4RJXA

Crystal structure of the opro mutant protein f62y/d114y
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
425
structure length
425
Chain Sequence
LQHHHHHHHLEGTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQADYSRFDGFYTKNGNTADAAYFRRAYIELGGTAYKDWKYQINFDLSHNTGSSDNGYFDEASVTYTGFNPVNLKFGRFYPDFGLEKATSSKWVTAPERNAAYELADWINTHQDGMGAQVNSTLADMAYLSAGVSAKDADDSDGDSVKQFNFRGVFAPMHEAGNVLHVGVNYAYRDLDDTAFDSRIRPRLGMRGIATSGGNDAGDNGNRATFGGVSNSPAGSYKDDSVWGLEGAWAMGPFSAQAEYLARKLKADDNAYKDIKAKGYYAQLAYTLTGESRQYKLEGAKFDSVKPENKEIGAWEVFYRYDNIKVEDDNVVADTATREVGDTKAKAHNLGVNWYVNDAVKISAAYVKAKTDKITNNNGDDDGDGFVTRLQYVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Dynamics, and Substrate Specificity of the OprO Porin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Porin O
total genus 130
structure length 425
sequence length 425
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07396 Porin_O_P Phosphate-selective porin O and P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4rjxA00
3VY9X 3PRNA 3FYXA 1PHOA 5DL5A 3VZWX 3WI4A 1BT9A 4LSHA 1HXXA 2Y0LA 4FSOA 2XG6A 2FGQX 5FVNA 2PORA 4BUMX 4AUIA 8PRNA 4LSIA 2XE2A 2Y0HA 3UU2A 2ZLDA 3WI5A 2QTKA 1OSMA 1GFMA 5DL8A 5DL7A 4D65A 4D5UA 4GCPA 4FMSA 1BH3A 2XE5A 3HW9A 4FSPA 3JTYA 1GFQA 4RJXA 1E54A 3NSGA 4FT6A 1GFOA 6PRNA 3T20A 1OPFA 2J4UP 2PRNA 3SY9A 3POXA 2XE3A 3PORA 4FRTA 2K4TA 4FOZA 3SYSA 1HXUA 5DL6A 3T24A 1H6S1 3VZTX 1GFPA 1PRNA 3POQA 3SZDA 2O4VA 3A2SX 4JFBA 4FRXA 3SZVA 2Y2XA 2OMFA 3O0EA 4LSEA 3UPGA 4KRAA 4D64A 3K19A 1HXTA 3HWBA 4GCSA 2ZFGA 7PRNA 3VZUX 4KR8A 1MPFA 2XE1A 4KR4A 1GFNA 4RJWA 3SYBA 2ODJA 5PRNA 5JDPA 4LSFA 4C69X 2J1NA 3EMNX 4GCQA 3VY8X 3SY7A 2FGRA 3T0SA 2Y0KA 3POUA
chains in the Genus database with same CATH superfamily
2K0LA 3LK2B 1ORMA 3LK3A 1Q9FA 3RBHA 4FESA 2LHFA 4K3BA 5EE2A 2KZ7B 3PQSA 5G39A 1QJ8A 3PQUA 3PRNA 3VY9X 2F1CX 3FYXA 4CTDA 5B5EO 4B61A 1PHOA 5DL5A 4Z3TA 5AFUK 3VZWX 5IYUA 4N74A 3WI4A 2N2MA 1BT9A 1Q9GA 4LSHA 1HXXA 2Y0LA 3AA0A 5GV0A 4FSOA 1YS5A 5T5FA 2XG6A 1T16A 1MM5A 3DA4A 2FGQX 3G7GA 4AYNA 5FVNA 2XTRA 2PORA 1BXWA 1ZHXA 4O3XB 4BUMX 4O4XA 4AUIA 8PRNA 3GP6A 4LSIA 5JDPA 2XE2A 2Y0HA 3BRYA 3UU2A 2ZLDA 2W81C 3WI5A 2QTKA 2AXTO 5E79O 1OSMA 3VE1A 1G90A 1GFMA 4FZMA 5DL8A 2ERVA 5GTIO 4RL9A 3V8UA 3TZGA 1ZHTA 2MNHA 3C5OA 3AA7B 5DL7A 4D65A 2W80C 4D5UA 2KDYA 1ZHZA 1THQA 4GCPA 4O4UA 1T1LA 1QJ9A 4AYMC 4FMSA 4C4VA 1BH3A 4JCHA 5G38A 5GTHO 2XE5A 3A0BO 2X9KA 3AA1B 3HW9A 4FSPA 3JTYA 1GFQA 4G76A 4N59A 1E54A 3NSGA 4FT6A 1GFOA 4O49A 3A0HO 4O3YA 4RJXA 6PRNA 3T20A 4C4VB 1OPFA 4C00A 2J4UP 3BS0A 2PRNA 3SY9A 3AA1A 3POXA 4XNKA 3AA7A 2GE4A 2Y7SA 2XE3A 4AYDC 3PORA 2F1VA 4PUXA 4N58A 3KVDD 4FRTA 3PGUA 2K4TA 4N75A 4FOZA 3SYSA 2JMMA 3DA3A 1HXUA 5DL6A 4QQ1A 4G75A 5ADXK 2N2LA 3PGSA 4PJ0O 3T24A 1H6S1 3VZTX 3JCUO 3LK3B 3HOLA 3VE2A 3LK2A 3WU2O 1GFPA 1PRNA 4IL6O 3UAQA 3HOEA 3KZIO 3DWOX 3AAEB 4XNLA 1IZNA 4AKRA 2YNKA 3QRCA 3POQA 3AA0B 4UB6O 2KC0A 4GF4A 2O4VA 3SZDA 3A2SX 3BRZA 4JFBA 3PF1A 4FRXA 3SZVA 4FQEA 2M06A 5G3AA 4O3ZA 2Y2XA 4FZLA 2OMFA 2R4NA 2WVPA 2F1TA 1IZNB 1QJPA 2R8AA 2XTQA 3O0EA 3PGRA 3LK42 1S5LO 4UB8O 4AKRB 4F4BA 2WJQA 5TISO 4AFKA 5ADXL 3UPGA 4KRAA 4D64A 4AZLA 5AFUL 3LK41 4AYID 2MHLA 4K3CA 2X27X 3AA6A 4FUVA 5G26A 3K19A 2LFUA 2XMXA 2M07A 1HXTA 1ZHWA 4U9CA 3HWBA 4GCSA 2ZFGA 1MM4A 5KAFO 7PRNA 5H2FO 3VZUX 1P4TA 2YPVA 4KR8A 4E1TA 1MPFA 3NJTA 3AA6B 2IWWA 5KAIO 2XE1A 4KR4A 1GFNA 4AKMA 2R4LA 1ZHYA 3AAAB 2KXPB 4FZNA 4RJWA 3SYBA 2ODJA 4E1SA 5PRNA 2IWVA 2R88A 2KXPA 2R89A 3DWNA 4LSFA 4C69X 5B66O 4PR7A 2WJRA 2J1NA 3EMNX 4RLBA 3AAAA 2R4PA 4O3WA 5D5DA 4GCQA 3VY8X 3SY7A 4AYEC 2R4OA 3QRAA 2FGRA 2KZ7A 3DZMA 3AAEA 2JQYA 4GHBA 4RLCA 3T0SA 4LSEA 2Y0KA 3POUA
chains in the Genus database with same CATH topology
2K0LA 3LK2B 1ORMA 3LK3A 1Q9FA 3RBHA 4FESA 2LHFA 5EE2A 2KZ7B 3PQSA 3VY9X 1QJ8A 3PQUA 3PRNA 3FYXA 4B61A 1PHOA 5DL5A 4Z3TA 5AFUK 3VZWX 5IYUA 3WI4A 2N2MA 1BT9A 1Q9GA 4LSHA 1HXXA 2Y0LA 3AA0A 5GV0A 4FSOA 1YS5A 5T5FA 2XG6A 1MM5A 3DA4A 2FGQX 3G7GA 5FVNA 2XTRA 2PORA 1BXWA 1ZHXA 4O3XB 4BUMX 4O4XA 4AUIA 8PRNA 3GP6A 4LSIA 2XE2A 2Y0HA 3UU2A 2ZLDA 2W81C 3WI5A 2QTKA 1OSMA 3VE1A 1G90A 1GFMA 4FZMA 5DL8A 2ERVA 4RL9A 3V8UA 3TZGA 1ZHTA 2MNHA 3C5OA 3AA7B 5DL7A 4D65A 2W80C 4D5UA 2KDYA 1ZHZA 1THQA 4GCPA 4O4UA 1QJ9A 4AYMC 4FMSA 1BH3A 4JCHA 2XE5A 3HW9A 3AA1B 4FSPA 4N59A 3JTYA 1GFQA 4G76A 4O3YA 1E54A 3NSGA 4FT6A 1GFOA 4O49A 4RJXA 6PRNA 3T20A 1OPFA 2J4UP 2PRNA 3SY9A 3AA1A 3POXA 4XNKA 3AA7A 2GE4A 2Y7SA 2XE3A 4AYDC 3PORA 2F1VA 4PUXA 4N58A 3KVDD 4FRTA 2K4TA 4FOZA 3SYSA 2JMMA 3DA3A 1HXUA 5DL6A 4QQ1A 4G75A 5ADXK 2N2LA 3T24A 1H6S1 3VZTX 3LK3B 3HOLA 3VE2A 3LK2A 1GFPA 1PRNA 3UAQA 3HOEA 3AAEB 4XNLA 1IZNA 4AKRA 2YNKA 3QRCA 3POQA 3AA0B 2KC0A 4GF4A 2O4VA 3SZDA 3A2SX 4JFBA 4FRXA 3SZVA 2M06A 4O3ZA 2Y2XA 4FZLA 2OMFA 2XTQA 3O0EA 2F1TA 1IZNB 1QJPA 4LSEA 4AKRB 4AYNA 3LK42 4F4BA 4AFKA 5ADXL 3UPGA 4KRAA 4D64A 4AZLA 5AFUL 3LK41 4AYID 2MHLA 2X27X 3AA6A 4FUVA 5G26A 3K19A 2LFUA 2XMXA 2M07A 1HXTA 1ZHWA 4U9CA 3HWBA 4GCSA 2ZFGA 1MM4A 7PRNA 3VZUX 1P4TA 2YPVA 4KR8A 4E1TA 1MPFA 3AA6B 2XE1A 4KR4A 1GFNA 4AKMA 1ZHYA 3AAAB 2KXPB 4FZNA 4RJWA 3SYBA 2ODJA 4E1SA 5PRNA 5JDPA 2KXPA 4LSFA 4C69X 4RLBA 2J1NA 3EMNX 3AAAA 4O3WA 5D5DA 4GCQA 3VY8X 3SY7A 4AYEC 3QRAA 2FGRA 2KZ7A 4RLCA 3AAEA 4GHBA 3T0SA 2Y0KA 3POUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VY9 X;  3PRN A;  3FYX A;  1PHO A;  5DL5 A;  3VZW X;  3WI4 A;  1BT9 A;  4LSH A;  1HXX A;  2Y0L A;  4FSO A;  2XG6 A;  2FGQ X;  5FVN A;  2POR A;  4BUM X;  4AUI A;  8PRN A;  4LSI A;  2XE2 A;  2Y0H A;  3UU2 A;  2ZLD A;  3WI5 A;  2QTK A;  1OSM A;  1GFM A;  5DL8 A;  5DL7 A;  4D65 A;  4D5U A;  4GCP A;  4FMS A;  1BH3 A;  2XE5 A;  3HW9 A;  4FSP A;  3JTY A;  1GFQ A;  4RJX A;  1E54 A;  3NSG A;  4FT6 A;  1GFO A;  6PRN A;  3T20 A;  1OPF A;  2J4U P;  2PRN A;  3SY9 A;  3POX A;  2XE3 A;  3POR A;  4FRT A;  2K4T A;  4FOZ A;  3SYS A;  1HXU A;  5DL6 A;  3T24 A;  1H6S 1;  3VZT X;  1GFP A;  1PRN A;  3POQ A;  3SZD A;  2O4V A;  3A2S X;  4JFB A;  4FRX A;  3SZV A;  2Y2X A;  2OMF A;  3O0E A;  4LSE A;  3UPG A;  4KRA A;  4D64 A;  3K19 A;  1HXT A;  3HWB A;  4GCS A;  2ZFG A;  7PRN A;  3VZU X;  4KR8 A;  1MPF A;  2XE1 A;  4KR4 A;  1GFN A;  4RJW A;  3SYB A;  2ODJ A;  5PRN A;  5JDP A;  4LSF A;  4C69 X;  2J1N A;  3EMN X;  4GCQ A;  3VY8 X;  3SY7 A;  2FGR A;  3T0S A;  2Y0K A;  3POU A; 
#chains in the Genus database with same CATH topology
 2K0L A;  3LK2 B;  1ORM A;  3LK3 A;  1Q9F A;  3RBH A;  4FES A;  2LHF A;  4K3B A;  5EE2 A;  2KZ7 B;  3PQS A;  5G39 A;  1QJ8 A;  3PQU A;  3PRN A;  3VY9 X;  2F1C X;  3FYX A;  4CTD A;  5B5E O;  4B61 A;  1PHO A;  5DL5 A;  4Z3T A;  5AFU K;  3VZW X;  5IYU A;  4N74 A;  3WI4 A;  2N2M A;  1BT9 A;  1Q9G A;  4LSH A;  1HXX A;  2Y0L A;  3AA0 A;  5GV0 A;  4FSO A;  1YS5 A;  5T5F A;  2XG6 A;  1T16 A;  1MM5 A;  3DA4 A;  2FGQ X;  3G7G A;  4AYN A;  5FVN A;  2XTR A;  2POR A;  1BXW A;  1ZHX A;  4O3X B;  4BUM X;  4O4X A;  4AUI A;  8PRN A;  3GP6 A;  4LSI A;  5JDP A;  2XE2 A;  2Y0H A;  3BRY A;  3UU2 A;  2ZLD A;  2W81 C;  3WI5 A;  2QTK A;  2AXT O;  5E79 O;  1OSM A;  3VE1 A;  1G90 A;  1GFM A;  4FZM A;  5DL8 A;  2ERV A;  5GTI O;  4RL9 A;  3V8U A;  3TZG A;  1ZHT A;  2MNH A;  3C5O A;  3AA7 B;  5DL7 A;  4D65 A;  2W80 C;  4D5U A;  2KDY A;  1ZHZ A;  1THQ A;  4GCP A;  4O4U A;  1T1L A;  1QJ9 A;  4AYM C;  4FMS A;  4C4V A;  1BH3 A;  4JCH A;  5G38 A;  5GTH O;  2XE5 A;  3A0B O;  2X9K A;  3AA1 B;  3HW9 A;  4FSP A;  3JTY A;  1GFQ A;  4G76 A;  4N59 A;  1E54 A;  3NSG A;  4FT6 A;  1GFO A;  4O49 A;  3A0H O;  4O3Y A;  4RJX A;  6PRN A;  3T20 A;  4C4V B;  1OPF A;  4C00 A;  2J4U P;  3BS0 A;  2PRN A;  3SY9 A;  3AA1 A;  3POX A;  4XNK A;  3AA7 A;  2GE4 A;  2Y7S A;  2XE3 A;  4AYD C;  3POR A;  2F1V A;  4PUX A;  4N58 A;  3KVD D;  4FRT A;  3PGU A;  2K4T A;  4N75 A;  4FOZ A;  3SYS A;  2JMM A;  3DA3 A;  1HXU A;  5DL6 A;  4QQ1 A;  4G75 A;  5ADX K;  2N2L A;  3PGS A;  4PJ0 O;  3T24 A;  1H6S 1;  3VZT X;  3JCU O;  3LK3 B;  3HOL A;  3VE2 A;  3LK2 A;  3WU2 O;  1GFP A;  1PRN A;  4IL6 O;  3UAQ A;  3HOE A;  3KZI O;  3DWO X;  3AAE B;  4XNL A;  1IZN A;  4AKR A;  2YNK A;  3QRC A;  3POQ A;  3AA0 B;  4UB6 O;  2KC0 A;  4GF4 A;  2O4V A;  3SZD A;  3A2S X;  3BRZ A;  4JFB A;  3PF1 A;  4FRX A;  3SZV A;  4FQE A;  2M06 A;  5G3A A;  4O3Z A;  2Y2X A;  4FZL A;  2OMF A;  2R4N A;  2WVP A;  2F1T A;  1IZN B;  1QJP A;  2R8A A;  2XTQ A;  3O0E A;  3PGR A;  3LK4 2;  1S5L O;  4UB8 O;  4AKR B;  4F4B A;  2WJQ A;  5TIS O;  4AFK A;  5ADX L;  3UPG A;  4KRA A;  4D64 A;  4AZL A;  5AFU L;  3LK4 1;  4AYI D;  2MHL A;  4K3C A;  2X27 X;  3AA6 A;  4FUV A;  5G26 A;  3K19 A;  2LFU A;  2XMX A;  2M07 A;  1HXT A;  1ZHW A;  4U9C A;  3HWB A;  4GCS A;  2ZFG A;  1MM4 A;  5KAF O;  7PRN A;  5H2F O;  3VZU X;  1P4T A;  2YPV A;  4KR8 A;  4E1T A;  1MPF A;  3NJT A;  3AA6 B;  2IWW A;  5KAI O;  2XE1 A;  4KR4 A;  1GFN A;  4AKM A;  2R4L A;  1ZHY A;  3AAA B;  2KXP B;  4FZN A;  4RJW A;  3SYB A;  2ODJ A;  4E1S A;  5PRN A;  2IWV A;  2R88 A;  2KXP A;  2R89 A;  3DWN A;  4LSF A;  4C69 X;  5B66 O;  4PR7 A;  2WJR A;  2J1N A;  3EMN X;  4RLB A;  3AAA A;  2R4P A;  4O3W A;  5D5D A;  4GCQ A;  3VY8 X;  3SY7 A;  4AYE C;  2R4O A;  3QRA A;  2FGR A;  2KZ7 A;  3DZM A;  3AAE A;  2JQY A;  4GHB A;  4RLC A;  3T0S A;  4LSE A;  2Y0K A;  3POU A; 
#chains in the Genus database with same CATH homology
 2K0L A;  3LK2 B;  1ORM A;  3LK3 A;  1Q9F A;  3RBH A;  4FES A;  2LHF A;  5EE2 A;  2KZ7 B;  3PQS A;  3VY9 X;  1QJ8 A;  3PQU A;  3PRN A;  3FYX A;  4B61 A;  1PHO A;  5DL5 A;  4Z3T A;  5AFU K;  3VZW X;  5IYU A;  3WI4 A;  2N2M A;  1BT9 A;  1Q9G A;  4LSH A;  1HXX A;  2Y0L A;  3AA0 A;  5GV0 A;  4FSO A;  1YS5 A;  5T5F A;  2XG6 A;  1MM5 A;  3DA4 A;  2FGQ X;  3G7G A;  5FVN A;  2XTR A;  2POR A;  1BXW A;  1ZHX A;  4O3X B;  4BUM X;  4O4X A;  4AUI A;  8PRN A;  3GP6 A;  4LSI A;  2XE2 A;  2Y0H A;  3UU2 A;  2ZLD A;  2W81 C;  3WI5 A;  2QTK A;  1OSM A;  3VE1 A;  1G90 A;  1GFM A;  4FZM A;  5DL8 A;  2ERV A;  4RL9 A;  3V8U A;  3TZG A;  1ZHT A;  2MNH A;  3C5O A;  3AA7 B;  5DL7 A;  4D65 A;  2W80 C;  4D5U A;  2KDY A;  1ZHZ A;  1THQ A;  4GCP A;  4O4U A;  1QJ9 A;  4AYM C;  4FMS A;  1BH3 A;  4JCH A;  2XE5 A;  3HW9 A;  3AA1 B;  4FSP A;  4N59 A;  3JTY A;  1GFQ A;  4G76 A;  4O3Y A;  1E54 A;  3NSG A;  4FT6 A;  1GFO A;  4O49 A;  4RJX A;  6PRN A;  3T20 A;  1OPF A;  2J4U P;  2PRN A;  3SY9 A;  3AA1 A;  3POX A;  4XNK A;  3AA7 A;  2GE4 A;  2Y7S A;  2XE3 A;  4AYD C;  3POR A;  2F1V A;  4PUX A;  4N58 A;  3KVD D;  4FRT A;  2K4T A;  4FOZ A;  3SYS A;  2JMM A;  3DA3 A;  1HXU A;  5DL6 A;  4QQ1 A;  4G75 A;  5ADX K;  2N2L A;  3T24 A;  1H6S 1;  3VZT X;  3LK3 B;  3HOL A;  3VE2 A;  3LK2 A;  1GFP A;  1PRN A;  3UAQ A;  3HOE A;  3AAE B;  4XNL A;  1IZN A;  4AKR A;  2YNK A;  3QRC A;  3POQ A;  3AA0 B;  2KC0 A;  4GF4 A;  2O4V A;  3SZD A;  3A2S X;  4JFB A;  4FRX A;  3SZV A;  2M06 A;  4O3Z A;  2Y2X A;  4FZL A;  2OMF A;  2XTQ A;  3O0E A;  2F1T A;  1IZN B;  1QJP A;  4LSE A;  4AKR B;  4AYN A;  3LK4 2;  4F4B A;  4AFK A;  5ADX L;  3UPG A;  4KRA A;  4D64 A;  4AZL A;  5AFU L;  3LK4 1;  4AYI D;  2MHL A;  2X27 X;  3AA6 A;  4FUV A;  5G26 A;  3K19 A;  2LFU A;  2XMX A;  2M07 A;  1HXT A;  1ZHW A;  4U9C A;  3HWB A;  4GCS A;  2ZFG A;  1MM4 A;  7PRN A;  3VZU X;  1P4T A;  2YPV A;  4KR8 A;  4E1T A;  1MPF A;  3AA6 B;  2XE1 A;  4KR4 A;  1GFN A;  4AKM A;  1ZHY A;  3AAA B;  2KXP B;  4FZN A;  4RJW A;  3SYB A;  2ODJ A;  4E1S A;  5PRN A;  5JDP A;  2KXP A;  4LSF A;  4C69 X;  4RLB A;  2J1N A;  3EMN X;  3AAA A;  4O3W A;  5D5D A;  4GCQ A;  3VY8 X;  3SY7 A;  4AYE C;  3QRA A;  2FGR A;  2KZ7 A;  4RLC A;  3AAE A;  4GHB A;  3T0S A;  2Y0K A;  3POU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...