4RK2A

Crystal structure of sugar transporter rhe_pf00321 from rhizobium etli, target efi-510806, an open conformation
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
393
structure length
393
Chain Sequence
AVTLKWALWDWDKTAYYKPLIEAYQAKHPNVKFEPMDLGSQDYQQMISTQLTGGSKDIDIVTIKDVPGYTNLVRAGNIADLSGFVKDQKIDPAPYGGLIEELTIDGKIYSLPFRSDFWIVYYNKDIFDKAGVPYPTNDMTWAQFDETAEKLAGGMGTNKTYGALLHTWRSTVQLPGILDGKHTLVDGDYAFLKPWYERALTLQKDGAIPSYAFLKTSNTHYSALFFNGTIGMLPMGTWFVGTQIAKVKSGESKSKNWGIVKFPHPDGVPAGTTAAQISGLAVNSNSQHKDAALDFIKFVAGPEGAAVVAATGTFPALKTADVSAKIASTPGFPQDEASKEALIPAKAYLEMAVNPNAAKIEVVLNRAHDAIMTDNTSVDDGLKEMTEGVKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Sugar Transporter RHE_Pf00321 from Rhizobium Etli, Target EFI-510806
rcsb
source organism Rhizobium etli
molecule tags Transport protein
molecule keywords Putative sugar ABC transporter, substrate-binding protein
total genus 138
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4rk2A00
1B51A 4OERA 1YPNA 3O6HA 4WEDA 4F2QA 3VVDA 3PMXA 2Z23A 3SEWA 4EDPA 1RYOA 2RKMA 3MP6A 3SEXA 3PD8A 2D3IA 3RLFE 3MP1A 1EZ9A 1M5DA 5I2KA 3UIFA 4ESWA 3Q28A 4OFOA 3WAFA 5L9SA 5ITPA 3OO6A 1KWHA 5M2VA 2HCAA 3RT6B 1ZTYA 3EHUA 2XXUA 3PUZE 3PUVE 2OBGA 1MQHA 1OVTA 1UTHA 4YKIA 5I56B 3PPQA 3ODBA 4HS7A 3G3GA 1OQGA 4U22A 2H98A 3K1NA 1B1XA 3IJOB 5AA3A 3KN7A 1AIVA 1PB9A 3KEIA 1B0LA 1MPDA 2F97A 1QJMA 3HO7A 3UK4A 5H8FA 2QS1A 3GXAA 1PB8A 4Q0CA 5I58A 2I3VA 2E0SA 1SW5A 1A7LA 2ZNSA 3C4MA 3MVZA 4MLVA 4QFNA 4KI0E 4MFIA 4R6KA 3SKPA 1R9LA 4BDNA 1A54A 4MF3A 4GXSB 3SDFA 3TCGA 3VE1B 2RC9A 1MY3A 2AIXA 4WEPA 3TTMA 3N94A 2OZZA 3SEYA 4DE8A 1MY2A 1B9JA 5ICTA 3K02A 1B3HA 2FNCA 3U72A 5BWJA 3VFJA 3KOSA 1FQBA 2ZNUA 4XTCQ 1UQWA 4NEDA 5H8QA 3DP8A 3E13X 3OD7A 2G29A 3IO4A 1OIBA 4OWDA 4MH5A 3I3VA 3OO7A 1WODA 4NF5B 5DVJA 5B70A 3FVNA 1P99A 3OMBA 4QSCA 4U21A 1ZMGA 2YJPA 3HHGA 3Q26A 2RC7A 1UTBA 2B3BA 3GLBA 3TDJA 4F18A 4DDDA 5ITOA 2H25A 5CMKA 3A3UA 4BDQA 4E0WA 3O66A 2X7QA 1QUJA 1FTLA 4Q30B 4ISUA 2Z8DA 1AOVA 4N13A 4LONB 3ZS6A 2Y84A 4G4PA 5I59A 2Q8JA 4X9TA 3CG3A 2XXWA 4POWA 3KN8A 3MPKA 1I69A 1POTA 2WKYA 1NNFA 1US5A 3PUYE 4F22A 2DS9A 4EXKA 4ECFA 3CFLA 1MDQA 3IR1A 4FECA 4F3PA 2ALUA 2OWTA 2QJEA 5CBRA 3IOUA 1JQFA 1LAHE 1TT1A 2VOZA 4YMAA 4LP2B 1B58A 3KZGA 3MC2A 4R72A 3TZAA 1ANFA 1M5CA 2GFEA 1IXIA 3H6UA 3RGYA 2DWHA 1GGGA 1MQGA 4RJZA 3U92A 3PU5A 4H67A 5TPAB 5JEIA 5JK4A 4YU0A 1OMPA 4G8HA 3Q25A 1H45A 3JZJA 3QYTA 4EQ9A 1MDP1 5IKBA 5JTYA 1MS7A 1B7HA 1OVBA 2H5YA 1D4NA 3L6GA 5EHSA 1JEUA 1MH3A 1FTKA 1MXUA 4DCXA 1USYE 3H6TA 3QXMA 1B5JA 1BP5A 1S50A 2DVCA 2P1SA 3BFUA 3DP4A 3IORA 2OWSA 1CE2A 4FEDA 2B65A 4G8NA 3GBAA 3SEUA 3T9XB 1B3LA 2V3UA 5F7VA 3R7XA 4U1OA 2XXQA 3PUWE 4PFUA 4U1ZA 2XXHA 4C1UA 4EUOA 4JB7A 1P1WA 1ZIUA 3IB0A 1B6HA 1LBCA 1TFDA 1YCJA 4GF8A 4IO5A 1URSA 4WKMA 3VV5A 5J1DA 1TWYA 3UP9A 5JTYB 4AB6A 2I4CA 2ZNTA 1PB7A 2CMOA 3O6IA 2DWAA 2V3QA 1FQAA 1JNFA 3PMVA 4KQPA 4FEBA 4RPNA 3FASA 4G68C 4IY5A 4YB7A 1SDXA 4HCYA 2O1LA 1MM6A 1ZJLA 4DLDA 5A5XB 4PFYA 2RC8A 3SEVA 3OO9A 5H8NA 1SW2A 5DVFA 1IUDA 4OQOA 2V93A 3G7WA 3K6WA 2O84X 3IO6A 3RY3A 5EYFA 2D5WA 2HZKA 3FIRA 4R74A 5ELVA 3P7IA 4IGTA 2QMXA 3H4ZA 3UORA 4OHNA 1A8FA 1JW5A 2UYFA 4N07A 2VP1A 4GRKA 4OZ9A 4LA9A 1H3DA 1ZKBA 3MZ1A 3W15C 4YMBA 3S9EA 1B46A 2RF1A 3MWBA 1XVXA 2I0CA 4OTEA 3K01A 5B7DA 4IO4A 3BFTA 2UVJA 5H8HA 3DP6A 1IQ7A 3DM0A 3U8QA 2F7CA 1NH7A 3KSJA 5TP9B 3TTKA 3USDA 5CC2A 5KZTA 3ECRA 4FAJA 4PE5B 1P1UA 3IJXB 1XVYA 3QUJA 3WAEA 2ZXTA 5CM6A 3FD3A 2I58A 3IB2A 1Q35A 1JVYA 2DXYA 1JVXA 3PPRA 4U2RA 4KYSA 4RNSA 4XXUA 1DMBA 4JDFA 2GHAA 4NF6B 4QFPA 5KCJB 1D9VA 3LSLA 1MM7A 5DYHA 5I2NA 3GZGA 1ZBMA 4FJPA 3MBPA 1IZ1A 2AL5A 2GRVA 3FVKA 1URGA 1B4ZA 2GHBA 2HFBA 1WDNA 1N04A 2O51A 3CSGA 3R26A 4K3FA 3CFXA 2QSXA 5K2XA 2HQ0A 2I4BA 2Y7KA 3FATA 1XS5A 4H6DA 3RPWA 3L6HA 1MXZA 1QULA 2HEUA 2R9JA 3ZKKA 2V84A 1LB9A 1YAEA 3IOWA 4BDOA 3LSXA 1NFTA 3MUQA 4N6PA 2F6PA 1MXVA 1JW4A 2I49A 3FUZA 4G77A 5CMMA 1AL3A 2XX9A 2ZYMA 1FQDA 3FJMA 3PPPA 2H99A 4ZEKA 2Y7WA 3TYHA 2UVGA 4HCWA 2DYXA 2NWJA 4F1VA 1UIUA 4QFKA 5CRYA 4EQBA 1SBPA 1PC3A 5KDTB 2H4IA 4QFOA 5LOMA 4PFTA 2UVHA 4H0WA 4TLMB 4ZECA 2XX8A 3FV1A 3MZ9A 2F7BA 1FTOA 3QK6A 3RUMA 3T22A 4NF6A 2D21A 2V3TA 2Z22A 4IO3A 4I9DA 4ZZAA 2ONRA 3S9LC 2RINA 4YKPA 3QUFA 4RK9A 4GFRA 1LAGE 2LAOA 1A8EA 3H03A 5BUUA 3UA8A 1Y20A 2Q2CA 2W7YA 4R9GA 4RY1A 1VR5A 2DP8A 4P11A 4XKNA 5H8HB 3UGWA 4ZZEA 5I56A 1GVCA 3ILTB 4JWOA 5FHMA 3CRBA 3R6UA 1LSTA 4EF1A 1HSLA 1SW1A 1A99A 1MXYA 3E3KA 3LR1A 4BLAA 4Q8RA 4NTLA 2Y7IA 2DOJA 1O63A 3CIJA 3FGSA 4AQ4A 3S9NC 1JETA 4LUBA 2A5TB 4UACA 4U4SA 5HBCA 3A3CA 1H43A 1UTBB 1XC1A 3D4CA 2PX1A 3PPNA 2YPNA 3FJ7A 1MPCA 3Q29A 1MRPA 4PP0A 5CMCA 3FXQA 2UVIA 4PFWA 4RYAA 1VFEA 2PBWA 2DWIA 1QW0A 4QFLA 3KJTA 3HN0A 3FV2A 1DOTA 1DPPA 3LSWA 3PUXE 3MJNA 3ZKLA 4EXLA 1LFGA 5I84A 3FZVA 2FYIA 2Q89A 5H8SA 1M5BA 3I6VA 1B0HA 4ZS9A 1CB6A 1QVSA 1JEVA 1B4HA 3KG2A 2XHDA 3KOTA 3EHSA 4LVQA 2XXXA 3C36A 1IITA 2UXAA 4MLQA 1QUKA 5L9OA 2NVUB 5I58B 1Y1ZA 1O64A 3C31A 4OENA 3S9MC 2RCAA 3E9XA 3OO8A 4OESA 2F35A 1N76A 5KCJA 1LAXA 4GIZA 5CBSA 3K6UA 5L9MA 3C33A 3IAZA 3F11A 2REGA 4X1BA 4JWXA 1EU8A 2I3WA 1AH5A 4C1TA 5IAIA 3TUSA 1PBQA 4QRZA 1YTVA 4KR5A 4H65A 3CR9A 3K6VA 1Y3QA 1DTGA 1DPEA 4Q5TA 3T9VA 1JW1A 2BJJX 2Z8EA 2NOOA 4YB5A 1FTJA 1SVXB 4GXAA 4TOZA 5FHOA 5H8QB 2DQVA 3RN8A 3RNNA 3T96B 1P1QA 3TTLA 3PD9A 3VLUA 1HSEA 3O28A 5AA4A 2REJA 1P1OA 1VE4A 3EQ1A 4KFQA 1SI1A 3TPAA 3VDFA 3G3KA 3I5OA 4P0IA 1B40A 1MXXA 1LCFA 2ESNA 3O6GA 3FXRA 3IK6B 4DXBA 4O3CA 3TODA 1Z7NE 5FHNA 5AA2A 5K2YA 1I6AA 1B5HA 2PYYA 2VGQA 1LFHA 2R71A 1II5A 3H6VA 4JBZA 3OSQA 4H5GA 3IL1B 3VXBA 3VXCA 4YZZA 4YAHX 5H8NB 3B6QA 1H44A 1S7YA 4YICA 3IOTA 4O3BA 4KHZE 4XIGQ 3OENA 3N26A 1ELJA 1FQEA 1POY1 3K2DA 4PETA 4EF2A 4O3AA 2A5TA 1B3GA 3PPOA 4OETA 2R6GE 4G2ZA 4WXJA 3N6TA 3VVEA 1AMFA 1LFIA 3TKDA 3ZSFA 2GH9A 3E4RA 4OFLA 4OYVA 3B6TA 3QIMA 4YB6A 2E1SA 1Y4TA 2O68A 4LZ7A 4ELQA 2O7IA 2V25A 3C35A 3H06B 4I62A 3W9WA 1B3FA 5CMBA 4M4GA 4DCYA 1A55A 2HZLA 4IY6A 3EN3A 5H8FB 1URDA 4ZE9A 3T9HB 4ZEBA 4F3SA 4ZEDA 3MP8A 4YKJA 1J1NA 2Q9TA 3AXFA 3M3LA 1SI0A 4F1YA 2F8DA 2P2AA 1EZOA 3S4UA 1UTHB 2QMWA 1XOCA 2Q88A 5DEXB 1FTMA 1LGBC 1WVJA 3G3JA 4DZ1A 4Z7EA 5KDTA 1N3WA 1Y3PA 3O2AA 3SESA 2O6AA 1Q1KA 3BKIB 1B5IA 2IA4A 4H5FA 2F78A 4LATA 4HW8A 1O7TA 2VHAA 3HSTA 3MPLA 4LZ5A 1RYXA 3BBRA 3QSLA 4GL0A 3U1OA 5AA2D 3HCQA 3KN3A 4F29A 1SQYA 1LCTA 5FTHA 1VSOA 2ZYOA 4F3GA 4DXUA 3LC8A 3FVGA 1SW4A 3FXUA 2THIA 4JSDA 4QSDA 5ISUA 3LUYA 1QKAA 4X48A 1SYHA 4XKQA 3DELB 2X7PA 2ZYKA 3MVYA 3SERA 4BDRA 1SD3A 2YLNA 5A5XA 4GD5A 4ND9A 4NF4B 2QS3A 2F36A 3V5AA 4BDLA 4R2BA 2DE3A 3SETA 4ESXA 1SYIA 1B7UA 1OLAA 4OVJA 3MAMA 1B7ZA 3RT8A 3ILUB 4G68A 1MQIA 1OQHA 2KLFA 3IB1A 4IGRA 4RXLA 4IO2A 3KSXA 1MPBA 3RQTA 3TEPA 1Y3NA 3KFMA 1PDAA 3OSRA 3U94A 1IIWA 3W9VA 4RK2A 2B3FA 2UYEA 3B7DA 3CFZA 4NWCA 1PEBA 4UA8A 1XT8A 1US4A 4TQUQ 4L17A 3JV9A 2XXRA 3KBRA 4KCCA 4NF5A 3TQWA 4C0RA 2XXVA 3RTWB 1NMUA 5I57B 3EPEA 2DWJA 2NXOA 4KYEA 1N7WA 1BIYA 3OEKA 2F7AA 1IEJA 2QS2A 3EF7A 4NF8B 3CSBA 3HV1A 2Y7PA 1QUIA 5TPAA 3H7MA 1FQCA 2F5XA 4GL8A 5I2KB 2HAUA 4FIMA 3MW0A 3OXNA 1S9TA 3K6XA 4NWDA 1EH3A 3M8UA 4GQOA 4KD5A 5DTBA 5AA4B 2ONSA 1B05A 3G3FA 4U23A 5L8DA 2G93A 3CVGA 3D4GA 3MVWA 1R9QA 5DEXA 3M3KA 3RTFB 4H8JA 3K0VA 1OLCA 3VLVA 3N5LA 1NL5A 2IEEA 2ONKE 1D9YA 4NE4A 3T66A 1F9BA 1XHYA 4F3BA 1L5TA 4IB2A 4OMBA 2I0BA 1TFAA 5HM4B 4FE8A 4HTGA 1N84A 2XX7A 4R6HA 3UN6A 3TFLA 1HSJA 1MY4A 1QKBA 3DLNA 2HXWA 2A5SA 1GV8A 4DIGA 5DT6A 2O7UA 3OOAA 1D3KA 2PMSA 1MG1A 2PVUA 1N0TA 2F6GA 5ICQA 1B52A 2FA7A 2DE4A 3JYRA 2ZMBA 3GBBA 4I8CA 3MVXA 3VVFA 2M8CA 1LB8A 2DVZA 3MZBA 3H6WA 4LZ8A 3MQ9A 4LQ5A 2OCUA 3K1PA 4NF8A 4GVOA 3O29A 2XXPA 1UIVA 1M5FA 5I59B 1R6ZA 4XKRA 2Y7RA 3PGFA 2XD2A 4GOTA 4R2FA 5I2NB 4G8MA 2XXTA 4GWOA 4JXIA 3FVOA 2NUVA 1BTJA 5EHMA 3TQLA 2Q2AA 4OFJA 1ATGA 1IXGA 1B2HA 1GR2A 3PV0E 4QF9A 4THIA 2OK2A 3EHTA 3H3GA 4G68B 4LQ2A 1MY1A 4OXVA 4IO6A 4QSEA 4YKKA 4ELPA 5AE4A 5I57A 1T0KA 1FCKA 4IO7A 4X1DA 1FQFA 1BLFA 3Q27A 2PT1A 1Y4CA 2DXRA 2OJTA 1MQDA 2ANJA 2QS4A 3T93B 3THIA 2HAVA 3C32A 2DSFA 5AA1A 4KYDA 3V83A 1R1NA 1VFDA 4OEVA 1DSNA 1IXCA 1PBPA 3C9HA 3T9UA 4U4XA 4R73A 2P0SA 4ONYA 3OEMA 3G3HA 5CI5A 1DTZA 1B3EA 2F34A 2ZYNA 3TELA 1I6QA 3A09A 1MH4A 4EQ7A 1H76A 1ZU0A 1N7XA 3K4UA 3HHFA 4ZDMA 1N3XA 2PT2A 1NKXA 2QRYA 2XXYA 4DXCA 3K00A 1RKMA 2QPQA 3C34A 4XKPA 2XD3A 3LSFB 2I6EA 1BKAA 4RA1A 4TLLB 1NNKA 4NMYA 4MBPA 2X26A 3OELA 4OEUA 4F31B 1ZLQA 2Z8FA 2ABHA 5DVIA 2XXIA 4M1VA 2O69A 5AA2B 3ONMA 3HPIA 1B32A 3IOVA 4Z0IA 2I48A 4KCDA 4R6YA 3TTRA 3V89B 3O97A 3FJGA 4PQJA 3CG1A 3S2VA 1LLSA 2OLBA 2CZLA 2RCBA 4ZEIA 4ZE8A 3V8XB 5F1QA 4ELRA 1GTKA 3TTNA 1IXHA 3IX1A 1I6BA 4F39A 2DE2A 4NF4A 5HPQA 4JSOA 2VD2A 1EZPA 2QL3A 3PMWA 5FTIA 3TCFA 4F2OA 3TAJA 1NNPA 4BDMA 1NH8A 4R9FA 4P0GA 4AB5A 4POXA 4F19A 3K1MA 3KGCA 4JWYA 1P1NA 2AYSA 1M5EA 1MXWA 2VD3A 1NNTA 1Z7ME 3B6WA 3QAXA 2AL4A 4H8IA 1LBBA 4QHQA 1FW0A 2O1MA 5TU0A 4E0XA 5TP9A 4ZEFA 3N6UA 4GLIA 1MQJA 3TCHA 3TMGA 1Y1MA 4ELOA 3U93A 3G3IA 3O9PA 4KPTA 4RPOA 1B1HA 4H1XA 3M3FA 3KJ7A 4FATA 1A40A 1LAFE 4FORA 2H9BA 1MY0A 3CI8A 1Y9UA 1USYH 4I1DA 4F1UA 3VLWA 3LBSA 1TXFA 4R75A
chains in the Genus database with same CATH superfamily
4F2QA 4I40A 3SEWA 4PC9A 3MP1A 1EZ9A 1M5DA 4NQ8A 3EHUA 2XXUA 3PUZE 1OVTA 4YKIA 3ODBA 4GWYA 2H98A 3IJOB 1AIVA 1PB9A 1B0LA 2F97A 3HO7A 5I58A 2E0SA 2ZNSA 4BDNA 4MF3A 3TCGA 2P3NA 3K02A 1FQBA 3E13X 2WBBA 1OIBA 4OWDA 4MH5A 4QSCA 4U21A 3HHGA 2RC7A 1FPJA 5CMKA 3O66A 1FTLA 4ISUA 4LONB 3ZS6A 5I59A 2Q8JA 2Q8MA 4X9TA 2Y5KA 1IMEA 4POWA 4F22A 3CFLA 5CBRA 2ALUA 2XWKA 1JQFA 4YMAA 3MC2A 1G0IA 1GGGA 2ZZWA 5JEIA 1H45A 1MDP1 4PAIA 3L6GA 1JEUA 4X04A 4DCXA 4PFYA 3DP4A 4G8NA 1CE2A 3MSTA 4FEDA 3GBAA 1SPIA 2XXQA 4C1UA 2V4CA 1ZIUA 1B6HA 3VV5A 1NV1A 3UP9A 5JTYB 2PFZA 4AB6A 2V3QA 4KQPA 3FASA 4IY5A 2O1LA 5A5XB 2VPOA 1SW2A 1IUDA 2PFYA 1DK4A 2HZKA 4R74A 1A8FA 4N07A 4OZ9A 4YMBA 2RF1A 4OTEA 5B7DA 4IO4A 2F7CA 1XVYA 5CM6A 2DXYA 4XXUA 1D9VA 5DYHA 5I2NA 1IZ1A 2AL5A 2GRVA 1B4ZA 2HFBA 2HQ0A 2Y7KA 4H6DA 3ZKKA 1LB9A 1YAEA 3IOWA 3LSXA 4N6PA 3MUQA 1MXVA 3FUZA 5AA4A 1AL3A 2XX9A 2H99A 3B50A 4F1VA 1UIUA 4QFKA 5KDTB 4NGUA 4PFTA 4TLMB 4MMPA 2F7BA 2D21A 2QVUA 5A5LA 1A8EA 4N91A 4R9GA 1Y20A 3HFUA 4MAGA 3ILTB 4OA4A 3R6UA 3LR1A 1MXYA 4BLAA 4NTLA 1FPIA 3FGSA 1O63A 5HBCA 4U4SA 3A3CA 1UTBB 4XF5A 3KJTA 1DPPA 4PTKA 5I5PA 3KOTA 2XXXA 1IITA 1NUZA 4MLQA 2NVUB 1Y1ZA 3C31A 4HE1A 4QBAA 3OO8A 1N76A 4GIZA 1YTVA 3T9VA 5H8QB 4N6KA 4YB5A 1FTJA 4PFBA 3RNNA 1P1QA 3PD9A 1HSEA 1P1OA 5I3SA 3G3KA 4P0IA 1LCFA 5I7IA 1Z7NE 5AA2A 5K2YA 1FPBA 1B5HA 2R71A 1II5A 4JBZA 4JVIA 4H5GA 4YAHX 2QVVA 3IOTA 4O3BA 4KHZE 4XIGQ 2QVRA 4OETA 1B3GA 2R6GE 4WXJA 1AMFA 4OYVA 1FRPA 2E1SA 4I62A 3T9HB 4ZEBA 1J1NA 2F8DA 2P2AA 1UTHB 2Q88A 1WVJA 1IMDA 3KN3A 1LCTA 4DXUA 3LC8A 3FVGA 4JSDA 2THIA 3LUYA 4XKQA 3DELB 2X7PA 2ZYKA 3MVYA 4BDRA 4ND9A 2F36A 2DE3A 4PDDA 4ESXA 1SYIA 1B7UA 4G68A 4MCOA 3OSRA 1XT8A 5IGAA 4C0RA 3RTWB 1YZ0A 2NXOA 1N7WA 1BIYA 4NF8B 1QUIA 2F5XA 1FPFA 5I2KB 3FBPA 2HAUA 4FIMA 4I3YA 1EH3A 3M8UA 5DTBA 4AS5A 4U23A 3D4GA 5DEXA 3K0VA 2ZZVA 1OLCA 3VLVA 1NL5A 4F3BA 2XWIA 1XHYA 2I0BA 4GX3A 4R6HA 1GV8A 2A5SA 4XEQA 1D3KA 1MG1A 2FA7A 1RDYA 2B4LA 2ZMBA 4I8CA 4XFEA 2DVZA 3MZBA 1DCUA 4LQ5A 4UABA 1UIVA 5I59B 1R6ZA 4G8MA 3FVOA 5IM2A 4P56A 3PV0E 2OK2A 3H3GA 4YKKA 1T0KA 4X1DA 3Q27A 4MNPA 4KXPA 2DXRA 3V83A 1VFDA 4OEVA 3C9HA 1IXCA 4NN3A 2ZYNA 1I6QA 4EQ7A 3RPLA 1N3XA 1RKMA 2QPQA 2WYPA 1NNKA 4MBPA 1ZLQA 4GWXA 4OVQA 2XXIA 1VDWA 5AA2B 3ONMA 4PF8A 1B32A 3IOVA 4R6YA 3CG1A 1LLSA 3V8XB 4ELRA 1GTKA 1IXHA 1I6BA 2DE2A 4JSOA 2QL3A 4F2OA 1NNPA 4BDMA 1NH8A 4R9FA 1CNQA 4JWYA 4NG7A 1P1NA 3QAXA 4H8IA 1LBBA 3TCHA 1Y1MA 4KPTA 1B1HA 1A40A 1LAFE 4F1UA 1Y9UA 3LBSA 5ET5A 1TXFA 3O6HA 4WEDA 3VVDA 3PMXA 2Z23A 4H45A 2RKMA 2D3IA 5I2KA 4ESWA 2GQ1A 1KWHA 2B4MA 3PUVE 2OBGA 3PPQA 1OQGA 5AA3A 1B1XA 3KEIA 1QJMA 5H8FA 2HHMA 3MVZA 4O7IA 1A54A 3VE1B 4DXCA 2RC9A 2AIXA 1MY2A 1B9JA 2HXRA 3BIGA 1UQWA 4NF5B 3OMBA 1ZMGA 2YJPA 1UTBA 1LBZA 1FPEA 3A3UA 1QUJA 2Z8DA 4OVRA 4G4PA 3KN8A 4EXKA 1MDQA 4FECA 2QJEA 3IOUA 1LAHE 4R72A 5FBPA 2GFEA 1IXIA 1MQGA 4RJZA 3PU5A 5EQ8A 5JK4A 4YU0A 3JZJA 5JTYA 1LBWA 1MH3A 1FTKA 3QXMA 1S50A 2DVCA 2HPGA 4ZZEA 5A5XA 3SEUA 1B3LA 4U1OA 4U1ZA 4JB7A 3IB0A 1URSA 1NI9A 2I4CA 2CMOA 4RPNA 4FEBA 4P9KA 1MM6A 4N15A 4OVTA 2RC8A 4OQOA 3K6WA 2D5WA 3FIRA 5ELVA 1NV7A 4OHNA 1JW5A 2VP1A 4LA9A 3S9EA 1XVXA 2I0CA 3K01A 2UVJA 3DP6A 1IQ7A 3DM0A 3U8QA 1NH7A 5TP9B 1P1UA 1G0HA 1NUXA 2ZXTA 3IB2A 1NUYA 4QFPA 3LSLA 1MM7A 4FJPA 3FVKA 5K2XA 1WDNA 2CEXA 3FATA 3RPWA 1QULA 2R9JA 5CC2A 3TYHA 1FQDA 3FJMA 2UVGA 4HCWA 4EQBA 1SBPA 5LOMA 4H0WA 3FV1A 3MZ9A 3QK6A 3RUMA 3D1RA 4IO3A 3S9LC 3QUFA 2LAOA 2W7YA 3ZKLA 3FXBA 3CRBA 1LSTA 4EF1A 2Y7IA 1JETA 4UACA 2A5TB 1XC1A 3Q29A 3D4CA 2PX1A 3PPNA 4PBHA 3FXQA 1NV2A 4RYAA 3LSWA 4EXLA 1LFGA 5EQ9A 4ZS9A 1QVSA 1JEVA 2KQZA 3KG2A 1QUKA 5I58B 2F35A 3K6UA 5L9MA 4JWXA 1EU8A 2I3WA 1AH5A 1PBQA 4QRZA 4KR5A 3CR9A 1JW1A 2BJJX 2NOOA 5FHOA 4GXAA 2JJKA 2DQVA 3VLUA 3EQ1A 3TPAA 3FXRA 3TODA 1LFHA 3OSQA 4YZZA 5H8NB 4YICA 3OENA 1POY1 3K2DA 2A5TA 3PPOA 3VVEA 3N6TA 3TKDA 2GH9A 3E4RA 3B6TA 3QIMA 1Y4TA 2O68A 2O7IA 2V25A 3W9WA 5CMBA 1A55A 4N81A 3EN3A 5H8FB 3AXFA 3M3LA 4F1YA 5ESYA 1FJ9A 5DEXB 5KDTA 1Y3PA 3SESA 2O6AA 1B5IA 2IA4A 4LATA 1O7TA 3BBRA 5AA2D 3U1OA 3HCQA 5FTHA 2ZYOA 3CHGA 1SW4A 3FXUA 4QSDA 4PCDA 1SYHA 2F3DA 4GD5A 4NF4B 4R2BA 3SETA 3ILUB 1FJ6A 2XWOA 3KSXA 1MPBA 2P3VA 4IO2A 1Y3NA 1PDAA 4GWZA 1FBDA 2B3FA 2UYEA 4NWCA 4L17A 3JV9A 4N8GA 2MKZA 2XXVA 4JVCA 1FBGA 2F7AA 3EF7A 2Y7PA 5AA4B 4KD5A 4GQOA 2ONSA 2G93A 3CVGA 1R9QA 3ROJA 3T66A 1F9BA 1K9ZA 1TFAA 4HTGA 3OOAA 1B52A 5IZ1A 1YYZA 3MVXA 2M8CA 3H6WA 2OCUA 2XXPA 1M5FA 2Y7RA 2XD2A 4GOTA 4R2FA 4GWOA 1BTJA 5EHMA 1FPKA 3KC1A 3TQLA 1ATGA 1IXGA 4QF9A 4THIA 4LQ2A 4QSEA 1MQDA 2QS4A 5AA1A 3C32A 1R1NA 3OEMA 1DTZA 2F34A 1H76A 4MHFA 2PT2A 1NKXA 2QRYA 2XXYA 3K00A 3C34A 4PGPA 3LSFB 2I6EA 1BKAA 3OELA 2ABHA 2O69A 4OVPA 4Z0IA 2VPNA 3FJGA 1K9YA 3S2VA 2DDKA 5F1QA 5EQ7A 4GWWA 4F39A 4NF4A 3PMWA 3TCFA 1BK4A 2XWVA 2XA5A 1NNTA 4QHQA 2FHYA 5TP9A 4ZEFA 4GLIA 3TMGA 3U93A 3G3IA 4RPOA 3M3FA 4OERA 5EYGA 4EDPA 1RYOA 3MP6A 1NV4A 3SEXA 5ET8A 1KA0A 3RLFE 4PDHA 3OO6A 5M2VA 4AS4A 1UTHA 3G3GA 3K1NA 4PE3A 1MPDA 3GXAA 4Q0CA 4MLVA 3SKPA 4MFIA 3SDFA 4GXSB 4DE8A 4WEPA 3TTMA 3N94A 2OZZA 1B3HA 1FTAA 2FNCA 3U72A 5BWJA 4XTCQ 2ZNUA 3DP8A 3OD7A 1WODA 5DVJA 5EHSA 1P99A 3Q26A 2B3BA 3TDJA 4DDDA 2H25A 4E0WA 4N13A 4GBVA 1Q9DA 2XXWA 5IZ3B 2WBDA 3ISPA 1NNFA 3PUYE 2DS9A 3IR1A 4F3PA 2VOZA 4LP2B 1B58A 3KZGA 3TZAA 1ANFA 1M5CA 3H6UA 3RGYA 2DWHA 3U92A 2CZKA 4H67A 1LBVA 4NX1A 1B7HA 1D4NA 4OANA 3KBZA 3H6TA 1B5JA 1BP5A 3BFUA 4QFLA 4TQUQ 3IORA 2B65A 2V3UA 2CZIA 4EUOA 4PFUA 1YCJA 1TFDA 4WKMA 5J1DA 1TWYA 2ZNTA 1PB7A 3O6IA 2DWAA 1FQAA 3PMVA 4GX4A 4H46A 4LN5A 1ZJLA 3SEVA 3OO9A 4PFIA 5DVFA 3G7WA 1YXIA 3IO6A 3P7IA 4IGTA 3UORA 3W15C 5H8HA 3KSJA 5ET6A 4FAJA 3IJXB 2L5VA 2I58A 1Q35A 1JVYA 3PPRA 4RNSA 3GYYA 2GHAA 5KCJB 3MBPA 1URGA 1N04A 2WEFA 4K3FA 4MNCA 1MXZA 4I3EA 2HEUA 4QXDA 4N6DA 1NFTA 2F6PA 3VFJA 4ZEKA 4MIJA 2DYXA 1PC3A 4QFOA 1FTOA 4NF6A 2V3TA 4I9DA 4ZZAA 2RINA 4RK9A 1LAGE 3H03A 5LTCA 2Q2CA 5IZ3A 4FATA 4RY1A 2DP8A 4P11A 4XKNA 5I56A 1GVCA 2FVZA 3E79A 5FHMA 1HSLA 1SW1A 5I2NB 2DOJA 3CIJA 3S9NC 4LUBA 1H43A 3VLWA 4PP0A 2YPNA 5CMCA 2UVIA 1VFEA 2DWIA 3B8BA 3HN0A 3FV2A 1DOTA 4MNIA 3MJNA 5I84A 2FYIA 2Q89A 5F24A 5H8SA 3I6VA 1RDZA 1CB6A 4LVQA 4G61A 4OENA 3E9XA 5KCJA 4PFRA 5CBSA 3C33A 4X1BA 2REGA 3TUSA 4H65A 3K6VA 1DTGA 1DPEA 4Q5TA 2Z8EA 1EYIA 3T96B 3TTLA 3O28A 2Q74A 5LDZA 4KFQA 3VDFA 3I5OA 4NAPA 3O6GA 2ESNA 3IK6B 3VXBA 4GBWA 3B6QA 1S7YA 4PETA 1ELJA 1FQEA 1LFIA 3ZSFA 4YB6A 4LZ7A 4ELQA 3C35A 1FSAA 2R8TA 1B3FA 4M4GA 2HZLA 1URDA 2Q9TA 1FBCA 4JVDA 1SI0A 1IMAA 1EZOA 4N17A 1XOCA 1FTMA 1LGBC 4HW8A 2VHAA 3MPLA 1QGXA 1RYXA 4GL0A 4F29A 1SQYA 4OVSA 1VSOA 5ISUA 1QKAA 2YLNA 3V5AA 2QS3A 3MAMA 3RT8A 3E78A 1OQHA 3IB1A 4IGRA 3KFMA 3B7DA 3CFZA 1PEBA 4UA8A 3KBRA 3PTYA 4KCCA 3TQWA 5IZZA 1NMUA 5I57B 2DWJA 3OEKA 1IEJA 2QS2A 3HV1A 3MW0A 3K6XA 4NWDA 1B05A 5L8DA 4MX6A 3MVWA 3RTFB 4H8JA 3N5LA 2IEEA 2ONKE 1D9YA 4NE4A 4IB2A 4OMBA 2XX7A 3TFLA 1MY4A 2PMSA 2PVUA 2DE4A 3JYRA 3GBBA 4LZ8A 4NF8A 3QMFA 4XKRA 5DW8A 2XXTA 2Q2AA 1LBYA 3T1BA 3EHTA 4OXVA 4IO6A 5AE4A 5I57A 1FCKA 4IO7A 2PT1A 1Y4CA 3THIA 2OJTA 2ANJA 2HAVA 4PBQA 1KA1A 1DSNA 1PBPA 3T9UA 4U4XA 4ONYA 3G3HA 5CI5A 3NOHA 3TELA 3A09A 1N7XA 3HHFA 1INPA 1D9QA 2XD3A 4RA1A 3IFCA 4TLLB 4NF0A 2X26A 4OEUA 3HPIA 3TTRA 2I48A 4ZE8A 4ZEIA 4O7MA 1FBPA 4GWSA 3IX1A 2FIEA 5HPQA 1EZPA 4F19A 3K1MA 3S4UA 1M5EA 1MXWA 2VD3A 2AL4A 1LEVA 1MQJA 3O9PA 3LUZA 4P1EA 2H9BA 4I1DA 4R75A 1B51A 1YPNA 3KC0A 3A29A 3SZPA 3PD8A 3UIFA 5L9SA 3Q28A 4OFOA 3WAFA 5ITPA 3RT6B 2HCAA 1ZTYA 4FBPA 1MQHA 5I56B 4HS7A 4U22A 1FPLA 3KN7A 1RDXA 3UK4A 2QS1A 3RPLB 1PB8A 2I3VA 1EYJA 1SW5A 1A7LA 4QFNA 3C4MA 1FBHA 4R6KA 4KI0E 1R9LA 1MY3A 4P1LA 3SEYA 2OWZA 5ICTA 3KOSA 1FPGA 4NEDA 5H8QA 2G29A 3IO4A 3T0JA 3I3VA 3OO7A 5B70A 3FVNA 1LBXA 3GLBA 5ITOA 4BDQA 2CZHA 2X7QA 4Q30B 1AOVA 4NHBA 2Y84A 3CG3A 3MPKA 1I69A 1POTA 2WKYA 1US5A 4ECFA 2OWTA 1TT1A 2WX9A 4MEVA 5TPAB 1NV6A 1OMPA 4G8HA 3Q25A 3QYTA 4EQ9A 5IKBA 1MS7A 1OVBA 2FIXA 2H5YA 1EYKA 5ET7A 4DI3D 1MXUA 1USYE 2P1SA 4ELOA 4F18A 2OWSA 3T9XB 5F7VA 3R7XA 3PUWE 2XXHA 1P1WA 1LBCA 4GF8A 4IO5A 4GWUA 1IMCA 1JNFA 4YB7A 2FBPA 4G68C 1SDXA 4HCYA 4DLDA 2CEYA 5H8NA 1FPDA 2V93A 2O84X 3RY3A 5EYFA 1IMBA 2QMXA 3H4ZA 2UYFA 4GRKA 4P3LA 1H3DA 1ZKBA 3MZ1A 1B46A 3MWBA 3BFTA 3TTKA 3USDA 5KZTA 3ECRA 4PE5B 3QUJA 3WAEA 3FD3A 4N4UA 5J16A 1JVXA 2PCRA 4U2RA 4KYSA 4HE2A 1DMBA 4JDFA 4NF6B 3GZGA 1ZBMA 2O51A 2GHBA 3CSGA 3R26A 1KZ8A 2QSXA 3CFXA 2I4BA 1XS5A 3L6HA 2V84A 4BDOA 1NV0A 4G77A 1JW4A 2I49A 5CMMA 2ZYMA 3PPPA 1DBZA 2Y7WA 2NWJA 5CRYA 4X8RA 1NV5A 2H4IA 2UVHA 2KR0A 4ZECA 2XX8A 3T22A 2Z22A 2WYKA 2ONRA 4YKPA 4GFRA 5BUUA 3UA8A 3BIHA 1VR5A 5H8HB 3UGWA 4JWOA 4HXVA 3E3KA 1A99A 4Q8RA 4AQ4A 4X48A 3FJ7A 1MPCA 1MRPA 4PFWA 2PBWA 1QW0A 2ZZXA 3PUXE 2BJIA 3FZVA 1M5BA 1B0HA 1B4HA 2XHDA 3EHSA 3C36A 2UXAA 5L9OA 3S9MC 1O64A 2RCAA 4OESA 1LAXA 3IAZA 3F11A 4C1TA 2Y5LA 3EKIA 1Y3QA 4O94A 1AWBA 1SVXB 4TOZA 3RN8A 2REJA 1VE4A 1SI1A 3IFAA 5IAIA 1B40A 1MXXA 4DXBA 4O3CA 5FHNA 4O8MA 1I6AA 2PYYA 2VGQA 3VXCA 3H6VA 3IL1B 4PAFA 1H44A 4N8YA 3N26A 4EF2A 4O3AA 4G2ZA 4OFLA 2QFLA 4PAKA 3H06B 1NUWA 4DCYA 4IY6A 4ZE9A 4F3SA 4ZEDA 3MP8A 4IR8A 4YKJA 2QMWA 3G3JA 4Z7EA 4DZ1A 1N3WA 3O2AA 1Q1KA 3BKIB 4MJOA 4H5FA 2F78A 4LZ5A 3HSTA 3U65A 3QSLA 4F3GA 5EYHA 3SERA 1SD3A 4BDLA 4P8BA 4OVJA 1OLAA 1B7ZA 2XXKA 1MQIA 2KLFA 4RXLA 3RQTA 3TEPA 5T3JA 3U94A 1IIWA 1XI6A 3W9VA 4RK2A 1US4A 2XXRA 4NF5A 2OX3A 3EPEA 4KYEA 3MYUA 3CSBA 5TPAA 3H7MA 1FQCA 4GL8A 3OXNA 1S9TA 3G3FA 3M3KA 1L5TA 5HM4B 1JP4A 4FE8A 1N84A 3UN6A 1HSJA 1QKBA 3DLNA 2HXWA 4DIGA 5DT6A 2O7UA 1N0TA 2F6GA 5ICQA 3VVFA 1LB8A 5EQAA 3MQ9A 3K1PA 4GVOA 4HE0A 3O29A 4PF6A 3PGFA 4DI4B 1FBFA 3RYDA 4JXIA 2NUVA 4OFJA 1GR2A 1B2HA 4G68B 1MY1A 4ELPA 1FQFA 1BLFA 3T93B 2DSFA 4KYDA 4R73A 2P0SA 1IMFA 1B3EA 1MH4A 4PGNA 1ZU0A 3K4UA 4ZDMA 4XKPA 2VT5A 4NMYA 4F31B 4P47A 2Z8FA 5DVIA 4M1VA 4KCDA 3V89B 3O97A 4PQJA 2OLBA 2CZLA 2RCBA 3TTNA 2VD2A 5FTIA 3TAJA 1FBEA 4P0GA 4AB5A 4POXA 3KGCA 2AYSA 1Z7ME 3B6WA 2F3BA 1FW0A 2O1MA 5TU0A 4E0XA 1NV3A 3N6UA 3LV0A 4H1XA 3KJ7A 4FORA 1MY0A 3CI8A 1USYH 4GX6A
chains in the Genus database with same CATH topology
1B51A 4OERA 1YPNA 3O6HA 4WEDA 4F2QA 3VVDA 3PMXA 2Z23A 3SEWA 4EDPA 1RYOA 2RKMA 3MP6A 3SEXA 3PD8A 2D3IA 3RLFE 3MP1A 1EZ9A 1M5DA 5I2KA 3UIFA 4ESWA 3Q28A 4OFOA 3WAFA 5L9SA 5ITPA 3OO6A 1KWHA 5M2VA 2HCAA 3RT6B 1ZTYA 3EHUA 2XXUA 3PUZE 3PUVE 2OBGA 1MQHA 1OVTA 1UTHA 4YKIA 5I56B 3PPQA 3ODBA 4HS7A 3G3GA 1OQGA 4U22A 2H98A 3K1NA 1B1XA 3IJOB 5AA3A 3KN7A 1AIVA 1PB9A 3KEIA 1B0LA 1MPDA 2F97A 1QJMA 3HO7A 3UK4A 5H8FA 2QS1A 3GXAA 1PB8A 4Q0CA 5I58A 2I3VA 2E0SA 1SW5A 1A7LA 2ZNSA 3C4MA 3MVZA 4MLVA 4QFNA 4KI0E 4MFIA 4R6KA 3SKPA 1R9LA 4BDNA 1A54A 4MF3A 4GXSB 3SDFA 3TCGA 3VE1B 2RC9A 1MY3A 2AIXA 4WEPA 3TTMA 3N94A 2OZZA 3SEYA 4DE8A 1MY2A 1B9JA 5ICTA 3K02A 1B3HA 2FNCA 3U72A 5BWJA 3VFJA 3KOSA 1FQBA 2ZNUA 4XTCQ 1UQWA 4NEDA 5H8QA 3DP8A 3E13X 3OD7A 2G29A 3IO4A 1OIBA 4OWDA 4MH5A 3I3VA 3OO7A 1WODA 4NF5B 5DVJA 5B70A 3FVNA 1P99A 3OMBA 4QSCA 4U21A 1ZMGA 2YJPA 3HHGA 3Q26A 2RC7A 1UTBA 2B3BA 3GLBA 3TDJA 4F18A 4DDDA 5ITOA 2H25A 5CMKA 3A3UA 4BDQA 4E0WA 3O66A 2X7QA 1QUJA 1FTLA 4Q30B 4ISUA 2Z8DA 1AOVA 4N13A 4LONB 3ZS6A 2Y84A 4G4PA 5I59A 2Q8JA 4X9TA 3CG3A 2XXWA 4POWA 3KN8A 3MPKA 1I69A 1POTA 2WKYA 1NNFA 1US5A 3PUYE 4F22A 2DS9A 4EXKA 4ECFA 3CFLA 1MDQA 3IR1A 4FECA 4F3PA 2ALUA 2OWTA 2QJEA 5CBRA 3IOUA 1JQFA 1LAHE 1TT1A 2VOZA 4YMAA 4LP2B 1B58A 3KZGA 3MC2A 4R72A 3TZAA 1ANFA 1M5CA 2GFEA 1IXIA 3H6UA 3RGYA 2DWHA 1GGGA 1MQGA 4RJZA 3U92A 3PU5A 4H67A 5TPAB 5JEIA 5JK4A 4YU0A 1OMPA 4G8HA 3Q25A 1H45A 3JZJA 3QYTA 4EQ9A 1MDP1 5IKBA 5JTYA 1MS7A 1B7HA 1OVBA 2H5YA 1D4NA 3L6GA 5EHSA 1JEUA 1MH3A 1FTKA 1MXUA 4DCXA 1USYE 3H6TA 3QXMA 1B5JA 1BP5A 1S50A 2DVCA 2P1SA 3BFUA 3DP4A 3IORA 2OWSA 1CE2A 4FEDA 2B65A 4G8NA 3GBAA 3SEUA 3T9XB 1B3LA 2V3UA 5F7VA 3R7XA 4U1OA 2XXQA 3PUWE 4PFUA 4U1ZA 2XXHA 4C1UA 4EUOA 4JB7A 1P1WA 1ZIUA 3IB0A 1B6HA 1LBCA 1TFDA 1YCJA 4GF8A 4IO5A 1URSA 4WKMA 3VV5A 5J1DA 1TWYA 3UP9A 5JTYB 4AB6A 2I4CA 2ZNTA 1PB7A 2CMOA 3O6IA 2DWAA 2V3QA 1FQAA 1JNFA 3PMVA 4KQPA 4FEBA 4RPNA 3FASA 4G68C 4IY5A 4YB7A 1SDXA 4HCYA 2O1LA 1MM6A 1ZJLA 4DLDA 5A5XB 4PFYA 2RC8A 3SEVA 3OO9A 5H8NA 1SW2A 5DVFA 1IUDA 4OQOA 2V93A 3G7WA 3K6WA 2O84X 3IO6A 3RY3A 5EYFA 2D5WA 2HZKA 3FIRA 4R74A 5ELVA 3P7IA 4IGTA 2QMXA 3H4ZA 3UORA 4OHNA 1A8FA 1JW5A 2UYFA 4N07A 2VP1A 4GRKA 4OZ9A 4LA9A 1H3DA 1ZKBA 3MZ1A 3W15C 4YMBA 3S9EA 1B46A 2RF1A 3MWBA 1XVXA 2I0CA 4OTEA 3K01A 5B7DA 4IO4A 3BFTA 2UVJA 5H8HA 3DP6A 1IQ7A 3DM0A 3U8QA 2F7CA 1NH7A 3KSJA 5TP9B 3TTKA 3USDA 5CC2A 5KZTA 3ECRA 4FAJA 4PE5B 1P1UA 3IJXB 1XVYA 3QUJA 3WAEA 2ZXTA 5CM6A 3FD3A 2I58A 3IB2A 1Q35A 1JVYA 2DXYA 1JVXA 3PPRA 4U2RA 4KYSA 4RNSA 4XXUA 1DMBA 4JDFA 2GHAA 4NF6B 4QFPA 5KCJB 1D9VA 3LSLA 1MM7A 5DYHA 5I2NA 3GZGA 1ZBMA 4FJPA 3MBPA 1IZ1A 2AL5A 2GRVA 3FVKA 1URGA 1B4ZA 2GHBA 2HFBA 1WDNA 1N04A 2O51A 3CSGA 3R26A 4K3FA 3CFXA 2QSXA 5K2XA 2HQ0A 2I4BA 2Y7KA 3FATA 1XS5A 4H6DA 3RPWA 3L6HA 1MXZA 1QULA 2HEUA 2R9JA 3ZKKA 2V84A 1LB9A 1YAEA 3IOWA 4BDOA 3LSXA 1NFTA 3MUQA 4N6PA 2F6PA 1MXVA 1JW4A 2I49A 3FUZA 4G77A 5CMMA 1AL3A 2XX9A 2ZYMA 1FQDA 3FJMA 3PPPA 2H99A 4ZEKA 2Y7WA 3TYHA 2UVGA 4HCWA 2DYXA 2NWJA 4F1VA 1UIUA 4QFKA 5CRYA 4EQBA 1SBPA 1PC3A 5KDTB 2H4IA 4QFOA 5LOMA 4PFTA 2UVHA 4H0WA 4TLMB 4ZECA 2XX8A 3FV1A 3MZ9A 2F7BA 1FTOA 3QK6A 3RUMA 3T22A 4NF6A 2D21A 2V3TA 2Z22A 4IO3A 4I9DA 4ZZAA 2ONRA 3S9LC 2RINA 4YKPA 3QUFA 4RK9A 4GFRA 1LAGE 2LAOA 1A8EA 3H03A 5BUUA 3UA8A 1Y20A 2Q2CA 2W7YA 4R9GA 4RY1A 1VR5A 2DP8A 4P11A 4XKNA 5H8HB 3UGWA 4ZZEA 5I56A 1GVCA 3ILTB 4JWOA 5FHMA 3CRBA 3R6UA 1LSTA 4EF1A 1HSLA 1SW1A 1A99A 1MXYA 3E3KA 3LR1A 4BLAA 4Q8RA 4NTLA 2Y7IA 2DOJA 1O63A 3CIJA 3FGSA 4AQ4A 3S9NC 1JETA 4LUBA 2A5TB 4UACA 4U4SA 5HBCA 3A3CA 1H43A 1UTBB 1XC1A 3D4CA 2PX1A 3PPNA 2YPNA 3FJ7A 1MPCA 3Q29A 1MRPA 4PP0A 5CMCA 3FXQA 2UVIA 4PFWA 4RYAA 1VFEA 2PBWA 2DWIA 1QW0A 4QFLA 3KJTA 3HN0A 3FV2A 1DOTA 1DPPA 3LSWA 3PUXE 3MJNA 3ZKLA 4EXLA 1LFGA 5I84A 3FZVA 2FYIA 2Q89A 5H8SA 1M5BA 3I6VA 1B0HA 4ZS9A 1CB6A 1QVSA 1JEVA 1B4HA 3KG2A 2XHDA 3KOTA 3EHSA 4LVQA 2XXXA 3C36A 1IITA 2UXAA 4MLQA 1QUKA 5L9OA 2NVUB 5I58B 1Y1ZA 1O64A 3C31A 4OENA 3S9MC 2RCAA 3E9XA 3OO8A 4OESA 2F35A 1N76A 5KCJA 1LAXA 4GIZA 5CBSA 3K6UA 5L9MA 3C33A 3IAZA 3F11A 2REGA 4X1BA 4JWXA 1EU8A 2I3WA 1AH5A 4C1TA 5IAIA 3TUSA 1PBQA 4QRZA 1YTVA 4KR5A 4H65A 3CR9A 3K6VA 1Y3QA 1DTGA 1DPEA 4Q5TA 3T9VA 1JW1A 2BJJX 2Z8EA 2NOOA 4YB5A 1FTJA 1SVXB 4GXAA 4TOZA 5FHOA 5H8QB 2DQVA 3RN8A 3RNNA 3T96B 1P1QA 3TTLA 3PD9A 3VLUA 1HSEA 3O28A 5AA4A 2REJA 1P1OA 1VE4A 3EQ1A 4KFQA 1SI1A 3TPAA 3VDFA 3G3KA 3I5OA 4P0IA 1B40A 1MXXA 1LCFA 2ESNA 3O6GA 3FXRA 3IK6B 4DXBA 4O3CA 3TODA 1Z7NE 5FHNA 5AA2A 5K2YA 1I6AA 1B5HA 2PYYA 2VGQA 1LFHA 2R71A 1II5A 3H6VA 4JBZA 3OSQA 4H5GA 3IL1B 3VXBA 3VXCA 4YZZA 4YAHX 5H8NB 3B6QA 1H44A 1S7YA 4YICA 3IOTA 4O3BA 4KHZE 4XIGQ 3OENA 3N26A 1ELJA 1FQEA 1POY1 3K2DA 4PETA 4EF2A 4O3AA 2A5TA 1B3GA 3PPOA 4OETA 2R6GE 4G2ZA 4WXJA 3N6TA 3VVEA 1AMFA 1LFIA 3TKDA 3ZSFA 2GH9A 3E4RA 4OFLA 4OYVA 3B6TA 3QIMA 4YB6A 2E1SA 1Y4TA 2O68A 4LZ7A 4ELQA 2O7IA 2V25A 3C35A 3H06B 4I62A 3W9WA 1B3FA 5CMBA 4M4GA 4DCYA 1A55A 2HZLA 4IY6A 3EN3A 5H8FB 1URDA 4ZE9A 3T9HB 4ZEBA 4F3SA 4ZEDA 3MP8A 4YKJA 1J1NA 2Q9TA 3AXFA 3M3LA 1SI0A 4F1YA 2F8DA 2P2AA 1EZOA 3S4UA 1UTHB 2QMWA 1XOCA 2Q88A 5DEXB 1FTMA 1LGBC 1WVJA 3G3JA 4DZ1A 4Z7EA 5KDTA 1N3WA 1Y3PA 3O2AA 3SESA 2O6AA 1Q1KA 3BKIB 1B5IA 2IA4A 4H5FA 2F78A 4LATA 4HW8A 1O7TA 2VHAA 3HSTA 3MPLA 4LZ5A 1RYXA 3BBRA 3QSLA 4GL0A 3U1OA 5AA2D 3HCQA 3KN3A 4F29A 1SQYA 1LCTA 5FTHA 1VSOA 2ZYOA 4F3GA 4DXUA 3LC8A 3FVGA 1SW4A 3FXUA 2THIA 4JSDA 4QSDA 5ISUA 3LUYA 1QKAA 4X48A 1SYHA 4XKQA 3DELB 2X7PA 2ZYKA 3MVYA 3SERA 4BDRA 1SD3A 2YLNA 5A5XA 4GD5A 4ND9A 4NF4B 2QS3A 2F36A 3V5AA 4BDLA 4R2BA 2DE3A 3SETA 4ESXA 1SYIA 1B7UA 1OLAA 4OVJA 3MAMA 1B7ZA 3RT8A 3ILUB 4G68A 1MQIA 1OQHA 2KLFA 3IB1A 4IGRA 4RXLA 4IO2A 3KSXA 1MPBA 3RQTA 3TEPA 1Y3NA 3KFMA 1PDAA 3OSRA 3U94A 1IIWA 3W9VA 4RK2A 2B3FA 2UYEA 3B7DA 3CFZA 4NWCA 1PEBA 4UA8A 1XT8A 1US4A 4TQUQ 4L17A 3JV9A 2XXRA 3KBRA 4KCCA 4NF5A 3TQWA 4C0RA 2XXVA 3RTWB 1NMUA 5I57B 3EPEA 2DWJA 2NXOA 4KYEA 1N7WA 1BIYA 3OEKA 2F7AA 1IEJA 2QS2A 3EF7A 4NF8B 3CSBA 3HV1A 2Y7PA 1QUIA 5TPAA 3H7MA 1FQCA 2F5XA 4GL8A 5I2KB 2HAUA 4FIMA 3MW0A 3OXNA 1S9TA 3K6XA 4NWDA 1EH3A 3M8UA 4GQOA 4KD5A 5DTBA 5AA4B 2ONSA 1B05A 3G3FA 4U23A 5L8DA 2G93A 3CVGA 3D4GA 3MVWA 1R9QA 5DEXA 3M3KA 3RTFB 4H8JA 3K0VA 1OLCA 3VLVA 3N5LA 1NL5A 2IEEA 2ONKE 1D9YA 4NE4A 3T66A 1F9BA 1XHYA 4F3BA 1L5TA 4IB2A 4OMBA 2I0BA 1TFAA 5HM4B 4FE8A 4HTGA 1N84A 2XX7A 4R6HA 3UN6A 3TFLA 1HSJA 1MY4A 1QKBA 3DLNA 2HXWA 2A5SA 1GV8A 4DIGA 5DT6A 2O7UA 3OOAA 1D3KA 2PMSA 1MG1A 2PVUA 1N0TA 2F6GA 5ICQA 1B52A 2FA7A 2DE4A 3JYRA 2ZMBA 3GBBA 4I8CA 3MVXA 3VVFA 2M8CA 1LB8A 2DVZA 3MZBA 3H6WA 4LZ8A 3MQ9A 4LQ5A 2OCUA 3K1PA 4NF8A 4GVOA 3O29A 2XXPA 1UIVA 1M5FA 5I59B 1R6ZA 4XKRA 2Y7RA 3PGFA 2XD2A 4GOTA 4R2FA 5I2NB 4G8MA 2XXTA 4GWOA 4JXIA 3FVOA 2NUVA 1BTJA 5EHMA 3TQLA 2Q2AA 4OFJA 1ATGA 1IXGA 1B2HA 1GR2A 3PV0E 4QF9A 4THIA 2OK2A 3EHTA 3H3GA 4G68B 4LQ2A 1MY1A 4OXVA 4IO6A 4QSEA 4YKKA 4ELPA 5AE4A 5I57A 1T0KA 1FCKA 4IO7A 4X1DA 1FQFA 1BLFA 3Q27A 2PT1A 1Y4CA 2DXRA 2OJTA 1MQDA 2ANJA 2QS4A 3T93B 3THIA 2HAVA 3C32A 2DSFA 5AA1A 4KYDA 3V83A 1R1NA 1VFDA 4OEVA 1DSNA 1IXCA 1PBPA 3C9HA 3T9UA 4U4XA 4R73A 2P0SA 4ONYA 3OEMA 3G3HA 5CI5A 1DTZA 1B3EA 2F34A 2ZYNA 3TELA 1I6QA 3A09A 1MH4A 4EQ7A 1H76A 1ZU0A 1N7XA 3K4UA 3HHFA 4ZDMA 1N3XA 2PT2A 1NKXA 2QRYA 2XXYA 4DXCA 3K00A 1RKMA 2QPQA 3C34A 4XKPA 2XD3A 3LSFB 2I6EA 1BKAA 4RA1A 4TLLB 1NNKA 4NMYA 4MBPA 2X26A 3OELA 4OEUA 4F31B 1ZLQA 2Z8FA 2ABHA 5DVIA 2XXIA 4M1VA 2O69A 5AA2B 3ONMA 3HPIA 1B32A 3IOVA 4Z0IA 2I48A 4KCDA 4R6YA 3TTRA 3V89B 3O97A 3FJGA 4PQJA 3CG1A 3S2VA 1LLSA 2OLBA 2CZLA 2RCBA 4ZEIA 4ZE8A 3V8XB 5F1QA 4ELRA 1GTKA 3TTNA 1IXHA 3IX1A 1I6BA 4F39A 2DE2A 4NF4A 5HPQA 4JSOA 2VD2A 1EZPA 2QL3A 3PMWA 5FTIA 3TCFA 4F2OA 3TAJA 1NNPA 4BDMA 1NH8A 4R9FA 4P0GA 4AB5A 4POXA 4F19A 3K1MA 3KGCA 4JWYA 1P1NA 2AYSA 1M5EA 1MXWA 2VD3A 1NNTA 1Z7ME 3B6WA 3QAXA 2AL4A 4H8IA 1LBBA 4QHQA 1FW0A 2O1MA 5TU0A 4E0XA 5TP9A 4ZEFA 3N6UA 4GLIA 1MQJA 3TCHA 3TMGA 1Y1MA 4ELOA 3U93A 3G3IA 3O9PA 4KPTA 4RPOA 1B1HA 4H1XA 3M3FA 3KJ7A 4FATA 1A40A 1LAFE 4FORA 2H9BA 1MY0A 3CI8A 1Y9UA 1USYH 4I1DA 4F1UA 3VLWA 3LBSA 1TXFA 4R75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B51 A;  4OER A;  1YPN A;  3O6H A;  4WED A;  4F2Q A;  3VVD A;  3PMX A;  2Z23 A;  3SEW A;  4EDP A;  1RYO A;  2RKM A;  3MP6 A;  3SEX A;  3PD8 A;  2D3I A;  3RLF E;  3MP1 A;  1EZ9 A;  1M5D A;  5I2K A;  3UIF A;  4ESW A;  3Q28 A;  4OFO A;  3WAF A;  5L9S A;  5ITP A;  3OO6 A;  1KWH A;  5M2V A;  2HCA A;  3RT6 B;  1ZTY A;  3EHU A;  2XXU A;  3PUZ E;  3PUV E;  2OBG A;  1MQH A;  1OVT A;  1UTH A;  4YKI A;  5I56 B;  3PPQ A;  3ODB A;  4HS7 A;  3G3G A;  1OQG A;  4U22 A;  2H98 A;  3K1N A;  1B1X A;  3IJO B;  5AA3 A;  3KN7 A;  1AIV A;  1PB9 A;  3KEI A;  1B0L A;  1MPD A;  2F97 A;  1QJM A;  3HO7 A;  3UK4 A;  5H8F A;  2QS1 A;  3GXA A;  1PB8 A;  4Q0C A;  5I58 A;  2I3V A;  2E0S A;  1SW5 A;  1A7L A;  2ZNS A;  3C4M A;  3MVZ A;  4MLV A;  4QFN A;  4KI0 E;  4MFI A;  4R6K A;  3SKP A;  1R9L A;  4BDN A;  1A54 A;  4MF3 A;  4GXS B;  3SDF A;  3TCG A;  3VE1 B;  2RC9 A;  1MY3 A;  2AIX A;  4WEP A;  3TTM A;  3N94 A;  2OZZ A;  3SEY A;  4DE8 A;  1MY2 A;  1B9J A;  5ICT A;  3K02 A;  1B3H A;  2FNC A;  3U72 A;  5BWJ A;  3VFJ A;  3KOS A;  1FQB A;  2ZNU A;  4XTC Q;  1UQW A;  4NED A;  5H8Q A;  3DP8 A;  3E13 X;  3OD7 A;  2G29 A;  3IO4 A;  1OIB A;  4OWD A;  4MH5 A;  3I3V A;  3OO7 A;  1WOD A;  4NF5 B;  5DVJ A;  5B70 A;  3FVN A;  1P99 A;  3OMB A;  4QSC A;  4U21 A;  1ZMG A;  2YJP A;  3HHG A;  3Q26 A;  2RC7 A;  1UTB A;  2B3B A;  3GLB A;  3TDJ A;  4F18 A;  4DDD A;  5ITO A;  2H25 A;  5CMK A;  3A3U A;  4BDQ A;  4E0W A;  3O66 A;  2X7Q A;  1QUJ A;  1FTL A;  4Q30 B;  4ISU A;  2Z8D A;  1AOV A;  4N13 A;  4LON B;  3ZS6 A;  2Y84 A;  4G4P A;  5I59 A;  2Q8J A;  4X9T A;  3CG3 A;  2XXW A;  4POW A;  3KN8 A;  3MPK A;  1I69 A;  1POT A;  2WKY A;  1NNF A;  1US5 A;  3PUY E;  4F22 A;  2DS9 A;  4EXK A;  4ECF A;  3CFL A;  1MDQ A;  3IR1 A;  4FEC A;  4F3P A;  2ALU A;  2OWT A;  2QJE A;  5CBR A;  3IOU A;  1JQF A;  1LAH E;  1TT1 A;  2VOZ A;  4YMA A;  4LP2 B;  1B58 A;  3KZG A;  3MC2 A;  4R72 A;  3TZA A;  1ANF A;  1M5C A;  2GFE A;  1IXI A;  3H6U A;  3RGY A;  2DWH A;  1GGG A;  1MQG A;  4RJZ A;  3U92 A;  3PU5 A;  4H67 A;  5TPA B;  5JEI A;  5JK4 A;  4YU0 A;  1OMP A;  4G8H A;  3Q25 A;  1H45 A;  3JZJ A;  3QYT A;  4EQ9 A;  1MDP 1;  5IKB A;  5JTY A;  1MS7 A;  1B7H A;  1OVB A;  2H5Y A;  1D4N A;  3L6G A;  5EHS A;  1JEU A;  1MH3 A;  1FTK A;  1MXU A;  4DCX A;  1USY E;  3H6T A;  3QXM A;  1B5J A;  1BP5 A;  1S50 A;  2DVC A;  2P1S A;  3BFU A;  3DP4 A;  3IOR A;  2OWS A;  1CE2 A;  4FED A;  2B65 A;  4G8N A;  3GBA A;  3SEU A;  3T9X B;  1B3L A;  2V3U A;  5F7V A;  3R7X A;  4U1O A;  2XXQ A;  3PUW E;  4PFU A;  4U1Z A;  2XXH A;  4C1U A;  4EUO A;  4JB7 A;  1P1W A;  1ZIU A;  3IB0 A;  1B6H A;  1LBC A;  1TFD A;  1YCJ A;  4GF8 A;  4IO5 A;  1URS A;  4WKM A;  3VV5 A;  5J1D A;  1TWY A;  3UP9 A;  5JTY B;  4AB6 A;  2I4C A;  2ZNT A;  1PB7 A;  2CMO A;  3O6I A;  2DWA A;  2V3Q A;  1FQA A;  1JNF A;  3PMV A;  4KQP A;  4FEB A;  4RPN A;  3FAS A;  4G68 C;  4IY5 A;  4YB7 A;  1SDX A;  4HCY A;  2O1L A;  1MM6 A;  1ZJL A;  4DLD A;  5A5X B;  4PFY A;  2RC8 A;  3SEV A;  3OO9 A;  5H8N A;  1SW2 A;  5DVF A;  1IUD A;  4OQO A;  2V93 A;  3G7W A;  3K6W A;  2O84 X;  3IO6 A;  3RY3 A;  5EYF A;  2D5W A;  2HZK A;  3FIR A;  4R74 A;  5ELV A;  3P7I A;  4IGT A;  2QMX A;  3H4Z A;  3UOR A;  4OHN A;  1A8F A;  1JW5 A;  2UYF A;  4N07 A;  2VP1 A;  4GRK A;  4OZ9 A;  4LA9 A;  1H3D A;  1ZKB A;  3MZ1 A;  3W15 C;  4YMB A;  3S9E A;  1B46 A;  2RF1 A;  3MWB A;  1XVX A;  2I0C A;  4OTE A;  3K01 A;  5B7D A;  4IO4 A;  3BFT A;  2UVJ A;  5H8H A;  3DP6 A;  1IQ7 A;  3DM0 A;  3U8Q A;  2F7C A;  1NH7 A;  3KSJ A;  5TP9 B;  3TTK A;  3USD A;  5CC2 A;  5KZT A;  3ECR A;  4FAJ A;  4PE5 B;  1P1U A;  3IJX B;  1XVY A;  3QUJ A;  3WAE A;  2ZXT A;  5CM6 A;  3FD3 A;  2I58 A;  3IB2 A;  1Q35 A;  1JVY A;  2DXY A;  1JVX A;  3PPR A;  4U2R A;  4KYS A;  4RNS A;  4XXU A;  1DMB A;  4JDF A;  2GHA A;  4NF6 B;  4QFP A;  5KCJ B;  1D9V A;  3LSL A;  1MM7 A;  5DYH A;  5I2N A;  3GZG A;  1ZBM A;  4FJP A;  3MBP A;  1IZ1 A;  2AL5 A;  2GRV A;  3FVK A;  1URG A;  1B4Z A;  2GHB A;  2HFB A;  1WDN A;  1N04 A;  2O51 A;  3CSG A;  3R26 A;  4K3F A;  3CFX A;  2QSX A;  5K2X A;  2HQ0 A;  2I4B A;  2Y7K A;  3FAT A;  1XS5 A;  4H6D A;  3RPW A;  3L6H A;  1MXZ A;  1QUL A;  2HEU A;  2R9J A;  3ZKK A;  2V84 A;  1LB9 A;  1YAE A;  3IOW A;  4BDO A;  3LSX A;  1NFT A;  3MUQ A;  4N6P A;  2F6P A;  1MXV A;  1JW4 A;  2I49 A;  3FUZ A;  4G77 A;  5CMM A;  1AL3 A;  2XX9 A;  2ZYM A;  1FQD A;  3FJM A;  3PPP A;  2H99 A;  4ZEK A;  2Y7W A;  3TYH A;  2UVG A;  4HCW A;  2DYX A;  2NWJ A;  4F1V A;  1UIU A;  4QFK A;  5CRY A;  4EQB A;  1SBP A;  1PC3 A;  5KDT B;  2H4I A;  4QFO A;  5LOM A;  4PFT A;  2UVH A;  4H0W A;  4TLM B;  4ZEC A;  2XX8 A;  3FV1 A;  3MZ9 A;  2F7B A;  1FTO A;  3QK6 A;  3RUM A;  3T22 A;  4NF6 A;  2D21 A;  2V3T A;  2Z22 A;  4IO3 A;  4I9D A;  4ZZA A;  2ONR A;  3S9L C;  2RIN A;  4YKP A;  3QUF A;  4RK9 A;  4GFR A;  1LAG E;  2LAO A;  1A8E A;  3H03 A;  5BUU A;  3UA8 A;  1Y20 A;  2Q2C A;  2W7Y A;  4R9G A;  4RY1 A;  1VR5 A;  2DP8 A;  4P11 A;  4XKN A;  5H8H B;  3UGW A;  4ZZE A;  5I56 A;  1GVC A;  3ILT B;  4JWO A;  5FHM A;  3CRB A;  3R6U A;  1LST A;  4EF1 A;  1HSL A;  1SW1 A;  1A99 A;  1MXY A;  3E3K A;  3LR1 A;  4BLA A;  4Q8R A;  4NTL A;  2Y7I A;  2DOJ A;  1O63 A;  3CIJ A;  3FGS A;  4AQ4 A;  3S9N C;  1JET A;  4LUB A;  2A5T B;  4UAC A;  4U4S A;  5HBC A;  3A3C A;  1H43 A;  1UTB B;  1XC1 A;  3D4C A;  2PX1 A;  3PPN A;  2YPN A;  3FJ7 A;  1MPC A;  3Q29 A;  1MRP A;  4PP0 A;  5CMC A;  3FXQ A;  2UVI A;  4PFW A;  4RYA A;  1VFE A;  2PBW A;  2DWI A;  1QW0 A;  4QFL A;  3KJT A;  3HN0 A;  3FV2 A;  1DOT A;  1DPP A;  3LSW A;  3PUX E;  3MJN A;  3ZKL A;  4EXL A;  1LFG A;  5I84 A;  3FZV A;  2FYI A;  2Q89 A;  5H8S A;  1M5B A;  3I6V A;  1B0H A;  4ZS9 A;  1CB6 A;  1QVS A;  1JEV A;  1B4H A;  3KG2 A;  2XHD A;  3KOT A;  3EHS A;  4LVQ A;  2XXX A;  3C36 A;  1IIT A;  2UXA A;  4MLQ A;  1QUK A;  5L9O A;  2NVU B;  5I58 B;  1Y1Z A;  1O64 A;  3C31 A;  4OEN A;  3S9M C;  2RCA A;  3E9X A;  3OO8 A;  4OES A;  2F35 A;  1N76 A;  5KCJ A;  1LAX A;  4GIZ A;  5CBS A;  3K6U A;  5L9M A;  3C33 A;  3IAZ A;  3F11 A;  2REG A;  4X1B A;  4JWX A;  1EU8 A;  2I3W A;  1AH5 A;  4C1T A;  5IAI A;  3TUS A;  1PBQ A;  4QRZ A;  1YTV A;  4KR5 A;  4H65 A;  3CR9 A;  3K6V A;  1Y3Q A;  1DTG A;  1DPE A;  4Q5T A;  3T9V A;  1JW1 A;  2BJJ X;  2Z8E A;  2NOO A;  4YB5 A;  1FTJ A;  1SVX B;  4GXA A;  4TOZ A;  5FHO A;  5H8Q B;  2DQV A;  3RN8 A;  3RNN A;  3T96 B;  1P1Q A;  3TTL A;  3PD9 A;  3VLU A;  1HSE A;  3O28 A;  5AA4 A;  2REJ A;  1P1O A;  1VE4 A;  3EQ1 A;  4KFQ A;  1SI1 A;  3TPA A;  3VDF A;  3G3K A;  3I5O A;  4P0I A;  1B40 A;  1MXX A;  1LCF A;  2ESN A;  3O6G A;  3FXR A;  3IK6 B;  4DXB A;  4O3C A;  3TOD A;  1Z7N E;  5FHN A;  5AA2 A;  5K2Y A;  1I6A A;  1B5H A;  2PYY A;  2VGQ A;  1LFH A;  2R71 A;  1II5 A;  3H6V A;  4JBZ A;  3OSQ A;  4H5G A;  3IL1 B;  3VXB A;  3VXC A;  4YZZ A;  4YAH X;  5H8N B;  3B6Q A;  1H44 A;  1S7Y A;  4YIC A;  3IOT A;  4O3B A;  4KHZ E;  4XIG Q;  3OEN A;  3N26 A;  1ELJ A;  1FQE A;  1POY 1;  3K2D A;  4PET A;  4EF2 A;  4O3A A;  2A5T A;  1B3G A;  3PPO A;  4OET A;  2R6G E;  4G2Z A;  4WXJ A;  3N6T A;  3VVE A;  1AMF A;  1LFI A;  3TKD A;  3ZSF A;  2GH9 A;  3E4R A;  4OFL A;  4OYV A;  3B6T A;  3QIM A;  4YB6 A;  2E1S A;  1Y4T A;  2O68 A;  4LZ7 A;  4ELQ A;  2O7I A;  2V25 A;  3C35 A;  3H06 B;  4I62 A;  3W9W A;  1B3F A;  5CMB A;  4M4G A;  4DCY A;  1A55 A;  2HZL A;  4IY6 A;  3EN3 A;  5H8F B;  1URD A;  4ZE9 A;  3T9H B;  4ZEB A;  4F3S A;  4ZED A;  3MP8 A;  4YKJ A;  1J1N A;  2Q9T A;  3AXF A;  3M3L A;  1SI0 A;  4F1Y A;  2F8D A;  2P2A A;  1EZO A;  3S4U A;  1UTH B;  2QMW A;  1XOC A;  2Q88 A;  5DEX B;  1FTM A;  1LGB C;  1WVJ A;  3G3J A;  4DZ1 A;  4Z7E A;  5KDT A;  1N3W A;  1Y3P A;  3O2A A;  3SES A;  2O6A A;  1Q1K A;  3BKI B;  1B5I A;  2IA4 A;  4H5F A;  2F78 A;  4LAT A;  4HW8 A;  1O7T A;  2VHA A;  3HST A;  3MPL A;  4LZ5 A;  1RYX A;  3BBR A;  3QSL A;  4GL0 A;  3U1O A;  5AA2 D;  3HCQ A;  3KN3 A;  4F29 A;  1SQY A;  1LCT A;  5FTH A;  1VSO A;  2ZYO A;  4F3G A;  4DXU A;  3LC8 A;  3FVG A;  1SW4 A;  3FXU A;  2THI A;  4JSD A;  4QSD A;  5ISU A;  3LUY A;  1QKA A;  4X48 A;  1SYH A;  4XKQ A;  3DEL B;  2X7P A;  2ZYK A;  3MVY A;  3SER A;  4BDR A;  1SD3 A;  2YLN A;  5A5X A;  4GD5 A;  4ND9 A;  4NF4 B;  2QS3 A;  2F36 A;  3V5A A;  4BDL A;  4R2B A;  2DE3 A;  3SET A;  4ESX A;  1SYI A;  1B7U A;  1OLA A;  4OVJ A;  3MAM A;  1B7Z A;  3RT8 A;  3ILU B;  4G68 A;  1MQI A;  1OQH A;  2KLF A;  3IB1 A;  4IGR A;  4RXL A;  4IO2 A;  3KSX A;  1MPB A;  3RQT A;  3TEP A;  1Y3N A;  3KFM A;  1PDA A;  3OSR A;  3U94 A;  1IIW A;  3W9V A;  4RK2 A;  2B3F A;  2UYE A;  3B7D A;  3CFZ A;  4NWC A;  1PEB A;  4UA8 A;  1XT8 A;  1US4 A;  4TQU Q;  4L17 A;  3JV9 A;  2XXR A;  3KBR A;  4KCC A;  4NF5 A;  3TQW A;  4C0R A;  2XXV A;  3RTW B;  1NMU A;  5I57 B;  3EPE A;  2DWJ A;  2NXO A;  4KYE A;  1N7W A;  1BIY A;  3OEK A;  2F7A A;  1IEJ A;  2QS2 A;  3EF7 A;  4NF8 B;  3CSB A;  3HV1 A;  2Y7P A;  1QUI A;  5TPA A;  3H7M A;  1FQC A;  2F5X A;  4GL8 A;  5I2K B;  2HAU A;  4FIM A;  3MW0 A;  3OXN A;  1S9T A;  3K6X A;  4NWD A;  1EH3 A;  3M8U A;  4GQO A;  4KD5 A;  5DTB A;  5AA4 B;  2ONS A;  1B05 A;  3G3F A;  4U23 A;  5L8D A;  2G93 A;  3CVG A;  3D4G A;  3MVW A;  1R9Q A;  5DEX A;  3M3K A;  3RTF B;  4H8J A;  3K0V A;  1OLC A;  3VLV A;  3N5L A;  1NL5 A;  2IEE A;  2ONK E;  1D9Y A;  4NE4 A;  3T66 A;  1F9B A;  1XHY A;  4F3B A;  1L5T A;  4IB2 A;  4OMB A;  2I0B A;  1TFA A;  5HM4 B;  4FE8 A;  4HTG A;  1N84 A;  2XX7 A;  4R6H A;  3UN6 A;  3TFL A;  1HSJ A;  1MY4 A;  1QKB A;  3DLN A;  2HXW A;  2A5S A;  1GV8 A;  4DIG A;  5DT6 A;  2O7U A;  3OOA A;  1D3K A;  2PMS A;  1MG1 A;  2PVU A;  1N0T A;  2F6G A;  5ICQ A;  1B52 A;  2FA7 A;  2DE4 A;  3JYR A;  2ZMB A;  3GBB A;  4I8C A;  3MVX A;  3VVF A;  2M8C A;  1LB8 A;  2DVZ A;  3MZB A;  3H6W A;  4LZ8 A;  3MQ9 A;  4LQ5 A;  2OCU A;  3K1P A;  4NF8 A;  4GVO A;  3O29 A;  2XXP A;  1UIV A;  1M5F A;  5I59 B;  1R6Z A;  4XKR A;  2Y7R A;  3PGF A;  2XD2 A;  4GOT A;  4R2F A;  5I2N B;  4G8M A;  2XXT A;  4GWO A;  4JXI A;  3FVO A;  2NUV A;  1BTJ A;  5EHM A;  3TQL A;  2Q2A A;  4OFJ A;  1ATG A;  1IXG A;  1B2H A;  1GR2 A;  3PV0 E;  4QF9 A;  4THI A;  2OK2 A;  3EHT A;  3H3G A;  4G68 B;  4LQ2 A;  1MY1 A;  4OXV A;  4IO6 A;  4QSE A;  4YKK A;  4ELP A;  5AE4 A;  5I57 A;  1T0K A;  1FCK A;  4IO7 A;  4X1D A;  1FQF A;  1BLF A;  3Q27 A;  2PT1 A;  1Y4C A;  2DXR A;  2OJT A;  1MQD A;  2ANJ A;  2QS4 A;  3T93 B;  3THI A;  2HAV A;  3C32 A;  2DSF A;  5AA1 A;  4KYD A;  3V83 A;  1R1N A;  1VFD A;  4OEV A;  1DSN A;  1IXC A;  1PBP A;  3C9H A;  3T9U A;  4U4X A;  4R73 A;  2P0S A;  4ONY A;  3OEM A;  3G3H A;  5CI5 A;  1DTZ A;  1B3E A;  2F34 A;  2ZYN A;  3TEL A;  1I6Q A;  3A09 A;  1MH4 A;  4EQ7 A;  1H76 A;  1ZU0 A;  1N7X A;  3K4U A;  3HHF A;  4ZDM A;  1N3X A;  2PT2 A;  1NKX A;  2QRY A;  2XXY A;  4DXC A;  3K00 A;  1RKM A;  2QPQ A;  3C34 A;  4XKP A;  2XD3 A;  3LSF B;  2I6E A;  1BKA A;  4RA1 A;  4TLL B;  1NNK A;  4NMY A;  4MBP A;  2X26 A;  3OEL A;  4OEU A;  4F31 B;  1ZLQ A;  2Z8F A;  2ABH A;  5DVI A;  2XXI A;  4M1V A;  2O69 A;  5AA2 B;  3ONM A;  3HPI A;  1B32 A;  3IOV A;  4Z0I A;  2I48 A;  4KCD A;  4R6Y A;  3TTR A;  3V89 B;  3O97 A;  3FJG A;  4PQJ A;  3CG1 A;  3S2V A;  1LLS A;  2OLB A;  2CZL A;  2RCB A;  4ZEI A;  4ZE8 A;  3V8X B;  5F1Q A;  4ELR A;  1GTK A;  3TTN A;  1IXH A;  3IX1 A;  1I6B A;  4F39 A;  2DE2 A;  4NF4 A;  5HPQ A;  4JSO A;  2VD2 A;  1EZP A;  2QL3 A;  3PMW A;  5FTI A;  3TCF A;  4F2O A;  3TAJ A;  1NNP A;  4BDM A;  1NH8 A;  4R9F A;  4P0G A;  4AB5 A;  4POX A;  4F19 A;  3K1M A;  3KGC A;  4JWY A;  1P1N A;  2AYS A;  1M5E A;  1MXW A;  2VD3 A;  1NNT A;  1Z7M E;  3B6W A;  3QAX A;  2AL4 A;  4H8I A;  1LBB A;  4QHQ A;  1FW0 A;  2O1M A;  5TU0 A;  4E0X A;  5TP9 A;  4ZEF A;  3N6U A;  4GLI A;  1MQJ A;  3TCH A;  3TMG A;  1Y1M A;  4ELO A;  3U93 A;  3G3I A;  3O9P A;  4KPT A;  4RPO A;  1B1H A;  4H1X A;  3M3F A;  3KJ7 A;  4FAT A;  1A40 A;  1LAF E;  4FOR A;  2H9B A;  1MY0 A;  3CI8 A;  1Y9U A;  1USY H;  4I1D A;  4F1U A;  3VLW A;  3LBS A;  1TXF A;  4R75 A; 
#chains in the Genus database with same CATH topology
 4F2Q A;  4I40 A;  3SEW A;  4PC9 A;  3MP1 A;  1EZ9 A;  1M5D A;  4NQ8 A;  3EHU A;  2XXU A;  3PUZ E;  1OVT A;  4YKI A;  3ODB A;  4GWY A;  2H98 A;  3IJO B;  1AIV A;  1PB9 A;  1B0L A;  2F97 A;  3HO7 A;  5I58 A;  2E0S A;  2ZNS A;  4BDN A;  4MF3 A;  3TCG A;  2P3N A;  3K02 A;  1FQB A;  3E13 X;  2WBB A;  1OIB A;  4OWD A;  4MH5 A;  4QSC A;  4U21 A;  3HHG A;  2RC7 A;  1FPJ A;  5CMK A;  3O66 A;  1FTL A;  4ISU A;  4LON B;  3ZS6 A;  5I59 A;  2Q8J A;  2Q8M A;  4X9T A;  2Y5K A;  1IME A;  4POW A;  4F22 A;  3CFL A;  5CBR A;  2ALU A;  2XWK A;  1JQF A;  4YMA A;  3MC2 A;  1G0I A;  1GGG A;  2ZZW A;  5JEI A;  1H45 A;  1MDP 1;  4PAI A;  3L6G A;  1JEU A;  4X04 A;  4DCX A;  4PFY A;  3DP4 A;  4G8N A;  1CE2 A;  3MST A;  4FED A;  3GBA A;  1SPI A;  2XXQ A;  4C1U A;  2V4C A;  1ZIU A;  1B6H A;  3VV5 A;  1NV1 A;  3UP9 A;  5JTY B;  2PFZ A;  4AB6 A;  2V3Q A;  4KQP A;  3FAS A;  4IY5 A;  2O1L A;  5A5X B;  2VPO A;  1SW2 A;  1IUD A;  2PFY A;  1DK4 A;  2HZK A;  4R74 A;  1A8F A;  4N07 A;  4OZ9 A;  4YMB A;  2RF1 A;  4OTE A;  5B7D A;  4IO4 A;  2F7C A;  1XVY A;  5CM6 A;  2DXY A;  4XXU A;  1D9V A;  5DYH A;  5I2N A;  1IZ1 A;  2AL5 A;  2GRV A;  1B4Z A;  2HFB A;  2HQ0 A;  2Y7K A;  4H6D A;  3ZKK A;  1LB9 A;  1YAE A;  3IOW A;  3LSX A;  4N6P A;  3MUQ A;  1MXV A;  3FUZ A;  5AA4 A;  1AL3 A;  2XX9 A;  2H99 A;  3B50 A;  4F1V A;  1UIU A;  4QFK A;  5KDT B;  4NGU A;  4PFT A;  4TLM B;  4MMP A;  2F7B A;  2D21 A;  2QVU A;  5A5L A;  1A8E A;  4N91 A;  4R9G A;  1Y20 A;  3HFU A;  4MAG A;  3ILT B;  4OA4 A;  3R6U A;  3LR1 A;  1MXY A;  4BLA A;  4NTL A;  1FPI A;  3FGS A;  1O63 A;  5HBC A;  4U4S A;  3A3C A;  1UTB B;  4XF5 A;  3KJT A;  1DPP A;  4PTK A;  5I5P A;  3KOT A;  2XXX A;  1IIT A;  1NUZ A;  4MLQ A;  2NVU B;  1Y1Z A;  3C31 A;  4HE1 A;  4QBA A;  3OO8 A;  1N76 A;  4GIZ A;  1YTV A;  3T9V A;  5H8Q B;  4N6K A;  4YB5 A;  1FTJ A;  4PFB A;  3RNN A;  1P1Q A;  3PD9 A;  1HSE A;  1P1O A;  5I3S A;  3G3K A;  4P0I A;  1LCF A;  5I7I A;  1Z7N E;  5AA2 A;  5K2Y A;  1FPB A;  1B5H A;  2R71 A;  1II5 A;  4JBZ A;  4JVI A;  4H5G A;  4YAH X;  2QVV A;  3IOT A;  4O3B A;  4KHZ E;  4XIG Q;  2QVR A;  4OET A;  1B3G A;  2R6G E;  4WXJ A;  1AMF A;  4OYV A;  1FRP A;  2E1S A;  4I62 A;  3T9H B;  4ZEB A;  1J1N A;  2F8D A;  2P2A A;  1UTH B;  2Q88 A;  1WVJ A;  1IMD A;  3KN3 A;  1LCT A;  4DXU A;  3LC8 A;  3FVG A;  4JSD A;  2THI A;  3LUY A;  4XKQ A;  3DEL B;  2X7P A;  2ZYK A;  3MVY A;  4BDR A;  4ND9 A;  2F36 A;  2DE3 A;  4PDD A;  4ESX A;  1SYI A;  1B7U A;  4G68 A;  4MCO A;  3OSR A;  1XT8 A;  5IGA A;  4C0R A;  3RTW B;  1YZ0 A;  2NXO A;  1N7W A;  1BIY A;  4NF8 B;  1QUI A;  2F5X A;  1FPF A;  5I2K B;  3FBP A;  2HAU A;  4FIM A;  4I3Y A;  1EH3 A;  3M8U A;  5DTB A;  4AS5 A;  4U23 A;  3D4G A;  5DEX A;  3K0V A;  2ZZV A;  1OLC A;  3VLV A;  1NL5 A;  4F3B A;  2XWI A;  1XHY A;  2I0B A;  4GX3 A;  4R6H A;  1GV8 A;  2A5S A;  4XEQ A;  1D3K A;  1MG1 A;  2FA7 A;  1RDY A;  2B4L A;  2ZMB A;  4I8C A;  4XFE A;  2DVZ A;  3MZB A;  1DCU A;  4LQ5 A;  4UAB A;  1UIV A;  5I59 B;  1R6Z A;  4G8M A;  3FVO A;  5IM2 A;  4P56 A;  3PV0 E;  2OK2 A;  3H3G A;  4YKK A;  1T0K A;  4X1D A;  3Q27 A;  4MNP A;  4KXP A;  2DXR A;  3V83 A;  1VFD A;  4OEV A;  3C9H A;  1IXC A;  4NN3 A;  2ZYN A;  1I6Q A;  4EQ7 A;  3RPL A;  1N3X A;  1RKM A;  2QPQ A;  2WYP A;  1NNK A;  4MBP A;  1ZLQ A;  4GWX A;  4OVQ A;  2XXI A;  1VDW A;  5AA2 B;  3ONM A;  4PF8 A;  1B32 A;  3IOV A;  4R6Y A;  3CG1 A;  1LLS A;  3V8X B;  4ELR A;  1GTK A;  1IXH A;  1I6B A;  2DE2 A;  4JSO A;  2QL3 A;  4F2O A;  1NNP A;  4BDM A;  1NH8 A;  4R9F A;  1CNQ A;  4JWY A;  4NG7 A;  1P1N A;  3QAX A;  4H8I A;  1LBB A;  3TCH A;  1Y1M A;  4KPT A;  1B1H A;  1A40 A;  1LAF E;  4F1U A;  1Y9U A;  3LBS A;  5ET5 A;  1TXF A;  3O6H A;  4WED A;  3VVD A;  3PMX A;  2Z23 A;  4H45 A;  2RKM A;  2D3I A;  5I2K A;  4ESW A;  2GQ1 A;  1KWH A;  2B4M A;  3PUV E;  2OBG A;  3PPQ A;  1OQG A;  5AA3 A;  1B1X A;  3KEI A;  1QJM A;  5H8F A;  2HHM A;  3MVZ A;  4O7I A;  1A54 A;  3VE1 B;  4DXC A;  2RC9 A;  2AIX A;  1MY2 A;  1B9J A;  2HXR A;  3BIG A;  1UQW A;  4NF5 B;  3OMB A;  1ZMG A;  2YJP A;  1UTB A;  1LBZ A;  1FPE A;  3A3U A;  1QUJ A;  2Z8D A;  4OVR A;  4G4P A;  3KN8 A;  4EXK A;  1MDQ A;  4FEC A;  2QJE A;  3IOU A;  1LAH E;  4R72 A;  5FBP A;  2GFE A;  1IXI A;  1MQG A;  4RJZ A;  3PU5 A;  5EQ8 A;  5JK4 A;  4YU0 A;  3JZJ A;  5JTY A;  1LBW A;  1MH3 A;  1FTK A;  3QXM A;  1S50 A;  2DVC A;  2HPG A;  4ZZE A;  5A5X A;  3SEU A;  1B3L A;  4U1O A;  4U1Z A;  4JB7 A;  3IB0 A;  1URS A;  1NI9 A;  2I4C A;  2CMO A;  4RPN A;  4FEB A;  4P9K A;  1MM6 A;  4N15 A;  4OVT A;  2RC8 A;  4OQO A;  3K6W A;  2D5W A;  3FIR A;  5ELV A;  1NV7 A;  4OHN A;  1JW5 A;  2VP1 A;  4LA9 A;  3S9E A;  1XVX A;  2I0C A;  3K01 A;  2UVJ A;  3DP6 A;  1IQ7 A;  3DM0 A;  3U8Q A;  1NH7 A;  5TP9 B;  1P1U A;  1G0H A;  1NUX A;  2ZXT A;  3IB2 A;  1NUY A;  4QFP A;  3LSL A;  1MM7 A;  4FJP A;  3FVK A;  5K2X A;  1WDN A;  2CEX A;  3FAT A;  3RPW A;  1QUL A;  2R9J A;  5CC2 A;  3TYH A;  1FQD A;  3FJM A;  2UVG A;  4HCW A;  4EQB A;  1SBP A;  5LOM A;  4H0W A;  3FV1 A;  3MZ9 A;  3QK6 A;  3RUM A;  3D1R A;  4IO3 A;  3S9L C;  3QUF A;  2LAO A;  2W7Y A;  3ZKL A;  3FXB A;  3CRB A;  1LST A;  4EF1 A;  2Y7I A;  1JET A;  4UAC A;  2A5T B;  1XC1 A;  3Q29 A;  3D4C A;  2PX1 A;  3PPN A;  4PBH A;  3FXQ A;  1NV2 A;  4RYA A;  3LSW A;  4EXL A;  1LFG A;  5EQ9 A;  4ZS9 A;  1QVS A;  1JEV A;  2KQZ A;  3KG2 A;  1QUK A;  5I58 B;  2F35 A;  3K6U A;  5L9M A;  4JWX A;  1EU8 A;  2I3W A;  1AH5 A;  1PBQ A;  4QRZ A;  4KR5 A;  3CR9 A;  1JW1 A;  2BJJ X;  2NOO A;  5FHO A;  4GXA A;  2JJK A;  2DQV A;  3VLU A;  3EQ1 A;  3TPA A;  3FXR A;  3TOD A;  1LFH A;  3OSQ A;  4YZZ A;  5H8N B;  4YIC A;  3OEN A;  1POY 1;  3K2D A;  2A5T A;  3PPO A;  3VVE A;  3N6T A;  3TKD A;  2GH9 A;  3E4R A;  3B6T A;  3QIM A;  1Y4T A;  2O68 A;  2O7I A;  2V25 A;  3W9W A;  5CMB A;  1A55 A;  4N81 A;  3EN3 A;  5H8F B;  3AXF A;  3M3L A;  4F1Y A;  5ESY A;  1FJ9 A;  5DEX B;  5KDT A;  1Y3P A;  3SES A;  2O6A A;  1B5I A;  2IA4 A;  4LAT A;  1O7T A;  3BBR A;  5AA2 D;  3U1O A;  3HCQ A;  5FTH A;  2ZYO A;  3CHG A;  1SW4 A;  3FXU A;  4QSD A;  4PCD A;  1SYH A;  2F3D A;  4GD5 A;  4NF4 B;  4R2B A;  3SET A;  3ILU B;  1FJ6 A;  2XWO A;  3KSX A;  1MPB A;  2P3V A;  4IO2 A;  1Y3N A;  1PDA A;  4GWZ A;  1FBD A;  2B3F A;  2UYE A;  4NWC A;  4L17 A;  3JV9 A;  4N8G A;  2MKZ A;  2XXV A;  4JVC A;  1FBG A;  2F7A A;  3EF7 A;  2Y7P A;  5AA4 B;  4KD5 A;  4GQO A;  2ONS A;  2G93 A;  3CVG A;  1R9Q A;  3ROJ A;  3T66 A;  1F9B A;  1K9Z A;  1TFA A;  4HTG A;  3OOA A;  1B52 A;  5IZ1 A;  1YYZ A;  3MVX A;  2M8C A;  3H6W A;  2OCU A;  2XXP A;  1M5F A;  2Y7R A;  2XD2 A;  4GOT A;  4R2F A;  4GWO A;  1BTJ A;  5EHM A;  1FPK A;  3KC1 A;  3TQL A;  1ATG A;  1IXG A;  4QF9 A;  4THI A;  4LQ2 A;  4QSE A;  1MQD A;  2QS4 A;  5AA1 A;  3C32 A;  1R1N A;  3OEM A;  1DTZ A;  2F34 A;  1H76 A;  4MHF A;  2PT2 A;  1NKX A;  2QRY A;  2XXY A;  3K00 A;  3C34 A;  4PGP A;  3LSF B;  2I6E A;  1BKA A;  3OEL A;  2ABH A;  2O69 A;  4OVP A;  4Z0I A;  2VPN A;  3FJG A;  1K9Y A;  3S2V A;  2DDK A;  5F1Q A;  5EQ7 A;  4GWW A;  4F39 A;  4NF4 A;  3PMW A;  3TCF A;  1BK4 A;  2XWV A;  2XA5 A;  1NNT A;  4QHQ A;  2FHY A;  5TP9 A;  4ZEF A;  4GLI A;  3TMG A;  3U93 A;  3G3I A;  4RPO A;  3M3F A;  4OER A;  5EYG A;  4EDP A;  1RYO A;  3MP6 A;  1NV4 A;  3SEX A;  5ET8 A;  1KA0 A;  3RLF E;  4PDH A;  3OO6 A;  5M2V A;  4AS4 A;  1UTH A;  3G3G A;  3K1N A;  4PE3 A;  1MPD A;  3GXA A;  4Q0C A;  4MLV A;  3SKP A;  4MFI A;  3SDF A;  4GXS B;  4DE8 A;  4WEP A;  3TTM A;  3N94 A;  2OZZ A;  1B3H A;  1FTA A;  2FNC A;  3U72 A;  5BWJ A;  4XTC Q;  2ZNU A;  3DP8 A;  3OD7 A;  1WOD A;  5DVJ A;  5EHS A;  1P99 A;  3Q26 A;  2B3B A;  3TDJ A;  4DDD A;  2H25 A;  4E0W A;  4N13 A;  4GBV A;  1Q9D A;  2XXW A;  5IZ3 B;  2WBD A;  3ISP A;  1NNF A;  3PUY E;  2DS9 A;  3IR1 A;  4F3P A;  2VOZ A;  4LP2 B;  1B58 A;  3KZG A;  3TZA A;  1ANF A;  1M5C A;  3H6U A;  3RGY A;  2DWH A;  3U92 A;  2CZK A;  4H67 A;  1LBV A;  4NX1 A;  1B7H A;  1D4N A;  4OAN A;  3KBZ A;  3H6T A;  1B5J A;  1BP5 A;  3BFU A;  4QFL A;  4TQU Q;  3IOR A;  2B65 A;  2V3U A;  2CZI A;  4EUO A;  4PFU A;  1YCJ A;  1TFD A;  4WKM A;  5J1D A;  1TWY A;  2ZNT A;  1PB7 A;  3O6I A;  2DWA A;  1FQA A;  3PMV A;  4GX4 A;  4H46 A;  4LN5 A;  1ZJL A;  3SEV A;  3OO9 A;  4PFI A;  5DVF A;  3G7W A;  1YXI A;  3IO6 A;  3P7I A;  4IGT A;  3UOR A;  3W15 C;  5H8H A;  3KSJ A;  5ET6 A;  4FAJ A;  3IJX B;  2L5V A;  2I58 A;  1Q35 A;  1JVY A;  3PPR A;  4RNS A;  3GYY A;  2GHA A;  5KCJ B;  3MBP A;  1URG A;  1N04 A;  2WEF A;  4K3F A;  4MNC A;  1MXZ A;  4I3E A;  2HEU A;  4QXD A;  4N6D A;  1NFT A;  2F6P A;  3VFJ A;  4ZEK A;  4MIJ A;  2DYX A;  1PC3 A;  4QFO A;  1FTO A;  4NF6 A;  2V3T A;  4I9D A;  4ZZA A;  2RIN A;  4RK9 A;  1LAG E;  3H03 A;  5LTC A;  2Q2C A;  5IZ3 A;  4FAT A;  4RY1 A;  2DP8 A;  4P11 A;  4XKN A;  5I56 A;  1GVC A;  2FVZ A;  3E79 A;  5FHM A;  1HSL A;  1SW1 A;  5I2N B;  2DOJ A;  3CIJ A;  3S9N C;  4LUB A;  1H43 A;  3VLW A;  4PP0 A;  2YPN A;  5CMC A;  2UVI A;  1VFE A;  2DWI A;  3B8B A;  3HN0 A;  3FV2 A;  1DOT A;  4MNI A;  3MJN A;  5I84 A;  2FYI A;  2Q89 A;  5F24 A;  5H8S A;  3I6V A;  1RDZ A;  1CB6 A;  4LVQ A;  4G61 A;  4OEN A;  3E9X A;  5KCJ A;  4PFR A;  5CBS A;  3C33 A;  4X1B A;  2REG A;  3TUS A;  4H65 A;  3K6V A;  1DTG A;  1DPE A;  4Q5T A;  2Z8E A;  1EYI A;  3T96 B;  3TTL A;  3O28 A;  2Q74 A;  5LDZ A;  4KFQ A;  3VDF A;  3I5O A;  4NAP A;  3O6G A;  2ESN A;  3IK6 B;  3VXB A;  4GBW A;  3B6Q A;  1S7Y A;  4PET A;  1ELJ A;  1FQE A;  1LFI A;  3ZSF A;  4YB6 A;  4LZ7 A;  4ELQ A;  3C35 A;  1FSA A;  2R8T A;  1B3F A;  4M4G A;  2HZL A;  1URD A;  2Q9T A;  1FBC A;  4JVD A;  1SI0 A;  1IMA A;  1EZO A;  4N17 A;  1XOC A;  1FTM A;  1LGB C;  4HW8 A;  2VHA A;  3MPL A;  1QGX A;  1RYX A;  4GL0 A;  4F29 A;  1SQY A;  4OVS A;  1VSO A;  5ISU A;  1QKA A;  2YLN A;  3V5A A;  2QS3 A;  3MAM A;  3RT8 A;  3E78 A;  1OQH A;  3IB1 A;  4IGR A;  3KFM A;  3B7D A;  3CFZ A;  1PEB A;  4UA8 A;  3KBR A;  3PTY A;  4KCC A;  3TQW A;  5IZZ A;  1NMU A;  5I57 B;  2DWJ A;  3OEK A;  1IEJ A;  2QS2 A;  3HV1 A;  3MW0 A;  3K6X A;  4NWD A;  1B05 A;  5L8D A;  4MX6 A;  3MVW A;  3RTF B;  4H8J A;  3N5L A;  2IEE A;  2ONK E;  1D9Y A;  4NE4 A;  4IB2 A;  4OMB A;  2XX7 A;  3TFL A;  1MY4 A;  2PMS A;  2PVU A;  2DE4 A;  3JYR A;  3GBB A;  4LZ8 A;  4NF8 A;  3QMF A;  4XKR A;  5DW8 A;  2XXT A;  2Q2A A;  1LBY A;  3T1B A;  3EHT A;  4OXV A;  4IO6 A;  5AE4 A;  5I57 A;  1FCK A;  4IO7 A;  2PT1 A;  1Y4C A;  3THI A;  2OJT A;  2ANJ A;  2HAV A;  4PBQ A;  1KA1 A;  1DSN A;  1PBP A;  3T9U A;  4U4X A;  4ONY A;  3G3H A;  5CI5 A;  3NOH A;  3TEL A;  3A09 A;  1N7X A;  3HHF A;  1INP A;  1D9Q A;  2XD3 A;  4RA1 A;  3IFC A;  4TLL B;  4NF0 A;  2X26 A;  4OEU A;  3HPI A;  3TTR A;  2I48 A;  4ZE8 A;  4ZEI A;  4O7M A;  1FBP A;  4GWS A;  3IX1 A;  2FIE A;  5HPQ A;  1EZP A;  4F19 A;  3K1M A;  3S4U A;  1M5E A;  1MXW A;  2VD3 A;  2AL4 A;  1LEV A;  1MQJ A;  3O9P A;  3LUZ A;  4P1E A;  2H9B A;  4I1D A;  4R75 A;  1B51 A;  1YPN A;  3KC0 A;  3A29 A;  3SZP A;  3PD8 A;  3UIF A;  5L9S A;  3Q28 A;  4OFO A;  3WAF A;  5ITP A;  3RT6 B;  2HCA A;  1ZTY A;  4FBP A;  1MQH A;  5I56 B;  4HS7 A;  4U22 A;  1FPL A;  3KN7 A;  1RDX A;  3UK4 A;  2QS1 A;  3RPL B;  1PB8 A;  2I3V A;  1EYJ A;  1SW5 A;  1A7L A;  4QFN A;  3C4M A;  1FBH A;  4R6K A;  4KI0 E;  1R9L A;  1MY3 A;  4P1L A;  3SEY A;  2OWZ A;  5ICT A;  3KOS A;  1FPG A;  4NED A;  5H8Q A;  2G29 A;  3IO4 A;  3T0J A;  3I3V A;  3OO7 A;  5B70 A;  3FVN A;  1LBX A;  3GLB A;  5ITO A;  4BDQ A;  2CZH A;  2X7Q A;  4Q30 B;  1AOV A;  4NHB A;  2Y84 A;  3CG3 A;  3MPK A;  1I69 A;  1POT A;  2WKY A;  1US5 A;  4ECF A;  2OWT A;  1TT1 A;  2WX9 A;  4MEV A;  5TPA B;  1NV6 A;  1OMP A;  4G8H A;  3Q25 A;  3QYT A;  4EQ9 A;  5IKB A;  1MS7 A;  1OVB A;  2FIX A;  2H5Y A;  1EYK A;  5ET7 A;  4DI3 D;  1MXU A;  1USY E;  2P1S A;  4ELO A;  4F18 A;  2OWS A;  3T9X B;  5F7V A;  3R7X A;  3PUW E;  2XXH A;  1P1W A;  1LBC A;  4GF8 A;  4IO5 A;  4GWU A;  1IMC A;  1JNF A;  4YB7 A;  2FBP A;  4G68 C;  1SDX A;  4HCY A;  4DLD A;  2CEY A;  5H8N A;  1FPD A;  2V93 A;  2O84 X;  3RY3 A;  5EYF A;  1IMB A;  2QMX A;  3H4Z A;  2UYF A;  4GRK A;  4P3L A;  1H3D A;  1ZKB A;  3MZ1 A;  1B46 A;  3MWB A;  3BFT A;  3TTK A;  3USD A;  5KZT A;  3ECR A;  4PE5 B;  3QUJ A;  3WAE A;  3FD3 A;  4N4U A;  5J16 A;  1JVX A;  2PCR A;  4U2R A;  4KYS A;  4HE2 A;  1DMB A;  4JDF A;  4NF6 B;  3GZG A;  1ZBM A;  2O51 A;  2GHB A;  3CSG A;  3R26 A;  1KZ8 A;  2QSX A;  3CFX A;  2I4B A;  1XS5 A;  3L6H A;  2V84 A;  4BDO A;  1NV0 A;  4G77 A;  1JW4 A;  2I49 A;  5CMM A;  2ZYM A;  3PPP A;  1DBZ A;  2Y7W A;  2NWJ A;  5CRY A;  4X8R A;  1NV5 A;  2H4I A;  2UVH A;  2KR0 A;  4ZEC A;  2XX8 A;  3T22 A;  2Z22 A;  2WYK A;  2ONR A;  4YKP A;  4GFR A;  5BUU A;  3UA8 A;  3BIH A;  1VR5 A;  5H8H B;  3UGW A;  4JWO A;  4HXV A;  3E3K A;  1A99 A;  4Q8R A;  4AQ4 A;  4X48 A;  3FJ7 A;  1MPC A;  1MRP A;  4PFW A;  2PBW A;  1QW0 A;  2ZZX A;  3PUX E;  2BJI A;  3FZV A;  1M5B A;  1B0H A;  1B4H A;  2XHD A;  3EHS A;  3C36 A;  2UXA A;  5L9O A;  3S9M C;  1O64 A;  2RCA A;  4OES A;  1LAX A;  3IAZ A;  3F11 A;  4C1T A;  2Y5L A;  3EKI A;  1Y3Q A;  4O94 A;  1AWB A;  1SVX B;  4TOZ A;  3RN8 A;  2REJ A;  1VE4 A;  1SI1 A;  3IFA A;  5IAI A;  1B40 A;  1MXX A;  4DXB A;  4O3C A;  5FHN A;  4O8M A;  1I6A A;  2PYY A;  2VGQ A;  3VXC A;  3H6V A;  3IL1 B;  4PAF A;  1H44 A;  4N8Y A;  3N26 A;  4EF2 A;  4O3A A;  4G2Z A;  4OFL A;  2QFL A;  4PAK A;  3H06 B;  1NUW A;  4DCY A;  4IY6 A;  4ZE9 A;  4F3S A;  4ZED A;  3MP8 A;  4IR8 A;  4YKJ A;  2QMW A;  3G3J A;  4Z7E A;  4DZ1 A;  1N3W A;  3O2A A;  1Q1K A;  3BKI B;  4MJO A;  4H5F A;  2F78 A;  4LZ5 A;  3HST A;  3U65 A;  3QSL A;  4F3G A;  5EYH A;  3SER A;  1SD3 A;  4BDL A;  4P8B A;  4OVJ A;  1OLA A;  1B7Z A;  2XXK A;  1MQI A;  2KLF A;  4RXL A;  3RQT A;  3TEP A;  5T3J A;  3U94 A;  1IIW A;  1XI6 A;  3W9V A;  4RK2 A;  1US4 A;  2XXR A;  4NF5 A;  2OX3 A;  3EPE A;  4KYE A;  3MYU A;  3CSB A;  5TPA A;  3H7M A;  1FQC A;  4GL8 A;  3OXN A;  1S9T A;  3G3F A;  3M3K A;  1L5T A;  5HM4 B;  1JP4 A;  4FE8 A;  1N84 A;  3UN6 A;  1HSJ A;  1QKB A;  3DLN A;  2HXW A;  4DIG A;  5DT6 A;  2O7U A;  1N0T A;  2F6G A;  5ICQ A;  3VVF A;  1LB8 A;  5EQA A;  3MQ9 A;  3K1P A;  4GVO A;  4HE0 A;  3O29 A;  4PF6 A;  3PGF A;  4DI4 B;  1FBF A;  3RYD A;  4JXI A;  2NUV A;  4OFJ A;  1GR2 A;  1B2H A;  4G68 B;  1MY1 A;  4ELP A;  1FQF A;  1BLF A;  3T93 B;  2DSF A;  4KYD A;  4R73 A;  2P0S A;  1IMF A;  1B3E A;  1MH4 A;  4PGN A;  1ZU0 A;  3K4U A;  4ZDM A;  4XKP A;  2VT5 A;  4NMY A;  4F31 B;  4P47 A;  2Z8F A;  5DVI A;  4M1V A;  4KCD A;  3V89 B;  3O97 A;  4PQJ A;  2OLB A;  2CZL A;  2RCB A;  3TTN A;  2VD2 A;  5FTI A;  3TAJ A;  1FBE A;  4P0G A;  4AB5 A;  4POX A;  3KGC A;  2AYS A;  1Z7M E;  3B6W A;  2F3B A;  1FW0 A;  2O1M A;  5TU0 A;  4E0X A;  1NV3 A;  3N6U A;  3LV0 A;  4H1X A;  3KJ7 A;  4FOR A;  1MY0 A;  3CI8 A;  1USY H;  4GX6 A; 
#chains in the Genus database with same CATH homology
 1B51 A;  4OER A;  1YPN A;  3O6H A;  4WED A;  4F2Q A;  3VVD A;  3PMX A;  2Z23 A;  3SEW A;  4EDP A;  1RYO A;  2RKM A;  3MP6 A;  3SEX A;  3PD8 A;  2D3I A;  3RLF E;  3MP1 A;  1EZ9 A;  1M5D A;  5I2K A;  3UIF A;  4ESW A;  3Q28 A;  4OFO A;  3WAF A;  5L9S A;  5ITP A;  3OO6 A;  1KWH A;  5M2V A;  2HCA A;  3RT6 B;  1ZTY A;  3EHU A;  2XXU A;  3PUZ E;  3PUV E;  2OBG A;  1MQH A;  1OVT A;  1UTH A;  4YKI A;  5I56 B;  3PPQ A;  3ODB A;  4HS7 A;  3G3G A;  1OQG A;  4U22 A;  2H98 A;  3K1N A;  1B1X A;  3IJO B;  5AA3 A;  3KN7 A;  1AIV A;  1PB9 A;  3KEI A;  1B0L A;  1MPD A;  2F97 A;  1QJM A;  3HO7 A;  3UK4 A;  5H8F A;  2QS1 A;  3GXA A;  1PB8 A;  4Q0C A;  5I58 A;  2I3V A;  2E0S A;  1SW5 A;  1A7L A;  2ZNS A;  3C4M A;  3MVZ A;  4MLV A;  4QFN A;  4KI0 E;  4MFI A;  4R6K A;  3SKP A;  1R9L A;  4BDN A;  1A54 A;  4MF3 A;  4GXS B;  3SDF A;  3TCG A;  3VE1 B;  2RC9 A;  1MY3 A;  2AIX A;  4WEP A;  3TTM A;  3N94 A;  2OZZ A;  3SEY A;  4DE8 A;  1MY2 A;  1B9J A;  5ICT A;  3K02 A;  1B3H A;  2FNC A;  3U72 A;  5BWJ A;  3VFJ A;  3KOS A;  1FQB A;  2ZNU A;  4XTC Q;  1UQW A;  4NED A;  5H8Q A;  3DP8 A;  3E13 X;  3OD7 A;  2G29 A;  3IO4 A;  1OIB A;  4OWD A;  4MH5 A;  3I3V A;  3OO7 A;  1WOD A;  4NF5 B;  5DVJ A;  5B70 A;  3FVN A;  1P99 A;  3OMB A;  4QSC A;  4U21 A;  1ZMG A;  2YJP A;  3HHG A;  3Q26 A;  2RC7 A;  1UTB A;  2B3B A;  3GLB A;  3TDJ A;  4F18 A;  4DDD A;  5ITO A;  2H25 A;  5CMK A;  3A3U A;  4BDQ A;  4E0W A;  3O66 A;  2X7Q A;  1QUJ A;  1FTL A;  4Q30 B;  4ISU A;  2Z8D A;  1AOV A;  4N13 A;  4LON B;  3ZS6 A;  2Y84 A;  4G4P A;  5I59 A;  2Q8J A;  4X9T A;  3CG3 A;  2XXW A;  4POW A;  3KN8 A;  3MPK A;  1I69 A;  1POT A;  2WKY A;  1NNF A;  1US5 A;  3PUY E;  4F22 A;  2DS9 A;  4EXK A;  4ECF A;  3CFL A;  1MDQ A;  3IR1 A;  4FEC A;  4F3P A;  2ALU A;  2OWT A;  2QJE A;  5CBR A;  3IOU A;  1JQF A;  1LAH E;  1TT1 A;  2VOZ A;  4YMA A;  4LP2 B;  1B58 A;  3KZG A;  3MC2 A;  4R72 A;  3TZA A;  1ANF A;  1M5C A;  2GFE A;  1IXI A;  3H6U A;  3RGY A;  2DWH A;  1GGG A;  1MQG A;  4RJZ A;  3U92 A;  3PU5 A;  4H67 A;  5TPA B;  5JEI A;  5JK4 A;  4YU0 A;  1OMP A;  4G8H A;  3Q25 A;  1H45 A;  3JZJ A;  3QYT A;  4EQ9 A;  1MDP 1;  5IKB A;  5JTY A;  1MS7 A;  1B7H A;  1OVB A;  2H5Y A;  1D4N A;  3L6G A;  5EHS A;  1JEU A;  1MH3 A;  1FTK A;  1MXU A;  4DCX A;  1USY E;  3H6T A;  3QXM A;  1B5J A;  1BP5 A;  1S50 A;  2DVC A;  2P1S A;  3BFU A;  3DP4 A;  3IOR A;  2OWS A;  1CE2 A;  4FED A;  2B65 A;  4G8N A;  3GBA A;  3SEU A;  3T9X B;  1B3L A;  2V3U A;  5F7V A;  3R7X A;  4U1O A;  2XXQ A;  3PUW E;  4PFU A;  4U1Z A;  2XXH A;  4C1U A;  4EUO A;  4JB7 A;  1P1W A;  1ZIU A;  3IB0 A;  1B6H A;  1LBC A;  1TFD A;  1YCJ A;  4GF8 A;  4IO5 A;  1URS A;  4WKM A;  3VV5 A;  5J1D A;  1TWY A;  3UP9 A;  5JTY B;  4AB6 A;  2I4C A;  2ZNT A;  1PB7 A;  2CMO A;  3O6I A;  2DWA A;  2V3Q A;  1FQA A;  1JNF A;  3PMV A;  4KQP A;  4FEB A;  4RPN A;  3FAS A;  4G68 C;  4IY5 A;  4YB7 A;  1SDX A;  4HCY A;  2O1L A;  1MM6 A;  1ZJL A;  4DLD A;  5A5X B;  4PFY A;  2RC8 A;  3SEV A;  3OO9 A;  5H8N A;  1SW2 A;  5DVF A;  1IUD A;  4OQO A;  2V93 A;  3G7W A;  3K6W A;  2O84 X;  3IO6 A;  3RY3 A;  5EYF A;  2D5W A;  2HZK A;  3FIR A;  4R74 A;  5ELV A;  3P7I A;  4IGT A;  2QMX A;  3H4Z A;  3UOR A;  4OHN A;  1A8F A;  1JW5 A;  2UYF A;  4N07 A;  2VP1 A;  4GRK A;  4OZ9 A;  4LA9 A;  1H3D A;  1ZKB A;  3MZ1 A;  3W15 C;  4YMB A;  3S9E A;  1B46 A;  2RF1 A;  3MWB A;  1XVX A;  2I0C A;  4OTE A;  3K01 A;  5B7D A;  4IO4 A;  3BFT A;  2UVJ A;  5H8H A;  3DP6 A;  1IQ7 A;  3DM0 A;  3U8Q A;  2F7C A;  1NH7 A;  3KSJ A;  5TP9 B;  3TTK A;  3USD A;  5CC2 A;  5KZT A;  3ECR A;  4FAJ A;  4PE5 B;  1P1U A;  3IJX B;  1XVY A;  3QUJ A;  3WAE A;  2ZXT A;  5CM6 A;  3FD3 A;  2I58 A;  3IB2 A;  1Q35 A;  1JVY A;  2DXY A;  1JVX A;  3PPR A;  4U2R A;  4KYS A;  4RNS A;  4XXU A;  1DMB A;  4JDF A;  2GHA A;  4NF6 B;  4QFP A;  5KCJ B;  1D9V A;  3LSL A;  1MM7 A;  5DYH A;  5I2N A;  3GZG A;  1ZBM A;  4FJP A;  3MBP A;  1IZ1 A;  2AL5 A;  2GRV A;  3FVK A;  1URG A;  1B4Z A;  2GHB A;  2HFB A;  1WDN A;  1N04 A;  2O51 A;  3CSG A;  3R26 A;  4K3F A;  3CFX A;  2QSX A;  5K2X A;  2HQ0 A;  2I4B A;  2Y7K A;  3FAT A;  1XS5 A;  4H6D A;  3RPW A;  3L6H A;  1MXZ A;  1QUL A;  2HEU A;  2R9J A;  3ZKK A;  2V84 A;  1LB9 A;  1YAE A;  3IOW A;  4BDO A;  3LSX A;  1NFT A;  3MUQ A;  4N6P A;  2F6P A;  1MXV A;  1JW4 A;  2I49 A;  3FUZ A;  4G77 A;  5CMM A;  1AL3 A;  2XX9 A;  2ZYM A;  1FQD A;  3FJM A;  3PPP A;  2H99 A;  4ZEK A;  2Y7W A;  3TYH A;  2UVG A;  4HCW A;  2DYX A;  2NWJ A;  4F1V A;  1UIU A;  4QFK A;  5CRY A;  4EQB A;  1SBP A;  1PC3 A;  5KDT B;  2H4I A;  4QFO A;  5LOM A;  4PFT A;  2UVH A;  4H0W A;  4TLM B;  4ZEC A;  2XX8 A;  3FV1 A;  3MZ9 A;  2F7B A;  1FTO A;  3QK6 A;  3RUM A;  3T22 A;  4NF6 A;  2D21 A;  2V3T A;  2Z22 A;  4IO3 A;  4I9D A;  4ZZA A;  2ONR A;  3S9L C;  2RIN A;  4YKP A;  3QUF A;  4RK9 A;  4GFR A;  1LAG E;  2LAO A;  1A8E A;  3H03 A;  5BUU A;  3UA8 A;  1Y20 A;  2Q2C A;  2W7Y A;  4R9G A;  4RY1 A;  1VR5 A;  2DP8 A;  4P11 A;  4XKN A;  5H8H B;  3UGW A;  4ZZE A;  5I56 A;  1GVC A;  3ILT B;  4JWO A;  5FHM A;  3CRB A;  3R6U A;  1LST A;  4EF1 A;  1HSL A;  1SW1 A;  1A99 A;  1MXY A;  3E3K A;  3LR1 A;  4BLA A;  4Q8R A;  4NTL A;  2Y7I A;  2DOJ A;  1O63 A;  3CIJ A;  3FGS A;  4AQ4 A;  3S9N C;  1JET A;  4LUB A;  2A5T B;  4UAC A;  4U4S A;  5HBC A;  3A3C A;  1H43 A;  1UTB B;  1XC1 A;  3D4C A;  2PX1 A;  3PPN A;  2YPN A;  3FJ7 A;  1MPC A;  3Q29 A;  1MRP A;  4PP0 A;  5CMC A;  3FXQ A;  2UVI A;  4PFW A;  4RYA A;  1VFE A;  2PBW A;  2DWI A;  1QW0 A;  4QFL A;  3KJT A;  3HN0 A;  3FV2 A;  1DOT A;  1DPP A;  3LSW A;  3PUX E;  3MJN A;  3ZKL A;  4EXL A;  1LFG A;  5I84 A;  3FZV A;  2FYI A;  2Q89 A;  5H8S A;  1M5B A;  3I6V A;  1B0H A;  4ZS9 A;  1CB6 A;  1QVS A;  1JEV A;  1B4H A;  3KG2 A;  2XHD A;  3KOT A;  3EHS A;  4LVQ A;  2XXX A;  3C36 A;  1IIT A;  2UXA A;  4MLQ A;  1QUK A;  5L9O A;  2NVU B;  5I58 B;  1Y1Z A;  1O64 A;  3C31 A;  4OEN A;  3S9M C;  2RCA A;  3E9X A;  3OO8 A;  4OES A;  2F35 A;  1N76 A;  5KCJ A;  1LAX A;  4GIZ A;  5CBS A;  3K6U A;  5L9M A;  3C33 A;  3IAZ A;  3F11 A;  2REG A;  4X1B A;  4JWX A;  1EU8 A;  2I3W A;  1AH5 A;  4C1T A;  5IAI A;  3TUS A;  1PBQ A;  4QRZ A;  1YTV A;  4KR5 A;  4H65 A;  3CR9 A;  3K6V A;  1Y3Q A;  1DTG A;  1DPE A;  4Q5T A;  3T9V A;  1JW1 A;  2BJJ X;  2Z8E A;  2NOO A;  4YB5 A;  1FTJ A;  1SVX B;  4GXA A;  4TOZ A;  5FHO A;  5H8Q B;  2DQV A;  3RN8 A;  3RNN A;  3T96 B;  1P1Q A;  3TTL A;  3PD9 A;  3VLU A;  1HSE A;  3O28 A;  5AA4 A;  2REJ A;  1P1O A;  1VE4 A;  3EQ1 A;  4KFQ A;  1SI1 A;  3TPA A;  3VDF A;  3G3K A;  3I5O A;  4P0I A;  1B40 A;  1MXX A;  1LCF A;  2ESN A;  3O6G A;  3FXR A;  3IK6 B;  4DXB A;  4O3C A;  3TOD A;  1Z7N E;  5FHN A;  5AA2 A;  5K2Y A;  1I6A A;  1B5H A;  2PYY A;  2VGQ A;  1LFH A;  2R71 A;  1II5 A;  3H6V A;  4JBZ A;  3OSQ A;  4H5G A;  3IL1 B;  3VXB A;  3VXC A;  4YZZ A;  4YAH X;  5H8N B;  3B6Q A;  1H44 A;  1S7Y A;  4YIC A;  3IOT A;  4O3B A;  4KHZ E;  4XIG Q;  3OEN A;  3N26 A;  1ELJ A;  1FQE A;  1POY 1;  3K2D A;  4PET A;  4EF2 A;  4O3A A;  2A5T A;  1B3G A;  3PPO A;  4OET A;  2R6G E;  4G2Z A;  4WXJ A;  3N6T A;  3VVE A;  1AMF A;  1LFI A;  3TKD A;  3ZSF A;  2GH9 A;  3E4R A;  4OFL A;  4OYV A;  3B6T A;  3QIM A;  4YB6 A;  2E1S A;  1Y4T A;  2O68 A;  4LZ7 A;  4ELQ A;  2O7I A;  2V25 A;  3C35 A;  3H06 B;  4I62 A;  3W9W A;  1B3F A;  5CMB A;  4M4G A;  4DCY A;  1A55 A;  2HZL A;  4IY6 A;  3EN3 A;  5H8F B;  1URD A;  4ZE9 A;  3T9H B;  4ZEB A;  4F3S A;  4ZED A;  3MP8 A;  4YKJ A;  1J1N A;  2Q9T A;  3AXF A;  3M3L A;  1SI0 A;  4F1Y A;  2F8D A;  2P2A A;  1EZO A;  3S4U A;  1UTH B;  2QMW A;  1XOC A;  2Q88 A;  5DEX B;  1FTM A;  1LGB C;  1WVJ A;  3G3J A;  4DZ1 A;  4Z7E A;  5KDT A;  1N3W A;  1Y3P A;  3O2A A;  3SES A;  2O6A A;  1Q1K A;  3BKI B;  1B5I A;  2IA4 A;  4H5F A;  2F78 A;  4LAT A;  4HW8 A;  1O7T A;  2VHA A;  3HST A;  3MPL A;  4LZ5 A;  1RYX A;  3BBR A;  3QSL A;  4GL0 A;  3U1O A;  5AA2 D;  3HCQ A;  3KN3 A;  4F29 A;  1SQY A;  1LCT A;  5FTH A;  1VSO A;  2ZYO A;  4F3G A;  4DXU A;  3LC8 A;  3FVG A;  1SW4 A;  3FXU A;  2THI A;  4JSD A;  4QSD A;  5ISU A;  3LUY A;  1QKA A;  4X48 A;  1SYH A;  4XKQ A;  3DEL B;  2X7P A;  2ZYK A;  3MVY A;  3SER A;  4BDR A;  1SD3 A;  2YLN A;  5A5X A;  4GD5 A;  4ND9 A;  4NF4 B;  2QS3 A;  2F36 A;  3V5A A;  4BDL A;  4R2B A;  2DE3 A;  3SET A;  4ESX A;  1SYI A;  1B7U A;  1OLA A;  4OVJ A;  3MAM A;  1B7Z A;  3RT8 A;  3ILU B;  4G68 A;  1MQI A;  1OQH A;  2KLF A;  3IB1 A;  4IGR A;  4RXL A;  4IO2 A;  3KSX A;  1MPB A;  3RQT A;  3TEP A;  1Y3N A;  3KFM A;  1PDA A;  3OSR A;  3U94 A;  1IIW A;  3W9V A;  4RK2 A;  2B3F A;  2UYE A;  3B7D A;  3CFZ A;  4NWC A;  1PEB A;  4UA8 A;  1XT8 A;  1US4 A;  4TQU Q;  4L17 A;  3JV9 A;  2XXR A;  3KBR A;  4KCC A;  4NF5 A;  3TQW A;  4C0R A;  2XXV A;  3RTW B;  1NMU A;  5I57 B;  3EPE A;  2DWJ A;  2NXO A;  4KYE A;  1N7W A;  1BIY A;  3OEK A;  2F7A A;  1IEJ A;  2QS2 A;  3EF7 A;  4NF8 B;  3CSB A;  3HV1 A;  2Y7P A;  1QUI A;  5TPA A;  3H7M A;  1FQC A;  2F5X A;  4GL8 A;  5I2K B;  2HAU A;  4FIM A;  3MW0 A;  3OXN A;  1S9T A;  3K6X A;  4NWD A;  1EH3 A;  3M8U A;  4GQO A;  4KD5 A;  5DTB A;  5AA4 B;  2ONS A;  1B05 A;  3G3F A;  4U23 A;  5L8D A;  2G93 A;  3CVG A;  3D4G A;  3MVW A;  1R9Q A;  5DEX A;  3M3K A;  3RTF B;  4H8J A;  3K0V A;  1OLC A;  3VLV A;  3N5L A;  1NL5 A;  2IEE A;  2ONK E;  1D9Y A;  4NE4 A;  3T66 A;  1F9B A;  1XHY A;  4F3B A;  1L5T A;  4IB2 A;  4OMB A;  2I0B A;  1TFA A;  5HM4 B;  4FE8 A;  4HTG A;  1N84 A;  2XX7 A;  4R6H A;  3UN6 A;  3TFL A;  1HSJ A;  1MY4 A;  1QKB A;  3DLN A;  2HXW A;  2A5S A;  1GV8 A;  4DIG A;  5DT6 A;  2O7U A;  3OOA A;  1D3K A;  2PMS A;  1MG1 A;  2PVU A;  1N0T A;  2F6G A;  5ICQ A;  1B52 A;  2FA7 A;  2DE4 A;  3JYR A;  2ZMB A;  3GBB A;  4I8C A;  3MVX A;  3VVF A;  2M8C A;  1LB8 A;  2DVZ A;  3MZB A;  3H6W A;  4LZ8 A;  3MQ9 A;  4LQ5 A;  2OCU A;  3K1P A;  4NF8 A;  4GVO A;  3O29 A;  2XXP A;  1UIV A;  1M5F A;  5I59 B;  1R6Z A;  4XKR A;  2Y7R A;  3PGF A;  2XD2 A;  4GOT A;  4R2F A;  5I2N B;  4G8M A;  2XXT A;  4GWO A;  4JXI A;  3FVO A;  2NUV A;  1BTJ A;  5EHM A;  3TQL A;  2Q2A A;  4OFJ A;  1ATG A;  1IXG A;  1B2H A;  1GR2 A;  3PV0 E;  4QF9 A;  4THI A;  2OK2 A;  3EHT A;  3H3G A;  4G68 B;  4LQ2 A;  1MY1 A;  4OXV A;  4IO6 A;  4QSE A;  4YKK A;  4ELP A;  5AE4 A;  5I57 A;  1T0K A;  1FCK A;  4IO7 A;  4X1D A;  1FQF A;  1BLF A;  3Q27 A;  2PT1 A;  1Y4C A;  2DXR A;  2OJT A;  1MQD A;  2ANJ A;  2QS4 A;  3T93 B;  3THI A;  2HAV A;  3C32 A;  2DSF A;  5AA1 A;  4KYD A;  3V83 A;  1R1N A;  1VFD A;  4OEV A;  1DSN A;  1IXC A;  1PBP A;  3C9H A;  3T9U A;  4U4X A;  4R73 A;  2P0S A;  4ONY A;  3OEM A;  3G3H A;  5CI5 A;  1DTZ A;  1B3E A;  2F34 A;  2ZYN A;  3TEL A;  1I6Q A;  3A09 A;  1MH4 A;  4EQ7 A;  1H76 A;  1ZU0 A;  1N7X A;  3K4U A;  3HHF A;  4ZDM A;  1N3X A;  2PT2 A;  1NKX A;  2QRY A;  2XXY A;  4DXC A;  3K00 A;  1RKM A;  2QPQ A;  3C34 A;  4XKP A;  2XD3 A;  3LSF B;  2I6E A;  1BKA A;  4RA1 A;  4TLL B;  1NNK A;  4NMY A;  4MBP A;  2X26 A;  3OEL A;  4OEU A;  4F31 B;  1ZLQ A;  2Z8F A;  2ABH A;  5DVI A;  2XXI A;  4M1V A;  2O69 A;  5AA2 B;  3ONM A;  3HPI A;  1B32 A;  3IOV A;  4Z0I A;  2I48 A;  4KCD A;  4R6Y A;  3TTR A;  3V89 B;  3O97 A;  3FJG A;  4PQJ A;  3CG1 A;  3S2V A;  1LLS A;  2OLB A;  2CZL A;  2RCB A;  4ZEI A;  4ZE8 A;  3V8X B;  5F1Q A;  4ELR A;  1GTK A;  3TTN A;  1IXH A;  3IX1 A;  1I6B A;  4F39 A;  2DE2 A;  4NF4 A;  5HPQ A;  4JSO A;  2VD2 A;  1EZP A;  2QL3 A;  3PMW A;  5FTI A;  3TCF A;  4F2O A;  3TAJ A;  1NNP A;  4BDM A;  1NH8 A;  4R9F A;  4P0G A;  4AB5 A;  4POX A;  4F19 A;  3K1M A;  3KGC A;  4JWY A;  1P1N A;  2AYS A;  1M5E A;  1MXW A;  2VD3 A;  1NNT A;  1Z7M E;  3B6W A;  3QAX A;  2AL4 A;  4H8I A;  1LBB A;  4QHQ A;  1FW0 A;  2O1M A;  5TU0 A;  4E0X A;  5TP9 A;  4ZEF A;  3N6U A;  4GLI A;  1MQJ A;  3TCH A;  3TMG A;  1Y1M A;  4ELO A;  3U93 A;  3G3I A;  3O9P A;  4KPT A;  4RPO A;  1B1H A;  4H1X A;  3M3F A;  3KJ7 A;  4FAT A;  1A40 A;  1LAF E;  4FOR A;  2H9B A;  1MY0 A;  3CI8 A;  1Y9U A;  1USY H;  4I1D A;  4F1U A;  3VLW A;  3LBS A;  1TXF A;  4R75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...