4RJVA

Crystal structure of a de novo designed ferredoxin fold, northeast structural genomics consortium (nesg) target or461
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'MEMDIRFRGDDDEALARALLKMVVRAVSFGAQVRFTDDGNDLEIRITGVPEQVLKELAKEAERLAKEFGITVTRTIRGSLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OR461
publication title Northeast Structural Genomics Consortium Target OR461
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 24
structure length 83
sequence length 83
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4rjvA00
5LMUJ 4JYAJ 4NEZA 1N33J 4DR5J 4NEYA 4NXMJ 4B3SJ 4B3TJ 4PWWA 4KYZA 4V1Ak 4DR1J 1XNRJ 2F4VJ 5A2QU 4LFAJ 4NXNJ 3J7AN 1N34J 2UXDJ 4JI3J 4DUZJ 2UUCJ 4X66J 4LF7J 2VQEJ 4DR4J 3D3BJ 3OTOJ 3R2DJ 3IMQJ 5FLXU 4JI7J 5BR8J 4X65J 1HNWJ 4LF8J 4LF4J 4DV6J 4LF9J 4YY3J 4KHPJ 4DUYJ 4YHHJ 2KVQE 2VQFJ 4DV4J 2UXCJ 4DV7J 1FJGJ 1XMOJ 2MQ8A 4RJVA 2E5LJ 3J81U 5AJ3J 2UU9J 4AQYJ 4DV3J 5LMNJ 2KL8A 4JI6J 1IBMJ 4DV1J 1IBLJ 4DR7J 2HHHJ 1J5EJ 5IWAJ 3D3CJ 4B3MJ 4DR2J 3R2CJ 4DV5J 4DV0J 4K0KJ 4KY3A 3J80U 4JI2J 4JI1J 4B3RJ 4DV2J 3T1HJ 4LF5J 1N36J 2MEWA 4JI8J 2ZM6J 4JI0J 4GKJJ 2UXBJ 1I94J 4JI4J 4GKKJ 4LFBJ 4LF6J 5LM7E 1HNXJ 1XNQJ 2UUBJ 4JV5J 4X62J 4LFCJ 2UUAJ 1HNZJ 3W1YC 3JAMU 5IT9U 3T1YJ 4DR6J 2MTLA 1XMQJ 4HHUA 4X64J 1N32J 1HR0J 4DR3J 4JI5J 4OX9J 1IBKJ
chains in the Genus database with same CATH superfamily
4A47A 2PIIA 3IBFB 4CH1A 2XYGB 4A8SA 3QWPA 2KXNB 4CYUB 4ZIWA 4H4OA 3ENWA 1YG0A 1MMLA 4NXNJ 3ZFVA 3IR7B 3Q8VA 1EKSA 2Y3YA 3QJLA 2IM0A 2WONA 1LWEA 3DLGB 1URNA 2XQCA 3TAQA 4LR8A 2OMOA 2ZBIA 2YKQA 1SUQB 2HWIA 3I32A 2MQ8A 3ILOA 2HVZA 3BGFA 4DPXA 5HJYA 1OQ3A 2MKKA 1NHKL 4EBEA 2CQHA 2VG5A 2XY6A 3FMWA 3TA1A 3CDWA 3TUJC 2HAIA 1UWBB 1NO8A 4NZ7A 3OHAA 2XO7A 2GAHC 2VG6B 3Q2SC 1P1TA 4P2FA 1IBMF 1I6JA 4CO0A 1FKOA 3CCSS 2DGQA 2PO4A 4HH0A 4DR2F 2EFOA 3M30B 1GMUA 3Q8SB 5D3GA 4FVCA 3G8TA 2DHAA 3M8QB 4IOCQ 5BYQA 4JI8F 4AE5A 4NA1A 3KG4A 2KO1A 4KKOA 1KEKA 4ES2A 3EGWB 5B08A 4DSLA 3RUBL 2UUAF 5DS7A 1TTHB 2QN6B 5ETRA 2PFDA 1WJ9A 2QGFB 4RNNA 4FF4A 3ISND 1JJHA 4WFNQ 4HACA 3EWGA 2C2EA 3HSZA 1WDTA 3NWGA 1VC0A 1V3RA 2R7OA 1VQLS 4ITSA 3I4HX 2M0GB 3VV2B 1QUPA 1RHUB 4OV1A 4DPWA 1QAIA 4A4JA 4K0KJ 3OL7A 3NP5A 3G71S 2ERRA 4Q43A 3MFIA 1O6XA 1QSLA 2FHMA 2C2KB 4FYDA 4MYTA 3ZZZA 1P27B 1RAIB 1MROA 1CJTA 1TL3A 4X4UA 1ZYQA 3HFVA 2J6TA 3MEGA 2HYIB 4KHRA 2BEFA 3HD2A 4EUVA 2GQ2A 1Q86T 4ZPCA 5HQMA 1HI8A 2V5HG 2N4DA 5K14B 3LALA 5HROB 1ZH5A 1FKAF 3UQSA 3E3XA 1CJKA 3DOMA 4JI2F 3GWCA 3R5CA 4GO7X 1VC6A 1NUEA 1VIXA 4X62F 4XDDA 2C3YA 5L46A 1UAWA 1ZAWA 1HQEB 3KK1B 2YWGA 7FD1A 1GEHA 4YY3J 5LMUF 4PG4A 1J5OA 3KUEA 1VQ5S 2OHDA 2QA4G 4DSFA 4PXDA 3CCTA 2AJ1A 5LXRA 2NXUA 4JI3F 2VQEF 1N0UA 2AX0A 4WTYA 3MEDB 2JRSA 4AD6A 2V4JA 4ED0A 2ABYA 2R42A 2I5JB 4PQUA 1KBRA 3BQ2A 1KLMB 2YX1A 1JLCB 2UXCF 3M8YA 2CQGA 2B9EA 4A8OA 2YPYA 4YR0A 1F6TA 2VPYB 3THPA 3ET6A 1P1LA 5IM0B 4MT1A 3B82A 1D0EA 3HT3A 4B3MF 1DTQB 4NI2B 4CRJA 2FJAB 4A8MP 2NR0A 2PC6A 2AD9A 1PGZA 1QSYA 2P9EA 1TU0B 3F41A 2KB2A 4RW6B 2BXJA 3M8SA 2FYXA 4AUKA 2C3PA 2BDPA 2OSQA 4ZPBA 2ZWPA 2FPHX 1KDNA 2AV5A 2V2KA 3I5CA 1ROFA 3BQ1A 1X4GA 5D4NA 2HVDA 4RWWA 4ZPDA 3RRGA 2Z2MA 5GMKa 3K0JA 3KLGA 1QE1A 2WSCC 2RSQA 3AB2B 3NBPA 3THVA 3PRBA 1U09A 1JX4A 4GO5X 3OLAA 4ANDA 4F50A 4CLKA 2XMTA 5HMYA 2CJKA 4MK7A 1G4CA 3M9OB 2HHQA 1JQGA 2HIQA 4KHPF 4I4BA 3BPDA 1T3NA 1UKUA 4OYMA 2CJAA 1HNVA 3KMSA 2UU9F 1FWPA 1PJ5A 3AH6A 1RT3A 3GIJA 3QSYB 4OIXA 1YZ7A 2D41A 2RQCA 4OZJA 3QIPA 3LOUA 4X4SA 3UDLA 4YB6A 2D3O1 4K2XA 1PYOB 4NLYA 4ZP7A 3T6JA 1NXIA 2XWXA 3FRYA 5IQ6A 2LQ9A 5HAOA 1U2CA 3KLHA 1L3UA 3UD3P 1R8PA 3FMBA 2V68A 2RAQA 3EXYA 1DQ8A 2DD8S 1JLAB 4OI6A 3CCLS 1FF2A 4AL5A 3OL6A 2Q3PA 2Y1RI 2VU5A 4R0EA 4FXVA 1C2PA 1VHFA 2F4FA 1HBMB 1X0FA 2B7CB 2N3LA 5C25B 2NZ4A 4ZCKA 4Q5VA 2LCWA 3C6UB 5DQGA 3TJ8A 3RW7A 4IRKA 1B99A 4GKJJ 3NCPA 2SXLA 1D9AA 2EKYA 5GMEA 1LXJA 1KVJA 2KHDA 2HZCA 1TKZB 1B3TA 2BM1A 3NAHA 3FEYB 2DXFA 1TFWA 2KZMA 4N56A 1U1KA 1U2RA 3H59A 2MYFA 5BXIA 4LRBA 4N8NA 2KVIA 2HLTA 4NE9C 2NUUG 1Q1KA 1M0SA 2CJBA 3OPKA 2VZ9A 1UFLA 2J76E 2BOPA 4EO8A 4ICLB 5BR8J 4U9RA 3BEGB 3MM9B 3Q22A 3ENQA 1RTJB 1RQ0A 2DNYA 3DCAA 3IWNC 2RD5C 1WUUA 1FJGJ 4P7VA 4QPXA 4DR1F 2FZCB 4CLSA 2BRLA 3V81A 3BSOA 1S12A 3VAJA 3BDEA 2QYCA 4LR7A 5DQHA 1CEZA 2HBYB 3JSYA 2OD6A 3BSAA 4UY8T 2HNDB 3IAS9 2W7PA 3EICA 5K9FA 2IM2A 4MYUA 1IKYB 3NS7B 3MUMP 5IV3A 3EM1A 4I7FA 3AD8C 2WVBA 1CJUB 2UVUA 2LXUA 3RGIA 5DZ7A 4AL7A 4M5LA 1GTHA 3OXLA 1WG5A 2B9YA 1K1SA 4M95A 4LFAJ 4ZMMA 3DXBA 3DLEA 5H9EJ 2QA2A 2EC2A 1BQXA 5L9NA 4OZLA 3HM9A 5T7LA 4HR2A 1PIEA 2AYEA 1FO1A 5HQLA 2JVRA 7AT1B 5E2QA 2OFHX 4X2BA 3FCHA 2KT3A 5T14A 3PTWA 2BQUA 4DL2A 5U47A 2VIHA 2DXEA 3HHNB 3K2YA 3CUNA 4I2QB 1KRPA 4J9MA 2PD1A 4F3QA 2J5AA 4RBTA 4DV6F 3NXZA 1R27B 1FERA 1UJ4A 3DYAB 4LSNA 5D78A 3ITHA 3QGHA 4DFJA 1TAQA 2CWXA 1S0MA 1MU2A 1N56A 1SJ4P 2FVPA 3CJSA 3HF5A 1HBUA 2P9CA 1MN9A 4ED4A 2DK2A 2Z2LA 5LL6d 1IM6A 5HVGA 3W2VB 4ZLPA 2OKQA 2ZBQA 4QIFA 4DV2F 2C2DA 3NGSA 1YBTA 1JKHA 1OY8A 2DEIA 3KLFB 3Q24A 2NSBA 2IA6A 5J2MA 3W8PA 1VLOA 1L3VA 2DO0A 1EQ0A 3GYNA 4F25A 2J0SD 1NHUA 2XY7A 2WOMA 5K5MA 1N32F 1T0TV 2XGQA 4LF9J 1N5TA 2V8HA 4ZHRB 1CULA 2BJ1A 2QEXS 2YX4A 1MW7A 5CYMB 2AEMA 4D3HA 1CC7A 2B8PA 4AXJA 3BO3A 4K2JA 4JP8A 5LJ5Y 2CVIA 2RB7A 3TEHB 2AEJA 2ASDA 4OZNA 4IO9Q 2HVIA 3SFGA 4WF9Q 2JNJA 1RT5A 3ISNC 4ZJOA 2V9KA 1FVQA 1H2UX 3QO9B 4IKAA 2WRMA 4TKTA 1H0HB 1SCJB 2FHKA 2X1FA 2QX0A 3H2LA 5D0HA 2W2QP 4C3KA 5DZ6A 3QRPA 2I8EA 3LP2A 1FTCA 3RBEA 1R8CA 1F60B 1UVMA 5L39A 4TLQA 4M5JA 3QATA 5G0RA 4KFBA 5IT0A 2XMAA 3M6VA 3F73A 4OHWA 2HBRB 3NCQA 5HMZA 3Q86A 1IKXA 2AX1A 3SDEB 4OJHA 3PX0A 1WTBA 1WKKA 1AFJA 4H4MA 1O51A 1S9EA 1F2HA 3HHDA 1V9OA 2UV8A 5L38A 3WC0A 2ZH2A 1S1UB 4HDGA 5B0GA 4JI6J 5KG7A 4WFAQ 4ZN1A 3C15B 4P73A 1NKBA 2BUNA 3QZ8A 1NDCA 4TU7A 3HO1A 3TO8A 3ENAA 3V4IB 4QPTA 1V6HA 1NK6A 2M8HA 4OFZA 5A6WA 4C11A 2EFPA 4MK8A 3OV7A 5HI7A 4CO1A 4RBUA 2C3UA 4HHUA 2HHHF 4TLRA 3CD0A 2KRRA 1Y5IB 4DV5F 2L9DA 2B8QA 4QW9A 4J9PA 3NL0A 3LPEA 3JQKA 2JEIA 2W8KA 2CG4A 2E9TA 2IPOB 3G6YA 2C3OA 3HVAA 2DNZA 2UV8G 2V8GA 4Z7YA 3IBWA 1R7IA 5E3CA 5BYSA 3KHLA 3TZZA 4ERDA 2BV3A 1OSDA 3ZNJ1 4WXOA 2ZE2A 3M2UA 2GQCA 4V19X 1O0PA 4A46A 3M9NB 1VQ6S 3CDEA 1NLKL 5KFJA 1VGYA 4M94A 1U0HB 1S4FA 4IO1A 4O3RA 4F4AA 4C8OA 5LMNJ 2WB4A 1B64A 1AUDA 3ETMA 1BWVA 4XPCA 4NX9A 3CCRS 2KTQA 3IG1B 1FKPA 1VBZA 1KONA 2AIRB 4CP5A 2V8VA 2RVJA 2Z58B 3EX7B 2DNPA 2AYMA 4ED2A 1NPRA 3MPVA 4OZ3A 4RW9A 4URSA 3HPOA 2GJ2A 4NOHA 1N52B 3KK3A 4UW2A 3N4WA 4LUBA 2QFIA 4M8LA 3WX8A 4C0BA 3C8YA 4RLEA 3RAQA 1VQ7S 3R7NB 2ROPA 2H5EA 2OJ3A 3B4MA 4RO0A 1R6YA 3BGUA 2ZVIA 4NWBA 4BWMA 2J0QD 5KT2A 3UFCX 5DRKA 1R8AA 3GCWP 2K3KA 5KTQA 2Y9HA 1TAUA 4LF1A 1W7WA 2DH7A 2D69A 3VVUA 3ISZA 1LNQA 2IVYA 3HFKA 1HBNA 4IG3B 4ZITA 9RUBA 3TJAA 2B6AB 4YDXA 4P71A 3NOCA 1LFWA 1X9WA 4ZVUB 1EP4B 4DL0C 1CS4B 2BW7A 1NM2A 3SSQA 1ACMB 1BE4A 2CPHA 5CHCB 3U1LA 4M5KA 4K4UA 3MMBA 3QRQA 1TK0A 4QYRA 1UEVA 3QIDA 2R3VA 4IOBA 1WF1A 4M5NA 2G2YA 2J7KA 1IWAA 2CQIA 4YHHF 3PDNA 1NK0A 1ICEB 5AE2A 4JV0A 5I3QA 5AJ3F 4I0WA 3ZTRA 2PSZA 1F9HA 3QYYA 2OH2A 2XWYA 5C5JA 3M2VB 3MAHA 2LLZA 4BS2A 4CZCA 4O3PA 3DM2B 2LDYA 2HLUA 4DI6A 3IGNA 5KFLA 4DG1B 4JYAJ 5KFBA 2WVEA 1UA1A 1WC3A 1FE0A 2IM3A 1GMWA 4OYBA 2F40A 1RXOB 1XIQA 1VJWA 2D9PA 6AT1B 5DDRC 3EYZA 1FNOA 4JUZA 2J6SA 3PZPA 4I2PB 2NZCA 2WB1D 1S4EA 2AWZA 2Q79A 2PEHA 1WOPA 1BHNA 2R7TA 2AHOB 3I0SA 1K9MT 3K17A 2VA3A 2W9BB 4L73A 3RBDA 2B51A 2IJFA 1FDBA 2BANB 1ZPWX 3W65A 4DUZF 2AT1B 3T19A 1HW9A 1JLGA 2PMHA 1SKWA 4HTJA 2HNYB 2AU0A 3MM7B 4D3GA 1AYEA 4JI0J 3RW6A 2CQ4A 2JZ5A 4EYHB 1X0PA 2J7UA 2FTRA 2E7XA 2UVWA 3S01A 5J2PB 4NLRA 4AYBD 4OI4A 2JJ4D 1ULRA 3TJ9A 4MIAA 5HLFA 4YB5A 1PKUA 2ASLA 3JSMB 3IO1A 2MJNA 3CC7S 2W4PA 1WC0A 1T9TA 2K1RB 3M32A 4QWCA 3CTRA 4J9UE 4KSEB 4XDCA 1HD1A 2MZSA 3KTQA 3TVYA 3A3PB 3TANA 3J81U 2ZKUA 2RQKA 1RT7B 3PM9A 4U96A 5D0GA 1IBLJ 2KYXA 3E8OA 3AD9C 4NZ0A 1LEOA 4F7VA 2AJQA 1RHRB 4MKVA 3DRXA 2B7BB 3T1HJ 4FYWB 3M8QA 2Y1JA 3PKMA 4YN3B 5J2QB 3ELHA 3O5TB 2E5LF 1RYRA 2G1DA 4U6PA 5IQQA 4USVA 1S1TB 1WWHA 1SJFA 5F0UA 4FNIA 1KWMA 3D1QA 2A10A 4RUBA 4K5SA 5HANA 3PJ9A 3OD2A 3W3SA 2E7WA 1FA0A 1YGYA 2LA6A 3MECB 4ZVOB 1FXDA 1RWUA 3EXCX 3FNNA 2P2CB 1SL2A 2DGOA 2HPUA 1F3VA 3BM7A 4WK1A 3V4MA 1W25A 3MR6A 4KGKA 2LXFA 3NGKA 4UQTA 5A2QY 4TY9A 3H4BA 1MLAA 1T03A 3PW0A 2EFNA 3OBIA 1YK9A 4USKA 2RJZA 4P72A 2MKIA 4HHHA 4EWTA 3CT9A 3PYDA 4USWA 3PR5B 2YNHA 4GKKJ 4LF6J 3MTJA 2FVCA 2EG2A 1KQSR 3QAEA 2C2RA 2HURA 1BLUA 2R4FA 3OTEA 1ITPA 1HQEA 4ZVQB 2QLBB 1FFSB 3EDRB 1WG1A 1HR0J 3HVTA 2EKNA 2A6MA 2GX8A 3IM8A 3KHRA 2CQPA 2KFNA 2ZH1A 1Z2ZA 3GB0A 2EFVA 4K50A 3THTA 3V2UC 4M63A 2EBGA 2V69A 1RTHA 3KLIB 2DGXA 3A8KA 3CCVS 3WZ0A 1EZZB 2C2MB 1UFKA 3PACA 2AJ0A 5JVGQ 3V6DB 2IAJB 4KH1B 5BYRA 2JSXA 5KG5A 5CA5A 3NGTA 3D67A 5KFZA 5HVHA 1NAQA 2N82B 3Q0AA 2V8PA 1IXKA 2UXDF 1QAJA 2CQ0A 5K20B 2R7RA 1FXRA 2R8GA 4B9TA 2OPPB 1DTTB 4OJ3A 1RT6A 4RNMA 3HCXA 3T5JA 3JTOA 5KFGA 1DY3A 4RU9A 3NWRA 1DAXA 1SIWB 2I6WA 3M7VA 4DR7F 4OYWA 2EFQA 1S6UA 4LRDA 4J9SA 3NG8A 2OI2A 4ES3A 4WFXA 3SBMA 1VK3A 2ZJRQ 1U2FA 4ECSA 3D6HB 4F3OA 1NH7A 1KHVA 2YTCA 2F4VJ 3MR2A 4ALZA 2YNFA 1F9FA 4H4OB 2GIQA 4B02A 1FHTA 4X65J 5D4OA 1B4SA 4X4NA 5ETNA 4RW8A 1VRUB 2WONB 2YPZA 2MQLA 1LWEB 2YNIA 4DV4J 4NXMF 1OSCA 3G8QA 2IRYA 3UN3A 3D9BA 2HK2A 2A2DA 2C22A 3GU0A 2QLXA 4NZ6A 4ZS6A 2ZH4A 4JI1J 1UZDA 4M5DB 3LAKA 2VG5B 4UZBA 1XQIA 5IXUA 1BQMA 2D3ZA 3FBCA 4FZVA 2XS2A 2FB0A 2NUHA 3K5PA 4ZCIA 4JV5J 4OYZA 1YJNS 4AQYF 1YI2S 3JAMU 1M5OC 3BO4A 4CLPA 2VBXA 4YR3A 5ETKA 4C3LA 4Q45A 1KN6A 2KFYA 3KHGA 3IN5A 3N6MA 2BKOA 5D3GB 4WCEQ 3AB4B 1EETB 2R2UA 4KKOB 1NSPA 2KYZA 4YB7A 1UCNA 4ID5A 2BRKA 1N33F 3RBXA 5AXLA 1S7HA 3NS6A 1TUVA 2OEKA 4HACB 1Y3JA 1HI0P 2DT9A 1JLFA 3J81j 1G7CB 2OPQA 2NQPA 1WTFA 4CO2A 4YR2A 1U47A 2NS1B 1XC9A 3M2RA 2VHGA 4DV0J 3BBBA 1N48A 2D74B 2W2MP 2J9EA 2HZVA 4WWSA 2UUBJ 2OLWA 4Q0BA 2ZFHA 4ECXA 2BJ9A 1CJTB 1U49A 1HYSA 2V67A 3MM9A 3MEGB 3G82A 4AT1B 5EDWA 3Q8QB 2HQCA 3C6TA 3E01A 4DX5A 3D5MA 3S8SA 3DOMB 1XNRJ 3H2VE 4X4VA 4PG6A 2OD4A 2YKAA 1N34J 1S0OA 2RHQB 4TQRA 5MLCV 2DR7A 3HI9A 4CLZA 5HP1B 4USJC 1Y11A 3HHLA 1ZZFA 1XMOJ 2RF2A 3KYLA 4F04B 5J1EA 2XY5A 3PY8A 2CNLB 2CNKB 2VUGA 1T05A 2H1YA 2VOOA 3N01A 2GA7A 3MFHA 3AOCA 2C3MA 2BJ7A 1S6PA 4JI7F 3IBCB 4NA3A 1HPZA 3CCMS 1RZMA 4NLPA 4F0KA 4PQUB 5RUBA 3ENVA 4KO0A 4CO5A 4FPRA 5F41A 4O44A 2ZNYA 3DRRB 1FEEA 3ZZ0A 4DR3J 1TK5A 3HZGA 1LW2A 1RWNB 1RCOB 1YJ7A 3FK4A 4DR5J 1IKVA 4AFFA 4I6AA 1FNMA 2QZ8A 1QY7A 1R0BG 3TUPA 3NKYA 3UNYA 3W9HA 1X31C 4YFUA 3IRWP 4J9OA 3RRHA 3W62A 3ZTPA 1VQ9S 2G4BA 3L7PA 3FSXA 2GVDA 4DFKA 3UWTA 3HT0A 3HZEA 4FS1A 3GYXB 2ILZA 2I9SA 1U1NA 2E1PA 4CI0B 2XMMA 3KLGB 1QE1B 5IT4A 3NBPB 1Y5LB 1HARA 1I5OB 1Q7LB 1R8HA 4NA2A 3GFXA 5DDQC 1D3WA 1OJ4A 5E3AA 1S49A 1C0UA 4NLUA 4EMDA 2JLGA 1BWEA 4KT0C 3DKDA 2WHOA 1HNVB 2RRAA 1LWXA 1RT3B 2R8JA 1MG7A 1N5SA 4DCJB 2EK1A 3QIPB 4PYDA 2MDAA 1GT8A 1YDLA 4LFCF 2E44A 4A8WA 1UPPA 2ZOGA 1T94A 2CPXA 2YKOA 4OYIA 1RHMB 4OHYA 5GAHU 2RH3A 3M8RA 3OR1A 2A6OA 5DO2A 5BJRA 2PMZD 5HMWA 2H4YB 4EEYA 4DV1J 3QQCD 5IWAJ 3KOAA 1F2GA 3CW2C 4ZPTR 2O1PA 2I0XA 3K5MA 5CD4A 2VBWA 4MH8A 3DMJB 1N88A 1WEYA 3WX4A 4GC6A 3BF4A 3H5SA 1VQ8S 4C6AA 1YRTA 3NNCA 1SJQA 2XMVA 4OYAA 4PR6A 2E1CA 4UOFA 4UTGA 1VRTA 4P6QA 2W4CA 1NK7A 3QGPA 3QFHA 2QSWA 2E9RX 4DQRA 2FY1A 4L72B 5IOLA 4R5PA 3M8PB 3EGZA 5F8HA 5D8HB 2ZD1A 3K58A 4EYIB 1U25A 1TUGB 1RCXB 2LP4A 4KB7A 3GFYA 3ETOA 1PYTA 3HKZD 4Y0FA 1N54B 4TNOA 1RBOB 3J7A1 1YTYA 3BBCA 1QJHA 1S1VA 2PT0A 4USMA 3TAPA 3W5YA 2DY9A 2B4PA 3OJUA 3V81B 4U7UD 1UFWA 2CQ2A 2XTJP 3HX9A 5E33A 1S6QA 4X4OA 1C4CA 1I94J 3GIMA 4CM0A 1KKHA 4DFMA 4ECUA 5LT5A 3HDSA 2VV5A 2W9CA 3P3DA 2DHSA 2CJ9A 1P8GA 1YX2A 4DN9A 2HFVA 2CQCA 2G2ZA 2VPWB 1LWCA 2MMYA 1Y4ZB 3RBZA 1U48A 3UD5A 2ZHBA 5ADZA 3QJJA 2HBQB 3KXDA 1QVGR 4I7FB 3MMAA 3HFZB 2CWKA 2AEFA 4B3RF 3PFEA 2FJDB 1VISA 3L7UA 3L9ZA 1S0VA 2ILYA 3TYTA 1PAUB 1SC3B 4OZ0A 4LQ3A 5IFMA 5LXYA 2HQIA 4LFBF 1B70B 1HNIA 4W92B 2PEBA 1XERA 2F63A 1LK7A 5SZTA 2HS3A 2ZHOA 2YWFA 3NOGA 3TWZA 1HD0A 4OJGA 2QA4S 1NU4A 3KLVA 3DXSX 1NJIT 4F4YA 3DLEB 2HWTA 2RUGA 1X5SA 5E3RA 2JC0A 5T7LB 1QSSA 3Q83A 5KFEA 3ULHA 2KJVA 3MPUB 3PO5A 2DY1A 2IRUA 4AL6A 4HH1A 2EK6A 3TARA 4IH7A 3PYFA 2AZ1A 2HFOA 2UZAA 4CLTA 3CXCR 1AXQA 4ELUA 3I56S 2JOQA 4W4MA 4M5IA 1M1KT 3GTYX 3DLKB 1IQTA 1FRIA 3BN7A 1WHWA 3D6FB 3H90A 3Q8YA 3CCQS 3R9LA 1YLXA 1HNZJ 2AGPA 5EWFA 1TL7A 1PG5B 4LVNP 4OI1A 2IRXA 3PIOQ 1MU2B 3CJKA 4WE1A 2Y1IA 1HBUB 2XYPB 3BBFA 5HSPA 1M90T 1UEKA 4GVBA 3M8ZA 4DU8A 1UVNA 2G0JA 2BJ3A 2DEJA 3U1MA 5J2MB 2F5GA 2HFUA 2FUG9 2ZC3A 4ED1A 1M1GA 1SQEA 4L3KA 2CPFA 2WOMB 2HVEA 5J1NA 4DV7J 4LBIA 3H42A 3MR5A 1Q8KA 3ZZUA 3MCSA 4M5GA 7FDRA 4B9NA 3IAM9 1CULB 4B9LA 3R2CJ 5I42A 3UE2A 4DG1A 4URGA 3GSIA 1ZTTA 1GXTA 1WI6A 3D0GE 3SFUA 2ZH8A 4JI4J 2FVSA 4DPYA 2XYHB 4NCAA 1KHWA 1VMBA 3R5BA 4J90A 3T41A 4Y28C 2DYAA 2HKEA 3EDQB 3R1LA 2DNQA 1RT5B 1H38A 3F0NA 4ED5A 2IBOA 1PC4A 2MXYA 4BHQA 3LP0A 4A8XA 1ZA1B 5F8NA 4KE5A 3WIVA 1NRKA 2BANA 2WVCA 1FDDA 3FDSA 1RAGB 1RKIA 2LMIA 5LSRA 5F3ZA 3VAKA 2CDQA 2IFXA 3LP2B 1IVZA 4Q2MA 3K5NA 4ZK7M 3DHXA 3GFZA 4KFBB 4ZVFA 2P6SA 4QIVA 4JI0F 4AXIA 3MPWA 3HJVA 3FBEA 2IYIA 2V9WA 4Q2LA 1IKXB 2FZGB 4H4MB 1S9EB 1U6ZA 4R0JA 5M2PA 1RABB 3VCDA 4DCOB 4J9QA 4MMOA 2HHTA 1T9YA 1W2BR 2CRLA 2HHVA 1YZ6A 5A8RA 3G9CA 1N6QA 3FFIB 1HNWF 5AE1A 3JSMA 3WHIA 1AB8A 2VOPA 1KOOA 1UPMB 2F9DA 5H1SV 2R8HA 3CULA 2VC1A 4ZIVA 4PWUA 4DS5A 4KPCA 4QR2A 1JLEA 2OMLA 2M5YA 4X64J 4C11B 2NREA 3MM6B 1E6VA 2MLXA 2N4CA 2Y8YA 3RRKA 1U8WA 2UXBF 4FVMA 2ZEJA 3PW7A 2DR8A 1UEUA 3W5ZA 1T9XA 3GLJA 2YQ1A 4CLLA 2X7IA 5KAKA 3HHKA 3EJMA 2MJUA 2WVFA 4Z7CA 4F26A 1XMQF 3C16A 2XZWA 3T1HF 4JI5F 1CQMA 3GR1A 2KXHA 2VBYA 3WBZA 2FJEB 2ZE2B 3M2UB 4DL7A 3ZZYA 4DV3J 2WBMA 4PG8A 2CNOB 1GAOA 2ZBCA 4Q8EA 3D1OA 1F5CA 4ECZA 1S1TA 4YB1P 3P6YC 3HVRA 1FKPB 3PIPQ 1H73A 1V5IB 1VOMA 4KV8A 2DNLA 2BQ3A 1RBLA 1Q16B 4IH6A 3V6KA 1HNXJ 2DVIA 3MTKA 5IT9U 3MMCA 3FBBA 4RW9B 3HHEA 4ED7A 1HFEL 2H54B 4CH7A 4F67A 3KK3B 2JWNA 1YRXA 4B3TJ 1GMVA 3CE8A 4PWWA 2WZ1A 3DRSA 4NRUA 4Y2CA 2FJVA 3NAIA 4LVOP 3BSNA 3QBCA 4LF7J 1APSA 3NY0A 3T5LA 2AYBA 3G6VA 3TQEA 3DOLA 2VQFJ 3MEKA 2XS7A 1W26A 3P49B 1T02A 4F0MA 1X4BA 4EI2A 1HBNB 1VQKS 1VS3A 3CD7A 1G2EA 4CTAA 4X66F 5GADU 4HI2A 1R0AA 3PEJA 1TKXA 4FBTA 3H7HB 2ZM6J 3CD5A 3MMBB 4LRCA 2VASA 4K4ZA 3CC4S 2RKIB 1YJUA 3W2WA 2VPXB 3OTBA 3SZ2A 2IAJA 4U7UK 3W9JA 1SH3A 3NRBA 5HVFA 2HGNA 2RHSB 1A6LA 2LXIA 2D3OR 5D0RA 4G1IA 4FF1A 2ZZTA 1WF0A 3L3CA 3K57A 3UR3C 3DLHA 4GMKA 3CEDA 3LWMA 2ROGA 4PCQA 4USUA 4ECYA 1HKAA 4MK9A 2QL9B 4JB8B 3H98A 3M6WA 2JX2A 4ZVRB 3I0SB 1QTNB 1OPZA 3P45B 5DDOC 1JJ2R 3NGRA 1IBMJ 4ELTA 3QGIA 2GMHA 1NCLA 2YVSA 3DLBA 2IBKA 4DR2J 4WZMA 4CNYA 1NPKA 3H2UB 2B3TB 3UNGC 1S59A 1VIOA 4LQ9A 4JI8J 1JLGB 1H72C 3FEXB 1B0PA 2ZOMA 3P8BB 3AA9A 4ZVEA 4ZA1A 2M88A 3TNVA 3GFHA 2MHEA 2UUAJ 3W1YC 2BKNA 3H4DA 1ZBTA 3H8YA 4ZLLA 2HNZA 1VRUA 5IS2A 1D9FA 1XR5A 5IZHA 4CM2A 5EN1A 5HLFB 5F8IA 4V1Ak 1RI7A 3M05A 4U7CA 2XULA 2W7OA 4P2MA 1RWWB 2CZ9A 4OJ1A 1TFYA 4HYKA 1U4BA 4OQJA 4DR4J 2ACMA 3R2DJ 4I69A 2GO9A 3M32B 4EO6A 3MM5A 2BQRA 2Z30B 4M5DA 5DJBA 3VGSA 3D6TB 4CNZA 4RWXA 2H3EB 1VDHA 3CIMA 2QLFB 2GIRA 2DO4A 2BYCA 1ZM4A 3JAMY 1AZSA 3DGPA 2W9AA 4JI2J 1B7YB 2AMCB 1JLQA 2BVZA 3R3TA 1VYAA 1WKJA 2K8GA 4UUWA 1EHWA 1EETA 5GAEU 3KNGA 4X62J 2VKRA 1VJQA 2JL9A 2XHCA 4QWEA 3CO9A 1NEEA 1RWKB 2MKSA 5LMUJ 4C8ZA 3Q89A 4PPZA 3OTDA 1RAEB 1QM9A 2QJ3A 1R8BA 1IJFB 3V6JA 3J7AN 3CNQP 3LW5C 4JI3J 1VRQC 2DKOB 1TKTB 2VQEJ 2GVZA 1D9DA 4X4RA 2HQFA 2HMIA 1SBRA 4FYYB 2B9XA 2YX7A 5KFVA 1VQOS 1SB6A 1EJ7L 1RT2A 4FN5A 5KT3A 4Y65A 4A8QA 2C2NA 2R2RA 2YNGA 2UXCJ 3T5KA 1FX4A 1RA6A 8RUCA 3I96A 4G1QA 2OGUA 1WC6A 2RS2A 3QRRA 4DEZA 4NLQA 4B3MJ 2C28A 3BGLA 1U02A 2BBEA 3D0IE 1T03B 3FSIA 3KDOA 2WBRA 1XR6A 2YNHB 4ETZA 4PABA 3ZZTA 2KI2A 5HP1A 5L9XA 3HVTB 3AA8A 1A7GE 2HFNA 4DPUA 2JC1A 2E9ZA 1GX5A 3KJNB 2I1RA 2FVRA 1HW8A 4IDKA 2DJWA 1RTHB 4KHPJ 4ZP8A 4UQGA 4KIAA 1OYEA 2OO4A 4C8NA 3KNAA 5CZVA 1GFWB 2UU9J 3BR8A 3UCGA 4OX6A 5E0OA 1BD6A 1AA1B 4ANEA 4F2RA 1U7LA 3DRRA 1HMVA 3AAWB 2A1BA 4KR0B 3VZIA 4NPOA 1I51B 4URQU 3MWBA 4O23A 3GJTB 2I38A 2F8EX 1FXLA 2VPZB 1RT6B 2H9ZA 1ZPVA 3R8YA 5KT7A 3B54A 1YSJA 3E51A 4IFVA 1ZZNA 1IUJA 3W9IA 1LQ9A 3LTOA 3MCNA 3VGUA 4Q8FA 1S97A 1RT1A 3G6XA 2XM3A 4LF5F 5E3QA 3AT1B 4HLBA 2J7WA 4ID8A 1H74A 2IDEA 3KUGA 2DGVA 5JXSA 1HBOA 5KFAA 3T1YF 4CWBA 2P8IA 2YNFB 3NCRA 1T95A 5GMDA 3K5OA 1VBXA 3DC2A 3DRPA 3KKFA 3L7OA 1HQUA 4RW8B 2UP1A 1SQFA 2YNIB 5A8KA 2Y0SD 2V94A 1WACA 1UA0A 3D68A 1YBAA 2CPDA 4LMZA 4QIEA 3DHWC 1UP1A 1MWQA 4J9KA 5EGYA 3BYPA 1O8BA 4DU7A 2FLLA 2J8SA 2QL7B 1H3DA 3NMRA 1OS5A 1T8EA 2BJEA 5ETVA 3RR8A 2VDHA 4N76A 1BQMB 5K8MA 3JB9k 2HWHA 5C42A 2FC9A 2D7SA 3CC2S 1SL1A 3ZNUA 2CQ1A 3LP1B 3QZ7A 4ZCMA 4DR1J 3A3NB 1RLCL 2X1BA 3A8EA 4C4WA 2ZH5A 1NDLA 2HFZA 4ZDNA 3RAXA 4R25A 5F8LA 2U2FA 4Y2MA 4DF8A 3VF0B 3PVXA 4HVZA 4OX9F 3CJQA 1RJJA 3DMJA 1NSAA 3JTNA 4O4RA 1JXVA 3FQKA 3IM9A 4B3OA 1Q4RA 2GAGC 4F36A 4ID5B 1RP5A 2RNEA 2DPJA 4WFZA 2LECA 1MWYA 5C7PA 2DISA 3MAAA 4TN2A 1FT8A 3VAMA 1XK8A 1RAJA 1JLFB 2OPQB 4RW4A 4WYWA 1DZ5A 4RW7B 3K8WA 1N5QA 2E5IA 3M2RB 5KFIA 2V63A 2UVRA 3M8PA 4UF4A 2LA4A 1BUXA 2DNGA 2J0WA 2CJYB 4Q0BB 4EU0A 4J9VA 2HG4A 1JLBA 3L4BC 2G9OA 3NEKA 4QOTA 1HYSB 2MY7A 2YBVA 1KC8T 3G82B 3W66A 2DGWA 2XLKA 1TV6A 2KT2A 3C6TB 1FFWB 1QAXA 3EMTA 3E01B 4IYQA 4UOCA 1BY9A 3UDVA 3N0VA 1RACB 3GJQB 4WIIA 4DR6F 3B4DA 1UL3A 5JMNA 4DV6J 4O0IA 1L3TA 1FD2A 3NMAA 4L3NA 4R8UA 3QT7A 1XEZA 3MMJA 5ETOA 4KH0B 5IC6B 3HHLB 3TUIC 1S1WA 3DDNA 3OJSA 2K06A 3J7Z5 1AT1B 2XCPA 2RF2B 1J5EJ 3OTOF 1GK8A 1XBWA 5B7WA 3J7YU 1LWFA 3EVMA 5J1EB 3C14A 4LF8F 5KG1A 1T05B 5DG8A 4DV2J 2P6TA 5F0WA 2XMWA 1RK8A 1S6PB 5KFSA 1HPZB 4FPIA 4OI0A 1SH2A 1TUWA 1K47A 1Q5YA 2DNRA 3N9UC 1S1XA 5K8OA 1N32J 4KO0B 4ZPAA 1VI7A 1ZS6A 3BR9A 2B0GA 4O44B 2Z2YB 3W61A 2JLEA 1IWGA 1LW2B 3Q8PB 1IKVB 2NYHA 3JQMA 5DQIA 4CLUA 4KJIA 3OL9A 2GHPA 3T5HA 4K4VA 3DLKA 3KLEA 3RYLA 2LYVA 3HSDA 4A8KA 2QIFA 2AP6A 3SMZA 1UVIA 5LSOA 5HBMA 3AQPA 2GVDB 2DIUA 3M8WA 3DFEA 3P96A 3TP2A 4DOZA 5F3TA 3LANA 2QFJA 2JEJA 2UUCF 5MAOA 1PJ6A 4Y6IA 4MIBA 3SSSA 3A12A 5KT6A 1S9FA 5B0AA 3IS9B 2IJRA 3TX0A 3KJVA 1X7VA 2ZJPQ 2XG8A 4G6VB 1UETA 1NZ8A 5T41A 1KFSA 3SI8A 2IMOA 1C0UB 5AE3A 1C1BA 5AXMA 4F0HA 1SVDA 2GW8A 4O3SA 2F65A 5C2CA 5GAHI 2R2TA 1LFPA 5KOWA 4ILMA 1HWLA 4ZOSA 4QQBA 2MGZB 3TI0A 4WP8A 1RTDA 3IRXA 2C1EB 2Z8QA 2J9DE 4FF3A 3SQGB 2FJXA 3KMQA 4OYXA 1NKCA 1T9VA 3OR1B 4ECVA 5CXTA 3M6XA 2HHHJ 3PW2A 3SIPB 2GMJA 2Q6BA 3BB5A 4DV5J 4YMEA 4LRAA 3SQOP 4PWDA 3AFGA 4DUYF 2B4VA 2QA1A 4NCGA 2B4OA 1LOUA 5HO4A 2EBEA 3W5XA 4HHJA 2YWKA 2RMLA 3D0HE 5C2GA 2PFFB 3OUYA 4USHA 1VRTB 1N36F 3VQTA 1FRKA 1YQHA 4DSKA 3CWJA 2H5JB 4EFAC 1RWMB 3TZYA 2VC0A 3H20A 4KGXB 1VBYA 4DQQA 3D6MB 2A18A 5K8PA 4R5PB 3FFIA 1CJVA 2BE7D 3LQVA 1YITS 2RUSA 3VQSA 2ZH9A 2E5JA 5L1LA 1J27A 3H40A 4F8RA 2KN4A 2ZD1B 4EK2A 2CAJA 2VF3A 5ETSA 1TMMA 1FJ7A 2QLWA 2D1CA 1WORA 1S1VB 4C0HA 2YY3A 3MM6A 5KG4A 4HKQA 1RAFB 1VHIA 3W8GA 3FCWA 3N6NA 2COLA 2YH1A 1S6QB 2BKPA 2XCAA 3SV3A 2LFVA 1QAYA 2OTLS 2RRNA 4P9SA 4L6V3 4M5MA 3SSRA 4XK8C 2W9CB 3VR1A 4DJBA 3FVYA 1IBKJ 3MCOA 3BREA 3KG1A 4N41A 2BACA 1LWCB 2F3JA 4A8YA 1YJWS 3MMAB 4CO4A 1RB0A 4DBQA 1S79A 1C1CA 2VH7A 1WOOA 1RWVB 1XNQF 4BLGA 4F4XA 3H25A 4CDIA 3U27A 1HWJA 3CMAS 1M5VC 4ZLJA 1HNIB 1RGVA 4XIUA 2AGOA 1Q8BA 3MD3A 4K7QA 2IC3A 1EKRA 1U26A 3K8VA 4YHHJ 5L1KA 3DU5A 2HQDA 5A8WA 1NB7A 4NCBA 2DRDA 5AJ3J 2IMWP 2QRRA 2ZUAA 2GZOA 2GNKA 5KG0A 4IH5A 5IT9Y 1V3ZA 4O3QA 4MKYA 3KWMA 4CLYA 5I4MA 4OZ2A 2BW2A 4B3TF 1B0VA 3NGDA 1RBAA 3KUHA 4ELVA 2IHR1 1FI4A 5FIIA 2ZH7A 1NMEB 3CJ4A 4WTOB 1TR0A 2QV6A 3PYEA 1TL7B 2YKPA 3C46A 2G13A 2ZZNA 3CJKB 3QSIA 4WE1B 3BN4A 3H5XA 2BABA 2CJXB 3PJXA 3GILA 1OY9A 5KFHA 4DUZJ 1BMQB 4GVBB 2ROEA 1GXLA 4YOEA 2RS8A 1VBKA 1JJCB 3LGHA 5FDLA 3GV7B 4P52A 2XZTB 3GMGA 2IM1A 1YJRA 2ZM6F 3LUYA 4OMFG 4F4WA 2HRUA 2RU9A 1C4AA 3W7BA 2V2VA 2FLOA 2PMWA 2RKIA 1HQ2A 2OP5A 1EARA 4P10A 1GMWD 2CADA 2XZDB 2VG7A 2DCUB 3PW4A 5HQ8A 3HULA 3ZTQA 4F02A 3A1YG 5I42B 2MQMA 1NPPA 3Q8UA 1RISA 1X4DA 1F5AA 4ZLNA 1U1QA 1B7FA 1T3OA 1VQMS 4J7CA 3RB6A 2MHNA 4FXWA 4UT4A 4E98A 2XMKA 4DL4A 2KKHA 4NEZA 3IC1A 2HIYA 1FCAA 2ADCA 1PBUA 1BQNA 1MSWD 3F44A 1MMDA 4Y2IA 1S9GA 3I87A 3LP0B 6FD1A 2B4UA 2QMWA 3G2XA 2LKZA 2MQNA 5J2NA 3CJTA 5ETMA 4HT7A 2OSRA 3I9ZA 2OPRA 3AXMA 4OYPA 3MDFA 2CZVC 5D15A 4ZVTB 2K7JA 1PYSB 2E5LJ 2YWWA 2ATLA 4G3IA 4NXNF 1PBAA 3T1AA 4WJBA 2YWHA 4K59A 1VQNS 4MKBA 4NLGA 5H9FK 2CJQA 2GCFA 5EUHA 3VAHA 1WDDA 5A8RB 1N6QB 5F9NA 2F8HA 2GV1A 2EEYA 3GQCA 4DR4F 3CB4A 5ETLA 2MLYA 1X8DA 2PE8A 3POTA 2DNHA 2DNKA 3VGVA 2YKNA 4J91A 1JLEB 1HWKA 1IR1A 3CSKA 3VAIA 1Q78A 1FTRA 1X4CA 3DLLQ 1RT4A 4C8LA 4ZJLA 4K5RA 1E6VB 3DGVA 3QWUA 5A2QU 4H4KA 3O6QA 3QFWA 1ZM2A 3RG6A 5ETTA 3MM8A 2V2ZA 5B09A 2DXDA 1OMSA 4FF2A 4MAKA 4YDDB 1M5PC 4Z37A 1WC4A 1D1UA 4DQIA 3X3UA 3C16B 3OFEA 3CCJS 5G4DA 4C8MA 2G0CA 4BC9A 4TYAA 5FD1A 1HA1A 3MD1A 5L8RC 2XS5A 3FZ2A 2YH0A 4MTPA 1E6YA 3AJ1A 4O3NA 4ILLA 4KQZA 3WC2A 1P6TA 4Y2KA 3ZXWA 2KG1A 2DHXA 4TU8A 3H5YA 3BV8A 1QDUB 4N7TA 1FRLA 4KV8B 1TKTA 3J7ZT 3PHTA 4E0DA 2FIUA 2R9LA 4OYOA 4UZCA 3R5DA 5J1PA 3MMCB 1KD1T 3UD4P 5ETPA 4K0KF 1B0TA 3JS9A 4K8RA 2JH3A 5L1IA 2JEGA 1SQGA 2XSJA 1WHYA 2GHWA 4Y3CA 1GXUA 2RE1A 1GNKA 2UXDJ 1X60A 3DRSB 2AJ4A 2KZZA 2WW4A 2OFGX 3GYGA 4F3MA 5GADI 2B56A 3MHYA 1FRMA 1PCAA 1NNDA 3TW0A 3AOAA 4OX7A 3DOLB 3PYGA 4NLOA 4CO3A 5HMXA 3EUNA 1QD1A 1KQKA 2MZTA 2DCLA 4DR7J 3QT8A 4DDFA 2POKA 4OHVA 1TMJA 4EZ9A 4WP9A 3CCES 2HSEB 4CTAB 3TVKA 4UOHA 4LJMA 4YY3F 1RAOA 1R0AB 2NLWA 1K73T 3OR2A 3KHHA 3MPDA 2DH9A 3JSBA 1TKXB 2VFRA 2W2OP 2E1RA 5CYJA 1T9UA 4RNFA 2HQ3A 1Q7YT 3W2WB 4GC7A 5B0FA 3FZBA 2L48A 2OAUA 5AXNA 3D1HA 5A0YB 2W25A 3OQ2A 2ALZA 2EVZA 4NXMJ 2BMBA 3OVBA 2CQBA 3FBFA 1H98A 4BDPA 2XEXA 3JYTB 1UW9A 3Q23A 1X4AA 2VBZA 2BE2A 4EBDA 3LF0A 1WELA 5FLXU 1Q53A 2OIHA 2E29A 1VQYA 2XMUA 3HK2A 2GMLA 3R27A 1LW0A 2E5GA 2DNNA 4AQYJ 3N6LA 4DQPA 3KK2A 2YQ3A 2JHEA 4HTIA 4JV1A 2CG8A 4FKYA 1BGXT 2ALYB 4DL3A 5KFKA 2EFGA 2IYGA 1K1QA 4C48A 4PEOA 5KFRA 2QO3A 2EXUA 4TU9A 3DOKA 3CJ5A 5CCLA 2DIVA 1KTQA 3IWLA 5D4PA 1R0CB 1FD8A 3OFFA 3BSCA 4FYXB 3FEZA 4PYAA 3W60A 1KOHA 1TVRA 3UVJA 1N33J 3BKTA 1QVFR 4DSIA 3GIIA 2W8LA 2HNZB 3K5LA 3K7RA 3R7SB 4FS2A 3M6UA 1NZAA 4DLGA 2BE9B 4UUXA 2XMJA 1RDRA 3UW1A 3LH2S 1WNEA 4QIGA 3CCWA 3JTPA 3MM5B 1VQPS 4KC5A 3RB4A 2ACYA 3CIZA 2EG1A 5DLFA 4WU3A 5GAEI 3D2WA 5KG2A 4RX6A 4QJVA 3GONA 2A2CA 2RRBA 2MQPA 2ASJA 3GCXP 1DQAA 3QAUA 3LP1A 1AZSB 4N77A 3DGPB 5KOXA 5DM7Q 2DR5A 4FDFA 2DGTA 1JLQB 2CDRB 2KRBA 5AT1B 1Y7PA 4PRFA 3BQ0A 4CIOA 2KT5A 1X5TA 1R6VA 2HS4A 1D8ZA 4ZKAA 1Q8IA 3TAMA 4GKJF 1DFDA 3CJ0A 5GVQA 4XAKA 3U7JA 4KGVB 5HK4A 3LGMA 4NLSA 4K4YA 1S0NA 3R6GB 2HHUA 4JI7J 4QYZK 1CLFA 2GVZB 2XC9A 3PNIA 4RW7A 3PRVA 2HMIB 1NKEA 4N47A 3CJ3A 4IQMA 3A8IA 1RT2B 3I9V9 1NK8A 2YNGB 3UR0A 2KG0A 5IV4A 1VLYA 3PX6A 1U45A 2E1MC 4I1TA 4G1QB 3TVZA 4RU2A 5BR8F 4DXLA 2HK3A 1GH8A 1JB0C 2FHJD 3RAMA 2YXLA 4KBIA 3B8HA 2Q1LA 3KDNA 1FJGF 3HHLD 5KFCA 2DB1A 2HW3A 4NLVA 2J6UA 2MY8A 1X4HA 1IKWA 3DI6A 1WC5A 2H48B 1REVA 2CPIA 2FHJA 4ED8A 5I3UA 2OPSB 1KTVA 2J9DA 3ADAC 3GIRA 2GHVC 4OI2A 2B5JA 1M5HA 4KRWA 4P7TA 4L74A 2W1BA 3R5AA 2ADBA 1WEXA 1VK8A 1J5EF 3PV8A 2VA2A 4WBFA 2GGPA 4QBUA 1YIJS 2ZITA 3ILLA 5HJXA 2KJWA 1SKSA 4IG0A 3WQPA 4XPEA 4IDKB 3HKWA 1HLWA 2M9KA 5EWEA 5F8JA 5HN0A 2X1GA 2KM8B 5KFNA 2HHPA 4DZ6A 4LFAF 4RZRA 1TL4A 1M1HA 1DLOA 1HIYA 4NLXA 4USIA 1S6OA 3DU6A 1HMVB 3AY0A 2CA9A 2ZNZA 3K59A 4K4WA 2IY5B 2VKZG 3QGGA 1FESA 2VJVA 2F9JA 1OQ6A 4ZP6A 3EGNA 4LFCJ 1JIHA 2OELA 1SI9A 4L76A 1RHKB 3TEGA 1ZA2B 5KFPA 4OI3A 4IFVB 1N5YA 3TZWA 4ZP9A 2IJNA 5B0DA 5CZXA 3I31A 4O4GA 1NJXA 3G6ES 1RT1B 2PGCA 4O3OA 4HEA9 4WYLA 4RKUC 4IFYA 4ZVSB 3R5JB 5B0BA 2Y8WA 1C0TA 3CMES 1S57A 5KFFA 1HBOB 5KFXA 1NK4A 3IS9A 2DITA 3PEHA 2GO8A 4X4PA 4H4KC 3HP6A 1T11A 4NMLA 5HL7Q 4W90B 2MLZA 4ED3A 2FDNA 5THWA 3SCJE 1FK9A 3UN5A 3DRPB 3MUTP 1HQUB 1D09B 1WHVA 4NRTA 3TQ1A 1U1LA 5GAGU 3DRYA 3C19A 5A8KB 1ZM3A 2IA0A 2C2OB 3J80U 1KP6A 2CPZA 3M4XA 4LF9F 4PAAA 4E2FB 3RJMB 5DM6Q 2VFUA 1J2VA 2NXEA 2CPEA 1F5BA 3G86A 2K7KA 1CC8A 2L08A 2QC3A 2MGZA 2AJ2A 3AXKA 4ZJQA 3WIUA 4KGZB 2O66A 4GRSA 5C42B 2ZOFA 2AQ4A 3PG9A 4ILRA 3I5AA 2V8DA 3SQGA 1YWXA 2M70A 3GR0A 1U0SA 4NLDA 2GIFA 2VJUA 2FLNA 3N5BA 1JXLA 4XO0A 3MCMA 1YRUA 5E41A 1L5UA 1OO0B 1WF2A 2VL1A 2M4MA 3I0RA 2HEKA 4Q7AA 2M7SA 1KQFB 4OX8A 1W2IA 2R7WA 1N5VA 4DL5A 4DWIA 3ILJA 1Q0NA 2OTJS 1K8AT 1RWXB 4B3OB 5CD4H 3KFWX 1DURA 2E5HA 1SV5A 3OVSA 4MFBA 1OY6A 5CYQA 4F2SA 4B3RJ 3MAAB 2JLFA 1EAYC 1R3NA 1TL5A 4LRFA 3EVWA 4RW4B 4X4TA 3M1VB 3ZTSA 3GPAA 1CG2A 4LFBJ 3I5BA 1HHSA 4LT6A 4RUCA 1KVIA 2GQQA 4JI6F 3VTIA 4WPAA 1WEZA 1MN7A 2KFZA 4RNHA 3EPGA 4ZPVR 4OZ5A 3LGNA 3BJYA 2WTFA 1JLBB 3MAQA 2QLJB 3MXHP 2OEMA 2RDJA 3HVWA 1TV6B 1MWZA 5KG3A 1RTIA 3HJFA 2K2PA 3J7YI 2EWHA 3DNCA 1FFGB 5KFDA 3BGRB 3BH6B 4QWAA 4TY8A 3OFGA 4IR1A 3W63A 2BM0A 3UDCA 4R8UB 4J9LA 3PXGa 3PO4A 4ZVPB 2X3DA 1IBKF 5DLGA 1RTZA 1S1WB 3JQJA 2HQGA 2GFFA 4PUOA 2J9CA 4LSLA 2CNNB 2MKCA 2G0IA 1SPBP 1LWFB 3QT6A 3C14B 3QLHA 1FJCA 2WSFC 2MQOA 1TL1A 1KR4A 5KFQA 3M9MB 2EI5A 4U8YA 5LMNF 2DTJA 1ZAVA 2DGUA 3MR3A 1ZTWA 1U1MA 1WD6A 3D7SB 1S1XB 5ETQA 1SJ1A 1TELA 2DPIA 2QE5A 3UI3A 4DQSA 1TKDA 5JVHQ 2PI4A 2QSFA 4B9SA 4DSEA 2RDDA 2QT7A 2CIMA 3C3LA 1PC5A 4MJKA 1CPZA 2LEBA 2GJIA 3KLEB 1NSKL 1NHVA 2ZBPA 3OL8A 2HZAA 1RAHB 5HBMB 2NYIA 1S5ZA 1Q8LA 3CJRA 2XB2D 3KG0A 1URRA 1OWXA 3SV4A 1H2TZ 4OHXA 2XSFA 2O67A 3UN2A 4I67A 3KJVB 3CJ8A 1JNRB 4WK3A 5C24B 3MZIA 3TRGA 4CLFA 4NYPA 2QG9B 3LO3A 2E66A 4CYUA 1C1BB 5EWGA 1WSVA 4B9MA 3KJQB 3QT5A 2HHXA 3DLGA 4RNOA 4TXSA 3V6HA 3SCKE 5KFMA 4OHZA 4G1PA 4BCAA 5F8GA 2HVHA 1CBKA 1HNWJ 4LF4J 1RE1B 4ATNA 1SUQA 3MURP 4DN0A 4JYAF 3FGVA 3OSNA 1RTDB 3IRXB 4RJVA 5K8NA 2BOAA 3AQOA 1MNEA 5DG7A 1CVJA 1NH8A 1FRXA 4YS2A 1UWAA 4KTQA 1UWBA 2FGOA 4PXCA 1I1GA 1LKZA 1WSRA 2VG6A 3GG0A 4A8FA 2AF6A 5LJ3Y 4OLOA 2XI3A 2UXBJ 3PFOA 3I55S 4WKRA 1S48A 2IIHA 2FQQB 3SXLA 3MOZA 4PWDB 4ZVGA 1IR2A 3CDUA 1X5PA 3BO2A 1REGX 2IDLA 2W2NP 2JFDA 2MTLA 1T7PA 3M30A 1XMQJ 4NCGB 1JJ4A 3EPIA 2VB6A 4JI5J 2MZQA 2MZ1A 2VODA 4RBVA 3T3FA 4B3SJ 4J9RA 3O8WA 4J5OA 1QTMA 1UVKA 1DARA 1TP7A 3UO0A 3OUYB 2FJBB 3U1NA 1WG4A 1JXEA 2YKMB 2Z56B 3C2PA 2B9WA 1IJEB 3FUYA 4P75A 3E2EA 3HHLC 1NDKA 1CJVB 2B43A 2GC8A 5CQGA 4XTTA 2AYGA 3Q2TC 1HHQA 2DBBA 4ETXA 1EIYB 1ZOTA 1RUSA 2EC0A 1U1OA 4QCLA 4WFYA 1LV5A 4Q44A 1RWOB 4PG7A 4MIWA 2ZKTA 4ZVHA 1U24A 5B0EA 3OLBA 5DDPC 2KDOA 1O5JA 1NSQA 2FC8A 3IA0A 4DSJA 5K14A 3A4TA 5HROA 2KXFA 2DGSA 2IVMA 2BJ8A 1IBLF 3J81Y 2CXEA 2RILA 2DR6A 4DPOA 1LK5A 5D6GA 1AFIA 3MEEB 4NYOA 2XI2A 4NEYA 1PO6A 3I82A 1S10A 2F1FA 1SC6A 4KYZA 1R43A 2QMUB 3UDEA 2X51A 3VHQA 2EPIA 2NPIA 2XHWA 4USTA 3KK1A 4EGLA 4X66J 2FLPA 1QLNA 2NSCA 2F7VA 1GQEA 1C1CB 2V4QA 3FRZA 1KS2A 1JK9B 2FJWA 2N7CA 1Q95G 3GE9A 3AJ2A 2IC3B 4DS4A 4M5HA 5E5NA 4PPDA 2WVDA 3QJPA 2NCKL 4ZN3A 2V34A 5A8WB 3MEDA 2MQQA 1S77D 2I5JA 1SKUB 3R7BB 3NNHA 1KLMA 4N5SA 1IR0A 1JLCA 1JWWA 4I6YA 4TVAB 5E3PA 3QPIA 4NASA 4BC7A 5IM0A 2R8KA 3A13A 3ZTOA 3G96A 1FRHA 4U95A 1KSPA 4MKAA 1DTQA 4NI2A 6FDRA 1GX6A 4RW6A 4CQ1A 5SUHA 1XN9A 2MZJA 1YJTA 4DHVA 2A3JA 4NLTA 2LEPA 1ZAXA 3VAFA 4ENOA 4GKKF 1X4EA 1NK5A 4LF6F 5CH7B 1FE4A 1NJYA 3IGVA 1UMJA 4TYBA 3FC9A 4K4TA 1SC4B 5H9FJ 1HR0F 3CDAA 2EW9A 3RR7A 1HI1A 4KHMA 5FDLB 3AJDA 2X1AA 2MKHA 2DRAA 3CMQA 3RTVA 1IN0A 3TR5A 4OV6A 3MOJB 3PHEA 1FNXH 4DL6A 2JVOA 2HRYA 4OLPA 3GSDA 3N5FA 1U6BA 5A0YA 3IFEA 2VG7B 5F9LA 2H4WB 2UVVA 2MZRA 1QUVA 1RKJA 3BPSP 5DGBA 3JYTA 2ZUGA 3C66A 2Q66A 4CLWA 3PW5A 2RDIA 1S76D 5EX0A 3GV5B 2G2OA 2AGQA 1RWPB 5FLXY 3BZQA 3NS5A 5KFOA 1TQLA 3EE3A 2XLIA 5IC4B 3D28A 1EQMA 1BQNB 1S9GB 1RHQB 4K4SA 1JLAA 4HI1A 1FKOB 2LEAA 2HHSA 4H54A 5J2NB 3N79A 2MSSA 4B9VA 1XWLA 2OPRB 4NMXA 1HBMA 4I6WA 5C25A 3BS9A 2HRTA 4PXBA 2DHHA 1Z2LA 2XGPA 3C6UA 2F4VF 1IM4A 1U1RA 1MMNA 4Y34A 2NPFA 4C8KA 2R7VA 3GJSB 3LWLA 2R7QA 1XR7A 1KVKA 4WXWA 4IR9A 3FQLA 1F1BB 4X65F 2ZJQQ 2CFXA 4JOUA 3OW2R 2UUWA 1TKZA 4ZPWR 5DG9A 4DV4F 3B78A 2ZVSA 5ITHA 1SL0A 3CPWR 1P9YA 2HGMA 2HBZB 1SC1B 1HL6A 5EX3A 4JV2A 4QZVB 3A3OB 2RU3A 3L95X 1UVJA 4Y2AA 3POTB 4JI1F 1SJRA 2YKNB 3TX8A 4NYZA 2KH9A 5CCMA 2FZKB 1S99A 4ICLA 3CCZA 1MROB 1TL3B 2VICA 4JV5F 1RT4B 3Q8RB 1AUSL 3HLUA 1Y00A 4C7QA 1YKWA 2CPJA 3FJ2A 2VFVA 3SYZA 1RTJA 3MM8B 3GZ7A 3P4UB 1GTEA 3SCIE 1CJKB 3D66A 3R6LB 1FX2A 1Y3KA 1YVFA 4ECTA 4LR9A 3O2IA 1RSCA 1Q5VA 1RA7A 4WP3A 3HSJA 2HNDA 1N8RT 1IKYA 4B9UA 2AJFE 1KNZA 4C2MA 4PQAA 3MR7A 4FP9A 4M1KA 3MUVP 3CCUS 1BC6A 2MB0B 1E6YB 1VQSA 1J5OB 1CJUA 4KGMA 2YQ0A 2C2ZB 1ZETA 1RU2A 1DQ9A 4BWJA 2OUGA 2IVFB 3OHBA 3W64A 4DV0F 4L75A 4F4ZA 2V4JB 2VD3A 4ZCLA 4BBYA 4KAIA 3PCOB 2G1HA 3LPYA 2JDJA 5M2UA 2UUBF 2XSJB 3CGIA 1RYSA 4WIQA 3ET6B 4KPYA 4C3MA 2QYGA 3P5TL 4HT5A 4DUTA 1WOSA 4WKYA 4TQSA 2KU7A 3HSGA 1AW0A 3PJWA 4I2QA 1WC1A 3JSRA 3G87A 1F0XA 5KT4A 1D8YA 1XNRF 2XNQA 1WKLA 1N34F 3T6BA 3D3CJ 3DLJA 2H5IB 1VCTA 2RIJA 4C0OC 3DYAA 1PILA 2OPSA 5KFWA 4LF5J 5I3PA 2MEWA 2O5DA 3OSPA 1UJ6A 2Z4PA 4LBPA 5LM7E 1XMOF 4LIRA 3IXQA 5JJBA 5DETA 3IWXA 3OR2B 4J37A 1TK8A 3T1YJ 3W2VA 1YJVA 2PN6A 1U8SA 4I56A 4K4XA 2ZHAA 4Y00A 2W4DA 2L3MA 1Y5NB 2FD2A 3KLFA 2FY8A 1KQGB 4P74A 4U8VA 2Y1LB 1NDPA 2R8IA 1XJWB 4LBHA 4YQWA 2MKYA 1FEHA 4PZVA 1PSDA 3TZXA 2UUTA 1UJ5A 4OZ1A 2QL5B 1RADB 2MPUA 2WW8A 2O3DA 3D4JA 1Q79A 2BE2B 3UPFA 2VDIA 3P5BP 1CQNA 4DR3F 4ZHRA 2CUYA 4DR5F 1X4FA 5D77A 1V5VA 5CYMA 4ANCA 4IQXA 3PX4A 3EVOA 1G6BA 1LW0B 2WCXA 2AZ3A 4RL1A 1BXNA 5H9EK 4QR1A 2BZ2A 3KLHB 3KK2B 2JFKA 3R5GA 5F8MA 3RZAA 3OVAA 3QO9A 2AW0A 2DR9A 1XTZA 2XLJA 4PXEA 4QU7A 1X9SA 3G8SA 3GP9A 2ZH6A 3DOKB 1DJ0A 4N8OA 2H65B 4QYZJ 3G4SS 2XO6A 4OX9J 1ELOA 2P5VA 3ONQA 2M52A 5HATA 1TVRB 1Y10A 3UVJB 4NLWA 1CSJA 3O3LA 2VFSA 1FJEB 3UCUP 1EX8A 1F9EB 3SDEA 3S7RA 2LQJA 2ZDOA 2L9NA 2NXNA 4ED6A 1K0VA 3HD1A 4DLEA 3J80Y 4G65A 1S1UA 2KVQE 2H51B 4FKXA 3VGTA 3EZOA 2BJDA 5EHHA 4CH0S 3C15A 5KG6A 1YJ9S 4NL5A 1G1XA 2V2QA 3V4IA 2CYYA 2Z2ZA 1Q82T 3OXFA 2K3IA 1NBEB 2GS8A 4DCPB 2N3OA 4EZ6A 4DX6A 5AXKA 4EBCA 2ASYA 2WK4A 4DR6J 4DV1F 2I2YA 3WDOA 5IWAF 5LSLA 1FWKA 5FJ4A 2PA8D 1VQ4S 2R7XA 2CVEA 1JMTA 4WFBQ 4ER8A 5L1JA 1Y9OA 3PKYA 3TAMB 2LU2A 3O1LA 1Z1ZA 1DRZA 1A9NB 4CCHA 3LAMA 4V19J 3OTOJ 3VALA 8AT1B 5M2RA 4LF8J 3AD7C 4JBCA 3CF5Q 1S72S 2BX6A 2VONA 1U0HA 2DNOA 4IUFA 3M1VA 2O01C 3GJRB 1ZM9A 1M5SA 1SJ3P 3IG1A 2KL8A 3IR6B 4QWBA 2Q43A 1YBUA 3X1LB 3MPYA 3DN9A 4KY3A 1KLNA 1AROP 5A6PA 1R89A 4FYVB 4CT9A 1HWIA 1SKRA 2L41A 2NXJA 1S7IA 2HFSA 3MI7X 3TA2A 4DFPA 3ZZOA 1IKWB 3BGRA 3DI6B 5KFUA 4YUDA 2L9WA 2LQ5A 1NJWA 3V5RA 1REVB 2ZH3A 1I94F 5I3UB 1UTAA 4LSNB 3ITHB 1OIAA 2B5JB 4CT8A 2UUCJ 2YWEA 9ATCB 4IG3A 4J9NA 2CQDA 4P2XA 2B6AA 2R7UA 2QMXA 1OYDA 1X9MA 2GGPB 1EP4A 4I64A 2RQMA 1CS4A 1HWUA 3CD6S 2PA3A 5KFYA 3EZUA 2LVWA 4IG0B 1JKHB 3NNAA 3GV8B 4X84A 5D0EA 2J8AA 3S6EA 1P9QC 3EGVA 3K89A 4W98A 2LQBA 1RU1A 1PAEX 2F8MA 3UCZP 4QR0A 3NGUA 1DLOB 3ZZRA 3VWSA 1TZ0A 2LDIA 3A8JA 5E7OB 4RUHA 3ICLA 4LSZB 3PRDA 1FWLA 3M2VA 2WSEC 3MGJA 4QIWD 1A0OB 3DM2A 2V50A 4HL9A 4B17A 4P2SA 5CABA 4FBUA 1T9WA 4LF2A 2HAFA 2X3GA 5CAAA 1VC5A 3CJ2A 1N5YB 2D9OA 3TOQA 4S0MA 4I2PA 2E1AA 2ZDPA 4QW8A 4C8YA 2MKJA 4O4GB 3PR4A 1HNZF 5GAGI 2BA9A 2QTWA 1UW4A 2W9BA 2J0XA 4IFYB 2Z57B 3B6BA 1C0TB 3FSYA 4ECWA 2DNMA 2CPYA 1NJZA 2M8DB 4DUYJ 1H6KX 2M2BA 2ZZMA 1WI8A 4B08A 8ATCB 2GJFA 5C24A 2P9GA 1FK9B 3O44A 3CO0P 1IQZA 1LXNA 2HNYA 5G0RB 2APOA 3MM7A 3RB0A 1N36J 3GIKA 1KFDA 2W2PP 5J2PA 2FVQA 2CZ4A 3OXGA 1DHMA 3OFHA 3US5A 4DV7F 3SCLE 4X4QA 3ZO7A 1VFJA 4WU2A 3I4PA 4LF4F 2JEFA 1G3OA 2XBPA 1FDNA 3AHPA 4QU6A 3KJFB 4QWDA 2RQ4A 2K1RA 1U6FA 1R31A 3F56A 4IOAQ 2CQ3A 4JI4F 2Q6CA 2W24A 4IRDA 1M5KC 1N4LA 1NK9A 3D3BJ 1RAAB 4UOGA 3VVTA 4LREA 3H0PA 3R97A 2AKWB 1Y0HA 4C97A 2C42A 5D4LA 1RT7A 3TA0A 3I0RB 5LOQA 3ZZPA 5DGAA 2ZWOA 5KFTA 1X5OA 2Z0GA 1H7XA 4ECQA 2D3UA 4U67Q 1IBCB 1Q81T 3BH7B 3BDPA 4DX8H 3FCVA 4B3SF 2HHWA 1SV5B 1RLDA 2LU1A 4MFBB 5J2QA 3I6PA 5CYQB 4DPTA 2CKWA 3SEOA 3HMJG 2WAQD 1XNQJ 4RPFA 2R7SA 1K0TA 2BR0A 4F4KA 2YKMA 3R1HA 1DBDA 1U1PA 2N7YA 3GG1A 1F3FA 4E8UA 1N0VC 4YEAA 1K44A 1I3OB 2PI5A 2NXCA 3LA0A 2E7VA 1Z4UA 3BYRA 4DZDA 4C9DA 4IRCA 2A0FB 3MECA 3IMQJ 5B0CA 4X64F 2ZC4A 1RTIB 2ZBRA 2KM8C 4UY85 2RT3A 2XNRA 1UVLA 4DX7A 1H7WA 4TY8B 3T9ZA 3NLCA 2OEJA 2W7AA 4OL8A 3AODA 1XMBA 3IR5B 3EZ5A 2HS0A 3MEEA 2FGCA 5JUMA 4PG5A 1L3SA 2DH8A 3AOBA 1OPIA 1YHQS 4LIWA 4DMZA 3RB3A 4PUOB 4LSLB 3ZC4A 3DDKA 4DF4A 1V3SA 1FDAA 3CVKA 3QLHB 2R2SA 4DV3F 2HGLA 3QNWB 3BKUA 3ILIA 3IP0A 3N28A 3U02A 3TUZC 1TL1B 4A48A 1SIZA 1RHJB 3VZHA 3OTCA 2Y0BB 3KLIA 1FVSA 1WHXA 2FHOB 1HNXF 1UZHA 2MSTA 3JXOA 4O0NA 3V6DA 1SH0A 3BKFA 2V6AA 4FXDA 5KT5A 1VR6A 2W01A 3VAGA 1HHTP 3CDBA 3MF5A 1H2VZ 3S1TA 3FKBA 1L3KA 2LQ8A 4PKDB 2V4RA 2V0NA 2KHCA 3H5UA 3L09A 3RU0A 1SXLA 2OPPA 1DTTA 2PDAA 1FRJA 3BGOP 3QMQA 4LF7F 4ECRA 2ATCB 3D54A 2M3DA 4RUAA 1NB2A 2DRBA 1JNZB 4RR5A 1PJ7A 4GVLA 4Z2XA 3OT9A 2DHGA 4ES1A 5A76A 4C98A 3HXMA 2VQFF 4WZQA 3DDIA 4HDHA 4I68A 1EB0A 2VFTA 3T9NA 2U1AA 4FNHA 4YP3A
chains in the Genus database with same CATH topology
5LMUJ 4JYAJ 4NEZA 1N33J 4DR5J 4NEYA 4NXMJ 4B3SJ 4B3TJ 4PWWA 4KYZA 4V1Ak 4DR1J 1XNRJ 2F4VJ 5A2QU 4LFAJ 4NXNJ 3J7AN 1N34J 2UXDJ 4JI3J 4DUZJ 2UUCJ 4X66J 4LF7J 2VQEJ 4DR4J 3D3BJ 3OTOJ 3R2DJ 3IMQJ 5FLXU 4JI7J 5BR8J 4X65J 1HNWJ 4LF8J 4LF4J 4DV6J 4LF9J 4YY3J 4KHPJ 4DUYJ 4YHHJ 2KVQE 2VQFJ 4DV4J 2UXCJ 4DV7J 1FJGJ 1XMOJ 2MQ8A 4RJVA 2E5LJ 3J81U 5AJ3J 2UU9J 4AQYJ 4DV3J 5LMNJ 2KL8A 4JI6J 1IBMJ 4DV1J 1IBLJ 4DR7J 2HHHJ 1J5EJ 5IWAJ 3D3CJ 4B3MJ 4DR2J 3R2CJ 4DV5J 4DV0J 4K0KJ 4KY3A 3J80U 4JI2J 4JI1J 4B3RJ 4DV2J 3T1HJ 4LF5J 1N36J 2MEWA 4JI8J 2ZM6J 4JI0J 4GKJJ 2UXBJ 1I94J 4JI4J 4GKKJ 4LFBJ 4LF6J 5LM7E 1HNXJ 1XNQJ 2UUBJ 4JV5J 4X62J 4LFCJ 2UUAJ 1HNZJ 3W1YC 3JAMU 5IT9U 3T1YJ 4DR6J 2MTLA 1XMQJ 4HHUA 4X64J 1N32J 1HR0J 4DR3J 4JI5J 4OX9J 1IBKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU J;  4JYA J;  4NEZ A;  1N33 J;  4DR5 J;  4NEY A;  4NXM J;  4B3S J;  4B3T J;  4PWW A;  4KYZ A;  4V1A k;  4DR1 J;  1XNR J;  2F4V J;  5A2Q U;  4LFA J;  4NXN J;  3J7A N;  1N34 J;  2UXD J;  4JI3 J;  4DUZ J;  2UUC J;  4X66 J;  4LF7 J;  2VQE J;  4DR4 J;  3D3B J;  3OTO J;  3R2D J;  3IMQ J;  5FLX U;  4JI7 J;  5BR8 J;  4X65 J;  1HNW J;  4LF8 J;  4LF4 J;  4DV6 J;  4LF9 J;  4YY3 J;  4KHP J;  4DUY J;  4YHH J;  2KVQ E;  2VQF J;  4DV4 J;  2UXC J;  4DV7 J;  1FJG J;  1XMO J;  2MQ8 A;  4RJV A;  2E5L J;  3J81 U;  5AJ3 J;  2UU9 J;  4AQY J;  4DV3 J;  5LMN J;  2KL8 A;  4JI6 J;  1IBM J;  4DV1 J;  1IBL J;  4DR7 J;  2HHH J;  1J5E J;  5IWA J;  3D3C J;  4B3M J;  4DR2 J;  3R2C J;  4DV5 J;  4DV0 J;  4K0K J;  4KY3 A;  3J80 U;  4JI2 J;  4JI1 J;  4B3R J;  4DV2 J;  3T1H J;  4LF5 J;  1N36 J;  2MEW A;  4JI8 J;  2ZM6 J;  4JI0 J;  4GKJ J;  2UXB J;  1I94 J;  4JI4 J;  4GKK J;  4LFB J;  4LF6 J;  5LM7 E;  1HNX J;  1XNQ J;  2UUB J;  4JV5 J;  4X62 J;  4LFC J;  2UUA J;  1HNZ J;  3W1Y C;  3JAM U;  5IT9 U;  3T1Y J;  4DR6 J;  2MTL A;  1XMQ J;  4HHU A;  4X64 J;  1N32 J;  1HR0 J;  4DR3 J;  4JI5 J;  4OX9 J;  1IBK J; 
#chains in the Genus database with same CATH topology
 4A47 A;  2PII A;  3IBF B;  4CH1 A;  2XYG B;  4A8S A;  3QWP A;  2KXN B;  4CYU B;  4ZIW A;  4H4O A;  3ENW A;  1YG0 A;  1MML A;  4NXN J;  3ZFV A;  3IR7 B;  3Q8V A;  1EKS A;  2Y3Y A;  3QJL A;  2IM0 A;  2WON A;  1LWE A;  3DLG B;  1URN A;  2XQC A;  3TAQ A;  4LR8 A;  2OMO A;  2ZBI A;  2YKQ A;  1SUQ B;  2HWI A;  3I32 A;  2MQ8 A;  3ILO A;  2HVZ A;  3BGF A;  4DPX A;  5HJY A;  1OQ3 A;  2MKK A;  1NHK L;  4EBE A;  2CQH A;  2VG5 A;  2XY6 A;  3FMW A;  3TA1 A;  3CDW A;  3TUJ C;  2HAI A;  1UWB B;  1NO8 A;  4NZ7 A;  3OHA A;  2XO7 A;  2GAH C;  2VG6 B;  3Q2S C;  1P1T A;  4P2F A;  1IBM F;  1I6J A;  4CO0 A;  1FKO A;  3CCS S;  2DGQ A;  2PO4 A;  4HH0 A;  4DR2 F;  2EFO A;  3M30 B;  1GMU A;  3Q8S B;  5D3G A;  4FVC A;  3G8T A;  2DHA A;  3M8Q B;  4IOC Q;  5BYQ A;  4JI8 F;  4AE5 A;  4NA1 A;  3KG4 A;  2KO1 A;  4KKO A;  1KEK A;  4ES2 A;  3EGW B;  5B08 A;  4DSL A;  3RUB L;  2UUA F;  5DS7 A;  1TTH B;  2QN6 B;  5ETR A;  2PFD A;  1WJ9 A;  2QGF B;  4RNN A;  4FF4 A;  3ISN D;  1JJH A;  4WFN Q;  4HAC A;  3EWG A;  2C2E A;  3HSZ A;  1WDT A;  3NWG A;  1VC0 A;  1V3R A;  2R7O A;  1VQL S;  4ITS A;  3I4H X;  2M0G B;  3VV2 B;  1QUP A;  1RHU B;  4OV1 A;  4DPW A;  1QAI A;  4A4J A;  4K0K J;  3OL7 A;  3NP5 A;  3G71 S;  2ERR A;  4Q43 A;  3MFI A;  1O6X A;  1QSL A;  2FHM A;  2C2K B;  4FYD A;  4MYT A;  3ZZZ A;  1P27 B;  1RAI B;  1MRO A;  1CJT A;  1TL3 A;  4X4U A;  1ZYQ A;  3HFV A;  2J6T A;  3MEG A;  2HYI B;  4KHR A;  2BEF A;  3HD2 A;  4EUV A;  2GQ2 A;  1Q86 T;  4ZPC A;  5HQM A;  1HI8 A;  2V5H G;  2N4D A;  5K14 B;  3LAL A;  5HRO B;  1ZH5 A;  1FKA F;  3UQS A;  3E3X A;  1CJK A;  3DOM A;  4JI2 F;  3GWC A;  3R5C A;  4GO7 X;  1VC6 A;  1NUE A;  1VIX A;  4X62 F;  4XDD A;  2C3Y A;  5L46 A;  1UAW A;  1ZAW A;  1HQE B;  3KK1 B;  2YWG A;  7FD1 A;  1GEH A;  4YY3 J;  5LMU F;  4PG4 A;  1J5O A;  3KUE A;  1VQ5 S;  2OHD A;  2QA4 G;  4DSF A;  4PXD A;  3CCT A;  2AJ1 A;  5LXR A;  2NXU A;  4JI3 F;  2VQE F;  1N0U A;  2AX0 A;  4WTY A;  3MED B;  2JRS A;  4AD6 A;  2V4J A;  4ED0 A;  2ABY A;  2R42 A;  2I5J B;  4PQU A;  1KBR A;  3BQ2 A;  1KLM B;  2YX1 A;  1JLC B;  2UXC F;  3M8Y A;  2CQG A;  2B9E A;  4A8O A;  2YPY A;  4YR0 A;  1F6T A;  2VPY B;  3THP A;  3ET6 A;  1P1L A;  5IM0 B;  4MT1 A;  3B82 A;  1D0E A;  3HT3 A;  4B3M F;  1DTQ B;  4NI2 B;  4CRJ A;  2FJA B;  4A8M P;  2NR0 A;  2PC6 A;  2AD9 A;  1PGZ A;  1QSY A;  2P9E A;  1TU0 B;  3F41 A;  2KB2 A;  4RW6 B;  2BXJ A;  3M8S A;  2FYX A;  4AUK A;  2C3P A;  2BDP A;  2OSQ A;  4ZPB A;  2ZWP A;  2FPH X;  1KDN A;  2AV5 A;  2V2K A;  3I5C A;  1ROF A;  3BQ1 A;  1X4G A;  5D4N A;  2HVD A;  4RWW A;  4ZPD A;  3RRG A;  2Z2M A;  5GMK a;  3K0J A;  3KLG A;  1QE1 A;  2WSC C;  2RSQ A;  3AB2 B;  3NBP A;  3THV A;  3PRB A;  1U09 A;  1JX4 A;  4GO5 X;  3OLA A;  4AND A;  4F50 A;  4CLK A;  2XMT A;  5HMY A;  2CJK A;  4MK7 A;  1G4C A;  3M9O B;  2HHQ A;  1JQG A;  2HIQ A;  4KHP F;  4I4B A;  3BPD A;  1T3N A;  1UKU A;  4OYM A;  2CJA A;  1HNV A;  3KMS A;  2UU9 F;  1FWP A;  1PJ5 A;  3AH6 A;  1RT3 A;  3GIJ A;  3QSY B;  4OIX A;  1YZ7 A;  2D41 A;  2RQC A;  4OZJ A;  3QIP A;  3LOU A;  4X4S A;  3UDL A;  4YB6 A;  2D3O 1;  4K2X A;  1PYO B;  4NLY A;  4ZP7 A;  3T6J A;  1NXI A;  2XWX A;  3FRY A;  5IQ6 A;  2LQ9 A;  5HAO A;  1U2C A;  3KLH A;  1L3U A;  3UD3 P;  1R8P A;  3FMB A;  2V68 A;  2RAQ A;  3EXY A;  1DQ8 A;  2DD8 S;  1JLA B;  4OI6 A;  3CCL S;  1FF2 A;  4AL5 A;  3OL6 A;  2Q3P A;  2Y1R I;  2VU5 A;  4R0E A;  4FXV A;  1C2P A;  1VHF A;  2F4F A;  1HBM B;  1X0F A;  2B7C B;  2N3L A;  5C25 B;  2NZ4 A;  4ZCK A;  4Q5V A;  2LCW A;  3C6U B;  5DQG A;  3TJ8 A;  3RW7 A;  4IRK A;  1B99 A;  4GKJ J;  3NCP A;  2SXL A;  1D9A A;  2EKY A;  5GME A;  1LXJ A;  1KVJ A;  2KHD A;  2HZC A;  1TKZ B;  1B3T A;  2BM1 A;  3NAH A;  3FEY B;  2DXF A;  1TFW A;  2KZM A;  4N56 A;  1U1K A;  1U2R A;  3H59 A;  2MYF A;  5BXI A;  4LRB A;  4N8N A;  2KVI A;  2HLT A;  4NE9 C;  2NUU G;  1Q1K A;  1M0S A;  2CJB A;  3OPK A;  2VZ9 A;  1UFL A;  2J76 E;  2BOP A;  4EO8 A;  4ICL B;  5BR8 J;  4U9R A;  3BEG B;  3MM9 B;  3Q22 A;  3ENQ A;  1RTJ B;  1RQ0 A;  2DNY A;  3DCA A;  3IWN C;  2RD5 C;  1WUU A;  1FJG J;  4P7V A;  4QPX A;  4DR1 F;  2FZC B;  4CLS A;  2BRL A;  3V81 A;  3BSO A;  1S12 A;  3VAJ A;  3BDE A;  2QYC A;  4LR7 A;  5DQH A;  1CEZ A;  2HBY B;  3JSY A;  2OD6 A;  3BSA A;  4UY8 T;  2HND B;  3IAS 9;  2W7P A;  3EIC A;  5K9F A;  2IM2 A;  4MYU A;  1IKY B;  3NS7 B;  3MUM P;  5IV3 A;  3EM1 A;  4I7F A;  3AD8 C;  2WVB A;  1CJU B;  2UVU A;  2LXU A;  3RGI A;  5DZ7 A;  4AL7 A;  4M5L A;  1GTH A;  3OXL A;  1WG5 A;  2B9Y A;  1K1S A;  4M95 A;  4LFA J;  4ZMM A;  3DXB A;  3DLE A;  5H9E J;  2QA2 A;  2EC2 A;  1BQX A;  5L9N A;  4OZL A;  3HM9 A;  5T7L A;  4HR2 A;  1PIE A;  2AYE A;  1FO1 A;  5HQL A;  2JVR A;  7AT1 B;  5E2Q A;  2OFH X;  4X2B A;  3FCH A;  2KT3 A;  5T14 A;  3PTW A;  2BQU A;  4DL2 A;  5U47 A;  2VIH A;  2DXE A;  3HHN B;  3K2Y A;  3CUN A;  4I2Q B;  1KRP A;  4J9M A;  2PD1 A;  4F3Q A;  2J5A A;  4RBT A;  4DV6 F;  3NXZ A;  1R27 B;  1FER A;  1UJ4 A;  3DYA B;  4LSN A;  5D78 A;  3ITH A;  3QGH A;  4DFJ A;  1TAQ A;  2CWX A;  1S0M A;  1MU2 A;  1N56 A;  1SJ4 P;  2FVP A;  3CJS A;  3HF5 A;  1HBU A;  2P9C A;  1MN9 A;  4ED4 A;  2DK2 A;  2Z2L A;  5LL6 d;  1IM6 A;  5HVG A;  3W2V B;  4ZLP A;  2OKQ A;  2ZBQ A;  4QIF A;  4DV2 F;  2C2D A;  3NGS A;  1YBT A;  1JKH A;  1OY8 A;  2DEI A;  3KLF B;  3Q24 A;  2NSB A;  2IA6 A;  5J2M A;  3W8P A;  1VLO A;  1L3V A;  2DO0 A;  1EQ0 A;  3GYN A;  4F25 A;  2J0S D;  1NHU A;  2XY7 A;  2WOM A;  5K5M A;  1N32 F;  1T0T V;  2XGQ A;  4LF9 J;  1N5T A;  2V8H A;  4ZHR B;  1CUL A;  2BJ1 A;  2QEX S;  2YX4 A;  1MW7 A;  5CYM B;  2AEM A;  4D3H A;  1CC7 A;  2B8P A;  4AXJ A;  3BO3 A;  4K2J A;  4JP8 A;  5LJ5 Y;  2CVI A;  2RB7 A;  3TEH B;  2AEJ A;  2ASD A;  4OZN A;  4IO9 Q;  2HVI A;  3SFG A;  4WF9 Q;  2JNJ A;  1RT5 A;  3ISN C;  4ZJO A;  2V9K A;  1FVQ A;  1H2U X;  3QO9 B;  4IKA A;  2WRM A;  4TKT A;  1H0H B;  1SCJ B;  2FHK A;  2X1F A;  2QX0 A;  3H2L A;  5D0H A;  2W2Q P;  4C3K A;  5DZ6 A;  3QRP A;  2I8E A;  3LP2 A;  1FTC A;  3RBE A;  1R8C A;  1F60 B;  1UVM A;  5L39 A;  4TLQ A;  4M5J A;  3QAT A;  5G0R A;  4KFB A;  5IT0 A;  2XMA A;  3M6V A;  3F73 A;  4OHW A;  2HBR B;  3NCQ A;  5HMZ A;  3Q86 A;  1IKX A;  2AX1 A;  3SDE B;  4OJH A;  3PX0 A;  1WTB A;  1WKK A;  1AFJ A;  4H4M A;  1O51 A;  1S9E A;  1F2H A;  3HHD A;  1V9O A;  2UV8 A;  5L38 A;  3WC0 A;  2ZH2 A;  1S1U B;  4HDG A;  5B0G A;  4JI6 J;  5KG7 A;  4WFA Q;  4ZN1 A;  3C15 B;  4P73 A;  1NKB A;  2BUN A;  3QZ8 A;  1NDC A;  4TU7 A;  3HO1 A;  3TO8 A;  3ENA A;  3V4I B;  4QPT A;  1V6H A;  1NK6 A;  2M8H A;  4OFZ A;  5A6W A;  4C11 A;  2EFP A;  4MK8 A;  3OV7 A;  5HI7 A;  4CO1 A;  4RBU A;  2C3U A;  4HHU A;  2HHH F;  4TLR A;  3CD0 A;  2KRR A;  1Y5I B;  4DV5 F;  2L9D A;  2B8Q A;  4QW9 A;  4J9P A;  3NL0 A;  3LPE A;  3JQK A;  2JEI A;  2W8K A;  2CG4 A;  2E9T A;  2IPO B;  3G6Y A;  2C3O A;  3HVA A;  2DNZ A;  2UV8 G;  2V8G A;  4Z7Y A;  3IBW A;  1R7I A;  5E3C A;  5BYS A;  3KHL A;  3TZZ A;  4ERD A;  2BV3 A;  1OSD A;  3ZNJ 1;  4WXO A;  2ZE2 A;  3M2U A;  2GQC A;  4V19 X;  1O0P A;  4A46 A;  3M9N B;  1VQ6 S;  3CDE A;  1NLK L;  5KFJ A;  1VGY A;  4M94 A;  1U0H B;  1S4F A;  4IO1 A;  4O3R A;  4F4A A;  4C8O A;  5LMN J;  2WB4 A;  1B64 A;  1AUD A;  3ETM A;  1BWV A;  4XPC A;  4NX9 A;  3CCR S;  2KTQ A;  3IG1 B;  1FKP A;  1VBZ A;  1KON A;  2AIR B;  4CP5 A;  2V8V A;  2RVJ A;  2Z58 B;  3EX7 B;  2DNP A;  2AYM A;  4ED2 A;  1NPR A;  3MPV A;  4OZ3 A;  4RW9 A;  4URS A;  3HPO A;  2GJ2 A;  4NOH A;  1N52 B;  3KK3 A;  4UW2 A;  3N4W A;  4LUB A;  2QFI A;  4M8L A;  3WX8 A;  4C0B A;  3C8Y A;  4RLE A;  3RAQ A;  1VQ7 S;  3R7N B;  2ROP A;  2H5E A;  2OJ3 A;  3B4M A;  4RO0 A;  1R6Y A;  3BGU A;  2ZVI A;  4NWB A;  4BWM A;  2J0Q D;  5KT2 A;  3UFC X;  5DRK A;  1R8A A;  3GCW P;  2K3K A;  5KTQ A;  2Y9H A;  1TAU A;  4LF1 A;  1W7W A;  2DH7 A;  2D69 A;  3VVU A;  3ISZ A;  1LNQ A;  2IVY A;  3HFK A;  1HBN A;  4IG3 B;  4ZIT A;  9RUB A;  3TJA A;  2B6A B;  4YDX A;  4P71 A;  3NOC A;  1LFW A;  1X9W A;  4ZVU B;  1EP4 B;  4DL0 C;  1CS4 B;  2BW7 A;  1NM2 A;  3SSQ A;  1ACM B;  1BE4 A;  2CPH A;  5CHC B;  3U1L A;  4M5K A;  4K4U A;  3MMB A;  3QRQ A;  1TK0 A;  4QYR A;  1UEV A;  3QID A;  2R3V A;  4IOB A;  1WF1 A;  4M5N A;  2G2Y A;  2J7K A;  1IWA A;  2CQI A;  4YHH F;  3PDN A;  1NK0 A;  1ICE B;  5AE2 A;  4JV0 A;  5I3Q A;  5AJ3 F;  4I0W A;  3ZTR A;  2PSZ A;  1F9H A;  3QYY A;  2OH2 A;  2XWY A;  5C5J A;  3M2V B;  3MAH A;  2LLZ A;  4BS2 A;  4CZC A;  4O3P A;  3DM2 B;  2LDY A;  2HLU A;  4DI6 A;  3IGN A;  5KFL A;  4DG1 B;  4JYA J;  5KFB A;  2WVE A;  1UA1 A;  1WC3 A;  1FE0 A;  2IM3 A;  1GMW A;  4OYB A;  2F40 A;  1RXO B;  1XIQ A;  1VJW A;  2D9P A;  6AT1 B;  5DDR C;  3EYZ A;  1FNO A;  4JUZ A;  2J6S A;  3PZP A;  4I2P B;  2NZC A;  2WB1 D;  1S4E A;  2AWZ A;  2Q79 A;  2PEH A;  1WOP A;  1BHN A;  2R7T A;  2AHO B;  3I0S A;  1K9M T;  3K17 A;  2VA3 A;  2W9B B;  4L73 A;  3RBD A;  2B51 A;  2IJF A;  1FDB A;  2BAN B;  1ZPW X;  3W65 A;  4DUZ F;  2AT1 B;  3T19 A;  1HW9 A;  1JLG A;  2PMH A;  1SKW A;  4HTJ A;  2HNY B;  2AU0 A;  3MM7 B;  4D3G A;  1AYE A;  4JI0 J;  3RW6 A;  2CQ4 A;  2JZ5 A;  4EYH B;  1X0P A;  2J7U A;  2FTR A;  2E7X A;  2UVW A;  3S01 A;  5J2P B;  4NLR A;  4AYB D;  4OI4 A;  2JJ4 D;  1ULR A;  3TJ9 A;  4MIA A;  5HLF A;  4YB5 A;  1PKU A;  2ASL A;  3JSM B;  3IO1 A;  2MJN A;  3CC7 S;  2W4P A;  1WC0 A;  1T9T A;  2K1R B;  3M32 A;  4QWC A;  3CTR A;  4J9U E;  4KSE B;  4XDC A;  1HD1 A;  2MZS A;  3KTQ A;  3TVY A;  3A3P B;  3TAN A;  3J81 U;  2ZKU A;  2RQK A;  1RT7 B;  3PM9 A;  4U96 A;  5D0G A;  1IBL J;  2KYX A;  3E8O A;  3AD9 C;  4NZ0 A;  1LEO A;  4F7V A;  2AJQ A;  1RHR B;  4MKV A;  3DRX A;  2B7B B;  3T1H J;  4FYW B;  3M8Q A;  2Y1J A;  3PKM A;  4YN3 B;  5J2Q B;  3ELH A;  3O5T B;  2E5L F;  1RYR A;  2G1D A;  4U6P A;  5IQQ A;  4USV A;  1S1T B;  1WWH A;  1SJF A;  5F0U A;  4FNI A;  1KWM A;  3D1Q A;  2A10 A;  4RUB A;  4K5S A;  5HAN A;  3PJ9 A;  3OD2 A;  3W3S A;  2E7W A;  1FA0 A;  1YGY A;  2LA6 A;  3MEC B;  4ZVO B;  1FXD A;  1RWU A;  3EXC X;  3FNN A;  2P2C B;  1SL2 A;  2DGO A;  2HPU A;  1F3V A;  3BM7 A;  4WK1 A;  3V4M A;  1W25 A;  3MR6 A;  4KGK A;  2LXF A;  3NGK A;  4UQT A;  5A2Q Y;  4TY9 A;  3H4B A;  1MLA A;  1T03 A;  3PW0 A;  2EFN A;  3OBI A;  1YK9 A;  4USK A;  2RJZ A;  4P72 A;  2MKI A;  4HHH A;  4EWT A;  3CT9 A;  3PYD A;  4USW A;  3PR5 B;  2YNH A;  4GKK J;  4LF6 J;  3MTJ A;  2FVC A;  2EG2 A;  1KQS R;  3QAE A;  2C2R A;  2HUR A;  1BLU A;  2R4F A;  3OTE A;  1ITP A;  1HQE A;  4ZVQ B;  2QLB B;  1FFS B;  3EDR B;  1WG1 A;  1HR0 J;  3HVT A;  2EKN A;  2A6M A;  2GX8 A;  3IM8 A;  3KHR A;  2CQP A;  2KFN A;  2ZH1 A;  1Z2Z A;  3GB0 A;  2EFV A;  4K50 A;  3THT A;  3V2U C;  4M63 A;  2EBG A;  2V69 A;  1RTH A;  3KLI B;  2DGX A;  3A8K A;  3CCV S;  3WZ0 A;  1EZZ B;  2C2M B;  1UFK A;  3PAC A;  2AJ0 A;  5JVG Q;  3V6D B;  2IAJ B;  4KH1 B;  5BYR A;  2JSX A;  5KG5 A;  5CA5 A;  3NGT A;  3D67 A;  5KFZ A;  5HVH A;  1NAQ A;  2N82 B;  3Q0A A;  2V8P A;  1IXK A;  2UXD F;  1QAJ A;  2CQ0 A;  5K20 B;  2R7R A;  1FXR A;  2R8G A;  4B9T A;  2OPP B;  1DTT B;  4OJ3 A;  1RT6 A;  4RNM A;  3HCX A;  3T5J A;  3JTO A;  5KFG A;  1DY3 A;  4RU9 A;  3NWR A;  1DAX A;  1SIW B;  2I6W A;  3M7V A;  4DR7 F;  4OYW A;  2EFQ A;  1S6U A;  4LRD A;  4J9S A;  3NG8 A;  2OI2 A;  4ES3 A;  4WFX A;  3SBM A;  1VK3 A;  2ZJR Q;  1U2F A;  4ECS A;  3D6H B;  4F3O A;  1NH7 A;  1KHV A;  2YTC A;  2F4V J;  3MR2 A;  4ALZ A;  2YNF A;  1F9F A;  4H4O B;  2GIQ A;  4B02 A;  1FHT A;  4X65 J;  5D4O A;  1B4S A;  4X4N A;  5ETN A;  4RW8 A;  1VRU B;  2WON B;  2YPZ A;  2MQL A;  1LWE B;  2YNI A;  4DV4 J;  4NXM F;  1OSC A;  3G8Q A;  2IRY A;  3UN3 A;  3D9B A;  2HK2 A;  2A2D A;  2C22 A;  3GU0 A;  2QLX A;  4NZ6 A;  4ZS6 A;  2ZH4 A;  4JI1 J;  1UZD A;  4M5D B;  3LAK A;  2VG5 B;  4UZB A;  1XQI A;  5IXU A;  1BQM A;  2D3Z A;  3FBC A;  4FZV A;  2XS2 A;  2FB0 A;  2NUH A;  3K5P A;  4ZCI A;  4JV5 J;  4OYZ A;  1YJN S;  4AQY F;  1YI2 S;  3JAM U;  1M5O C;  3BO4 A;  4CLP A;  2VBX A;  4YR3 A;  5ETK A;  4C3L A;  4Q45 A;  1KN6 A;  2KFY A;  3KHG A;  3IN5 A;  3N6M A;  2BKO A;  5D3G B;  4WCE Q;  3AB4 B;  1EET B;  2R2U A;  4KKO B;  1NSP A;  2KYZ A;  4YB7 A;  1UCN A;  4ID5 A;  2BRK A;  1N33 F;  3RBX A;  5AXL A;  1S7H A;  3NS6 A;  1TUV A;  2OEK A;  4HAC B;  1Y3J A;  1HI0 P;  2DT9 A;  1JLF A;  3J81 j;  1G7C B;  2OPQ A;  2NQP A;  1WTF A;  4CO2 A;  4YR2 A;  1U47 A;  2NS1 B;  1XC9 A;  3M2R A;  2VHG A;  4DV0 J;  3BBB A;  1N48 A;  2D74 B;  2W2M P;  2J9E A;  2HZV A;  4WWS A;  2UUB J;  2OLW A;  4Q0B A;  2ZFH A;  4ECX A;  2BJ9 A;  1CJT B;  1U49 A;  1HYS A;  2V67 A;  3MM9 A;  3MEG B;  3G82 A;  4AT1 B;  5EDW A;  3Q8Q B;  2HQC A;  3C6T A;  3E01 A;  4DX5 A;  3D5M A;  3S8S A;  3DOM B;  1XNR J;  3H2V E;  4X4V A;  4PG6 A;  2OD4 A;  2YKA A;  1N34 J;  1S0O A;  2RHQ B;  4TQR A;  5MLC V;  2DR7 A;  3HI9 A;  4CLZ A;  5HP1 B;  4USJ C;  1Y11 A;  3HHL A;  1ZZF A;  1XMO J;  2RF2 A;  3KYL A;  4F04 B;  5J1E A;  2XY5 A;  3PY8 A;  2CNL B;  2CNK B;  2VUG A;  1T05 A;  2H1Y A;  2VOO A;  3N01 A;  2GA7 A;  3MFH A;  3AOC A;  2C3M A;  2BJ7 A;  1S6P A;  4JI7 F;  3IBC B;  4NA3 A;  1HPZ A;  3CCM S;  1RZM A;  4NLP A;  4F0K A;  4PQU B;  5RUB A;  3ENV A;  4KO0 A;  4CO5 A;  4FPR A;  5F41 A;  4O44 A;  2ZNY A;  3DRR B;  1FEE A;  3ZZ0 A;  4DR3 J;  1TK5 A;  3HZG A;  1LW2 A;  1RWN B;  1RCO B;  1YJ7 A;  3FK4 A;  4DR5 J;  1IKV A;  4AFF A;  4I6A A;  1FNM A;  2QZ8 A;  1QY7 A;  1R0B G;  3TUP A;  3NKY A;  3UNY A;  3W9H A;  1X31 C;  4YFU A;  3IRW P;  4J9O A;  3RRH A;  3W62 A;  3ZTP A;  1VQ9 S;  2G4B A;  3L7P A;  3FSX A;  2GVD A;  4DFK A;  3UWT A;  3HT0 A;  3HZE A;  4FS1 A;  3GYX B;  2ILZ A;  2I9S A;  1U1N A;  2E1P A;  4CI0 B;  2XMM A;  3KLG B;  1QE1 B;  5IT4 A;  3NBP B;  1Y5L B;  1HAR A;  1I5O B;  1Q7L B;  1R8H A;  4NA2 A;  3GFX A;  5DDQ C;  1D3W A;  1OJ4 A;  5E3A A;  1S49 A;  1C0U A;  4NLU A;  4EMD A;  2JLG A;  1BWE A;  4KT0 C;  3DKD A;  2WHO A;  1HNV B;  2RRA A;  1LWX A;  1RT3 B;  2R8J A;  1MG7 A;  1N5S A;  4DCJ B;  2EK1 A;  3QIP B;  4PYD A;  2MDA A;  1GT8 A;  1YDL A;  4LFC F;  2E44 A;  4A8W A;  1UPP A;  2ZOG A;  1T94 A;  2CPX A;  2YKO A;  4OYI A;  1RHM B;  4OHY A;  5GAH U;  2RH3 A;  3M8R A;  3OR1 A;  2A6O A;  5DO2 A;  5BJR A;  2PMZ D;  5HMW A;  2H4Y B;  4EEY A;  4DV1 J;  3QQC D;  5IWA J;  3KOA A;  1F2G A;  3CW2 C;  4ZPT R;  2O1P A;  2I0X A;  3K5M A;  5CD4 A;  2VBW A;  4MH8 A;  3DMJ B;  1N88 A;  1WEY A;  3WX4 A;  4GC6 A;  3BF4 A;  3H5S A;  1VQ8 S;  4C6A A;  1YRT A;  3NNC A;  1SJQ A;  2XMV A;  4OYA A;  4PR6 A;  2E1C A;  4UOF A;  4UTG A;  1VRT A;  4P6Q A;  2W4C A;  1NK7 A;  3QGP A;  3QFH A;  2QSW A;  2E9R X;  4DQR A;  2FY1 A;  4L72 B;  5IOL A;  4R5P A;  3M8P B;  3EGZ A;  5F8H A;  5D8H B;  2ZD1 A;  3K58 A;  4EYI B;  1U25 A;  1TUG B;  1RCX B;  2LP4 A;  4KB7 A;  3GFY A;  3ETO A;  1PYT A;  3HKZ D;  4Y0F A;  1N54 B;  4TNO A;  1RBO B;  3J7A 1;  1YTY A;  3BBC A;  1QJH A;  1S1V A;  2PT0 A;  4USM A;  3TAP A;  3W5Y A;  2DY9 A;  2B4P A;  3OJU A;  3V81 B;  4U7U D;  1UFW A;  2CQ2 A;  2XTJ P;  3HX9 A;  5E33 A;  1S6Q A;  4X4O A;  1C4C A;  1I94 J;  3GIM A;  4CM0 A;  1KKH A;  4DFM A;  4ECU A;  5LT5 A;  3HDS A;  2VV5 A;  2W9C A;  3P3D A;  2DHS A;  2CJ9 A;  1P8G A;  1YX2 A;  4DN9 A;  2HFV A;  2CQC A;  2G2Z A;  2VPW B;  1LWC A;  2MMY A;  1Y4Z B;  3RBZ A;  1U48 A;  3UD5 A;  2ZHB A;  5ADZ A;  3QJJ A;  2HBQ B;  3KXD A;  1QVG R;  4I7F B;  3MMA A;  3HFZ B;  2CWK A;  2AEF A;  4B3R F;  3PFE A;  2FJD B;  1VIS A;  3L7U A;  3L9Z A;  1S0V A;  2ILY A;  3TYT A;  1PAU B;  1SC3 B;  4OZ0 A;  4LQ3 A;  5IFM A;  5LXY A;  2HQI A;  4LFB F;  1B70 B;  1HNI A;  4W92 B;  2PEB A;  1XER A;  2F63 A;  1LK7 A;  5SZT A;  2HS3 A;  2ZHO A;  2YWF A;  3NOG A;  3TWZ A;  1HD0 A;  4OJG A;  2QA4 S;  1NU4 A;  3KLV A;  3DXS X;  1NJI T;  4F4Y A;  3DLE B;  2HWT A;  2RUG A;  1X5S A;  5E3R A;  2JC0 A;  5T7L B;  1QSS A;  3Q83 A;  5KFE A;  3ULH A;  2KJV A;  3MPU B;  3PO5 A;  2DY1 A;  2IRU A;  4AL6 A;  4HH1 A;  2EK6 A;  3TAR A;  4IH7 A;  3PYF A;  2AZ1 A;  2HFO A;  2UZA A;  4CLT A;  3CXC R;  1AXQ A;  4ELU A;  3I56 S;  2JOQ A;  4W4M A;  4M5I A;  1M1K T;  3GTY X;  3DLK B;  1IQT A;  1FRI A;  3BN7 A;  1WHW A;  3D6F B;  3H90 A;  3Q8Y A;  3CCQ S;  3R9L A;  1YLX A;  1HNZ J;  2AGP A;  5EWF A;  1TL7 A;  1PG5 B;  4LVN P;  4OI1 A;  2IRX A;  3PIO Q;  1MU2 B;  3CJK A;  4WE1 A;  2Y1I A;  1HBU B;  2XYP B;  3BBF A;  5HSP A;  1M90 T;  1UEK A;  4GVB A;  3M8Z A;  4DU8 A;  1UVN A;  2G0J A;  2BJ3 A;  2DEJ A;  3U1M A;  5J2M B;  2F5G A;  2HFU A;  2FUG 9;  2ZC3 A;  4ED1 A;  1M1G A;  1SQE A;  4L3K A;  2CPF A;  2WOM B;  2HVE A;  5J1N A;  4DV7 J;  4LBI A;  3H42 A;  3MR5 A;  1Q8K A;  3ZZU A;  3MCS A;  4M5G A;  7FDR A;  4B9N A;  3IAM 9;  1CUL B;  4B9L A;  3R2C J;  5I42 A;  3UE2 A;  4DG1 A;  4URG A;  3GSI A;  1ZTT A;  1GXT A;  1WI6 A;  3D0G E;  3SFU A;  2ZH8 A;  4JI4 J;  2FVS A;  4DPY A;  2XYH B;  4NCA A;  1KHW A;  1VMB A;  3R5B A;  4J90 A;  3T41 A;  4Y28 C;  2DYA A;  2HKE A;  3EDQ B;  3R1L A;  2DNQ A;  1RT5 B;  1H38 A;  3F0N A;  4ED5 A;  2IBO A;  1PC4 A;  2MXY A;  4BHQ A;  3LP0 A;  4A8X A;  1ZA1 B;  5F8N A;  4KE5 A;  3WIV A;  1NRK A;  2BAN A;  2WVC A;  1FDD A;  3FDS A;  1RAG B;  1RKI A;  2LMI A;  5LSR A;  5F3Z A;  3VAK A;  2CDQ A;  2IFX A;  3LP2 B;  1IVZ A;  4Q2M A;  3K5N A;  4ZK7 M;  3DHX A;  3GFZ A;  4KFB B;  4ZVF A;  2P6S A;  4QIV A;  4JI0 F;  4AXI A;  3MPW A;  3HJV A;  3FBE A;  2IYI A;  2V9W A;  4Q2L A;  1IKX B;  2FZG B;  4H4M B;  1S9E B;  1U6Z A;  4R0J A;  5M2P A;  1RAB B;  3VCD A;  4DCO B;  4J9Q A;  4MMO A;  2HHT A;  1T9Y A;  1W2B R;  2CRL A;  2HHV A;  1YZ6 A;  5A8R A;  3G9C A;  1N6Q A;  3FFI B;  1HNW F;  5AE1 A;  3JSM A;  3WHI A;  1AB8 A;  2VOP A;  1KOO A;  1UPM B;  2F9D A;  5H1S V;  2R8H A;  3CUL A;  2VC1 A;  4ZIV A;  4PWU A;  4DS5 A;  4KPC A;  4QR2 A;  1JLE A;  2OML A;  2M5Y A;  4X64 J;  4C11 B;  2NRE A;  3MM6 B;  1E6V A;  2MLX A;  2N4C A;  2Y8Y A;  3RRK A;  1U8W A;  2UXB F;  4FVM A;  2ZEJ A;  3PW7 A;  2DR8 A;  1UEU A;  3W5Z A;  1T9X A;  3GLJ A;  2YQ1 A;  4CLL A;  2X7I A;  5KAK A;  3HHK A;  3EJM A;  2MJU A;  2WVF A;  4Z7C A;  4F26 A;  1XMQ F;  3C16 A;  2XZW A;  3T1H F;  4JI5 F;  1CQM A;  3GR1 A;  2KXH A;  2VBY A;  3WBZ A;  2FJE B;  2ZE2 B;  3M2U B;  4DL7 A;  3ZZY A;  4DV3 J;  2WBM A;  4PG8 A;  2CNO B;  1GAO A;  2ZBC A;  4Q8E A;  3D1O A;  1F5C A;  4ECZ A;  1S1T A;  4YB1 P;  3P6Y C;  3HVR A;  1FKP B;  3PIP Q;  1H73 A;  1V5I B;  1VOM A;  4KV8 A;  2DNL A;  2BQ3 A;  1RBL A;  1Q16 B;  4IH6 A;  3V6K A;  1HNX J;  2DVI A;  3MTK A;  5IT9 U;  3MMC A;  3FBB A;  4RW9 B;  3HHE A;  4ED7 A;  1HFE L;  2H54 B;  4CH7 A;  4F67 A;  3KK3 B;  2JWN A;  1YRX A;  4B3T J;  1GMV A;  3CE8 A;  4PWW A;  2WZ1 A;  3DRS A;  4NRU A;  4Y2C A;  2FJV A;  3NAI A;  4LVO P;  3BSN A;  3QBC A;  4LF7 J;  1APS A;  3NY0 A;  3T5L A;  2AYB A;  3G6V A;  3TQE A;  3DOL A;  2VQF J;  3MEK A;  2XS7 A;  1W26 A;  3P49 B;  1T02 A;  4F0M A;  1X4B A;  4EI2 A;  1HBN B;  1VQK S;  1VS3 A;  3CD7 A;  1G2E A;  4CTA A;  4X66 F;  5GAD U;  4HI2 A;  1R0A A;  3PEJ A;  1TKX A;  4FBT A;  3H7H B;  2ZM6 J;  3CD5 A;  3MMB B;  4LRC A;  2VAS A;  4K4Z A;  3CC4 S;  2RKI B;  1YJU A;  3W2W A;  2VPX B;  3OTB A;  3SZ2 A;  2IAJ A;  4U7U K;  3W9J A;  1SH3 A;  3NRB A;  5HVF A;  2HGN A;  2RHS B;  1A6L A;  2LXI A;  2D3O R;  5D0R A;  4G1I A;  4FF1 A;  2ZZT A;  1WF0 A;  3L3C A;  3K57 A;  3UR3 C;  3DLH A;  4GMK A;  3CED A;  3LWM A;  2ROG A;  4PCQ A;  4USU A;  4ECY A;  1HKA A;  4MK9 A;  2QL9 B;  4JB8 B;  3H98 A;  3M6W A;  2JX2 A;  4ZVR B;  3I0S B;  1QTN B;  1OPZ A;  3P45 B;  5DDO C;  1JJ2 R;  3NGR A;  1IBM J;  4ELT A;  3QGI A;  2GMH A;  1NCL A;  2YVS A;  3DLB A;  2IBK A;  4DR2 J;  4WZM A;  4CNY A;  1NPK A;  3H2U B;  2B3T B;  3UNG C;  1S59 A;  1VIO A;  4LQ9 A;  4JI8 J;  1JLG B;  1H72 C;  3FEX B;  1B0P A;  2ZOM A;  3P8B B;  3AA9 A;  4ZVE A;  4ZA1 A;  2M88 A;  3TNV A;  3GFH A;  2MHE A;  2UUA J;  3W1Y C;  2BKN A;  3H4D A;  1ZBT A;  3H8Y A;  4ZLL A;  2HNZ A;  1VRU A;  5IS2 A;  1D9F A;  1XR5 A;  5IZH A;  4CM2 A;  5EN1 A;  5HLF B;  5F8I A;  4V1A k;  1RI7 A;  3M05 A;  4U7C A;  2XUL A;  2W7O A;  4P2M A;  1RWW B;  2CZ9 A;  4OJ1 A;  1TFY A;  4HYK A;  1U4B A;  4OQJ A;  4DR4 J;  2ACM A;  3R2D J;  4I69 A;  2GO9 A;  3M32 B;  4EO6 A;  3MM5 A;  2BQR A;  2Z30 B;  4M5D A;  5DJB A;  3VGS A;  3D6T B;  4CNZ A;  4RWX A;  2H3E B;  1VDH A;  3CIM A;  2QLF B;  2GIR A;  2DO4 A;  2BYC A;  1ZM4 A;  3JAM Y;  1AZS A;  3DGP A;  2W9A A;  4JI2 J;  1B7Y B;  2AMC B;  1JLQ A;  2BVZ A;  3R3T A;  1VYA A;  1WKJ A;  2K8G A;  4UUW A;  1EHW A;  1EET A;  5GAE U;  3KNG A;  4X62 J;  2VKR A;  1VJQ A;  2JL9 A;  2XHC A;  4QWE A;  3CO9 A;  1NEE A;  1RWK B;  2MKS A;  5LMU J;  4C8Z A;  3Q89 A;  4PPZ A;  3OTD A;  1RAE B;  1QM9 A;  2QJ3 A;  1R8B A;  1IJF B;  3V6J A;  3J7A N;  3CNQ P;  3LW5 C;  4JI3 J;  1VRQ C;  2DKO B;  1TKT B;  2VQE J;  2GVZ A;  1D9D A;  4X4R A;  2HQF A;  2HMI A;  1SBR A;  4FYY B;  2B9X A;  2YX7 A;  5KFV A;  1VQO S;  1SB6 A;  1EJ7 L;  1RT2 A;  4FN5 A;  5KT3 A;  4Y65 A;  4A8Q A;  2C2N A;  2R2R A;  2YNG A;  2UXC J;  3T5K A;  1FX4 A;  1RA6 A;  8RUC A;  3I96 A;  4G1Q A;  2OGU A;  1WC6 A;  2RS2 A;  3QRR A;  4DEZ A;  4NLQ A;  4B3M J;  2C28 A;  3BGL A;  1U02 A;  2BBE A;  3D0I E;  1T03 B;  3FSI A;  3KDO A;  2WBR A;  1XR6 A;  2YNH B;  4ETZ A;  4PAB A;  3ZZT A;  2KI2 A;  5HP1 A;  5L9X A;  3HVT B;  3AA8 A;  1A7G E;  2HFN A;  4DPU A;  2JC1 A;  2E9Z A;  1GX5 A;  3KJN B;  2I1R A;  2FVR A;  1HW8 A;  4IDK A;  2DJW A;  1RTH B;  4KHP J;  4ZP8 A;  4UQG A;  4KIA A;  1OYE A;  2OO4 A;  4C8N A;  3KNA A;  5CZV A;  1GFW B;  2UU9 J;  3BR8 A;  3UCG A;  4OX6 A;  5E0O A;  1BD6 A;  1AA1 B;  4ANE A;  4F2R A;  1U7L A;  3DRR A;  1HMV A;  3AAW B;  2A1B A;  4KR0 B;  3VZI A;  4NPO A;  1I51 B;  4URQ U;  3MWB A;  4O23 A;  3GJT B;  2I38 A;  2F8E X;  1FXL A;  2VPZ B;  1RT6 B;  2H9Z A;  1ZPV A;  3R8Y A;  5KT7 A;  3B54 A;  1YSJ A;  3E51 A;  4IFV A;  1ZZN A;  1IUJ A;  3W9I A;  1LQ9 A;  3LTO A;  3MCN A;  3VGU A;  4Q8F A;  1S97 A;  1RT1 A;  3G6X A;  2XM3 A;  4LF5 F;  5E3Q A;  3AT1 B;  4HLB A;  2J7W A;  4ID8 A;  1H74 A;  2IDE A;  3KUG A;  2DGV A;  5JXS A;  1HBO A;  5KFA A;  3T1Y F;  4CWB A;  2P8I A;  2YNF B;  3NCR A;  1T95 A;  5GMD A;  3K5O A;  1VBX A;  3DC2 A;  3DRP A;  3KKF A;  3L7O A;  1HQU A;  4RW8 B;  2UP1 A;  1SQF A;  2YNI B;  5A8K A;  2Y0S D;  2V94 A;  1WAC A;  1UA0 A;  3D68 A;  1YBA A;  2CPD A;  4LMZ A;  4QIE A;  3DHW C;  1UP1 A;  1MWQ A;  4J9K A;  5EGY A;  3BYP A;  1O8B A;  4DU7 A;  2FLL A;  2J8S A;  2QL7 B;  1H3D A;  3NMR A;  1OS5 A;  1T8E A;  2BJE A;  5ETV A;  3RR8 A;  2VDH A;  4N76 A;  1BQM B;  5K8M A;  3JB9 k;  2HWH A;  5C42 A;  2FC9 A;  2D7S A;  3CC2 S;  1SL1 A;  3ZNU A;  2CQ1 A;  3LP1 B;  3QZ7 A;  4ZCM A;  4DR1 J;  3A3N B;  1RLC L;  2X1B A;  3A8E A;  4C4W A;  2ZH5 A;  1NDL A;  2HFZ A;  4ZDN A;  3RAX A;  4R25 A;  5F8L A;  2U2F A;  4Y2M A;  4DF8 A;  3VF0 B;  3PVX A;  4HVZ A;  4OX9 F;  3CJQ A;  1RJJ A;  3DMJ A;  1NSA A;  3JTN A;  4O4R A;  1JXV A;  3FQK A;  3IM9 A;  4B3O A;  1Q4R A;  2GAG C;  4F36 A;  4ID5 B;  1RP5 A;  2RNE A;  2DPJ A;  4WFZ A;  2LEC A;  1MWY A;  5C7P A;  2DIS A;  3MAA A;  4TN2 A;  1FT8 A;  3VAM A;  1XK8 A;  1RAJ A;  1JLF B;  2OPQ B;  4RW4 A;  4WYW A;  1DZ5 A;  4RW7 B;  3K8W A;  1N5Q A;  2E5I A;  3M2R B;  5KFI A;  2V63 A;  2UVR A;  3M8P A;  4UF4 A;  2LA4 A;  1BUX A;  2DNG A;  2J0W A;  2CJY B;  4Q0B B;  4EU0 A;  4J9V A;  2HG4 A;  1JLB A;  3L4B C;  2G9O A;  3NEK A;  4QOT A;  1HYS B;  2MY7 A;  2YBV A;  1KC8 T;  3G82 B;  3W66 A;  2DGW A;  2XLK A;  1TV6 A;  2KT2 A;  3C6T B;  1FFW B;  1QAX A;  3EMT A;  3E01 B;  4IYQ A;  4UOC A;  1BY9 A;  3UDV A;  3N0V A;  1RAC B;  3GJQ B;  4WII A;  4DR6 F;  3B4D A;  1UL3 A;  5JMN A;  4DV6 J;  4O0I A;  1L3T A;  1FD2 A;  3NMA A;  4L3N A;  4R8U A;  3QT7 A;  1XEZ A;  3MMJ A;  5ETO A;  4KH0 B;  5IC6 B;  3HHL B;  3TUI C;  1S1W A;  3DDN A;  3OJS A;  2K06 A;  3J7Z 5;  1AT1 B;  2XCP A;  2RF2 B;  1J5E J;  3OTO F;  1GK8 A;  1XBW A;  5B7W A;  3J7Y U;  1LWF A;  3EVM A;  5J1E B;  3C14 A;  4LF8 F;  5KG1 A;  1T05 B;  5DG8 A;  4DV2 J;  2P6T A;  5F0W A;  2XMW A;  1RK8 A;  1S6P B;  5KFS A;  1HPZ B;  4FPI A;  4OI0 A;  1SH2 A;  1TUW A;  1K47 A;  1Q5Y A;  2DNR A;  3N9U C;  1S1X A;  5K8O A;  1N32 J;  4KO0 B;  4ZPA A;  1VI7 A;  1ZS6 A;  3BR9 A;  2B0G A;  4O44 B;  2Z2Y B;  3W61 A;  2JLE A;  1IWG A;  1LW2 B;  3Q8P B;  1IKV B;  2NYH A;  3JQM A;  5DQI A;  4CLU A;  4KJI A;  3OL9 A;  2GHP A;  3T5H A;  4K4V A;  3DLK A;  3KLE A;  3RYL A;  2LYV A;  3HSD A;  4A8K A;  2QIF A;  2AP6 A;  3SMZ A;  1UVI A;  5LSO A;  5HBM A;  3AQP A;  2GVD B;  2DIU A;  3M8W A;  3DFE A;  3P96 A;  3TP2 A;  4DOZ A;  5F3T A;  3LAN A;  2QFJ A;  2JEJ A;  2UUC F;  5MAO A;  1PJ6 A;  4Y6I A;  4MIB A;  3SSS A;  3A12 A;  5KT6 A;  1S9F A;  5B0A A;  3IS9 B;  2IJR A;  3TX0 A;  3KJV A;  1X7V A;  2ZJP Q;  2XG8 A;  4G6V B;  1UET A;  1NZ8 A;  5T41 A;  1KFS A;  3SI8 A;  2IMO A;  1C0U B;  5AE3 A;  1C1B A;  5AXM A;  4F0H A;  1SVD A;  2GW8 A;  4O3S A;  2F65 A;  5C2C A;  5GAH I;  2R2T A;  1LFP A;  5KOW A;  4ILM A;  1HWL A;  4ZOS A;  4QQB A;  2MGZ B;  3TI0 A;  4WP8 A;  1RTD A;  3IRX A;  2C1E B;  2Z8Q A;  2J9D E;  4FF3 A;  3SQG B;  2FJX A;  3KMQ A;  4OYX A;  1NKC A;  1T9V A;  3OR1 B;  4ECV A;  5CXT A;  3M6X A;  2HHH J;  3PW2 A;  3SIP B;  2GMJ A;  2Q6B A;  3BB5 A;  4DV5 J;  4YME A;  4LRA A;  3SQO P;  4PWD A;  3AFG A;  4DUY F;  2B4V A;  2QA1 A;  4NCG A;  2B4O A;  1LOU A;  5HO4 A;  2EBE A;  3W5X A;  4HHJ A;  2YWK A;  2RML A;  3D0H E;  5C2G A;  2PFF B;  3OUY A;  4USH A;  1VRT B;  1N36 F;  3VQT A;  1FRK A;  1YQH A;  4DSK A;  3CWJ A;  2H5J B;  4EFA C;  1RWM B;  3TZY A;  2VC0 A;  3H20 A;  4KGX B;  1VBY A;  4DQQ A;  3D6M B;  2A18 A;  5K8P A;  4R5P B;  3FFI A;  1CJV A;  2BE7 D;  3LQV A;  1YIT S;  2RUS A;  3VQS A;  2ZH9 A;  2E5J A;  5L1L A;  1J27 A;  3H40 A;  4F8R A;  2KN4 A;  2ZD1 B;  4EK2 A;  2CAJ A;  2VF3 A;  5ETS A;  1TMM A;  1FJ7 A;  2QLW A;  2D1C A;  1WOR A;  1S1V B;  4C0H A;  2YY3 A;  3MM6 A;  5KG4 A;  4HKQ A;  1RAF B;  1VHI A;  3W8G A;  3FCW A;  3N6N A;  2COL A;  2YH1 A;  1S6Q B;  2BKP A;  2XCA A;  3SV3 A;  2LFV A;  1QAY A;  2OTL S;  2RRN A;  4P9S A;  4L6V 3;  4M5M A;  3SSR A;  4XK8 C;  2W9C B;  3VR1 A;  4DJB A;  3FVY A;  1IBK J;  3MCO A;  3BRE A;  3KG1 A;  4N41 A;  2BAC A;  1LWC B;  2F3J A;  4A8Y A;  1YJW S;  3MMA B;  4CO4 A;  1RB0 A;  4DBQ A;  1S79 A;  1C1C A;  2VH7 A;  1WOO A;  1RWV B;  1XNQ F;  4BLG A;  4F4X A;  3H25 A;  4CDI A;  3U27 A;  1HWJ A;  3CMA S;  1M5V C;  4ZLJ A;  1HNI B;  1RGV A;  4XIU A;  2AGO A;  1Q8B A;  3MD3 A;  4K7Q A;  2IC3 A;  1EKR A;  1U26 A;  3K8V A;  4YHH J;  5L1K A;  3DU5 A;  2HQD A;  5A8W A;  1NB7 A;  4NCB A;  2DRD A;  5AJ3 J;  2IMW P;  2QRR A;  2ZUA A;  2GZO A;  2GNK A;  5KG0 A;  4IH5 A;  5IT9 Y;  1V3Z A;  4O3Q A;  4MKY A;  3KWM A;  4CLY A;  5I4M A;  4OZ2 A;  2BW2 A;  4B3T F;  1B0V A;  3NGD A;  1RBA A;  3KUH A;  4ELV A;  2IHR 1;  1FI4 A;  5FII A;  2ZH7 A;  1NME B;  3CJ4 A;  4WTO B;  1TR0 A;  2QV6 A;  3PYE A;  1TL7 B;  2YKP A;  3C46 A;  2G13 A;  2ZZN A;  3CJK B;  3QSI A;  4WE1 B;  3BN4 A;  3H5X A;  2BAB A;  2CJX B;  3PJX A;  3GIL A;  1OY9 A;  5KFH A;  4DUZ J;  1BMQ B;  4GVB B;  2ROE A;  1GXL A;  4YOE A;  2RS8 A;  1VBK A;  1JJC B;  3LGH A;  5FDL A;  3GV7 B;  4P52 A;  2XZT B;  3GMG A;  2IM1 A;  1YJR A;  2ZM6 F;  3LUY A;  4OMF G;  4F4W A;  2HRU A;  2RU9 A;  1C4A A;  3W7B A;  2V2V A;  2FLO A;  2PMW A;  2RKI A;  1HQ2 A;  2OP5 A;  1EAR A;  4P10 A;  1GMW D;  2CAD A;  2XZD B;  2VG7 A;  2DCU B;  3PW4 A;  5HQ8 A;  3HUL A;  3ZTQ A;  4F02 A;  3A1Y G;  5I42 B;  2MQM A;  1NPP A;  3Q8U A;  1RIS A;  1X4D A;  1F5A A;  4ZLN A;  1U1Q A;  1B7F A;  1T3O A;  1VQM S;  4J7C A;  3RB6 A;  2MHN A;  4FXW A;  4UT4 A;  4E98 A;  2XMK A;  4DL4 A;  2KKH A;  4NEZ A;  3IC1 A;  2HIY A;  1FCA A;  2ADC A;  1PBU A;  1BQN A;  1MSW D;  3F44 A;  1MMD A;  4Y2I A;  1S9G A;  3I87 A;  3LP0 B;  6FD1 A;  2B4U A;  2QMW A;  3G2X A;  2LKZ A;  2MQN A;  5J2N A;  3CJT A;  5ETM A;  4HT7 A;  2OSR A;  3I9Z A;  2OPR A;  3AXM A;  4OYP A;  3MDF A;  2CZV C;  5D15 A;  4ZVT B;  2K7J A;  1PYS B;  2E5L J;  2YWW A;  2ATL A;  4G3I A;  4NXN F;  1PBA A;  3T1A A;  4WJB A;  2YWH A;  4K59 A;  1VQN S;  4MKB A;  4NLG A;  5H9F K;  2CJQ A;  2GCF A;  5EUH A;  3VAH A;  1WDD A;  5A8R B;  1N6Q B;  5F9N A;  2F8H A;  2GV1 A;  2EEY A;  3GQC A;  4DR4 F;  3CB4 A;  5ETL A;  2MLY A;  1X8D A;  2PE8 A;  3POT A;  2DNH A;  2DNK A;  3VGV A;  2YKN A;  4J91 A;  1JLE B;  1HWK A;  1IR1 A;  3CSK A;  3VAI A;  1Q78 A;  1FTR A;  1X4C A;  3DLL Q;  1RT4 A;  4C8L A;  4ZJL A;  4K5R A;  1E6V B;  3DGV A;  3QWU A;  5A2Q U;  4H4K A;  3O6Q A;  3QFW A;  1ZM2 A;  3RG6 A;  5ETT A;  3MM8 A;  2V2Z A;  5B09 A;  2DXD A;  1OMS A;  4FF2 A;  4MAK A;  4YDD B;  1M5P C;  4Z37 A;  1WC4 A;  1D1U A;  4DQI A;  3X3U A;  3C16 B;  3OFE A;  3CCJ S;  5G4D A;  4C8M A;  2G0C A;  4BC9 A;  4TYA A;  5FD1 A;  1HA1 A;  3MD1 A;  5L8R C;  2XS5 A;  3FZ2 A;  2YH0 A;  4MTP A;  1E6Y A;  3AJ1 A;  4O3N A;  4ILL A;  4KQZ A;  3WC2 A;  1P6T A;  4Y2K A;  3ZXW A;  2KG1 A;  2DHX A;  4TU8 A;  3H5Y A;  3BV8 A;  1QDU B;  4N7T A;  1FRL A;  4KV8 B;  1TKT A;  3J7Z T;  3PHT A;  4E0D A;  2FIU A;  2R9L A;  4OYO A;  4UZC A;  3R5D A;  5J1P A;  3MMC B;  1KD1 T;  3UD4 P;  5ETP A;  4K0K F;  1B0T A;  3JS9 A;  4K8R A;  2JH3 A;  5L1I A;  2JEG A;  1SQG A;  2XSJ A;  1WHY A;  2GHW A;  4Y3C A;  1GXU A;  2RE1 A;  1GNK A;  2UXD J;  1X60 A;  3DRS B;  2AJ4 A;  2KZZ A;  2WW4 A;  2OFG X;  3GYG A;  4F3M A;  5GAD I;  2B56 A;  3MHY A;  1FRM A;  1PCA A;  1NND A;  3TW0 A;  3AOA A;  4OX7 A;  3DOL B;  3PYG A;  4NLO A;  4CO3 A;  5HMX A;  3EUN A;  1QD1 A;  1KQK A;  2MZT A;  2DCL A;  4DR7 J;  3QT8 A;  4DDF A;  2POK A;  4OHV A;  1TMJ A;  4EZ9 A;  4WP9 A;  3CCE S;  2HSE B;  4CTA B;  3TVK A;  4UOH A;  4LJM A;  4YY3 F;  1RAO A;  1R0A B;  2NLW A;  1K73 T;  3OR2 A;  3KHH A;  3MPD A;  2DH9 A;  3JSB A;  1TKX B;  2VFR A;  2W2O P;  2E1R A;  5CYJ A;  1T9U A;  4RNF A;  2HQ3 A;  1Q7Y T;  3W2W B;  4GC7 A;  5B0F A;  3FZB A;  2L48 A;  2OAU A;  5AXN A;  3D1H A;  5A0Y B;  2W25 A;  3OQ2 A;  2ALZ A;  2EVZ A;  4NXM J;  2BMB A;  3OVB A;  2CQB A;  3FBF A;  1H98 A;  4BDP A;  2XEX A;  3JYT B;  1UW9 A;  3Q23 A;  1X4A A;  2VBZ A;  2BE2 A;  4EBD A;  3LF0 A;  1WEL A;  5FLX U;  1Q53 A;  2OIH A;  2E29 A;  1VQY A;  2XMU A;  3HK2 A;  2GML A;  3R27 A;  1LW0 A;  2E5G A;  2DNN A;  4AQY J;  3N6L A;  4DQP A;  3KK2 A;  2YQ3 A;  2JHE A;  4HTI A;  4JV1 A;  2CG8 A;  4FKY A;  1BGX T;  2ALY B;  4DL3 A;  5KFK A;  2EFG A;  2IYG A;  1K1Q A;  4C48 A;  4PEO A;  5KFR A;  2QO3 A;  2EXU A;  4TU9 A;  3DOK A;  3CJ5 A;  5CCL A;  2DIV A;  1KTQ A;  3IWL A;  5D4P A;  1R0C B;  1FD8 A;  3OFF A;  3BSC A;  4FYX B;  3FEZ A;  4PYA A;  3W60 A;  1KOH A;  1TVR A;  3UVJ A;  1N33 J;  3BKT A;  1QVF R;  4DSI A;  3GII A;  2W8L A;  2HNZ B;  3K5L A;  3K7R A;  3R7S B;  4FS2 A;  3M6U A;  1NZA A;  4DLG A;  2BE9 B;  4UUX A;  2XMJ A;  1RDR A;  3UW1 A;  3LH2 S;  1WNE A;  4QIG A;  3CCW A;  3JTP A;  3MM5 B;  1VQP S;  4KC5 A;  3RB4 A;  2ACY A;  3CIZ A;  2EG1 A;  5DLF A;  4WU3 A;  5GAE I;  3D2W A;  5KG2 A;  4RX6 A;  4QJV A;  3GON A;  2A2C A;  2RRB A;  2MQP A;  2ASJ A;  3GCX P;  1DQA A;  3QAU A;  3LP1 A;  1AZS B;  4N77 A;  3DGP B;  5KOX A;  5DM7 Q;  2DR5 A;  4FDF A;  2DGT A;  1JLQ B;  2CDR B;  2KRB A;  5AT1 B;  1Y7P A;  4PRF A;  3BQ0 A;  4CIO A;  2KT5 A;  1X5T A;  1R6V A;  2HS4 A;  1D8Z A;  4ZKA A;  1Q8I A;  3TAM A;  4GKJ F;  1DFD A;  3CJ0 A;  5GVQ A;  4XAK A;  3U7J A;  4KGV B;  5HK4 A;  3LGM A;  4NLS A;  4K4Y A;  1S0N A;  3R6G B;  2HHU A;  4JI7 J;  4QYZ K;  1CLF A;  2GVZ B;  2XC9 A;  3PNI A;  4RW7 A;  3PRV A;  2HMI B;  1NKE A;  4N47 A;  3CJ3 A;  4IQM A;  3A8I A;  1RT2 B;  3I9V 9;  1NK8 A;  2YNG B;  3UR0 A;  2KG0 A;  5IV4 A;  1VLY A;  3PX6 A;  1U45 A;  2E1M C;  4I1T A;  4G1Q B;  3TVZ A;  4RU2 A;  5BR8 F;  4DXL A;  2HK3 A;  1GH8 A;  1JB0 C;  2FHJ D;  3RAM A;  2YXL A;  4KBI A;  3B8H A;  2Q1L A;  3KDN A;  1FJG F;  3HHL D;  5KFC A;  2DB1 A;  2HW3 A;  4NLV A;  2J6U A;  2MY8 A;  1X4H A;  1IKW A;  3DI6 A;  1WC5 A;  2H48 B;  1REV A;  2CPI A;  2FHJ A;  4ED8 A;  5I3U A;  2OPS B;  1KTV A;  2J9D A;  3ADA C;  3GIR A;  2GHV C;  4OI2 A;  2B5J A;  1M5H A;  4KRW A;  4P7T A;  4L74 A;  2W1B A;  3R5A A;  2ADB A;  1WEX A;  1VK8 A;  1J5E F;  3PV8 A;  2VA2 A;  4WBF A;  2GGP A;  4QBU A;  1YIJ S;  2ZIT A;  3ILL A;  5HJX A;  2KJW A;  1SKS A;  4IG0 A;  3WQP A;  4XPE A;  4IDK B;  3HKW A;  1HLW A;  2M9K A;  5EWE A;  5F8J A;  5HN0 A;  2X1G A;  2KM8 B;  5KFN A;  2HHP A;  4DZ6 A;  4LFA F;  4RZR A;  1TL4 A;  1M1H A;  1DLO A;  1HIY A;  4NLX A;  4USI A;  1S6O A;  3DU6 A;  1HMV B;  3AY0 A;  2CA9 A;  2ZNZ A;  3K59 A;  4K4W A;  2IY5 B;  2VKZ G;  3QGG A;  1FES A;  2VJV A;  2F9J A;  1OQ6 A;  4ZP6 A;  3EGN A;  4LFC J;  1JIH A;  2OEL A;  1SI9 A;  4L76 A;  1RHK B;  3TEG A;  1ZA2 B;  5KFP A;  4OI3 A;  4IFV B;  1N5Y A;  3TZW A;  4ZP9 A;  2IJN A;  5B0D A;  5CZX A;  3I31 A;  4O4G A;  1NJX A;  3G6E S;  1RT1 B;  2PGC A;  4O3O A;  4HEA 9;  4WYL A;  4RKU C;  4IFY A;  4ZVS B;  3R5J B;  5B0B A;  2Y8W A;  1C0T A;  3CME S;  1S57 A;  5KFF A;  1HBO B;  5KFX A;  1NK4 A;  3IS9 A;  2DIT A;  3PEH A;  2GO8 A;  4X4P A;  4H4K C;  3HP6 A;  1T11 A;  4NML A;  5HL7 Q;  4W90 B;  2MLZ A;  4ED3 A;  2FDN A;  5THW A;  3SCJ E;  1FK9 A;  3UN5 A;  3DRP B;  3MUT P;  1HQU B;  1D09 B;  1WHV A;  4NRT A;  3TQ1 A;  1U1L A;  5GAG U;  3DRY A;  3C19 A;  5A8K B;  1ZM3 A;  2IA0 A;  2C2O B;  3J80 U;  1KP6 A;  2CPZ A;  3M4X A;  4LF9 F;  4PAA A;  4E2F B;  3RJM B;  5DM6 Q;  2VFU A;  1J2V A;  2NXE A;  2CPE A;  1F5B A;  3G86 A;  2K7K A;  1CC8 A;  2L08 A;  2QC3 A;  2MGZ A;  2AJ2 A;  3AXK A;  4ZJQ A;  3WIU A;  4KGZ B;  2O66 A;  4GRS A;  5C42 B;  2ZOF A;  2AQ4 A;  3PG9 A;  4ILR A;  3I5A A;  2V8D A;  3SQG A;  1YWX A;  2M70 A;  3GR0 A;  1U0S A;  4NLD A;  2GIF A;  2VJU A;  2FLN A;  3N5B A;  1JXL A;  4XO0 A;  3MCM A;  1YRU A;  5E41 A;  1L5U A;  1OO0 B;  1WF2 A;  2VL1 A;  2M4M A;  3I0R A;  2HEK A;  4Q7A A;  2M7S A;  1KQF B;  4OX8 A;  1W2I A;  2R7W A;  1N5V A;  4DL5 A;  4DWI A;  3ILJ A;  1Q0N A;  2OTJ S;  1K8A T;  1RWX B;  4B3O B;  5CD4 H;  3KFW X;  1DUR A;  2E5H A;  1SV5 A;  3OVS A;  4MFB A;  1OY6 A;  5CYQ A;  4F2S A;  4B3R J;  3MAA B;  2JLF A;  1EAY C;  1R3N A;  1TL5 A;  4LRF A;  3EVW A;  4RW4 B;  4X4T A;  3M1V B;  3ZTS A;  3GPA A;  1CG2 A;  4LFB J;  3I5B A;  1HHS A;  4LT6 A;  4RUC A;  1KVI A;  2GQQ A;  4JI6 F;  3VTI A;  4WPA A;  1WEZ A;  1MN7 A;  2KFZ A;  4RNH A;  3EPG A;  4ZPV R;  4OZ5 A;  3LGN A;  3BJY A;  2WTF A;  1JLB B;  3MAQ A;  2QLJ B;  3MXH P;  2OEM A;  2RDJ A;  3HVW A;  1TV6 B;  1MWZ A;  5KG3 A;  1RTI A;  3HJF A;  2K2P A;  3J7Y I;  2EWH A;  3DNC A;  1FFG B;  5KFD A;  3BGR B;  3BH6 B;  4QWA A;  4TY8 A;  3OFG A;  4IR1 A;  3W63 A;  2BM0 A;  3UDC A;  4R8U B;  4J9L A;  3PXG a;  3PO4 A;  4ZVP B;  2X3D A;  1IBK F;  5DLG A;  1RTZ A;  1S1W B;  3JQJ A;  2HQG A;  2GFF A;  4PUO A;  2J9C A;  4LSL A;  2CNN B;  2MKC A;  2G0I A;  1SPB P;  1LWF B;  3QT6 A;  3C14 B;  3QLH A;  1FJC A;  2WSF C;  2MQO A;  1TL1 A;  1KR4 A;  5KFQ A;  3M9M B;  2EI5 A;  4U8Y A;  5LMN F;  2DTJ A;  1ZAV A;  2DGU A;  3MR3 A;  1ZTW A;  1U1M A;  1WD6 A;  3D7S B;  1S1X B;  5ETQ A;  1SJ1 A;  1TEL A;  2DPI A;  2QE5 A;  3UI3 A;  4DQS A;  1TKD A;  5JVH Q;  2PI4 A;  2QSF A;  4B9S A;  4DSE A;  2RDD A;  2QT7 A;  2CIM A;  3C3L A;  1PC5 A;  4MJK A;  1CPZ A;  2LEB A;  2GJI A;  3KLE B;  1NSK L;  1NHV A;  2ZBP A;  3OL8 A;  2HZA A;  1RAH B;  5HBM B;  2NYI A;  1S5Z A;  1Q8L A;  3CJR A;  2XB2 D;  3KG0 A;  1URR A;  1OWX A;  3SV4 A;  1H2T Z;  4OHX A;  2XSF A;  2O67 A;  3UN2 A;  4I67 A;  3KJV B;  3CJ8 A;  1JNR B;  4WK3 A;  5C24 B;  3MZI A;  3TRG A;  4CLF A;  4NYP A;  2QG9 B;  3LO3 A;  2E66 A;  4CYU A;  1C1B B;  5EWG A;  1WSV A;  4B9M A;  3KJQ B;  3QT5 A;  2HHX A;  3DLG A;  4RNO A;  4TXS A;  3V6H A;  3SCK E;  5KFM A;  4OHZ A;  4G1P A;  4BCA A;  5F8G A;  2HVH A;  1CBK A;  1HNW J;  4LF4 J;  1RE1 B;  4ATN A;  1SUQ A;  3MUR P;  4DN0 A;  4JYA F;  3FGV A;  3OSN A;  1RTD B;  3IRX B;  4RJV A;  5K8N A;  2BOA A;  3AQO A;  1MNE A;  5DG7 A;  1CVJ A;  1NH8 A;  1FRX A;  4YS2 A;  1UWA A;  4KTQ A;  1UWB A;  2FGO A;  4PXC A;  1I1G A;  1LKZ A;  1WSR A;  2VG6 A;  3GG0 A;  4A8F A;  2AF6 A;  5LJ3 Y;  4OLO A;  2XI3 A;  2UXB J;  3PFO A;  3I55 S;  4WKR A;  1S48 A;  2IIH A;  2FQQ B;  3SXL A;  3MOZ A;  4PWD B;  4ZVG A;  1IR2 A;  3CDU A;  1X5P A;  3BO2 A;  1REG X;  2IDL A;  2W2N P;  2JFD A;  2MTL A;  1T7P A;  3M30 A;  1XMQ J;  4NCG B;  1JJ4 A;  3EPI A;  2VB6 A;  4JI5 J;  2MZQ A;  2MZ1 A;  2VOD A;  4RBV A;  3T3F A;  4B3S J;  4J9R A;  3O8W A;  4J5O A;  1QTM A;  1UVK A;  1DAR A;  1TP7 A;  3UO0 A;  3OUY B;  2FJB B;  3U1N A;  1WG4 A;  1JXE A;  2YKM B;  2Z56 B;  3C2P A;  2B9W A;  1IJE B;  3FUY A;  4P75 A;  3E2E A;  3HHL C;  1NDK A;  1CJV B;  2B43 A;  2GC8 A;  5CQG A;  4XTT A;  2AYG A;  3Q2T C;  1HHQ A;  2DBB A;  4ETX A;  1EIY B;  1ZOT A;  1RUS A;  2EC0 A;  1U1O A;  4QCL A;  4WFY A;  1LV5 A;  4Q44 A;  1RWO B;  4PG7 A;  4MIW A;  2ZKT A;  4ZVH A;  1U24 A;  5B0E A;  3OLB A;  5DDP C;  2KDO A;  1O5J A;  1NSQ A;  2FC8 A;  3IA0 A;  4DSJ A;  5K14 A;  3A4T A;  5HRO A;  2KXF A;  2DGS A;  2IVM A;  2BJ8 A;  1IBL F;  3J81 Y;  2CXE A;  2RIL A;  2DR6 A;  4DPO A;  1LK5 A;  5D6G A;  1AFI A;  3MEE B;  4NYO A;  2XI2 A;  4NEY A;  1PO6 A;  3I82 A;  1S10 A;  2F1F A;  1SC6 A;  4KYZ A;  1R43 A;  2QMU B;  3UDE A;  2X51 A;  3VHQ A;  2EPI A;  2NPI A;  2XHW A;  4UST A;  3KK1 A;  4EGL A;  4X66 J;  2FLP A;  1QLN A;  2NSC A;  2F7V A;  1GQE A;  1C1C B;  2V4Q A;  3FRZ A;  1KS2 A;  1JK9 B;  2FJW A;  2N7C A;  1Q95 G;  3GE9 A;  3AJ2 A;  2IC3 B;  4DS4 A;  4M5H A;  5E5N A;  4PPD A;  2WVD A;  3QJP A;  2NCK L;  4ZN3 A;  2V34 A;  5A8W B;  3MED A;  2MQQ A;  1S77 D;  2I5J A;  1SKU B;  3R7B B;  3NNH A;  1KLM A;  4N5S A;  1IR0 A;  1JLC A;  1JWW A;  4I6Y A;  4TVA B;  5E3P A;  3QPI A;  4NAS A;  4BC7 A;  5IM0 A;  2R8K A;  3A13 A;  3ZTO A;  3G96 A;  1FRH A;  4U95 A;  1KSP A;  4MKA A;  1DTQ A;  4NI2 A;  6FDR A;  1GX6 A;  4RW6 A;  4CQ1 A;  5SUH A;  1XN9 A;  2MZJ A;  1YJT A;  4DHV A;  2A3J A;  4NLT A;  2LEP A;  1ZAX A;  3VAF A;  4ENO A;  4GKK F;  1X4E A;  1NK5 A;  4LF6 F;  5CH7 B;  1FE4 A;  1NJY A;  3IGV A;  1UMJ A;  4TYB A;  3FC9 A;  4K4T A;  1SC4 B;  5H9F J;  1HR0 F;  3CDA A;  2EW9 A;  3RR7 A;  1HI1 A;  4KHM A;  5FDL B;  3AJD A;  2X1A A;  2MKH A;  2DRA A;  3CMQ A;  3RTV A;  1IN0 A;  3TR5 A;  4OV6 A;  3MOJ B;  3PHE A;  1FNX H;  4DL6 A;  2JVO A;  2HRY A;  4OLP A;  3GSD A;  3N5F A;  1U6B A;  5A0Y A;  3IFE A;  2VG7 B;  5F9L A;  2H4W B;  2UVV A;  2MZR A;  1QUV A;  1RKJ A;  3BPS P;  5DGB A;  3JYT A;  2ZUG A;  3C66 A;  2Q66 A;  4CLW A;  3PW5 A;  2RDI A;  1S76 D;  5EX0 A;  3GV5 B;  2G2O A;  2AGQ A;  1RWP B;  5FLX Y;  3BZQ A;  3NS5 A;  5KFO A;  1TQL A;  3EE3 A;  2XLI A;  5IC4 B;  3D28 A;  1EQM A;  1BQN B;  1S9G B;  1RHQ B;  4K4S A;  1JLA A;  4HI1 A;  1FKO B;  2LEA A;  2HHS A;  4H54 A;  5J2N B;  3N79 A;  2MSS A;  4B9V A;  1XWL A;  2OPR B;  4NMX A;  1HBM A;  4I6W A;  5C25 A;  3BS9 A;  2HRT A;  4PXB A;  2DHH A;  1Z2L A;  2XGP A;  3C6U A;  2F4V F;  1IM4 A;  1U1R A;  1MMN A;  4Y34 A;  2NPF A;  4C8K A;  2R7V A;  3GJS B;  3LWL A;  2R7Q A;  1XR7 A;  1KVK A;  4WXW A;  4IR9 A;  3FQL A;  1F1B B;  4X65 F;  2ZJQ Q;  2CFX A;  4JOU A;  3OW2 R;  2UUW A;  1TKZ A;  4ZPW R;  5DG9 A;  4DV4 F;  3B78 A;  2ZVS A;  5ITH A;  1SL0 A;  3CPW R;  1P9Y A;  2HGM A;  2HBZ B;  1SC1 B;  1HL6 A;  5EX3 A;  4JV2 A;  4QZV B;  3A3O B;  2RU3 A;  3L95 X;  1UVJ A;  4Y2A A;  3POT B;  4JI1 F;  1SJR A;  2YKN B;  3TX8 A;  4NYZ A;  2KH9 A;  5CCM A;  2FZK B;  1S99 A;  4ICL A;  3CCZ A;  1MRO B;  1TL3 B;  2VIC A;  4JV5 F;  1RT4 B;  3Q8R B;  1AUS L;  3HLU A;  1Y00 A;  4C7Q A;  1YKW A;  2CPJ A;  3FJ2 A;  2VFV A;  3SYZ A;  1RTJ A;  3MM8 B;  3GZ7 A;  3P4U B;  1GTE A;  3SCI E;  1CJK B;  3D66 A;  3R6L B;  1FX2 A;  1Y3K A;  1YVF A;  4ECT A;  4LR9 A;  3O2I A;  1RSC A;  1Q5V A;  1RA7 A;  4WP3 A;  3HSJ A;  2HND A;  1N8R T;  1IKY A;  4B9U A;  2AJF E;  1KNZ A;  4C2M A;  4PQA A;  3MR7 A;  4FP9 A;  4M1K A;  3MUV P;  3CCU S;  1BC6 A;  2MB0 B;  1E6Y B;  1VQS A;  1J5O B;  1CJU A;  4KGM A;  2YQ0 A;  2C2Z B;  1ZET A;  1RU2 A;  1DQ9 A;  4BWJ A;  2OUG A;  2IVF B;  3OHB A;  3W64 A;  4DV0 F;  4L75 A;  4F4Z A;  2V4J B;  2VD3 A;  4ZCL A;  4BBY A;  4KAI A;  3PCO B;  2G1H A;  3LPY A;  2JDJ A;  5M2U A;  2UUB F;  2XSJ B;  3CGI A;  1RYS A;  4WIQ A;  3ET6 B;  4KPY A;  4C3M A;  2QYG A;  3P5T L;  4HT5 A;  4DUT A;  1WOS A;  4WKY A;  4TQS A;  2KU7 A;  3HSG A;  1AW0 A;  3PJW A;  4I2Q A;  1WC1 A;  3JSR A;  3G87 A;  1F0X A;  5KT4 A;  1D8Y A;  1XNR F;  2XNQ A;  1WKL A;  1N34 F;  3T6B A;  3D3C J;  3DLJ A;  2H5I B;  1VCT A;  2RIJ A;  4C0O C;  3DYA A;  1PIL A;  2OPS A;  5KFW A;  4LF5 J;  5I3P A;  2MEW A;  2O5D A;  3OSP A;  1UJ6 A;  2Z4P A;  4LBP A;  5LM7 E;  1XMO F;  4LIR A;  3IXQ A;  5JJB A;  5DET A;  3IWX A;  3OR2 B;  4J37 A;  1TK8 A;  3T1Y J;  3W2V A;  1YJV A;  2PN6 A;  1U8S A;  4I56 A;  4K4X A;  2ZHA A;  4Y00 A;  2W4D A;  2L3M A;  1Y5N B;  2FD2 A;  3KLF A;  2FY8 A;  1KQG B;  4P74 A;  4U8V A;  2Y1L B;  1NDP A;  2R8I A;  1XJW B;  4LBH A;  4YQW A;  2MKY A;  1FEH A;  4PZV A;  1PSD A;  3TZX A;  2UUT A;  1UJ5 A;  4OZ1 A;  2QL5 B;  1RAD B;  2MPU A;  2WW8 A;  2O3D A;  3D4J A;  1Q79 A;  2BE2 B;  3UPF A;  2VDI A;  3P5B P;  1CQN A;  4DR3 F;  4ZHR A;  2CUY A;  4DR5 F;  1X4F A;  5D77 A;  1V5V A;  5CYM A;  4ANC A;  4IQX A;  3PX4 A;  3EVO A;  1G6B A;  1LW0 B;  2WCX A;  2AZ3 A;  4RL1 A;  1BXN A;  5H9E K;  4QR1 A;  2BZ2 A;  3KLH B;  3KK2 B;  2JFK A;  3R5G A;  5F8M A;  3RZA A;  3OVA A;  3QO9 A;  2AW0 A;  2DR9 A;  1XTZ A;  2XLJ A;  4PXE A;  4QU7 A;  1X9S A;  3G8S A;  3GP9 A;  2ZH6 A;  3DOK B;  1DJ0 A;  4N8O A;  2H65 B;  4QYZ J;  3G4S S;  2XO6 A;  4OX9 J;  1ELO A;  2P5V A;  3ONQ A;  2M52 A;  5HAT A;  1TVR B;  1Y10 A;  3UVJ B;  4NLW A;  1CSJ A;  3O3L A;  2VFS A;  1FJE B;  3UCU P;  1EX8 A;  1F9E B;  3SDE A;  3S7R A;  2LQJ A;  2ZDO A;  2L9N A;  2NXN A;  4ED6 A;  1K0V A;  3HD1 A;  4DLE A;  3J80 Y;  4G65 A;  1S1U A;  2KVQ E;  2H51 B;  4FKX A;  3VGT A;  3EZO A;  2BJD A;  5EHH A;  4CH0 S;  3C15 A;  5KG6 A;  1YJ9 S;  4NL5 A;  1G1X A;  2V2Q A;  3V4I A;  2CYY A;  2Z2Z A;  1Q82 T;  3OXF A;  2K3I A;  1NBE B;  2GS8 A;  4DCP B;  2N3O A;  4EZ6 A;  4DX6 A;  5AXK A;  4EBC A;  2ASY A;  2WK4 A;  4DR6 J;  4DV1 F;  2I2Y A;  3WDO A;  5IWA F;  5LSL A;  1FWK A;  5FJ4 A;  2PA8 D;  1VQ4 S;  2R7X A;  2CVE A;  1JMT A;  4WFB Q;  4ER8 A;  5L1J A;  1Y9O A;  3PKY A;  3TAM B;  2LU2 A;  3O1L A;  1Z1Z A;  1DRZ A;  1A9N B;  4CCH A;  3LAM A;  4V19 J;  3OTO J;  3VAL A;  8AT1 B;  5M2R A;  4LF8 J;  3AD7 C;  4JBC A;  3CF5 Q;  1S72 S;  2BX6 A;  2VON A;  1U0H A;  2DNO A;  4IUF A;  3M1V A;  2O01 C;  3GJR B;  1ZM9 A;  1M5S A;  1SJ3 P;  3IG1 A;  2KL8 A;  3IR6 B;  4QWB A;  2Q43 A;  1YBU A;  3X1L B;  3MPY A;  3DN9 A;  4KY3 A;  1KLN A;  1ARO P;  5A6P A;  1R89 A;  4FYV B;  4CT9 A;  1HWI A;  1SKR A;  2L41 A;  2NXJ A;  1S7I A;  2HFS A;  3MI7 X;  3TA2 A;  4DFP A;  3ZZO A;  1IKW B;  3BGR A;  3DI6 B;  5KFU A;  4YUD A;  2L9W A;  2LQ5 A;  1NJW A;  3V5R A;  1REV B;  2ZH3 A;  1I94 F;  5I3U B;  1UTA A;  4LSN B;  3ITH B;  1OIA A;  2B5J B;  4CT8 A;  2UUC J;  2YWE A;  9ATC B;  4IG3 A;  4J9N A;  2CQD A;  4P2X A;  2B6A A;  2R7U A;  2QMX A;  1OYD A;  1X9M A;  2GGP B;  1EP4 A;  4I64 A;  2RQM A;  1CS4 A;  1HWU A;  3CD6 S;  2PA3 A;  5KFY A;  3EZU A;  2LVW A;  4IG0 B;  1JKH B;  3NNA A;  3GV8 B;  4X84 A;  5D0E A;  2J8A A;  3S6E A;  1P9Q C;  3EGV A;  3K89 A;  4W98 A;  2LQB A;  1RU1 A;  1PAE X;  2F8M A;  3UCZ P;  4QR0 A;  3NGU A;  1DLO B;  3ZZR A;  3VWS A;  1TZ0 A;  2LDI A;  3A8J A;  5E7O B;  4RUH A;  3ICL A;  4LSZ B;  3PRD A;  1FWL A;  3M2V A;  2WSE C;  3MGJ A;  4QIW D;  1A0O B;  3DM2 A;  2V50 A;  4HL9 A;  4B17 A;  4P2S A;  5CAB A;  4FBU A;  1T9W A;  4LF2 A;  2HAF A;  2X3G A;  5CAA A;  1VC5 A;  3CJ2 A;  1N5Y B;  2D9O A;  3TOQ A;  4S0M A;  4I2P A;  2E1A A;  2ZDP A;  4QW8 A;  4C8Y A;  2MKJ A;  4O4G B;  3PR4 A;  1HNZ F;  5GAG I;  2BA9 A;  2QTW A;  1UW4 A;  2W9B A;  2J0X A;  4IFY B;  2Z57 B;  3B6B A;  1C0T B;  3FSY A;  4ECW A;  2DNM A;  2CPY A;  1NJZ A;  2M8D B;  4DUY J;  1H6K X;  2M2B A;  2ZZM A;  1WI8 A;  4B08 A;  8ATC B;  2GJF A;  5C24 A;  2P9G A;  1FK9 B;  3O44 A;  3CO0 P;  1IQZ A;  1LXN A;  2HNY A;  5G0R B;  2APO A;  3MM7 A;  3RB0 A;  1N36 J;  3GIK A;  1KFD A;  2W2P P;  5J2P A;  2FVQ A;  2CZ4 A;  3OXG A;  1DHM A;  3OFH A;  3US5 A;  4DV7 F;  3SCL E;  4X4Q A;  3ZO7 A;  1VFJ A;  4WU2 A;  3I4P A;  4LF4 F;  2JEF A;  1G3O A;  2XBP A;  1FDN A;  3AHP A;  4QU6 A;  3KJF B;  4QWD A;  2RQ4 A;  2K1R A;  1U6F A;  1R31 A;  3F56 A;  4IOA Q;  2CQ3 A;  4JI4 F;  2Q6C A;  2W24 A;  4IRD A;  1M5K C;  1N4L A;  1NK9 A;  3D3B J;  1RAA B;  4UOG A;  3VVT A;  4LRE A;  3H0P A;  3R97 A;  2AKW B;  1Y0H A;  4C97 A;  2C42 A;  5D4L A;  1RT7 A;  3TA0 A;  3I0R B;  5LOQ A;  3ZZP A;  5DGA A;  2ZWO A;  5KFT A;  1X5O A;  2Z0G A;  1H7X A;  4ECQ A;  2D3U A;  4U67 Q;  1IBC B;  1Q81 T;  3BH7 B;  3BDP A;  4DX8 H;  3FCV A;  4B3S F;  2HHW A;  1SV5 B;  1RLD A;  2LU1 A;  4MFB B;  5J2Q A;  3I6P A;  5CYQ B;  4DPT A;  2CKW A;  3SEO A;  3HMJ G;  2WAQ D;  1XNQ J;  4RPF A;  2R7S A;  1K0T A;  2BR0 A;  4F4K A;  2YKM A;  3R1H A;  1DBD A;  1U1P A;  2N7Y A;  3GG1 A;  1F3F A;  4E8U A;  1N0V C;  4YEA A;  1K44 A;  1I3O B;  2PI5 A;  2NXC A;  3LA0 A;  2E7V A;  1Z4U A;  3BYR A;  4DZD A;  4C9D A;  4IRC A;  2A0F B;  3MEC A;  3IMQ J;  5B0C A;  4X64 F;  2ZC4 A;  1RTI B;  2ZBR A;  2KM8 C;  4UY8 5;  2RT3 A;  2XNR A;  1UVL A;  4DX7 A;  1H7W A;  4TY8 B;  3T9Z A;  3NLC A;  2OEJ A;  2W7A A;  4OL8 A;  3AOD A;  1XMB A;  3IR5 B;  3EZ5 A;  2HS0 A;  3MEE A;  2FGC A;  5JUM A;  4PG5 A;  1L3S A;  2DH8 A;  3AOB A;  1OPI A;  1YHQ S;  4LIW A;  4DMZ A;  3RB3 A;  4PUO B;  4LSL B;  3ZC4 A;  3DDK A;  4DF4 A;  1V3S A;  1FDA A;  3CVK A;  3QLH B;  2R2S A;  4DV3 F;  2HGL A;  3QNW B;  3BKU A;  3ILI A;  3IP0 A;  3N28 A;  3U02 A;  3TUZ C;  1TL1 B;  4A48 A;  1SIZ A;  1RHJ B;  3VZH A;  3OTC A;  2Y0B B;  3KLI A;  1FVS A;  1WHX A;  2FHO B;  1HNX F;  1UZH A;  2MST A;  3JXO A;  4O0N A;  3V6D A;  1SH0 A;  3BKF A;  2V6A A;  4FXD A;  5KT5 A;  1VR6 A;  2W01 A;  3VAG A;  1HHT P;  3CDB A;  3MF5 A;  1H2V Z;  3S1T A;  3FKB A;  1L3K A;  2LQ8 A;  4PKD B;  2V4R A;  2V0N A;  2KHC A;  3H5U A;  3L09 A;  3RU0 A;  1SXL A;  2OPP A;  1DTT A;  2PDA A;  1FRJ A;  3BGO P;  3QMQ A;  4LF7 F;  4ECR A;  2ATC B;  3D54 A;  2M3D A;  4RUA A;  1NB2 A;  2DRB A;  1JNZ B;  4RR5 A;  1PJ7 A;  4GVL A;  4Z2X A;  3OT9 A;  2DHG A;  4ES1 A;  5A76 A;  4C98 A;  3HXM A;  2VQF F;  4WZQ A;  3DDI A;  4HDH A;  4I68 A;  1EB0 A;  2VFT A;  3T9N A;  2U1A A;  4FNH A;  4YP3 A; 
#chains in the Genus database with same CATH homology
 5LMU J;  4JYA J;  4NEZ A;  1N33 J;  4DR5 J;  4NEY A;  4NXM J;  4B3S J;  4B3T J;  4PWW A;  4KYZ A;  4V1A k;  4DR1 J;  1XNR J;  2F4V J;  5A2Q U;  4LFA J;  4NXN J;  3J7A N;  1N34 J;  2UXD J;  4JI3 J;  4DUZ J;  2UUC J;  4X66 J;  4LF7 J;  2VQE J;  4DR4 J;  3D3B J;  3OTO J;  3R2D J;  3IMQ J;  5FLX U;  4JI7 J;  5BR8 J;  4X65 J;  1HNW J;  4LF8 J;  4LF4 J;  4DV6 J;  4LF9 J;  4YY3 J;  4KHP J;  4DUY J;  4YHH J;  2KVQ E;  2VQF J;  4DV4 J;  2UXC J;  4DV7 J;  1FJG J;  1XMO J;  2MQ8 A;  4RJV A;  2E5L J;  3J81 U;  5AJ3 J;  2UU9 J;  4AQY J;  4DV3 J;  5LMN J;  2KL8 A;  4JI6 J;  1IBM J;  4DV1 J;  1IBL J;  4DR7 J;  2HHH J;  1J5E J;  5IWA J;  3D3C J;  4B3M J;  4DR2 J;  3R2C J;  4DV5 J;  4DV0 J;  4K0K J;  4KY3 A;  3J80 U;  4JI2 J;  4JI1 J;  4B3R J;  4DV2 J;  3T1H J;  4LF5 J;  1N36 J;  2MEW A;  4JI8 J;  2ZM6 J;  4JI0 J;  4GKJ J;  2UXB J;  1I94 J;  4JI4 J;  4GKK J;  4LFB J;  4LF6 J;  5LM7 E;  1HNX J;  1XNQ J;  2UUB J;  4JV5 J;  4X62 J;  4LFC J;  2UUA J;  1HNZ J;  3W1Y C;  3JAM U;  5IT9 U;  3T1Y J;  4DR6 J;  2MTL A;  1XMQ J;  4HHU A;  4X64 J;  1N32 J;  1HR0 J;  4DR3 J;  4JI5 J;  4OX9 J;  1IBK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...