25 A;  3PYF A;  3A3N B;  3LH2 S;  2D7S A;  3FBE A;  3BR8 A;  2BDP A;  2ZOF A;  4RL1 A;  2MHE A;  3DGP B;  2VBW A;  4DUT A;  1S1T A;  1SUQ B;  3V4M A;  2I0X A;  2UUC J;  2Y1J A;  1N5S A;  1VQ4 S;  4R5P A;  3P5T L;  1PJ7 A;  2EW9 A;  4PYA A;  3R5B A;  1NUE A;  3ZFV A;  1TKD A;  3OLB A;  2UUB F;  4EBD A;  4JV2 A;  2XSF A;  4NOH A;  4DLG A;  2Q66 A;  3SQG A;  2MKS A;  3KHH A;  2NYI A;  2DRD A;  2QO3 A;  2VDH A;  4Y34 A;  3L4B C;  2J0W A;  2AW0 A;  2KHC A;  1NO8 A;  2DNG A;  2LXF A;  2IM0 A;  4Q8E A;  2F40 A;  1Q1K A;  1V6H A;  1VQ8 S;  3GON A;  2ZZM A;  2GGP B;  4ICL B;  2MKJ A;  2XNQ A;  5C7P A;  2N3O A;  3I4H X;  1KS2 A;  4C0B A;  5CYM B;  2HHW A;  4RKU C;  2QEX S;  1S5Z A;  2YPZ A;  3VAF A;  2CA9 A;  2E44 A;  3JSR A;  3QZ7 A;  4K4T A;  4RU2 A;  2HW3 A;  2WVB A;  2XC9 A;  3JSM A;  3NLC A;  1UMJ A;  4EMD A;  4C7Q A;  4X62 J;  5KFZ A;  4NLD A;  1UTA A;  4DL5 A;  3TOQ A;  3N6N A;  2HWI A;  3CJ3 A;  1F1B B;  2IRY A;  2OD6 A;  4DG1 B;  1UEU A;  4FYW B;  2Z2Y B;  2IVM A;  4YY3 F;  3FRY A;  2BKN A;  3Q8V A;  1GTH A;  3S01 A;  2ZBQ A;  8ATC B;  3QGI A;  3OHA A;  3TVK A;  2BJ3 A;  3DLK B;  4DV3 F;  1NK7 A;  3QFW A;  1P1L A;  1F2G A;  1BQM B;  2R2T A;  4CLS A;  2A3J A;  1AXQ A;  2HFO A;  1CQM A;  4J9U E;  3TUP A;  4WU3 A;  2DTJ A;  1C1C A;  1PAU B;  1CLF A;  3H5Y A;  5LMN F;  3MCS A;  1LW0 B;  4Q2M A;  1LWE A;  1C4A A;  3ISN C;  1H0H B;  5D4O A;  4CLW A;  4A8W A;  2ASL A;  3DHX A;  1R8A A;  3SV4 A;  1RLD A;  1GXU A;  2WVF A;  5AXL A;  3MR5 A;  1VQ5 S;  2CWX A;  3K17 A;  4G1P A;  2HG4 A;  5KFE A;  4QIW D;  4J9P A;  1QVF R;  4DV1 J;  2LDI A;  4KGM A;  4DQQ A;  3VGS A;  2DRB A;  1SVD A;  2WB4 A;  3RUB L;  3R27 A;  1EIY B;  5IXU A;  4YB7 A;  2D3U A;  1DLO A;  3RTV A;  3V6J A;  1NJI T;  4JI0 F;  1HQU A;  3I5B A;  5HP1 A;  3D6F B;  4HHU A;  2A6M A;  2PE8 A;  1YBA A;  1OPI A;  2OML A;  1GXT A;  3AA8 A;  2XMK A;  2DB1 A;  2YNI B;  1FNO A;  2VPY B;  2WVC A;  4QJV A;  1RTJ A;  5CH7 B;  2DGX A;  1FKO A;  4AD6 A;  3KDO A;  1JLC A;  2YWF A;  5F3T A;  2HFV A;  5E33 A;  2YNG B;  3DRY A;  4I7F A;  1NND A;  2W9C A;  3VAJ A;  2RKI A;  3R2D J;  3N01 A;  1KDN A;  2AX1 A;  1A7G E;  1UA0 A;  2WON B;  5G0R B;  3PX0 A;  1UWB A;  2LA4 A;  4WE1 A;  3PW2 A;  2DIU A;  2RS8 A;  1VBZ A;  2WRM A;  1PO6 A;  4MK7 A;  4TKT A;  3BGR B;  3H5S A;  1JLQ A;  5E3P A;  2BJ9 A;  3K57 A;  1N5Q A;  2D9P A;  4C8O A;  3CXC R;  3HVT B;  4QR1 A;  1U48 A;  4YS2 A;  3EUN A;  1S6O A;  3MD1 A;  1RB0 A;  2G2O A;  3X1L B;  2W8L A;  2J6S A;  2JH3 A;  9ATC B;  5IT9 Y;  1HNI B;  4CO2 A;  4OZ2 A;  5KFJ A;  4ZCK A;  2V2Q A;  4I6W A;  2M7S A;  2VQE F;  2R7R A;  1SIZ A;  2YWK A;  2HVD A;  2A6O A;  1WSV A;  5HL7 Q;  2YKM A;  4QWA A;  2AMC B;  4CH0 S;  2PA8 D;  3PR4 A;  4WK1 A;  3GZ7 A;  4RW6 A;  1N52 B;  3PYD A;  1HMV A;  3CJ5 A;  3FCW A;  2BVZ A;  4HTI A;  4GKK F;  1JJC B;  3M4X A;  4XDD A;  3SXL A;  3CJ4 A;  2J8A A;  3QWU A;  4KPY A;  3O5T B;  1WHW A;  2L08 A;  3CE8 A;  4C3K A;  1VRQ C;  4O4G A;  4B9V A;  2HFN A;  3CJ8 A;  3CJQ A;  1K44 A;  1TK0 A;  4TY8 A;  3MUT P;  1LK7 A;  3EMT A;  2RT3 A;  4JOU A;  5KG3 A;  3KG0 A;  2XYH B;  2J8S A;  3CUN A;  1GMV A;  4M5J A;  3PHE A;  4WCE Q;  3CF5 Q;  5DO2 A;  3OXL A;  3ICL A;  1B7Y B;  2HHQ A;  5F9N A;  4X4R A;  1JLB A;  2AJF E;  2FY1 A;  4CLU A;  2AD9 A;  2E66 A;  1HAR A;  4WWS A;  4DV6 J;  2K7K A;  3KLE A;  1B0P A;  1YI2 S;  1TKT B;  2EFO A;  1HPZ A;  4ES3 A;  1PG5 B;  2AYB A;  3R5C A;  1SBR A;  4JI8 J;  2VDI A;  1NME B;  2CZV C;  1BXN A;  4KAI A;  3HCX A;  1F5B A;  3UCZ P;  5ETK A;  2CDR B;  3B6B A;  1LXN A;  4P72 A;  5B7W A;  4BS2 A;  5K8N A;  4M5M A;  1TU0 B;  5B0B A;  2VAS A;  4BCA A;  2ZVI A;  1WEZ A;  2ZD1 B;  4MKV A;  3CCQ S;  4Y65 A;  1EET A;  2H54 B;  2JVO A;  4ZCL A;  4ZCI A;  1JJ2 R;  2Q43 A;  4NLU A;  4DQS A;  5HAT A;  2WK4 A;  3FK4 A;  4DUZ F;  3C8Y A;  4DF4 A;  3A3O B;  3ILJ A;  1YJN S;  2KFY A;  1T7P A;  4A46 A;  2GAG C;  2BE2 A;  2DNL A;  5CYQ B;  3GFX A;  1R8H A;  5EDW A;  4O3Q A;  5LM7 E;  2D1C A;  1VLO A;  3FNN A;  3V6H A;  5DM6 Q;  1C1B A;  3DLH A;  4F02 A;  4O3N A;  3EDR B;  2DBB A;  1T3N A;  1SC1 B;  4WBF A;  2GFF A;  4ED3 A;  4DX6 A;  1FHT A;  2LLZ A;  4P6Q A;  1XIQ A;  1UCN A;  3N5F A;  2KVQ E;  3PHT A;  3CVK A;  5DZ7 A;  1R8P A;  3QAT A;  4DFP A;  5KFA A;  6AT1 B;  2XQC A;  3DOK A;  2AV5 A;  1HNX J;  2HBQ B;  3MPV A;  4ECU A;  1UKU A;  1NXI A;  1ZM4 A;  1OY8 A;  2P6T A;  2IVY A;  2ZE2 A;  9RUB A;  1RKI A;  1B64 A;  2GCF A;  2IC3 B;  1VIO A;  3EGW B;  4P2F A;  3HT3 A;  5IWA F;  4IRC A;  2PMZ D;  1JLE B;  1ZET A;  2CJA A;  3EYZ A;  2CPZ A;  5D15 A;  4O44 A;  3H25 A;  1XMQ F;  3MEE A;  2OEK A;  2N4D A;  3TVY A;  3KXD A;  3W8P A;  2F1F A;  3FC9 A;  4FYX B;  1NHK L;  1PJ5 A;  3BDE A;  2VC0 A;  3W5Y A;  2IM1 A;  3MZI A;  4DFJ A;  3HHL B;  2AP6 A;  2MEW A;  2DGU A;  1XEZ A;  1U0S A;  4QBU A;  1VQ9 S;  3MM8 B;  3I5C A;  3PKM A;  1KTV A;  2QGF B;  2HHS A;  2PD1 A;  4K4X A;  2V69 A;  2E5L F;  2N7C A;  3SCI E;  1HWU A;  2NSC A;  1U6Z A;  2Y1L B;  4DSF A;  1WKL A;  4DL6 A;  2BJ8 A;  3NGS A;  2MLX A;  4EBC A;  4EGL A;  3A8J A;  1N0V C;  1F9F A;  2VFS A;  5KFP A;  1V3R A;  3T9Z A;  1O6X A;  2I5J B;  2V4R A;  1IBK J;  3W2V B;  3J80 U;  1SH0 A;  3BM7 A;  1L3T A;  3MM7 A;  3LO3 A;  4B3M J;  1DUR A;  1IKW B;  2Y9H A;  1IBM F;  1LWF A;  4QZV B;  1KEK A;  3ZTP A;  1RJJ A;  4PCQ A;  3HP6 A;  1EP4 A;  2O67 A;  1U2R A;  2Q79 A;  3GJQ B;  2V8G A;  3HFK A;  3IR6 B;  3S8S A;  2EWH A;  2GO8 A;  2EC0 A;  1PC5 A;  3C66 A;  1UVJ A;  3VGT A;  4ZVF A;  1VCT A;  4FF1 A;  1F60 B;  5KFY A;  4CYU A;  4C3M A;  1XER A;  3AD9 C;  4ED0 A;  4LBI A;  2VA2 A;  2HNY B;  5CAA A;  4I2Q B;  3ETM A;  1U1N A;  2XHW A;  2NXU A;  4P2S A;  3I5A A;  4OYZ A;  3CC7 S;  1WC5 A;  1AW0 A;  2B51 A;  3OPK A;  4NCB A;  1HNZ J;  1FI4 A;  1FVQ A;  3DRR B;  2KYX A;  2PI5 A;  4EEY A;  3PKY A;  3HD1 A;  1WSR A;  3NY0 A;  1DHM A;  1FRJ A;  1SJ4 P;  1BY9 A;  5HVH A;  2XM3 A;  1SKR A;  1XMO J;  1RUS A;  1SJ1 A;  1S10 A;  1S1X A;  3T1H J;  2OPP A;  2HBY B;  5F3Z A;  4DR2 F;  5M2U A;  4TU7 A;  4DX7 A;  3S7R A;  4OYP A;  3GR1 A;  3MTK A;  4NLX A;  4PG5 A;  2IHR 1;  3CCW A;  4P10 A;  2WW4 A;  3C3L A;  5D3G B;  1WHY A;  4ZP9 A;  1CVJ A;  1LXJ A;  4J5O A;  4OLP A;  4DQR A;  4PKD B;  2ZWP A;  3WQP A;  3M30 A;  4DL3 A;  3I9V 9;  5E2Q A;  2UUA F;  3T3F A;  1TUG B;  3TJ9 A;  2UV8 A;  5J1E A;  1Q0N A;  2N82 B;  1WC1 A;  1M5H A;  5IT4 A;  4TLQ A;  1NLK L;  5J2M B;  3H5X A;  1HNV B;  5ETT A;  3F56 A;  1SJF A;  2CQB A;  3HXM A;  4WIQ A;  2HZC A;  4CNY A;  2QZ8 A;  5DS7 A;  2VG7 A;  4CTA A;  5D0E A;  1XK8 A;  4MTP A;  4ECY A;  2UV8 G;  1WEY A;  4ZJQ A;  2IA0 A;  1FO1 A;  1JX4 A;  1UPM B;  1E6Y B;  4Z7C A;  1ZTT A;  1R6Y A;  1BMQ B;  1NBE B;  2RUS A;  4DS4 A;  2KI2 A;  2XSJ A;  2LP4 A;  3IGN A;  3QT7 A;  4F0M A;  2K7J A;  4X65 J;  2FVQ A;  5KFQ A;  4LBH A;  4IFV A;  2W9B A;  4PEO A;  4DI6 A;  2E1M C;  2FHJ A;  3WBZ A;  2VPX B;  2R7O A;  3W7B A;  3NCQ A;  2LEB A;  4RU9 A;  3M32 A;  3LOU A;  1NH7 A;  2HRT A;  3GMG A;  4LSL B;  2V9K A;  2GMJ A;  2MJU A;  3GPA A;  1X31 C;  2OPQ B;  3DCA A;  3B4M A;  4MKY A;  1KHW A;  3PR5 B;  4QPX A;  4GMK A;  3AD7 C;  1RTI A;  3M8Q B;  2D41 A;  3UDV A;  3K5N A;  5GAG U;  5GVQ A;  1A0O B;  3BZQ A;  3M7V A;  4DV2 F;  4KRW A;  2H5E A;  1MNE A;  4G3I A;  1PC4 A;  3FEY B;  3BGL A;  2R2S A;  2GHW A;  4YFU A;  1TL3 A;  4PPD A;  4C11 B;  4C8Z A;  2QLJ B;  3PW4 A;  1T9V A;  1NK4 A;  1U1Q A;  2HLU A;  4UUW A;  2X3G A;  2HQI A;  3HDS A;  4OI1 A;  1AT1 B;  3E3X A;  2KVI A;  1VQO S;  4M8L A;  4DCJ B;  1WEL A;  4OV6 A;  1CQN A;  4UW2 A;  5E41 A;  3GIK A;  3PW7 A;  4NLR A;  3CT9 A;  4OZ5 A;  1BQX A;  2YTC A;  4ZOS A;  4DR6 J;  2B6A B;  2GVZ A;  1UPP A;  2R8J A;  1HW9 A;  4OX8 A;  3TZW A;  3GCW P;  4DLE A;  2NYH A;  3SZ2 A;  4YDX A;  1G2E A;  4JI7 F;  3DRS B;  2A1B A;  5GAE I;  5LSR A;  4OZ0 A;  2XLJ A;  4OI3 A;  3MAA B;  1JK9 B;  4KYZ A;  1R0A A;  3KLI B;  2VUG A;  3E01 B;  5A0Y B;  4NXN F;  3K5M A;  4I68 A;  3ENV A;  3CD5 A;  3TJA A;  4LR7 A;  3WC2 A;  2VIH A;  1WKK A;  4OX7 A;  4KO0 B;  4ES2 A;  1NKC A;  4IRD A;  1VYA A;  1KVI A;  1TKX A;  4DPW A;  1R8B A;  1YDL A;  1RP5 A;  4K4V A;  2B0G A;  1GMU A;  2B8Q A;  4WTY A;  2CIM A;  4NMX A;  3FZB A;  2ZWO A;  1DFD A;  3P96 A;  4RR5 A;  5GAD U;  3C15 B;  1I94 F;  2HND B;  4QWE A;  5DLF A;  4D3G A;  2HMI B;  3FCH A;  4KHP J;  4YUD A;  3G82 B;  4FF4 A;  1T05 A;  3D1Q A;  5CYJ A;  1IBL F;  2BQU A;  2XBP A;  3UN5 A;  4DR7 F;  4WYW A;  4JV5 J;  3O3L A;  3G96 A;  2AT1 B;  2KN4 A;  2B4O A;  4C6A A;  3MMJ A;  1L3S A;  3IP0 A;  2PEH A;  5KG7 A;  2B9W A;  2I2Y A;  2M88 A;  2L9D A;  1RT5 B;  1CJV B;  1KQS R;  1DJ0 A;  2BOA A;  2B5J B;  3HF5 A;  1IWG A;  1VK3 A;  2CXE A;  1EB0 A;  3ELH A;  4C8M A;  3MXH P;  1PSD A;  2HGL A;  4B9N A;  3DOM A;  3VAM A;  4QYR A;  4DR5 F;  1NEE A;  5B0F A;  3JTO A;  3N28 A;  4RWW A;  5AXN A;  2YH0 A;  4KB7 A;  5KG4 A;  3ZZO A;  4NA3 A;  2IMW P;  4M5I A;  4WFZ A;  2CNL B;  3BGF A;  4K0K J;  3CDW A;  3WDO A;  1Y11 A;  4EU0 A;  2NSB A;  3EVO A;  4NEZ A;  1TTH B;  2NXJ A;  4YQW A;  5IT9 U;  1MLA A;  1RWN B;  3DRP B;  1U8W A;  1N33 J;  4W4M A;  3DLJ A;  4G1I A;  2Z0G A;  4UTG A;  4LF9 F;  1KNZ A;  4U7C A;  2V2K A;  2YVS A;  1WC6 A;  4CH1 A;  2QA1 A;  3SMZ A;  3IGV A;  1TV6 A;  1JMT A;  2IAJ A;  3HHD A;  3MHY A;  3W61 A;  4AE5 A;  2FD2 A;  2DHX A;  2FJD B;  4U7U D;  1RT3 B;  3TX8 A;  4MIW A;  1S72 S;  2E1R A;  2VPZ B;  1RAC B;  1Q7Y T;  2GA7 A;  3J81 Y;  1FJC A;  4PWD A;  1VC0 A;  1IKV A;  3OR2 A;  4NZ7 A;  2L9W A;  1Z2L A;  3QO9 B;  2NLW A;  5I42 A;  3ZTR A;  3NS6 A;  2W24 A;  2RQM A;  1HD1 A;  3T5K A;  4FPR A;  2WW8 A;  2V8V A;  2FY8 A;  1LFP A;  4YR2 A;  4Y6I A;  2H51 B;  1HWJ A;  4C8N A;  4M5K A;  3Q83 A;  1VHI A;  3OSN A;  4NLT A;  2MGZ A;  3KMS A;  2P8I A;  4DV0 F;  4ID8 A;  3C6U B;  1ZZN A;  1MWY A;  3JAM Y;  1XR7 A;  2ZC3 A;  3BB5 A;  2RJZ A;  2Y1R I;  1M90 T;  3Q8U A;  2VON A;  5D0R A;  5D78 A;  4USI A;  3I56 S;  1HBO A;  2DRA A;  2RQ4 A;  3D28 A;  2FHO B;  3CJK A;  2F65 A;  4OIX A;  4GKJ J;  3G8Q A;  2XS5 A;  4Q0B B;  4PXD A;  3D6T B;  4ES1 A;  4F36 A;  1RA6 A;  4I1T A;  2R7Q A;  4IDK A;  3IN5 A;  1YG0 A;  4M1K A;  4LF6 F;  1RT2 B;  4DV7 J;  4ZKA A;  5CZX A;  1JKH A;  5K5M A;  3VAK A;  4I56 A;  4ZVU B;  4B9M A;  2GX8 A;  2QYG A;  1FJG F;  2HHX A;  4PG6 A;  5ETV A;  1QSS A;  3TUJ C;  2GAH C;  4GO7 X;  3TX0 A;  2JSX A;  1GFW B;  2W01 A;  4WFA Q;  1HA1 A;  3QSI A;  4OYM A;  1SL1 A;  3ZZ0 A;  2ZUA A;  1RAE B;  4LT6 A;  2BAN B;  2P9G A;  3FEZ A;  2L3M A;  2DNQ A;  2BMB A;  1SJ3 P;  3QGG A;  1X5S A;  3EM1 A;  4X64 J;  1KTQ A;  2ROE A;  3PV8 A;  3FBC A;  4ZHR B;  2V8P A;  4BC9 A;  5AE3 A;  5F8L A;  2YNH A;  5EN1 A;  1ZPV A;  3VVT A;  3MEC B;  2R4F A;  1FRI A;  4WF9 Q;  3MPU B;  3ULH A;  1FDA A;  2LU2 A;  4NLO A;  5J2P A;  1G4C A;  1G3O A;  4CO4 A;  3NOG A;  4PAA A;  3DGP A;  2FLN A;  4FBU A;  4EO6 A;  1JLF A;  2GNK A;  2HRU A;  3GYN A;  5CD4 H;  3M6V A;  3QNW B;  3NL0 A;  3NNH A;  5HBM A;  3R97 A;  1VQK S;  3M6U A;  3WIV A;  5A2Q Y;  2JL9 A;  3BF4 A;  1DRZ A;  1N36 F;  4LF8 F;  2PT0 A;  2VBY A;  1OO0 B;  3UQS A;  2AZ1 A;  5F9L A;  4RNO A;  4ED2 A;  1YZ7 A;  4H4M B;  3LP1 A;  4X62 F;  1Y0H A;  1MWQ A;  4K4U A;  5E3Q A;  4ILR A;  4C8Y A;  2ZJQ Q;  5I3U B;  3GV8 B;  1RCO B;  2DHA A;  1FF2 A;  1EQ0 A;  5FD1 A;  2IIH A;  1AZS A;  1XNQ J;  2ASD A;  3UPF A;  2X51 A;  1XR6 A;  5C2G A;  5J2N A;  2IBO A;  4JYA J;  1REV B;  5LL6 d;  4ECZ A;  3O8W A;  4NE9 C;  3RB3 A;  2GW8 A;  4RJV A;  2AQ4 A;  3BO3 A;  4Y2K A;  2HWT A;  3DLG B;  1UJ5 A;  1SC6 A;  2XI2 A;  2C2K B;  4WP9 A;  2P9E A;  3PFO A;  3GJS B;  3HX9 A;  2YXL A;  5KFC A;  1TAQ A;  3TI0 A;  5DQI A;  1HQE A;  4HR2 A;  1FNM A;  3JB9 k;  4R25 A;  3L7P A;  1NJW A;  1KQK A;  2XB2 D;  3KK3 B;  2A2D A;  5I4M A;  5ETS A;  3A8E A;  1D9A A;  2DNN A;  4E0D A;  4LF7 F;  4O0N A;  2MY7 A;  1VIX A;  4HL9 A;  2G13 A;  1E6V B;  2UU9 J;  2VKR A;  1VJW A;  4DV1 F;  2KL8 A;  1NSP A;  3OUY B;  4ZCM A;  4Q44 A;  2MZQ A;  3WX8 A;  5JVH Q;  4C97 A;  2MQN A;  2AYE A;  4OL8 A;  1IQZ A;  4URS A;  4OHX A;  4N47 A;  4I69 A;  2CNN B;  2O3D A;  4JI3 J;  3THP A;  4XDC A;  5HQL A;  2VV5 A;  1IKX A;  2GZO A;  1VFJ A;  2RDJ A;  1U1L A;  2BV3 A;  1D3W A;  3D6H B;  3G6Y A;  4K59 A;  2EBE A;  1N8R T;  3CO9 A;  3OFE A;  4HKQ A;  1WF2 A;  2LXU A;  2F8M A;  3HI9 A;  3D5M A;  4B3T F;  4RW4 B;  5GAH I;  3MMC B;  1MMN A;  2JEJ A;  2NXN A;  4KV8 B;  3RB4 A;  3ISZ A;  3T1A A;  3GCX P;  3I0R B;  2BJE A;  1UEK A;  6FDR A;  2NUU G;  3PNI A;  3CCJ S;  2F4V F;  3HHL D;  3ZNU A;  2OPS A;  2QA2 A;  2ZH3 A;  2FVC A;  1IJF B;  4DUY F;  1VJQ A;  2V50 A;  5MLC V;  3ET6 A;  1ZPW X;  4Y2C A;  1X4D A;  4LFB J;  3W60 A;  4ZPC A;  2MZ1 A;  1NSK L;  4LRB A;  1T03 A;  4WFX A;  3PRD A;  4XPC A;  2Z2Z A;  5B0C A;  1ZH5 A;  2PFF B;  1HYS A;  1KP6 A;  3L09 A;  2HHH J;  3L7U A;  2JNJ A;  5ETM A;  1ICE B;  1RAD B;  3R1L A;  2GHV C;  5CQG A;  2R7U A;  1T9T A;  2WON A;  2V6A A;  3K8V A;  3IG1 A;  1MRO A;  4CWB A;  3FZ2 A;  1D8Z A;  1RGV A;  2HFU A;  1TL7 B;  4MH8 A;  4UF4 A;  4NRU A;  4F3Q A;  3VVU A;  3A4T A;  1OIA A;  2LMI A;  4GVL A;  1H6K X;  2V0N A;  5FII A;  3MR2 A;  2POK A;  4ZLJ A;  2BM0 A;  4OZ3 A;  4PQA A;  1AA1 B;  2C2R A;  4FXD A;  1RI7 A;  3PXG a;  2ZIT A;  5HMY A;  3KLF B;  3GJT B;  2ZBI A;  4ZPW R;  2VFR A;  3KHL A;  1X4F A;  4BHQ A;  2A0F B;  2KRR A;  2CVE A;  1JLG A;  2WBR A;  4K2J A;  2V67 A;  3I0S A;  3MR3 A;  1SJQ A;  3MM6 A;  3W8G A;  3V6D A;  2ASJ A;  4O4R A;  2CJ9 A;  2VG5 A;  1NK9 A;  3PAC A;  3QGP A;  3F41 A;  1FWL A;  1IUJ A;  5E7O B;  3C16 B;  2F3J A;  3QJJ A;  2VOP A;  2DGQ A;  3GSI A;  1VK8 A;  5CZV A;  2BE7 D;  1PYS B;  3C14 A;  1RK8 A;  2B9Y A;  3TWZ A;  2M9K A;  1W7W A;  1EX8 A;  2BW7 A;  5JJB A;  4DV6 F;  3LUY A;  1KFD A;  1NJX A;  4JI8 F;  4U8Y A;  1IR0 A;  1GQE A;  2GVD A;  1DTQ A;  5A76 A;  4EUV A;  4AL6 A;  4B3R F;  1HW8 A;  2OTJ S;  1S0N A;  4Z7Y A;  1S1W B;  1QAI A;  4M5D A;  3MED B;  2AEJ A;  2HVZ A;  3JS9 A;  4N8N A;  1LKZ A;  1KQG B;  4ZVG A;  2OPR B;  1AUS L;  1RT4 B;  1LV5 A;  2ZH7 A;  3M2V A;  3I96 A;  3D7S B;  2RS2 A;  5A8K A;  1Y5I B;  4LUB A;  1VIS A;  1NK5 A;  2PI4 A;  2V4J A;  4TU8 A;  1C0T B;  2DH9 A;  3MCO A;  2YQ1 A;  4WFY A;  4J9V A;  4FF3 A;  1SH2 A;  5K20 B;  2GJ2 A;  4U9R A;  3KHR A;  2LQ8 A;  2Z2L A;  1RT1 B;  1YQH A;  3PVX A;  4M94 A;  2CNK B;  4IG0 A;  4PAB A;  4M5L A;  2EFV A;  1L3U A;  2DEI A;  2CFX A;  3SDE B;  2IJF A;  1IN0 A;  2MQL A;  1IWA A;  1LQ9 A;  5FJ4 A;  4YN3 B;  4DMZ A;  3OHB A;  3PIP Q;  3W5Z A;  3DXS X;  5DG7 A;  1VRU B;  5ETN A;  3K89 A;  5BR8 F;  4LF5 J;  5I3P A;  1U4B A;  1OSC A;  3V81 A;  1BWV A;  3Q89 A;  1IKY A;  4WYL A;  1LWX A;  5F8M A;  2X1G A;  1HD0 A;  1FFS B;  2IYI A;  1SI9 A;  4PG4 A;  1QSY A;  3VAI A;  4C8K A;  2WSE C;  3JTP A;  3ZZP A;  4B9U A;  2MB0 B;  1MW7 A;  4I2P B;  1MG7 A;  1QE1 A;  3A3P B;  3THV A;  1FTC A;  4H4O B;  3SSQ A;  4TQS A;  1HBM B;  1ZAX A;  2HSE B;  5AE2 A;  3CSK A;  1UVM A;  4P71 A;  1FA0 A;  1RT7 A;  1TL1 A;  3TAM B;  4DZD A;  2GC8 A;  4HAC A;  1X60 A;  1ULR A;  1YJ9 S;  2COL A;  1IR2 A;  1FX4 A;  1S57 A;  4ZPT R;  3PRV A;  2UXB F;  2ZM6 J;  5D4L A;  1UVL A;  2VU5 A;  4ZIW A;  5LJ3 Y;  1D9D A;  2MZT A;  2EFP A;  1RWW B;  4HDH A;  3H40 A;  3RAM A;  4ECS A;  4MIB A;  1CJK B;  1S6P B;  1FCA A;  2DNZ A;  4PYD A;  2CUY A;  4AT1 B;  2B9E A;  1Q8B A;  2VOO A;  4KGZ B;  3PY8 A;  1VQL S;  4FKX A;  1M1K T;  4Y3C A;  3NEK A;  2G4B A;  2GV1 A;  2BUN A;  3GU0 A;  5B0A A;  1WWH A;  4ID5 A;  1JLE A;  1S1U A;  1IQT A;  2DEJ A;  2ZDO A;  1H98 A;  2WVD A;  3L7O A;  1CUL B;  3M2U B;  4LMZ A;  1L3V A;  4FKY A;  5LSO A;  4NLV A;  2C42 A;  4NI2 A;  3D68 A;  4ANE A;  1A9N B;  2H9Z A;  1F6T A;  4F3O A;  2XO6 A;  4J7C A;  4X4T A;  2AKW B;  3K5P A;  3KK2 A;  4B3S J;  2XNR A;  1BD6 A;  1WI8 A;  3M2R B;  3HZE A;  4K5R A;  2UZA A;  5T7L B;  4QIE A;  2XMT A;  2J7K A;  3J81 U;  3VAH A;  4X2B A;  3LP2 A;  4MYU A;  2E5H A;  1F3F A;  1VDH A;  5DG9 A;  2XY5 A;  2KT5 A;  2EEY A;  3IAS 9;  3TJ8 A;  1ZS6 A;  1FK9 A;  4QIV A;  1OYD A;  4MKB A;  3VF0 B;  1Q8K A;  1Q82 T;  2ZZT A;  2VJV A;  3RR7 A;  3M9N B;  2XCA A;  1SKW A;  3Q8Y A;  1S9E A;  3DXB A;  4A8O A;  5M2R A;  1S9F A;  2E5J A;  4OI2 A;  2ZKU A;  4DXL A;  3R1H A;  1HNZ F;  1URR A;  4X66 J;  3NNC A;  3R7B B;  1Q5V A;  1GNK A;  4IH6 A;  3RR8 A;  4F50 A;  1FRX A;  3PJX A;  1S6Q A;  2CPY A;  3DLL Q;  1XMO F;  2N4C A;  4WKR A;  2MKH A;  3DOL B;  1SL2 A;  3VQS A;  1LW2 A;  3AHP A;  2LYV A;  3T1H F;  5FDL B;  1CJU B;  4ELU A;  2W7A A;  5C25 B;  3GQC A;  2MZR A;  1Q7L B;  4AXI A;  1S77 D;  1S0M A;  1R43 A;  3RW7 A;  3UCU P;  2HNY A;  1P9Y A;  2JOQ A;  5FLX Y;  2Y0B B;  2OEL A;  2MST A;  4K4W A;  5KFB A;  4F4X A;  1BQN A;  2VC1 A;  1GX5 A;  5LXR A;  4ERD A;  1S1T B;  1RHQ B;  1TL4 A;  4DL7 A;  3LAL A;  4GO5 X;  2LEP A;  3H42 A;  2MPU A;  2I1R A;  4R5P B;  2MQO A;  3CC4 S;  3TEG A;  1UVK A;  3CDE A;  4GVB A;  1RWO B;  1YTY A;  3NRB A;  3IO1 A;  3DU6 A;  5EWF A;  4UY8 T;  1X5T A;  6FD1 A;  3SQG B;  3BYP A;  3FSY A;  2APO A;  3QLH B;  4F8R A;  2IM3 A;  4CLP A;  1RAI B;  2D3O 1;  3ENQ A;  3OTO J;  2CRL A;  2VB6 A;  1H38 A;  3O44 A;  4BLG A;  3D67 A;  2Y1I A;  4FXW A;  1U0H A;  1JNR B;  2AHO B;  2A10 A;  2O1P A;  1NK0 A;  3CUL A;  5HAO A;  1VOM A;  5A8W A;  2ZC4 A;  3IWX A;  2ZHB A;  1FJE B;  1HI8 A;  3I55 S;  1GT8 A;  4UZC A;  3MM5 A;  4X65 F;  1U02 A;  5M2P A;  3M6X A;  1RHU B;  4O3R A;  1AFJ A;  2UUB J;  1CEZ A;  3JSM B;  2O5D A;  3NKY A;  1GAO A;  1HNV A;  1NB2 A;  3SCK E;  1S9G A;  2CAJ A;  3Q8P B;  3Q23 A;  5BYQ A;  2ERR A;  3RYL A;  2V8D A;  4FF2 A;  3ZTS A;  5IC4 B;  3LW5 C;  1KKH A;  2PSZ A;  4MFB A;  1J2V A;  1E6Y A;  2DGT A;  5GAD I;  5CD4 A;  2XYG B;  2J7W A;  2K3I A;  4HI1 A;  2DHH A;  4IG3 B;  1Z1Z A;  2CQI A;  1JJ4 A;  2W2O P;  4CM0 A;  4B9T A;  4C4W A;  2JC0 A;  4WFB Q;  4LRD A;  1NKB A;  2YX1 A;  4Y28 C;  2KO1 A;  2RML A;  2JZ5 A;  4JV1 A;  1EKS A;  4Y0F A;  2I6W A;  3T9N A;  1HLW A;  2IRU A;  1RWV B;  2MJN A;  1C1C B;  3BDP A;  2H4W B;  2X3D A;  4ZLN A;  5ETP A;  4GRS A;  1LWE B;  4QW8 A;  1FRH A;  2HKE A;  2W25 A;  4YR0 A;  1JLA B;  4USW A;  3BR9 A;  5HMZ A;  3HJV A;  3UDC A;  5C42 A;  1MU2 A;  3CD7 A;  3M8R A;  2FVS A;  3TA2 A;  1QAX A;  1CJT B;  3G71 S;  1U25 A;  4EZ6 A;  4J9N A;  1N5Y A;  2VQF J;  2KZZ A;  3I6P A;  1B99 A;  3R5A A;  4CLZ A;  4JI2 J;  1DLO B;  1RKJ A;  4MYT A;  3MEG A;  2ZJP Q;  5HP1 B;  1UWA A;  2KM8 C;  4HH1 A;  2ZH5 A;  4ZP7 A;  1KVJ A;  4LQ3 A;  5J2Q A;  2OO4 A;  2MQQ A;  3FBF A;  5IFM A;  4DQI A;  2E7X A;  5F8J A;  1RT6 A;  1RTJ B;  1BGX T;  1FKO B;  2QLW A;  5K8O A;  1KBR A;  1MN7 A;  1LOU A;  3EVW A;  3GV7 B;  4CNZ A;  2Y0S D;  4I7F B;  1NH8 A;  5KFN A;  2W9C B;  3CDB A;  4KHP F;  2RKI B;  2AYM A;  2NXE A;  2ACM A;  4LFC F;  4JV5 F;  1UWB B;  4KHR A;  2MZS A;  4F26 A;  2B4V A;  3KLI A;  4WE1 B;  2G9O A;  2BJ7 A;  2PMW A;  2A18 A;  1LK5 A;  3HFZ B;  3IBW A;  4CIO A;  3W9J A;  5HAN A;  1JLQ B;  3IWL A;  3D3B J;  3ZO7 A;  2KYZ A;  3T5H A;  1HL6 A;  2HIY A;  4P7V A;  1T9W A;  7AT1 B;  3GG1 A;  2HGN A;  3QIP A;  4LRE A;  1T9U A;  3QMQ A;  4E98 A;  3GIJ A;  5F8G A;  4QOT A;  4ZDN A;  5HJX A;  3GLJ A;  3KK1 B;  3KOA A;  1PYT A;  2XZT B;  3W5X A;  2OSQ A;  4U96 A;  4MIA A;  3UWT A;  4C48 A;  4X4V A;  3BH6 B;  1OS5 A;  3WHI A;  2W7P A;  3OR1 A;  4DOZ A;  4WXO A;  1Q8L A;  3QRP A;  2ZH1 A;  3UO0 A;  2YKM B;  1N33 F;  3TP2 A;  1ZOT A;  2J0X A;  2FJW A;  2HVH A;  4KBI A;  4RW6 B;  3EGV A;  2LEA A;  5HRO A;  3BKF A;  1HMV B;  4LSN A;  3G87 A;  3F0N A;  1K8A T;  5KG5 A;  4XO0 A;  1NJZ A;  4OJG A;  2V4Q A;  3H2U B;  3AOB A;  3AJ1 A;  4ZP8 A;  3G2X A;  1QM9 A;  2QX0 A;  1G6B A;  3LWM A;  4F4A A;  3SEO A;  4FN5 A;  3OL8 A;  1Y5L B;  4H4K C;  4O4G B;  2ZBR A;  3GB0 A;  2QLX A;  2AJ1 A;  3QJL A;  1TAU A;  1ZBT A;  1Q79 A;  3MAQ A;  2QJ3 A;  4TY8 B;  3WX4 A;  2YH1 A;  1JQG A;  2VQE J;  1QD1 A;  3M8P A;  1H3D A;  4NPO A;  4DN0 A;  3S1T A;  2DCL A;  2K06 A;  4OYO A;  4CM2 A;  4LRA A;  1JLB B;  3L95 X;  1R27 B;  3BO4 A;  4JB8 B;  1KR4 A;  4CCH A;  4UUX A;  2AJ2 A;  1GXL A;  3PZP A;  4O3P A;  4ZLP A;  1RAB B;  2OP5 A;  1GMW D;  1CC7 A;  4CT9 A;  1RT3 A;  2CG8 A;  2JEF A;  1HPZ B;  5EWE A;  2G0I A;  2FC9 A;  2M4M A;  1R89 A;  3NG8 A;  2VHG A;  5BYS A;  1OMS A;  4J9S A;  3KKF A;  2XMV A;  3B78 A;  1PBU A;  3MCN A;  4GKJ F;  2GQC A;  4QIF A;  3D3C J;  2CJB A;  3RU0 A;  2HQG A;  1UZH A;  3QGH A;  3MR7 A;  3W63 A;  2KJV A;  3AJD A;  1EET B;  4QU7 A;  1Y10 A;  4DV7 F;  4UOH A;  3T1Y F;  4RNH A;  2CAD A;  1V9O A;  5AXK A;  3SBM A;  3MPY A;  3M1V A;  2FHM A;  4KGV B;  5KFF A;  3BN7 A;  1D1U A;  2M2B A;  1FKP A;  1UZD A;  4I0W A;  4HLB A;  3GTY X;  2DD8 S;  1VHF A;  4A4J A;  3W62 A;  4IOA Q;  2BE2 B;  1QAJ A;  3VCD A;  4X64 F;  4Q0B A;  2V8H A;  4R8U A;  4P2X A;  3J7Z T;  1YIJ S;  2B7B B;  1C1B B;  3D1O A;  2FQQ B;  3VHQ A;  4F3M A;  4Y00 A;  1SL0 A;  4I67 A;  1RE1 B;  4FNH A;  4CO1 A;  4N77 A;  3V4I A;  2DHG A;  3QAE A;  2R7W A;  4DUZ J;  3ILO A;  3OFF A;  2L9N A;  2B7C B;  4K5S A;  3DOK B;  2CPD A;  1R6V A;  4ZPD A;  4J9M A;  2UVU A;  2HK3 A;  3TYT A;  3EGN A;  5K14 A;  1U1K A;  3DDK A;  3ZTO A;  2VG6 A;  3DU5 A;  2ZE2 B;  4DPY A;  3HO1 A;  3I4P A;  3DRX A;  3MOJ B;  2CQ1 A;  1PIL A;  3CCL S;  2MMY A;  3H90 A;  1IJE B;  3M8Z A;  4FP9 A;  2DNR A;  2DHS A;  4NYO A;  4NX9 A;  5LT5 A;  4O44 B;  3MEC A;  3MCM A;  3KTQ A;  3LAN A;  3MEE B;  4FS1 A;  3MWB A;  1DBD A;  2FHK A;  4OX9 J;  1OY6 A;  3ENW A;  4DX5 A;  1XBW A;  2JLE A;  4O0I A;  2DXE A;  1RHK B;  4JBC A;  5DDP C;  2RE1 A;  4G1Q A;  3RBZ A;  3HVW A;  1OQ3 A;  3HKW A;  2WB1 D;  2C2O B;  4NEY A;  4ED8 A;  4YDD B;  4EYI B;  3R7S B;  1KN6 A;  5HLF A;  2LCW A;  1NKE A;  4F0H A;  1X0F A;  4HYK A;  3HZG A;  3PDN A;  2HHU A;  2H4Y B;  2G0C A;  2AX0 A;  2DT9 A;  1XMQ J;  3EX7 B;  2CQC A;  1V3S A;  5CA5 A;  3MEK A;  1CG2 A;  1BUX A;  3MM7 B;  1K73 T;  2XUL A;  1WC0 A;  1NZ8 A;  2Q1L A;  1TR0 A;  3D4J A;  4KQZ A;  4OMF G;  3RBD A;  4ZA1 A;  5B09 A;  2KZM A;  1LWF B;  1UJ6 A;  3N9U C;  1JWW A;  3I87 A;  4AFF A;  3CD0 A;  3SI8 A;  2DGO A;  3M9M B;  1EP4 B;  2Q6C A;  2RQC A;  2JEI A;  4Y2M A;  2UU9 F;  4FYY B;  2CWK A;  3CIZ A;  1T94 A;  3BSC A;  3AJ2 A;  2QE5 A;  2CJX B;  2CZ9 A;  4CYU B;  4DR1 F;  1WAC A;  2CPE A;  3PJ9 A;  1QUV A;  2H3E B;  2XMU A;  4MK9 A;  1RTH A;  2IYG A;  2M8D B;  2ZVS A;  2B9X A;  3ITH B;  4JI3 F;  3N5B A;  1IBM J;  4YEA A;  3D1H A;  4A8X A;  1X8D A;  2RQK A;  2YWH A;  1Q5Y A;  2L48 A;  5KFR A;  5ADZ A;  4YR3 A;  2B3T B;  1ELO A;  4C0H A;  2HQF A;  1S1X B;  4RUB A;  4ZVP B;  2OPP B;  1SQG A;  1WHV A;  2ZHO A;  3DLE A;  4X4Q A;  5KFV A;  4IOC Q;  1SC4 B;  5CCL A;  5AJ3 J;  2W2M P;  3LTO A;  2X1A A;  3W3S A;  3LP0 A;  3FVY A;  3KUH A;  3SSS A;  1RTD A;  4Y2I A;  2BKO A;  2DR9 A;  3SCJ E;  2HNZ A;  3M30 B;  2FLO A;  1H2U X;  1RWU A;  5FLX U;  1GMW A;  3UNY A;  2XG8 A;  3LAK A;  4BWJ A;  3IM9 A;  5DGB A;  7FDR A;  3HHL C;  5J1E B;  4ZVO B;  1XMB A;  1YHQ S;  4USH A;  3CDA A;  3BQ0 A;  2HHH F;  1RHM B;  2KRB A;  2B56 A;  2CQ3 A;  1VC5 A;  3MUM P;  5BXI A;  1FEE A;  2RF2 A;  2ATL A;  4PQU A;  1W2B R;  2OGU A;  2H1Y A;  3AD8 C;  4DU8 A;  1S1V B;  1C0U B;  2VG7 B;  4CTA B;  2IA6 A;  1I3O B;  3D66 A;  3SFU A;  4MT1 A;  1X7V A;  3MMA A;  2VKZ G;  3K2Y A;  2MDA A;  5AXM A;  2ALZ A;  3BPS P;  4YOE A;  1IXK A;  1U6B A;  3DDN A;  1S4E A;  2MKK A;  2R7T A;  2ZBC A;  4PWW A;  2DPI A;  1U8S A;  2MQM A;  2CJY B;  2OUG A;  2XSJ B;  1PCA A;  4NYP A;  1AYE A;  2UUA J;  3NGR A;  4N76 A;  2YNF A;  2W9B B;  4IFV B;  2ACY A;  4OFZ A;  4XAK A;  3M32 B;  4B3O A;  3MDF A;  1I6J A;  4V1A k;  2PO4 A;  4NXM F;  1Y3J A;  1RIS A;  4IQM A;  1GK8 A;  1JB0 C;  3EPI A;  1RTI B;  1VRT A;  3RB6 A;  4YP3 A;  3DN9 A;  1FDN A;  1WF0 A;  2CKW A;  2GQ2 A;  1N32 F;  3GII A;  4KR0 B;  4PXE A;  5JXS A;  3M9O B;  1ZA1 B;  2D74 B;  3EVM A;  4MJK A;  3NGT A;  4QWD A;  1S0O A;  1FDB A;  3CGI A;  4ILL A;  4IR1 A;  1CS4 B;  1FEH A;  4KH0 B;  5AT1 B;  2RRN A;  4F2S A;  2AGO A;  1HKA A;  1TL3 B;  1RBA A;  2AWZ A;  4R0E A;  3KLH A;  3FJ2 A;  2W7O A;  3TZX A;  3C16 A;  3FEX B;  3LGH A;  3VTI A;  3PTW A;  2BYC A;  3E2E A;  4XTT A;  4RBT A;  3FGV A;  2AF6 A;  2LQ9 A;  3FSX A;  4NAS A;  3ZXW A;  3D54 A;  1UP1 A;  4YB5 A;  1P27 B;  3R2C J;  1URN A;  3UVJ A;  2K3K A;  1UL3 A;  4DPX A;  1S4F A;  3H7H B;  1JNZ B;  4A47 A;  2GVZ B;  2WCX A;  3FFI A;  1JJH A;  4AQY J;  1TKZ A;  1NJY A;  2WOM A;  3R9L A;  4F67 A;  4DV2 J;  3T19 A;  1ITP A;  1UFW A;  3CCU S;  3QRQ A;  3EGZ A;  4DSL A;  1S59 A;  3E8O A;  4WFN Q;  1R0A B;  3RB0 A;  4DCP B;  2HHV A;  3ZZR A;  1YJW S;  1HI0 P;  5JVG Q;  2UVR A;  1NRK A;  2QL5 B;  2W9A A;  5KAK A;  4USM A;  3U7J A;  2JWN A;  4JI1 F;  2ZEJ A;  3OVB A;  4DU7 A;  5HVG A;  4LF5 F;  1TKX B;  5K8M A;  5IM0 B;  4B17 A;  1FWP A;  3BSO A;  3WC0 A;  2HHP A;  3RRK A;  4LQ9 A;  2E7V A;  3BQ1 A;  4XPE A;  4PG7 A;  3U1M A;  4AUK A;  2QV6 A;  4ECW A;  1VI7 A;  2SXL A;  1RT1 A;  5DLG A;  2FJA B;  3TVZ A;  1T05 B;  1VQ6 S;  3AH6 A;  4JI7 J;  2M0G B;  3GYG A;  4C8L A;  4RW9 A;  1O8B A;  4KH1 B;  4EK2 A;  4TU9 A;  3IS9 A;  4WP8 A;  3PEH A;  5LOQ A;  1F5C A;  4NXN J;  5BYR A;  3CCM S;  4ZIV A;  1H74 A;  3GIL A;  1N56 A;  4BWM A;  3QID A;  3ZC4 A;  3RBE A;  2ZM6 F;  2B4P A;  4IKA A;  1PIE A;  4ITS A;  3D0H E;  4U7U K;  4YHH F;  3GR0 A;  4KFB B;  4CO5 A;  4L72 B;  4Q43 A;  4EWT A;  3H2V E;  3GYX B;  3DOM B;  3HHN B;  3UD5 A;  1PBA A;  4I2P A;  1QY7 A;  4YB1 P;  1RAO A;  5ETO A;  2JLF A;  3N79 A;  1IBL J;  4DEZ A;  1X4C A;  4DN9 A;  2YWE A;  4NZ6 A;  2AGP A;  2M52 A;  5GMD A;  3TA1 A;  1T8E A;  2HIQ A;  3DDI A;  2NRE A;  2YY3 A;  2MKC A;  2MLY A;  4OJH A;  5J1N A;  1TV6 B;  2IAJ B;  2RU3 A;  1DQ8 A;  3KUE A;  4HT7 A;  4ZN1 A;  3BBF A;  5HMX A;  1GEH A;  4B3S F;  2IRX A;  1S6P A;  4DR5 J;  2KU7 A;  1YIT S;  4DQP A;  5T14 A;  2R8H A;  3HJF A;  4PWD B;  5B08 A;  5KT7 A;  3KLG B;  3OR2 B;  3J7Y I;  3N6L A;  3KJN B;  4KHM A;  3NCR A;  5I42 B;  3VWS A;  2C3O A;  1Q4R A;  2Z57 B;  1HR0 F;  2VPW B;  5GAE U;  4XK8 C;  3C19 A;  4PXC A;  5THW A;  5KFG A;  1QSL A;  3PO5 A;  3H4B A;  4NLW A;  3VZI A;  4DPO A;  2H48 B;  4ED7 A;  4LF9 J;  5C2C A;  1HWK A;  2YKN A;  1RLC L;  2MGZ B;  3TZZ A;  2DNP A;  1N6Q A;  2QFI A;  1BLU A;  5IZH A;  4JI6 J;  2JHE A;  1ZAW A;  3JYT A;  1Y7P A;  4NRT A;  2UUT A;  4P75 A;  1HBO B;  2GQQ A;  4QU6 A;  4J91 A;  4Z37 A;  2AEM A;  2FLP A;  4RWX A;  3CJK B;  5LMU J;  3UD4 P;  3IRX B;  3L9Z A;  3JSB A;  4IFY A;  3B54 A;  3MPW A;  3TW0 A;  2CPX A;  4IO9 Q;  4JI4 J;  4ED5 A;  2BW2 A;  4AYB D;  4UOC A;  3R5G A;  1BE4 A;  4EBE A;  1CPZ A;  4IDK B;  2C22 A;  4OYX A;  4RW8 A;  5A8R A;  1RDR A;  2MY8 A;  3S6E A;  3GIM A;  4ZPA A;  3W2W A;  1JKH B;  1F9E B;  4DV0 J;  1S48 A;  3H20 A;  4OYB A;  3X3U A;  2C2M B;  3GFZ A;  4K2X A;  2QLB B;  2GIF A;  4P52 A;  2RNE A;  3H5U A;  2W2P P;  1NK8 A;  2IFX A;  2ZOG A;  1WOS A;  2XMJ A;  3UR3 C;  4PZV A;  1YGY A;  5E0O A;  1Y4Z B;  4LBP A;  5KFM A;  1CJU A;  4NZ0 A;  4G65 A;  4KSE B;  4C98 A;  4ZIT A;  3BJY A;  2YNH B;  5KFX A;  4LF6 J;  2RU9 A;  4K4Z A;  4QIG A;  2WTF A;  4D3H A;  5J2P B;  3OLA A;  3OTO F;  1FJG J;  2KT2 A;  3POT A;  3AXK A;  2BJD A;  1H2T Z;  4PUO A;  3TR5 A;  3M8Y A;  2OIH A;  1FXL A;  1JLF B;  1SKS A;  1NSA A;  3FRZ A;  5HBM B;  4ZPB A;  5L46 A;  2BRK A;  4RUC A;  3QAU A;  4HVZ A;  3LQV A;  4DS5 A;  1SQF A;  2HYI B;  2XWX A;  3R5D A;  3V6K A;  2KM8 B;  1NU4 A;  3IM8 A;  5KT5 A;  3LP1 B;  1TZ0 A;  3NGK A;  3AXM A;  3QLH A;  3AQP A;  1Q16 B;  4F25 A;  1I1G A;  2FB0 A;  4CLL A;  2FGO A;  3JXO A;  3MMB A;  3MM9 B;  4R0J A;  1FX2 A;  2HS4 A;  4JUZ A;  4AL7 A;  4ENO A;  1AZS B;  1TVR A;  5J2N B;  4ZP6 A;  1K47 A;  4X4N A;  1WG1 A;  2F8E X;  1N36 J;  4LF8 J;  3MI7 X;  1ZZF A;  1BHN A;  4I64 A;  4RZR A;  2AIR B;  1YJR A;  1FKA F;  3NAH A;  4F4W A;  2QLF B;  5A6W A;  2DR7 A;  4ETX A;  1YSJ A;  3UI3 A;  3CJT A;  1P6T A;  1TMJ A;  4BBY A;  4RNM A;  1BC6 A;  3V2U C;  1HQE B;  1NHV A;  2G2Z A;  3H0P A;  3NBP A;  5H1S V;  3CB4 A;  2QMX A;  1IBC B;  4ZPV R;  5L1L A;  2KB2 A;  3DKD A;  4WK3 A;  2Z4P A;  1KRP A;  2MLZ A;  5F8H A;  3PM9 A;  3GFY A;  2YWW A;  3DNC A;  4Q8F A;  3VGU A;  4FXV A;  5DQH A;  2NCK L;  2W2N P;  4IG3 A;  4QWB A;  1WTF A;  2BR0 A;  2IMO A;  2DO4 A;  2ADC A;  3T5J A;  5EX3 A;  3QZ8 A;  2ATC B;  1Q86 T;  1T9X A;  2EK1 A;  3BBB A;  4NCG A;  4NCA A;  1FXD A;  2VQF F;  3TA0 A;  4CO3 A;  1K0V A;  1L3K A;  3PG9 A;  1A6L A;  2B8P A;  2H5I B;  3ZTQ A;  2X1B A;  4JI2 F;  1RA7 A;  4JP8 A;  3DYA A;  2YX4 A;  3W9H A;  2IPO B;  1KLM A;  2LQJ A;  5HQ8 A;  1HBU A;  5C24 A;  1OSD A;  2FVP A;  3B8H A;  1D09 B;  1FD8 A;  4RUA A;  1IKX B;  1JLA A;  5EGY A;  1QAY A;  2UVV A;  3OL6 A;  1NDK A;  3MFI A;  4NLG A;  4LF7 J;  3ENA A;  3BPD A;  3DI6 A;  1CJT A;  4OZ1 A;  3PW0 A;  2FUG 9;  3I32 A;  2BBE A;  2ZKT A;  3KG4 A;  3CMA S;  4DV4 F;  4HHH A;  5JMN A;  4M95 A;  2FDN A;  2F4F A;  3FSI A;  3FBB A;  2BA9 A;  3CED A;  2IJR A;  2OPS B;  1TUV A;  1H7W A;  3IA0 A;  3KYL A;  3ET6 B;  4FYV B;  2P9C A;  2PC6 A;  1OY9 A;  1FD2 A;  1UJ4 A;  1LWC A;  4RNN A;  2GJI A;  3IR7 B;  4Y2A A;  1T03 B;  2RAQ A;  3NOC A;  2MXY A;  4NWB A;  1SC3 B;  1HYS B;  1YLX A;  2Y8W A;  3D2W A;  4NLY A;  1H72 C;  2K1R A;  4B3T J;  4Q7A A;  3P5B P;  4ECV A;  4LRC A;  1RAF B;  3IG1 B;  1MRO B;  1U49 A;  1YK9 A;  3G86 A;  1FRK A;  4IOB A;  3RJM B;  5CHC B;  3MOZ A;  2F4V J;  2LU1 A;  4E8U A;  3GV5 B;  4NL5 A;  1O0P A;  3EPG A;  2Y3Y A;  4DUY J;  2F9D A;  4XIU A;  3RG6 A;  1T02 A;  2XMM A;  2AJ4 A;  1SB6 A;  4N5S A; 
#chains in the Genus database with same CATH homology
 4JI3 J;  4RJV A;  4KY3 A;  4DV3 J;  4JV5 J;  1IBM J;  5LM7 E;  4DUZ J;  4DR7 J;  4DV6 J;  3W1Y C;  2UUB J;  4DR1 J;  3IMQ J;  4NXM J;  2MEW A;  1HNW J;  4JI8 J;  4LF9 J;  4DR6 J;  2UXB J;  3J7A N;  1XMQ J;  4DR3 J;  4DV7 J;  1J5E J;  3D3B J;  5LMN J;  4LF4 J;  1IBL J;  2UXD J;  4LFC J;  2E5L J;  4LF5 J;  4YHH J;  1HR0 J;  5A2Q U;  1N32 J;  3R2D J;  4DV4 J;  1XNR J;  2VQE J;  4JI6 J;  2VQF J;  2KVQ E;  4KYZ A;  4PWW A;  4GKK J;  1HNZ J;  4X66 J;  4B3R J;  4JI2 J;  4DV5 J;  1N34 J;  4LF6 J;  4JI1 J;  4X62 J;  5BR8 J;  2UUA J;  5AJ3 J;  1HNX J;  5LMU J;  1N36 J;  4LF8 J;  3T1Y J;  1IBK J;  2UUC J;  3J80 U;  4JI5 J;  4JI7 J;  4OX9 J;  2UXC J;  4B3T J;  1FJG J;  3OTO J;  4X64 J;  4B3M J;  1XMO J;  2MQ8 A;  2UU9 J;  4K0K J;  4JI4 J;  3R2C J;  4DV1 J;  2KL8 A;  4NEZ A;  5IT9 U;  2MTL A;  3T1H J;  3JAM U;  1XNQ J;  4NXN J;  4B3S J;  4DR5 J;  5FLX U;  4DR2 J;  4LFB J;  4V1A k;  4YY3 J;  1N33 J;  5IWA J;  4AQY J;  4JYA J;  4LF7 J;  2F4V J;  1I94 J;  4DV2 J;  4JI0 J;  4DR4 J;  4KHP J;  4LFA J;  4DV0 J;  4DUY J;  4NEY A;  4HHU A;  2ZM6 J;  3J81 U;  4X65 J;  4GKJ J;  2HHH J;  3D3C J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...