4RK2A

Crystal structure of sugar transporter rhe_pf00321 from rhizobium etli, target efi-510806, an open conformation
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
393
structure length
393
Chain Sequence
AVTLKWALWDWDKTAYYKPLIEAYQAKHPNVKFEPMDLGSQDYQQMISTQLTGGSKDIDIVTIKDVPGYTNLVRAGNIADLSGFVKDQKIDPAPYGGLIEELTIDGKIYSLPFRSDFWIVYYNKDIFDKAGVPYPTNDMTWAQFDETAEKLAGGMGTNKTYGALLHTWRSTVQLPGILDGKHTLVDGDYAFLKPWYERALTLQKDGAIPSYAFLKTSNTHYSALFFNGTIGMLPMGTWFVGTQIAKVKSGESKSKNWGIVKFPHPDGVPAGTTAAQISGLAVNSNSQHKDAALDFIKFVAGPEGAAVVAATGTFPALKTADVSAKIASTPGFPQDEASKEALIPAKAYLEMAVNPNAAKIEVVLNRAHDAIMTDNTSVDDGLKEMTEGVKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Sugar Transporter RHE_Pf00321 from Rhizobium Etli, Target EFI-510806
rcsb
source organism Rhizobium etli
molecule tags Transport protein
molecule keywords Putative sugar ABC transporter, substrate-binding protein
total genus 138
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4rk2A00
5CMKA 4RJZA 2VD2A 2DWHA 2Y7RA 1OQHA 4R74A 4E0WA 1R1NA 3IB1A 3V5AA 4FATA 3G3HA 2OJTA 5KCJA 1B05A 2F35A 3OO8A 3U1OA 5I58B 3CSBA 3K02A 4OESA 2OLBA 1MY2A 1WODA 1XS5A 4P11A 3OMBA 1LB9A 4YICA 4F22A 3PUXE 1FQEA 2ONRA 1N7WA 3MP6A 2DOJA 3PPPA 4G8HA 4OETA 1TXFA 3FV2A 2P2AA 3F11A 4ZEIA 3KFMA 5LOMA 2DSFA 1P1OA 4F1YA 2Y7PA 1H76A 3UN6A 3VXCA 1VSOA 4KD5A 4NF5B 4O3BA 2X7PA 1TFAA 3W9VA 1ZIUA 4I62A 4M4GA 5I2KB 5L9MA 1EH3A 3S9EA 3FATA 5FTHA 1US4A 2RKMA 3Q26A 2DWIA 3C9HA 4R6YA 5M2VA 1N7XA 2F8DA 4WXJA 4AQ4A 4F3BA 1CB6A 1HSEA 1O64A 1TFDA 2RCAA 4HCYA 2QMWA 5TPAA 3BFTA 3S2VA 3PV0E 1POY1 2F7CA 3FUZA 2CZLA 2GRVA 2HZKA 3PPOA 4GLIA 3RUMA 3RNNA 4KI0E 4OMBA 3DELB 3TYHA 3KJTA 3ZS6A 3D4CA 4OENA 4QSCA 1URGA 5B70A 1EZ9A 1MPBA 2NXOA 3K6VA 3LSLA 4IY5A 4OWDA 5H8FB 3IR1A 1B0HA 5I57B 4E0XA 3IB0A 5AE4A 1JW5A 4PFWA 1MDQA 1URDA 1MPCA 1M5FA 2F7AA 2Q2CA 3IAZA 2UVIA 4U2RA 1QULA 1SBPA 4U1OA 2RC7A 3O6HA 3B6QA 5L8DA 1XT8A 4G68A 2I49A 2IA4A 2XD3A 4N13A 2D3IA 1P99A 4HW8A 1IIWA 4G8NA 1XOCA 2O7UA 1FTOA 3C34A 2F7BA 1R6ZA 3LSFB 3T9VA 2OCUA 3IJOB 4OFLA 3RN8A 1A8EA 3MQ9A 3C31A 3UIFA 3TCGA 1B7UA 1B1HA 1QJMA 2NOOA 2XXYA 3E9XA 4GWOA 4KYDA 4NWDA 4QFLA 3CFZA 3V8XB 1LCTA 4RA1A 2DYXA 1S50A 2F6PA 4MH5A 1UIVA 1DPEA 1PC3A 3DLNA 3KOSA 3E4RA 4YB7A 3IOTA 4GXAA 3P7IA 3H6VA 3TELA 4GL0A 2HXWA 5H8NB 1I69A 1O63A 3HO7A 4F18A 3JZJA 2QS3A 4TLLB 3LUYA 1H3DA 3VE1B 3TZAA 4H5FA 3RPWA 3OSQA 3E3KA 2ZXTA 3GBAA 3OELA 4O3CA 1H45A 3GLBA 3KBRA 4DIGA 1M5CA 2IEEA 4RXLA 4U4SA 1ZKBA 1Y4TA 2PT2A 4F3GA 1POTA 3JYRA 1JW1A 1S7YA 2PMSA 4WEPA 2ZMBA 3T96B 5JK4A 4GD5A 3TUSA 4JDFA 2KLFA 3U92A 1D9YA 4R2FA 4RPNA 5ICQA 1KWHA 4OFOA 4U1ZA 1IXGA 4IO2A 3B6TA 2QRYA 4GFRA 4KFQA 2G93A 2ONSA 2QS2A 2UVHA 3RY3A 3TAJA 5I84A 3O9PA 1ELJA 2W7YA 3WAFA 4BDOA 5BUUA 5CM6A 2GFEA 1YAEA 1R9LA 2LAOA 5CC2A 3CSGA 2F36A 1N76A 3HN0A 1DPPA 5I2NB 3ZKKA 2Y84A 2O7IA 3R7XA 1LSTA 2FYIA 3LSWA 4H5GA 3WAEA 4HCWA 5H8HB 2AL4A 3BFUA 3LSXA 3K1MA 3O66A 3VXBA 3C32A 3KSXA 1MM7A 1USYE 3MVYA 4X48A 4C0RA 2QJEA 2Y7IA 1TT1A 3CVGA 4YB5A 4PQJA 2VGQA 3MVZA 2V3UA 3PD8A 1F9BA 4ZEFA 5IKBA 3TTNA 2Q88A 3HPIA 4JSOA 5KDTB 3FJ7A 1ZMGA 1GV8A 4KCDA 3GZGA 3Q29A 5EHMA 3S9LC 1TWYA 2R9JA 2FA7A 1SD3A 4O3AA 5DVJA 4ELOA 4EXKA 3MVWA 3PUWE 3VV5A 3UA8A 5H8QB 4GOTA 4H6DA 2GH9A 2GHAA 1LCFA 1OVTA 2QS1A 3KN3A 4LZ8A 1DSNA 4R75A 3SEVA 4ZZAA 4X9TA 4QFPA 4DLDA 3EHUA 3SESA 4OEVA 2YJPA 1A7LA 4OVJA 1QKBA 1NL5A 1R9QA 2B3FA 2X26A 1P1QA 3VVFA 3ZKLA 4I9DA 3KJ7A 2F97A 5I59A 4JWOA 1Z7NE 4BDLA 3L6HA 3O6GA 3ODBA 1FQCA 3KZGA 4IY6A 3S4UA 2F6GA 3E13X 4G68B 3MW0A 1B7HA 4NE4A 3U94A 1PDAA 1EZOA 3QAXA 1HSJA 5HM4B 1MQHA 3V89B 4EQBA 3G3JA 3RGYA 2NVUB 2UVJA 1QUIA 3OO6A 4KCCA 4YKIA 3BKIB 3K00A 3FVGA 3OEMA 5BWJA 2O6AA 1Y1MA 3T93B 1B5HA 1GTKA 3K6WA 3O6IA 4I1DA 4JWYA 3Q25A 4R6HA 4R72A 5TP9A 5H8FA 4G8MA 4H1XA 3Q27A 2VD3A 2HZLA 3VVDA 2XXRA 1MXUA 4HTGA 4RK2A 3O28A 4P0GA 5TU0A 2DS9A 2I48A 2REGA 3GBBA 4YZZA 4YKPA 5TPAB 2ZNTA 1IEJA 1URSA 2Z22A 2ZYMA 1B52A 3PPNA 4XKPA 1H43A 1MQDA 2ZYOA 4RY1A 1DMBA 1B3FA 1NNTA 1UTHB 3OSRA 4QSDA 2XD2A 5F7VA 3MBPA 3K01A 3FGSA 5HPQA 4EQ9A 1LFHA 4NF5A 3MPLA 1MM6A 3TTLA 1NMUA 4RK9A 2O1MA 1JW4A 3DP6A 1Q35A 2I4CA 1MXWA 3IOWA 2NWJA 3RTWB 4BLAA 5B7DA 3MVXA 1AOVA 1A40A 4N6PA 1WVJA 3HCQA 4ONYA 2P0SA 1XVXA 1IQ7A 3JV9A 1D4NA 2XX8A 5EHSA 3K6XA 1S9TA 2Q89A 3CFLA 1VFEA 2DE3A 4F2QA 4LATA 4BDQA 4EF1A 3QYTA 1LBCA 4IB2A 1I6AA 3H6TA 5ITPA 1B3LA 1SQYA 1ZTYA 3MAMA 1DTZA 4C1UA 1SW1A 1IXIA 4M1VA 3B7DA 4JWXA 4XXUA 4LQ5A 4P0IA 4U21A 4BDNA 1XC1A 3IOUA 1BIYA 2H25A 2Z8DA 2ZYNA 2DP8A 3TDJA 4YKJA 2V93A 5H8NA 1FTMA 3FJGA 1MS7A 5DTBA 3VLVA 3LBSA 3VVEA 5AA2D 1B4HA 2GHBA 4H67A 4H65A 3N94A 4JBZA 3FVNA 1MXVA 1J1NA 1NNFA 1NFTA 3H03A 3W9WA 4BDRA 4DXBA 2VP1A 5CBRA 1T0KA 3HHGA 1ZU0A 2PT1A 1LBBA 3O2AA 2UXAA 3PMWA 4NF8A 5FHNA 4ZEBA 5ICTA 1OMPA 1QW0A 2WKYA 5ELVA 3RT6B 4LQ2A 4OXVA 4JB7A 4LUBA 4ZDMA 3T9UA 4DXCA 3KOTA 2E1SA 1O7TA 3PD9A 4QFOA 4BDMA 1D9VA 1B32A 1JVXA 2V3TA 1LFGA 1MY1A 1NNPA 4NTLA 4THIA 5CRYA 2NUVA 3K0VA 2DWAA 2V25A 2Z8FA 5I57A 4IO7A 1B5IA 1BP5A 1LLSA 1M5BA 2QSXA 3FVOA 3MC2A 5CMCA 1Y20A 2ZNUA 4YMAA 5IAIA 1RKMA 2Q2AA 3MP8A 4DCXA 5JTYA 1OLAA 1FQBA 3ECRA 1LFIA 4OFJA 5K2XA 4ZECA 2M8CA 4OQOA 3SEUA 2QPQA 3I3VA 1LB8A 3LR1A 5CBSA 2UVGA 4YMBA 3CI8A 2QS4A 2YPNA 2D21A 2I3VA 4GRKA 4G77A 1YTVA 4Q8RA 4GVOA 1BKAA 1Y3NA 3EPEA 2ALUA 2AYSA 3DM0A 3G3GA 1B3GA 3I5OA 1H44A 4ND9A 3CG3A 3EHTA 3O29A 3SEWA 1SW4A 5CI5A 3UGWA 4KR5A 4DCYA 1GVCA 3R6UA 1UIUA 1RYOA 1Q1KA 1OIBA 2YLNA 2ZYKA 3CRBA 3ILUB 1JEUA 1N3XA 3FV1A 2OZZA 3C36A 1SI0A 4L17A 2Q8JA 4DE8A 2XXHA 3A3UA 5DEXB 4F2OA 3KN7A 5ISUA 1ZJLA 3IB2A 3EF7A 5AA2A 5J1DA 3U8QA 2Z23A 5I58A 2QMXA 3MZBA 4PFTA 2O1LA 3ZSFA 2PVUA 4DXUA 3N26A 3CG1A 3D4GA 3C33A 2DXRA 3TQLA 4YAHX 5KDTA 2E0SA 1Z7ME 3QUJA 4NEDA 2HFBA 1UQWA 2REJA 4QSEA 1JVYA 1D3KA 4UA8A 5I2KA 3UORA 3TODA 4OHNA 3EN3A 3FXQA 1NNKA 3MUQA 4MLQA 4GL8A 5I2NA 1RYXA 4ELQA 5HBCA 1N04A 2XXVA 1UTHA 3PPRA 2H9BA 1P1NA 1PB7A 2I6EA 4NF6A 2ONKE 2XXUA 5CMMA 4FIMA 1B5JA 2Y7KA 3FJMA 2OK2A 1IITA 1MRPA 2DVZA 4HS7A 4AB5A 1I6BA 1PEBA 4IO3A 1PBPA 2I0CA 1B9JA 4Q5TA 1Y4CA 2DXYA 4DDDA 1M5DA 1LAHE 3SDFA 3RLFE 5F1QA 3S9NC 3KSJA 5TP9B 1Y3QA 4LONB 1JETA 3K1PA 4ZS9A 4Z0IA 1MPDA 4ZZEA 1MQGA 1VE4A 1FCKA 5KZTA 4IGRA 2H5YA 4EXLA 4LZ5A 4AB6A 4FEBA 4F29A 3EQ1A 4DZ1A 4EQ7A 4G4PA 4PFUA 3PUZE 1MY4A 2ESNA 4U4XA 1I6QA 3PMVA 3MZ9A 5I59B 4ISUA 1B46A 5DVIA 1AIVA 4PFYA 2D5WA 3U93A 3TTMA 2PX1A 2DQVA 2THIA 1B3HA 4U23A 1MG1A 2AIXA 1US5A 3ONMA 3A09A 4NF4A 2I4BA 4ELPA 5I56B 3QK6A 2ANJA 2RC9A 3MP1A 1IZ1A 2V3QA 2RCBA 3BBRA 2VOZA 2XX9A 4NMYA 1GGGA 1GR2A 4FJPA 1AH5A 4OTEA 5CMBA 5H8QA 2XXIA 4ESXA 1FQAA 4ELRA 4PETA 1OLCA 3HV1A 3N6TA 3Q28A 4G2ZA 2ABHA 4X1DA 2HEUA 3M3FA 4I8CA 2I58A 3TFLA 2DE4A 4R9GA 1EU8A 2X7QA 3K4UA 3QSLA 4FE8A 4XKRA 1N0TA 1FQFA 1FQDA 1QVSA 5FHMA 4ESWA 4Z7EA 1LAFE 2G29A 2A5TB 3MJNA 4IGTA 4MBPA 1FTJA 4RYAA 4ECFA 1MDP1 2XHDA 1QKAA 1FTLA 5A5XB 2R6GE 2H99A 3IORA 3N5LA 3MZ1A 1AL3A 4KYSA 4NF4B 1SVXB 2RC8A 3OO7A 4G68C 4TOZA 1VR5A 3FXRA 1IXHA 1QUJA 3OENA 1SYIA 4IO6A 1MXZA 3FASA 1BLFA 2OWTA 3IX1A 1LAGE 3PMXA 4H8IA 5ITOA 3SETA 3C35A 4X1BA 4FAJA 2RF1A 2XXQA 2XXWA 3MWBA 5H8SA 5AA4A 4C1TA 2O51A 2Q9TA 3UK4A 2A5SA 3FZVA 3IK6B 4KQPA 2P1SA 3MPKA 2AL5A 1B6HA 1BTJA 2HAVA 3KN8A 2BJJX 1A8FA 3IO4A 3VLWA 1B51A 4Q30B 3IL1B 4RNSA 1ZLQA 4KYEA 4MFIA 4EDPA 4EF2A 3OEKA 4MF3A 3TPAA 4UACA 5JEIA 2FNCA 3M3KA 4KPTA 2F5XA 3H4ZA 2XXPA 3KEIA 4ZE8A 1NH8A 4TLMB 1B58A 2QL3A 3M8UA 2R71A 3CR9A 4YB6A 1Y1ZA 3IO6A 3K1NA 3KGCA 4QFKA 3OOAA 1B2HA 2O69A 2XXXA 3QUFA 3LC8A 1B4ZA 1USYH 3N6UA 3GXAA 3QIMA 4JXIA 4POXA 4Q0CA 3T9XB 3VFJA 4QF9A 4IO4A 1JQFA 4U22A 1ZBMA 3H6UA 5EYFA 3IJXB 3A3CA 2XX7A 3CIJA 4YU0A 2DE2A 2V84A 4JSDA 3RTFB 3TTKA 1IXCA 1MH4A 1P1WA 5AA4B 1B7ZA 1NH7A 3TTRA 2HCAA 3SEYA 3T22A 3FXUA 4F3SA 4F31B 3CFXA 3M3LA 2VHAA 4F39A 4QFNA 3C4MA 4IO5A 4H0WA 3FIRA 1WDNA 3FD3A 3OD7A 3ILTB 4R9FA 2HQ0A 4NWCA 1PB8A 1DOTA 1LAXA 1MQJA 2A5TA 1FTKA 2RINA 3G7WA 3K6UA 1XVYA 3PUYE 3O97A 4H8JA 2OBGA 1PBQA 1A54A 3I6VA 4R6KA 4MLVA 3PU5A 1Y9UA 4EUOA 1MQIA 4WKMA 1QUKA 3H6WA 4N07A 3K2DA 4OYVA 5AA2B 1EZPA 4GQOA 4LP2B 3H7MA 2F34A 4PP0A 2I0BA 3U72A 5DEXA 1XHYA 4FEDA 4WEDA 1YPNA 5L9SA 3TKDA 3FVKA 3IOVA 2F78A 4LZ7A 3UP9A 5AA3A 3PPQA 3S9MC 3TEPA 3KG2A 5DT6A 1AMFA 5I56A 1B3EA 4K3FA 1SDXA 1MXXA 4POWA 4TQUQ 4XTCQ 2HAUA 1JNFA 3RQTA 1M5EA 1SYHA 1VFDA 4OZ9A 2DWJA 4OEUA 1A99A 1ATGA 2UYEA 4QRZA 1MY3A 5AA1A 3HHFA 3SEXA 3T9HB 1A55A 5FTIA 1YCJA 5K2YA 3SKPA 1OVBA 5DVFA 5FHOA 4F3PA 1ANFA 2O84X 1B1XA 3T66A 4ZEDA 4R73A 4GF8A 3TCHA 4FORA 1HSLA 1IUDA 1CE2A 5DYHA 1PB9A 1MXYA 5JTYB 3PGFA 4XIGQ 3EHSA 1MY0A 2PYYA 4RPOA 1SI1A 3TQWA 1DTGA 4ZE9A 4XKQA 4KHZE 2Y7WA 5H8HA 5KCJB 3QXMA 4PE5B 2XXTA 3OXNA 2O68A 2ZNSA 1SW2A 2OWSA 2Z8EA 3G3KA 4FECA 4GXSB 2B65A 4LA9A 2UYFA 4YKKA 3VDFA 3W15C 3V83A 3H06B 1FW0A 1SW5A 2CMOA 2I3WA 4F1UA 1L5TA 1B40A 4NF8B 3HSTA 4XKNA 3AXFA 1UTBB 4LVQA 3USDA 4NF6B 1N3WA 1OQGA 4GIZA 4R2BA 3B6WA 5L9OA 2B3BA 4F19A 1MH3A 3VLUA 3OO9A 5A5XA 1NKXA 2DVCA 1B0LA 1P1UA 2H4IA 2H98A 2PBWA 3L6GA 3THIA 1UTBA 4F1VA 3DP4A 4QHQA 1Y3PA 3G3IA 4ZEKA 3TMGA 1N84A 3G3FA 3PUVE 1JEVA 3RT8A 3R26A 3SERA 3TCFA 1II5A 3DP8A 4OERA 1LGBC 3H3GA
chains in the Genus database with same CATH superfamily
4GWXA 2Y7RA 4FATA 2OJTA 3K02A 4P11A 3OMBA 3MP6A 2DOJA 4OETA 3FV2A 2P2AA 1LEVA 1P1OA 4GWUA 4MIJA 4NF5B 4O3BA 2OWZA 3W9VA 4I62A 5L9MA 4AS5A 4WXJA 1CB6A 1TFDA 2RCAA 3PV0E 2GRVA 3DELB 4OENA 4QSCA 1MPBA 3K6VA 4IY5A 1B0HA 2F7AA 3IAZA 1QULA 4U1OA 5L8DA 2IA4A 2D3IA 4HW8A 4N17A 2VT5A 3RN8A 1A8EA 3MQ9A 2XXYA 1BK4A 4MH5A 4YB7A 1PC3A 3DLNA 3E4RA 3A29A 3P7IA 4GXAA 1I69A 1O63A 3HO7A 4NX1A 3FXBA 3VE1B 4H5FA 3RPWA 4OVQA 3E3KA 2ZXTA 3OELA 4DIGA 1POTA 1JW1A 2QVUA 4GWSA 3U92A 2KLFA 1D9YA 1KWHA 4OFOA 4KFQA 3TAJA 2W7YA 2GFEA 2O7IA 4H5GA 4HCWA 5H8HB 1MM7A 3MSTA 2QJEA 1TT1A 4YB5A 3HPIA 2ZZXA 4GWYA 5KDTB 4ELOA 4EXKA 3PUWE 2FBPA 5H8QB 2QS1A 4R75A 1QKBA 4FBPA 2X26A 1IMDA 1Z7NE 3ODBA 1EYJA 1D9QA 1B7HA 3U94A 1MQHA 4EQBA 3FBPA 3G3JA 2WYPA 1NUZA 3T93B 3K6WA 3O6IA 4FAJA 1YZ0A 3Q25A 3GBBA 4YZZA 5DW8A 2Z22A 3PPNA 1DMBA 1UTHB 3OSRA 5F7VA 4EQ9A 1IMAA 4NF5A 4OVRA 1MM6A 1NMUA 4P8BA 5B7DA 1A40A 4N91A 3JV9A 1FPLA 1VFEA 2WBDA 1LBCA 3H6TA 1SQYA 4U21A 2H25A 2DP8A 4YKJA 2V93A 1FTMA 3VVEA 5AA2D 3N94A 1FBPA 3W9WA 1T0KA 2VP1A 2MKZA 2UXAA 3PMWA 5FHNA 4ZEBA 4LUBA 3PD9A 4QFOA 4BDMA 1D9VA 1B32A 1JVXA 1LFGA 1NNPA 2NUVA 1BP5A 3FVOA 1RKMA 2QPQA 3I3VA 1LB8A 4UABA 1FPFA 4Q8RA 3DM0A 4ND9A 4PDDA 4KR5A 4DCYA 4MEVA 3FV1A 4L17A 2OZZA 3C36A 2XXHA 3A3UA 1ZJLA 5J1DA 5I58A 3MZBA 3ZSFA 2PVUA 4DXUA 3N26A 2DXRA 3TQLA 4YAHX 2E0SA 5LTCA 1JVYA 1NNKA 3MUQA 1RYXA 1UTHA 3PPRA 2XXUA 2QVRA 4FIMA 1B5JA 2Y7KA 1MRPA 4AB5A 1PEBA 3QMFA 2I0CA 2DXYA 4DDDA 1M5DA 3SDFA 3S9NC 2XA5A 4Z0IA 4HXVA 5KZTA 5T3JA 4F29A 2F3DA 4QBAA 3PUZE 1I6QA 4PTKA 3ROJA 4PFYA 2THIA 2V3QA 1KZ8A 5H8QA 4ESXA 1FQAA 2HEUA 2I58A 1EU8A 2X7QA 3K4UA 5FHMA 1LAFE 2G29A 2A5TB 2JJKA 4MBPA 1FTJA 2H99A 4PFIA 3VVFA 1SVXB 1VR5A 3FXRA 5H8HA 2WX9A 3SETA 4F3SA 2OWTA 1LAGE 3FZVA 3IK6B 4KQPA 1IMBA 3KN8A 1A8FA 3VLWA 3IL1B 4MFIA 2QVVA 1NUYA 4UACA 3H4ZA 2XXPA 4ZE8A 1NH8A 4YB6A 2QL3A 3M8UA 2R71A 4N4UA 3IO6A 5ET6A 2XXXA 1B4ZA 3QIMA 4DI3D 4QF9A 1ZBMA 3H6UA 2DE2A 1MH4A 3T22A 4GX6A 4QFNA 4H0WA 4R9FA 2HQ0A 1MQJA 2A5TA 4H8JA 1FPBA 1PBQA 1A54A 3I6VA 4JVCA 1FJ9A 4R6KA 4MLVA 1KA0A 3K2DA 4OYVA 5AA2B 1EZPA 1RDZA 3H7MA 1XHYA 4WEDA 1YPNA 3TKDA 3FVKA 1AMFA 4XTCQ 3RQTA 4OZ9A 2UYEA 4GX3A 4QRZA 1YCJA 1OVBA 5DVFA 5FHOA 4F3PA 2Y5LA 3T66A 1B1XA 2OX3A 1HSLA 4N8YA 1MXYA 1DCUA 4RPOA 1SI1A 1DTGA 2O68A 1SW2A 3G3KA 3V83A 1L5TA 1B40A 3AXFA 4LVQA 4R2BA 5A5XA 1NKXA 2DVCA 3THIA 2H98A 2PBWA 2CZHA 3DP4A 1N84A 4I40A 1JEVA 3SERA 3TCFA 4NHBA 1SPIA 1LGBC 2WEFA 4RJZA 1FTAA 2DWHA 1YYZA 4R74A 4E0WA 1R1NA 5KCJA 4O7IA 5I58B 2HHMA 3CSBA 4OESA 2OLBA 1WODA 1LB9A 3PUXE 1FQEA 2ONRA 3PPPA 1TXFA 5LOMA 2DSFA 3VXCA 1IMEA 4KD5A 2X7PA 1ZIUA 1EH3A 2PFZA 5FTHA 1US4A 2RKMA 2DWIA 5M2VA 1HSEA 1O64A 3S2VA 2QMWA 3BFTA 2F7CA 2HZKA 4XFEA 3RUMA 4KI0E 4OMBA 3KJTA 2PCRA 1URGA 2NXOA 4PAKA 3IR1A 4E0XA 1JW5A 1MDQA 1URDA 1M5FA 4PBHA 2UVIA 3B6QA 1XT8A 2XD3A 4N13A 1P99A 1IIWA 4G8NA 3C34A 2F7BA 3LSFB 3IJOB 4OFLA 5IZZA 3V8XB 2DYXA 1K9ZA 4PAIA 3H6VA 4F18A 4O8MA 3GBAA 4F3GA 4N8GA 3JYRA 3KC0A 1S7YA 3T96B 3TUSA 1IXGA 4GFRA 2ONSA 2QS2A 2UVHA 3O9PA 1ELJA 5CM6A 1LBYA 1YAEA 2LAOA 3CSGA 2F36A 1LSTA 3LSWA 2AL4A 3BFUA 1F9BA 3TTNA 4JVDA 1GV8A 4KCDA 3GZGA 4MAGA 1LBVA 1TWYA 2FA7A 3MVWA 2FIXA 4GOTA 1LCFA 1OVTA 4LZ8A 1DSNA 3SEVA 3SESA 1A7LA 1R9QA 1P1QA 2WYKA 1NV2A 3ZKLA 4JWOA 1RDYA 3E13X 1PDAA 3GYYA 3QAXA 4MCOA 2UVJA 2P3VA 1GTKA 4I1DA 4JWYA 4R6HA 4GX4A 4R72A 5TP9A 2XWVA 2VD3A 3Q27A 2XXRA 4RK2A 5TU0A 2DS9A 2REGA 1IMCA 5TPAB 2ZNTA 2ZYMA 5CBRA 2ZYOA 4QSDA 2XD2A 3K01A 3MPLA 1JW4A 1MXWA 3MVXA 1D4NA 2XX8A 3CFLA 4EF1A 4BDQA 4IB2A 1B3LA 2CEXA 3MAMA 1DTZA 1SW1A 1IXIA 4M1VA 3B7DA 4P0IA 1BIYA 2ZYNA 3FJGA 1INPA 5EQ7A 4H67A 2GHBA 4H65A 3FVNA 3HHGA 1ZU0A 4NF8A 5ICTA 4ZDMA 4DXCA 3KOTA 1O7TA 1NUWA 2V3TA 4NTLA 5CRYA 2QSXA 3MC2A 5CMCA 1Y20A 1RDXA 4KXPA 5ET8A 1OLAA 3ECRA 4OFJA 3SEUA 2YPNA 2D21A 2I3VA 4GRKA 3I5OA 1B3GA 3UGWA 3O29A 1SW4A 4NG7A 2YLNA 2Q8JA 4XEQA 4F2OA 3IB2A 2Z23A 5IZ1A 5IZ3A 4OANA 4PFTA 3CG1A 1Z7ME 3QUJA 1LBZA 3TODA 4ELQA 2H9BA 2ONKE 2PFYA 3FJMA 1I6BA 4GBVA 1AWBA 4MMPA 1LAHE 2XWIA 4LONB 1MPDA 1MQGA 3EQ1A 4G4PA 4PFUA 4U4XA 3SZPA 1B46A 1FSAA 2D5WA 2PX1A 4U23A 4GWWA 1US5A 3ONMA 3A09A 4NF4A 1IZ1A 2DDKA 1GR2A 4FJPA 1AH5A 4OTEA 5CMBA 2XXIA 3HV1A 3Q28A 4G2ZA 4PE3A 3M3FA 1FQFA 1FQDA 1QVSA 4ESWA 4Z7EA 1MDP1 2XHDA 2R6GE 4G68C 1SYIA 4IO6A 1MXZA 3FASA 4X1BA 2RF1A 5AA4A 4C1TA 3LV0A 3UK4A 1BTJA 2HAVA 3IO4A 4RNSA 2L5VA 4EDPA 4MF3A 2Y5KA 3M3KA 3HFUA 4TLMB 4P9KA 1Y1ZA 4AS4A 3KGCA 1FPDA 1B2HA 2O69A 2GQ1A 1USYH 3T9XB 3VFJA 4JXIA 1JQFA 1B7ZA 4IR8A 2KQZA 3FXUA 3FD3A 3ILTB 5EQAA 4NWCA 5L9OA 1LAXA 2OBGA 1QUKA 4P1LA 3H6WA 3U72A 2I0BA 5DEXA 4LZ7A 5AA3A 3S9MC 3TEPA 3KG2A 1B3EA 4TQUQ 1QGXA 1SYHA 3T9HB 1A99A 1DBZA 1MY3A 5AA1A 1ANFA 2O84X 1DK4A 2FHYA 4ZEDA 4GF8A 3TCHA 4NAPA 5DYHA 5JTYB 3PGFA 4PDHA 1MY0A 1VDWA 3TQWA 4ZE9A 3CHGA 2Y7WA 2XXTA 3OXNA 1KA1A 2OWSA 4FECA 2B65A 4LA9A 2UYFA 1FW0A 1SW5A 2CMOA 2I3WA 3HSTA 1UTBB 4NF6B 4N81A 4GIZA 1P1UA 1B0LA 2H4IA 4F1VA 3E79A 4ZEKA 3G3FA 3PUVE 1EYKA 1II5A 4OERA 3D1RA 5CMKA 2VD2A 3IB1A 3V5AA 3G3HA 3U1OA 1MY2A 1XS5A 4YICA 1N7WA 3F11A 3KFMA 4F1YA 2Y7PA 1H76A 4M4GA 5I2KB 4O7MA 3Q26A 4R6YA 1FBHA 1NV7A 4HCYA 3VLUA 3FUZA 3U65A 2CZLA 3RNNA 3D4CA 1EZ9A 5H8FB 1MPCA 2RC7A 4G68A 1XOCA 1FTOA 1R6ZA 3T9VA 3TCGA 2NOOA 1QJMA 4KYDA 4NWDA 4QFLA 1LCTA 4RA1A 2F6PA 1S50A 1UIVA 3KOSA 2HXWA 1FJ6A 3JZJA 2QS3A 4TLLB 3LUYA 3TZAA 1G0IA 3KBRA 4PBQA 1M5CA 2IEEA 4RXLA 4U4SA 2PT2A 2PMSA 4WEPA 5JK4A 4R2FA 4U1ZA 3LUZA 3B6TA 5I84A 4BDOA 4O94A 3HN0A 1NI9A 2Y84A 3K1MA 3C32A 3KC1A 3MVYA 2Y7IA 2V3UA 2FVZA 1ZMGA 1NV4A 3Q29A 5IZ3B 3S9LC 2R9JA 1SD3A 4O3AA 5DVJA 3UA8A 4H6DA 2GHAA 4N15A 3EHUA 4PGNA 5I7IA 2B3FA 4I9DA 5I59A 2F97A 4BDLA 2HXRA 1FQCA 3KZGA 4G68B 4NE4A 5EYHA 4KCCA 1QUIA 3OO6A 4YKIA 3OEMA 3FVGA 1B5HA 5H8FA 4G8MA 1MXUA 4H46A 4HTGA 4P0GA 2I48A 1IEJA 5IGAA 5I2NA 1H43A 4MNCA 4RY1A 1B3FA 3FGSA 3TTLA 3RTWB 2O1MA 2NWJA 1Q35A 4BLAA 1AOVA 4N6PA 1WVJA 4ONYA 2P0SA 4MJOA 1XVXA 5EHSA 1IMFA 1S9TA 2DE3A 4F2QA 4LATA 3QYTA 2Q74A 1K9YA 4LQ5A 2Q8MA 4BDNA 3IOUA 5H8NA 3VLVA 1FPKA 3LBSA 1MXVA 1J1NA 1NNFA 3EKIA 2B4LA 4BDRA 2XWOA 2PT1A 1LBBA 3O2AA 1OMPA 2WKYA 4OXVA 4JB7A 3T9UA 3B50A 1MY1A 2Z8FA 5I57A 4IO7A 1B5IA 1LLSA 2ZNUA 4YMAA 2Q2AA 4DCXA 5JTYA 5ET5A 2WBBA 3LR1A 5CBSA 3KBZA 4G77A 1YTVA 4OVTA 1Y3NA 3EPEA 2ALUA 3G3GA 1H44A 3CG3A 5CI5A 1GVCA 1UIUA 1RYOA 4JVIA 1CNQA 1JEUA 1N3XA 4DE8A 5ISUA 5DEXB 3T1BA 1XI6A 3EF7A 2QMXA 2O1LA 3D4GA 2HFBA 2REJA 4QSEA 3UORA 1FBCA 4OHNA 1N04A 1PB7A 4NF0A 2I6EA 5CMMA 2OK2A 1IITA 2DVZA 4QXDA 4Q5TA 1Y4CA 2CEYA 3RLFE 5F1QA 1FBDA 3KSJA 1JETA 3K1PA 1FBFA 4ZS9A 1FCKA 4IGRA 2H5YA 4EXLA 4LZ5A 4AB6A 4FEBA 1FPGA 1MY4A 2ESNA 5I59B 3MYUA 4HE1A 1B3HA 2AIXA 4MNIA 4XF5A 4ELPA 5I56B 2RC9A 3BBRA 2XX9A 1OLCA 2ABHA 4X1DA 4I8CA 4HE0A 3TFLA 3QSLA 4FE8A 4XKRA 4IGTA 4ECFA 1NV1A 3USDA 4NF4B 3MZ1A 4TOZA 3OO7A 2RC8A 4ZECA 4PCDA 1IXHA 1BLFA 3IX1A 3E78A 3SEWA 3C35A 2XXQA 5H8SA 2Q9TA 2A5SA 2P1SA 1B6HA 4Q30B 1ZLQA 4KYEA 5JEIA 2FNCA 3KEIA 1B58A 3CR9A 4QFKA 3OOAA 3LC8A 4GBWA 4U22A 3A3CA 2XX7A 4YU0A 1IXCA 1P1WA 3TTRA 2HCAA 3SEYA 4F31B 3M3LA 4F39A 3B8BA 3C4MA 4IO5A 3FIRA 1WDNA 5EYGA 1FTKA 2RINA 1XVYA 4I3YA 4EUOA 4N07A 4GQOA 4LP2B 4FEDA 5L9SA 3RYDA 3PPQA 5I56A 4K3FA 4POWA 2HAUA 1M5EA 4DI4B 1ATGA 1A55A 5FTIA 5K2YA 4R73A 4FORA 5EQ9A 1PB9A 4XKQA 2B4MA 2ZNSA 2Z8EA 4N6KA 4GXSB 4PFRA 3W15C 4YKKA 1NV6A 4NF8B 4XKNA 1N3WA 1OQGA 3B6WA 3L6GA 1FRPA 1UTBA 1Y3PA 1NV0A 3R26A 3DP8A 1FBGA 1OQHA 5F24A 1B05A 2F35A 3OO8A 4F22A 4G8HA 4ZEIA 3UN6A 4MHFA 1VSOA 4P56A 1TFAA 4PAFA 3S9EA 3FATA 3C9HA 1N7XA 2F8DA 4AQ4A 4F3BA 5TPAA 2VPNA 4GLIA 1POY1 3PPOA 4DZ1A 5ITPA 3TYHA 3ZS6A 5B70A 3LSLA 4OWDA 5I57B 3IB0A 5AE4A 4PFWA 2Q2CA 4U2RA 4G61A 1SBPA 3ISPA 3O6HA 2I49A 1NUXA 2O7UA 2OCUA 2ZZWA 3C31A 3UIFA 1B7UA 1B1HA 4GWOA 3E9XA 5HBCA 3CFZA 1DPEA 3IOTA 3TELA 4GL0A 4P47A 5H8NB 1H3DA 3OSQA 3BIHA 4O3CA 1H45A 3GLBA 1ZKBA 1Y4TA 2ZMBA 4GD5A 4JDFA 4RPNA 5ICQA 4IO2A 3RY3A 2QRYA 2G93A 5BUUA 3WAFA 2FIEA 1R9LA 5CC2A 3NOHA 1N76A 1DPPA 5I2NB 3ZKKA 4LN5A 3R7XA 3WAEA 2FYIA 2V4CA 3LSXA 3O66A 3VXBA 3KSXA 1USYE 4X48A 4C0RA 3CVGA 4PQJA 2VGQA 5IM2A 3MVZA 3PD8A 4ZEFA 5IKBA 2Q88A 4JSOA 2XXKA 4HE2A 3FJ7A 5EHMA 3VV5A 2GH9A 3KN3A 4ZZAA 4X9TA 4QFPA 4DLDA 4OEVA 2YJPA 4OVJA 1NL5A 4P1EA 4PC9A 3IFAA 3KJ7A 4I3EA 3L6HA 3O6GA 2F3BA 2R8TA 3S4UA 4IY6A 2F6GA 3MW0A 1EZOA 5HM4B 1HSJA 3V89B 3RGYA 2NVUB 5BWJA 3BKIB 3K00A 2O6AA 1Y1MA 4H1XA 3VVDA 2HZLA 5ET7A 3O28A 2CZIA 4YKPA 1URSA 1B52A 4XKPA 1MQDA 4MX6A 1NNTA 2BJIA 3MBPA 5HPQA 1LFHA 4RK9A 3DP6A 2I4CA 3IOWA 3HCQA 1IQ7A 3K6XA 2Q89A 2ZZVA 5A5LA 1I6AA 1ZTYA 4C1UA 3PTYA 4PF6A 4JWXA 4XXUA 1XC1A 2Z8DA 3TDJA 1MS7A 5DTBA 1FBEA 1B4HA 4PFBA 4OVSA 4JBZA 4DXBA 3H03A 1NFTA 1QW0A 5ELVA 3RT6B 4LQ2A 2E1SA 4THIA 3K0VA 2DWAA 2V25A 2VPOA 4X04A 1M5BA 1EYIA 5IAIA 3MP8A 1FQBA 1LFIA 5K2XA 2M8CA 4OQOA 2UVGA 4YMBA 3CI8A 2QS4A 4OA4A 4GVOA 1BKAA 5I2KA 2AYSA 4POXA 3EHTA 3R6UA 1Q1KA 1OIBA 2ZYKA 3CRBA 3ILUB 1SI0A 3KN7A 2CZKA 5AA2A 3U8QA 4OVPA 3C33A 5KDTA 4NEDA 1UQWA 1D3KA 4UA8A 1JP4A 3EN3A 3FXQA 4MLQA 4GL8A 4N6DA 2XXVA 1P1NA 4NF6A 4HS7A 4IO3A 4PGPA 4P3LA 1PBPA 1B9JA 5TP9B 1Y3QA 4ZZEA 1VE4A 2KR0A 4EQ7A 4NGUA 3BIGA 3PMVA 3MZ9A 1FPEA 1NV3A 4ISUA 5DVIA 1AIVA 3U93A 3TTMA 5ESYA 2DQVA 1MG1A 1G0HA 2I4BA 3QK6A 2ANJA 3MP1A 4NMYA 2RCBA 2VOZA 1GGGA 4PF8A 4ELRA 4PETA 3N6TA 2DE4A 4R9GA 1N0TA 3MJNA 4RYAA 1QKAA 1FTLA 3IORA 3N5LA 4KYSA 1AL3A 4X8RA 4MNPA 3OENA 1QUJA 3PMXA 5ITOA 4H8IA 3MWBA 2XXWA 2O51A 3MPKA 2AL5A 2BJJX 1B51A 4NQ8A 5I3SA 4EF2A 3OEKA 3TPAA 4KPTA 2F5XA 3K1NA 3QUFA 3RPLA 3T0JA 3N6UA 3GXAA 4Q0CA 4IO4A 5EYFA 3IJXB 3CIJA 2V84A 4JSDA 3RTFB 3TTKA 5AA4B 1NH7A 2XWKA 1YXIA 3CFXA 2VHAA 2P3NA 2QFLA 5EQ8A 3OD7A 1PB8A 1DOTA 3K6UA 3G7WA 3PUYE 3O97A 5FBPA 3PU5A 1Y9UA 1MQIA 4WKMA 4PP0A 2F34A 3IOVA 2F78A 3UP9A 5DT6A 1FPIA 1SDXA 1MXXA 1JNFA 1LBWA 1VFDA 2DWJA 4OEUA 3SEXA 3HHFA 4NN3A 3SKPA 5LDZA 1IUDA 1CE2A 5J16A 4XIGQ 3EHSA 5I5PA 2PYYA 4KHZE 5KCJB 3QXMA 4PE5B 4GWZA 4H45A 2HPGA 1FPJA 1NV5A 3VDFA 3H06B 4F1UA 1LBXA 3IFCA 1Q9DA 2B3BA 4F19A 1MH3A 5A5XB 3OO9A 4QHQA 3G3IA 3TMGA 3RT8A 3H3GA 3RPLB
chains in the Genus database with same CATH topology
5CMKA 4RJZA 2VD2A 2DWHA 2Y7RA 1OQHA 4R74A 4E0WA 1R1NA 3IB1A 3V5AA 4FATA 3G3HA 2OJTA 5KCJA 1B05A 2F35A 3OO8A 3U1OA 5I58B 3CSBA 3K02A 4OESA 2OLBA 1MY2A 1WODA 1XS5A 4P11A 3OMBA 1LB9A 4YICA 4F22A 3PUXE 1FQEA 2ONRA 1N7WA 3MP6A 2DOJA 3PPPA 4G8HA 4OETA 1TXFA 3FV2A 2P2AA 3F11A 4ZEIA 3KFMA 5LOMA 2DSFA 1P1OA 4F1YA 2Y7PA 1H76A 3UN6A 3VXCA 1VSOA 4KD5A 4NF5B 4O3BA 2X7PA 1TFAA 3W9VA 1ZIUA 4I62A 4M4GA 5I2KB 5L9MA 1EH3A 3S9EA 3FATA 5FTHA 1US4A 2RKMA 3Q26A 2DWIA 3C9HA 4R6YA 5M2VA 1N7XA 2F8DA 4WXJA 4AQ4A 4F3BA 1CB6A 1HSEA 1O64A 1TFDA 2RCAA 4HCYA 2QMWA 5TPAA 3BFTA 3S2VA 3PV0E 1POY1 2F7CA 3FUZA 2CZLA 2GRVA 2HZKA 3PPOA 4GLIA 3RUMA 3RNNA 4KI0E 4OMBA 3DELB 3TYHA 3KJTA 3ZS6A 3D4CA 4OENA 4QSCA 1URGA 5B70A 1EZ9A 1MPBA 2NXOA 3K6VA 3LSLA 4IY5A 4OWDA 5H8FB 3IR1A 1B0HA 5I57B 4E0XA 3IB0A 5AE4A 1JW5A 4PFWA 1MDQA 1URDA 1MPCA 1M5FA 2F7AA 2Q2CA 3IAZA 2UVIA 4U2RA 1QULA 1SBPA 4U1OA 2RC7A 3O6HA 3B6QA 5L8DA 1XT8A 4G68A 2I49A 2IA4A 2XD3A 4N13A 2D3IA 1P99A 4HW8A 1IIWA 4G8NA 1XOCA 2O7UA 1FTOA 3C34A 2F7BA 1R6ZA 3LSFB 3T9VA 2OCUA 3IJOB 4OFLA 3RN8A 1A8EA 3MQ9A 3C31A 3UIFA 3TCGA 1B7UA 1B1HA 1QJMA 2NOOA 2XXYA 3E9XA 4GWOA 4KYDA 4NWDA 4QFLA 3CFZA 3V8XB 1LCTA 4RA1A 2DYXA 1S50A 2F6PA 4MH5A 1UIVA 1DPEA 1PC3A 3DLNA 3KOSA 3E4RA 4YB7A 3IOTA 4GXAA 3P7IA 3H6VA 3TELA 4GL0A 2HXWA 5H8NB 1I69A 1O63A 3HO7A 4F18A 3JZJA 2QS3A 4TLLB 3LUYA 1H3DA 3VE1B 3TZAA 4H5FA 3RPWA 3OSQA 3E3KA 2ZXTA 3GBAA 3OELA 4O3CA 1H45A 3GLBA 3KBRA 4DIGA 1M5CA 2IEEA 4RXLA 4U4SA 1ZKBA 1Y4TA 2PT2A 4F3GA 1POTA 3JYRA 1JW1A 1S7YA 2PMSA 4WEPA 2ZMBA 3T96B 5JK4A 4GD5A 3TUSA 4JDFA 2KLFA 3U92A 1D9YA 4R2FA 4RPNA 5ICQA 1KWHA 4OFOA 4U1ZA 1IXGA 4IO2A 3B6TA 2QRYA 4GFRA 4KFQA 2G93A 2ONSA 2QS2A 2UVHA 3RY3A 3TAJA 5I84A 3O9PA 1ELJA 2W7YA 3WAFA 4BDOA 5BUUA 5CM6A 2GFEA 1YAEA 1R9LA 2LAOA 5CC2A 3CSGA 2F36A 1N76A 3HN0A 1DPPA 5I2NB 3ZKKA 2Y84A 2O7IA 3R7XA 1LSTA 2FYIA 3LSWA 4H5GA 3WAEA 4HCWA 5H8HB 2AL4A 3BFUA 3LSXA 3K1MA 3O66A 3VXBA 3C32A 3KSXA 1MM7A 1USYE 3MVYA 4X48A 4C0RA 2QJEA 2Y7IA 1TT1A 3CVGA 4YB5A 4PQJA 2VGQA 3MVZA 2V3UA 3PD8A 1F9BA 4ZEFA 5IKBA 3TTNA 2Q88A 3HPIA 4JSOA 5KDTB 3FJ7A 1ZMGA 1GV8A 4KCDA 3GZGA 3Q29A 5EHMA 3S9LC 1TWYA 2R9JA 2FA7A 1SD3A 4O3AA 5DVJA 4ELOA 4EXKA 3MVWA 3PUWE 3VV5A 3UA8A 5H8QB 4GOTA 4H6DA 2GH9A 2GHAA 1LCFA 1OVTA 2QS1A 3KN3A 4LZ8A 1DSNA 4R75A 3SEVA 4ZZAA 4X9TA 4QFPA 4DLDA 3EHUA 3SESA 4OEVA 2YJPA 1A7LA 4OVJA 1QKBA 1NL5A 1R9QA 2B3FA 2X26A 1P1QA 3VVFA 3ZKLA 4I9DA 3KJ7A 2F97A 5I59A 4JWOA 1Z7NE 4BDLA 3L6HA 3O6GA 3ODBA 1FQCA 3KZGA 4IY6A 3S4UA 2F6GA 3E13X 4G68B 3MW0A 1B7HA 4NE4A 3U94A 1PDAA 1EZOA 3QAXA 1HSJA 5HM4B 1MQHA 3V89B 4EQBA 3G3JA 3RGYA 2NVUB 2UVJA 1QUIA 3OO6A 4KCCA 4YKIA 3BKIB 3K00A 3FVGA 3OEMA 5BWJA 2O6AA 1Y1MA 3T93B 1B5HA 1GTKA 3K6WA 3O6IA 4I1DA 4JWYA 3Q25A 4R6HA 4R72A 5TP9A 5H8FA 4G8MA 4H1XA 3Q27A 2VD3A 2HZLA 3VVDA 2XXRA 1MXUA 4HTGA 4RK2A 3O28A 4P0GA 5TU0A 2DS9A 2I48A 2REGA 3GBBA 4YZZA 4YKPA 5TPAB 2ZNTA 1IEJA 1URSA 2Z22A 2ZYMA 1B52A 3PPNA 4XKPA 1H43A 1MQDA 2ZYOA 4RY1A 1DMBA 1B3FA 1NNTA 1UTHB 3OSRA 4QSDA 2XD2A 5F7VA 3MBPA 3K01A 3FGSA 5HPQA 4EQ9A 1LFHA 4NF5A 3MPLA 1MM6A 3TTLA 1NMUA 4RK9A 2O1MA 1JW4A 3DP6A 1Q35A 2I4CA 1MXWA 3IOWA 2NWJA 3RTWB 4BLAA 5B7DA 3MVXA 1AOVA 1A40A 4N6PA 1WVJA 3HCQA 4ONYA 2P0SA 1XVXA 1IQ7A 3JV9A 1D4NA 2XX8A 5EHSA 3K6XA 1S9TA 2Q89A 3CFLA 1VFEA 2DE3A 4F2QA 4LATA 4BDQA 4EF1A 3QYTA 1LBCA 4IB2A 1I6AA 3H6TA 5ITPA 1B3LA 1SQYA 1ZTYA 3MAMA 1DTZA 4C1UA 1SW1A 1IXIA 4M1VA 3B7DA 4JWXA 4XXUA 4LQ5A 4P0IA 4U21A 4BDNA 1XC1A 3IOUA 1BIYA 2H25A 2Z8DA 2ZYNA 2DP8A 3TDJA 4YKJA 2V93A 5H8NA 1FTMA 3FJGA 1MS7A 5DTBA 3VLVA 3LBSA 3VVEA 5AA2D 1B4HA 2GHBA 4H67A 4H65A 3N94A 4JBZA 3FVNA 1MXVA 1J1NA 1NNFA 1NFTA 3H03A 3W9WA 4BDRA 4DXBA 2VP1A 5CBRA 1T0KA 3HHGA 1ZU0A 2PT1A 1LBBA 3O2AA 2UXAA 3PMWA 4NF8A 5FHNA 4ZEBA 5ICTA 1OMPA 1QW0A 2WKYA 5ELVA 3RT6B 4LQ2A 4OXVA 4JB7A 4LUBA 4ZDMA 3T9UA 4DXCA 3KOTA 2E1SA 1O7TA 3PD9A 4QFOA 4BDMA 1D9VA 1B32A 1JVXA 2V3TA 1LFGA 1MY1A 1NNPA 4NTLA 4THIA 5CRYA 2NUVA 3K0VA 2DWAA 2V25A 2Z8FA 5I57A 4IO7A 1B5IA 1BP5A 1LLSA 1M5BA 2QSXA 3FVOA 3MC2A 5CMCA 1Y20A 2ZNUA 4YMAA 5IAIA 1RKMA 2Q2AA 3MP8A 4DCXA 5JTYA 1OLAA 1FQBA 3ECRA 1LFIA 4OFJA 5K2XA 4ZECA 2M8CA 4OQOA 3SEUA 2QPQA 3I3VA 1LB8A 3LR1A 5CBSA 2UVGA 4YMBA 3CI8A 2QS4A 2YPNA 2D21A 2I3VA 4GRKA 4G77A 1YTVA 4Q8RA 4GVOA 1BKAA 1Y3NA 3EPEA 2ALUA 2AYSA 3DM0A 3G3GA 1B3GA 3I5OA 1H44A 4ND9A 3CG3A 3EHTA 3O29A 3SEWA 1SW4A 5CI5A 3UGWA 4KR5A 4DCYA 1GVCA 3R6UA 1UIUA 1RYOA 1Q1KA 1OIBA 2YLNA 2ZYKA 3CRBA 3ILUB 1JEUA 1N3XA 3FV1A 2OZZA 3C36A 1SI0A 4L17A 2Q8JA 4DE8A 2XXHA 3A3UA 5DEXB 4F2OA 3KN7A 5ISUA 1ZJLA 3IB2A 3EF7A 5AA2A 5J1DA 3U8QA 2Z23A 5I58A 2QMXA 3MZBA 4PFTA 2O1LA 3ZSFA 2PVUA 4DXUA 3N26A 3CG1A 3D4GA 3C33A 2DXRA 3TQLA 4YAHX 5KDTA 2E0SA 1Z7ME 3QUJA 4NEDA 2HFBA 1UQWA 2REJA 4QSEA 1JVYA 1D3KA 4UA8A 5I2KA 3UORA 3TODA 4OHNA 3EN3A 3FXQA 1NNKA 3MUQA 4MLQA 4GL8A 5I2NA 1RYXA 4ELQA 5HBCA 1N04A 2XXVA 1UTHA 3PPRA 2H9BA 1P1NA 1PB7A 2I6EA 4NF6A 2ONKE 2XXUA 5CMMA 4FIMA 1B5JA 2Y7KA 3FJMA 2OK2A 1IITA 1MRPA 2DVZA 4HS7A 4AB5A 1I6BA 1PEBA 4IO3A 1PBPA 2I0CA 1B9JA 4Q5TA 1Y4CA 2DXYA 4DDDA 1M5DA 1LAHE 3SDFA 3RLFE 5F1QA 3S9NC 3KSJA 5TP9B 1Y3QA 4LONB 1JETA 3K1PA 4ZS9A 4Z0IA 1MPDA 4ZZEA 1MQGA 1VE4A 1FCKA 5KZTA 4IGRA 2H5YA 4EXLA 4LZ5A 4AB6A 4FEBA 4F29A 3EQ1A 4DZ1A 4EQ7A 4G4PA 4PFUA 3PUZE 1MY4A 2ESNA 4U4XA 1I6QA 3PMVA 3MZ9A 5I59B 4ISUA 1B46A 5DVIA 1AIVA 4PFYA 2D5WA 3U93A 3TTMA 2PX1A 2DQVA 2THIA 1B3HA 4U23A 1MG1A 2AIXA 1US5A 3ONMA 3A09A 4NF4A 2I4BA 4ELPA 5I56B 3QK6A 2ANJA 2RC9A 3MP1A 1IZ1A 2V3QA 2RCBA 3BBRA 2VOZA 2XX9A 4NMYA 1GGGA 1GR2A 4FJPA 1AH5A 4OTEA 5CMBA 5H8QA 2XXIA 4ESXA 1FQAA 4ELRA 4PETA 1OLCA 3HV1A 3N6TA 3Q28A 4G2ZA 2ABHA 4X1DA 2HEUA 3M3FA 4I8CA 2I58A 3TFLA 2DE4A 4R9GA 1EU8A 2X7QA 3K4UA 3QSLA 4FE8A 4XKRA 1N0TA 1FQFA 1FQDA 1QVSA 5FHMA 4ESWA 4Z7EA 1LAFE 2G29A 2A5TB 3MJNA 4IGTA 4MBPA 1FTJA 4RYAA 4ECFA 1MDP1 2XHDA 1QKAA 1FTLA 5A5XB 2R6GE 2H99A 3IORA 3N5LA 3MZ1A 1AL3A 4KYSA 4NF4B 1SVXB 2RC8A 3OO7A 4G68C 4TOZA 1VR5A 3FXRA 1IXHA 1QUJA 3OENA 1SYIA 4IO6A 1MXZA 3FASA 1BLFA 2OWTA 3IX1A 1LAGE 3PMXA 4H8IA 5ITOA 3SETA 3C35A 4X1BA 4FAJA 2RF1A 2XXQA 2XXWA 3MWBA 5H8SA 5AA4A 4C1TA 2O51A 2Q9TA 3UK4A 2A5SA 3FZVA 3IK6B 4KQPA 2P1SA 3MPKA 2AL5A 1B6HA 1BTJA 2HAVA 3KN8A 2BJJX 1A8FA 3IO4A 3VLWA 1B51A 4Q30B 3IL1B 4RNSA 1ZLQA 4KYEA 4MFIA 4EDPA 4EF2A 3OEKA 4MF3A 3TPAA 4UACA 5JEIA 2FNCA 3M3KA 4KPTA 2F5XA 3H4ZA 2XXPA 3KEIA 4ZE8A 1NH8A 4TLMB 1B58A 2QL3A 3M8UA 2R71A 3CR9A 4YB6A 1Y1ZA 3IO6A 3K1NA 3KGCA 4QFKA 3OOAA 1B2HA 2O69A 2XXXA 3QUFA 3LC8A 1B4ZA 1USYH 3N6UA 3GXAA 3QIMA 4JXIA 4POXA 4Q0CA 3T9XB 3VFJA 4QF9A 4IO4A 1JQFA 4U22A 1ZBMA 3H6UA 5EYFA 3IJXB 3A3CA 2XX7A 3CIJA 4YU0A 2DE2A 2V84A 4JSDA 3RTFB 3TTKA 1IXCA 1MH4A 1P1WA 5AA4B 1B7ZA 1NH7A 3TTRA 2HCAA 3SEYA 3T22A 3FXUA 4F3SA 4F31B 3CFXA 3M3LA 2VHAA 4F39A 4QFNA 3C4MA 4IO5A 4H0WA 3FIRA 1WDNA 3FD3A 3OD7A 3ILTB 4R9FA 2HQ0A 4NWCA 1PB8A 1DOTA 1LAXA 1MQJA 2A5TA 1FTKA 2RINA 3G7WA 3K6UA 1XVYA 3PUYE 3O97A 4H8JA 2OBGA 1PBQA 1A54A 3I6VA 4R6KA 4MLVA 3PU5A 1Y9UA 4EUOA 1MQIA 4WKMA 1QUKA 3H6WA 4N07A 3K2DA 4OYVA 5AA2B 1EZPA 4GQOA 4LP2B 3H7MA 2F34A 4PP0A 2I0BA 3U72A 5DEXA 1XHYA 4FEDA 4WEDA 1YPNA 5L9SA 3TKDA 3FVKA 3IOVA 2F78A 4LZ7A 3UP9A 5AA3A 3PPQA 3S9MC 3TEPA 3KG2A 5DT6A 1AMFA 5I56A 1B3EA 4K3FA 1SDXA 1MXXA 4POWA 4TQUQ 4XTCQ 2HAUA 1JNFA 3RQTA 1M5EA 1SYHA 1VFDA 4OZ9A 2DWJA 4OEUA 1A99A 1ATGA 2UYEA 4QRZA 1MY3A 5AA1A 3HHFA 3SEXA 3T9HB 1A55A 5FTIA 1YCJA 5K2YA 3SKPA 1OVBA 5DVFA 5FHOA 4F3PA 1ANFA 2O84X 1B1XA 3T66A 4ZEDA 4R73A 4GF8A 3TCHA 4FORA 1HSLA 1IUDA 1CE2A 5DYHA 1PB9A 1MXYA 5JTYB 3PGFA 4XIGQ 3EHSA 1MY0A 2PYYA 4RPOA 1SI1A 3TQWA 1DTGA 4ZE9A 4XKQA 4KHZE 2Y7WA 5H8HA 5KCJB 3QXMA 4PE5B 2XXTA 3OXNA 2O68A 2ZNSA 1SW2A 2OWSA 2Z8EA 3G3KA 4FECA 4GXSB 2B65A 4LA9A 2UYFA 4YKKA 3VDFA 3W15C 3V83A 3H06B 1FW0A 1SW5A 2CMOA 2I3WA 4F1UA 1L5TA 1B40A 4NF8B 3HSTA 4XKNA 3AXFA 1UTBB 4LVQA 3USDA 4NF6B 1N3WA 1OQGA 4GIZA 4R2BA 3B6WA 5L9OA 2B3BA 4F19A 1MH3A 3VLUA 3OO9A 5A5XA 1NKXA 2DVCA 1B0LA 1P1UA 2H4IA 2H98A 2PBWA 3L6GA 3THIA 1UTBA 4F1VA 3DP4A 4QHQA 1Y3PA 3G3IA 4ZEKA 3TMGA 1N84A 3G3FA 3PUVE 1JEVA 3RT8A 3R26A 3SERA 3TCFA 1II5A 3DP8A 4OERA 1LGBC 3H3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMK A;  4RJZ A;  2VD2 A;  2DWH A;  2Y7R A;  1OQH A;  4R74 A;  4E0W A;  1R1N A;  3IB1 A;  3V5A A;  4FAT A;  3G3H A;  2OJT A;  5KCJ A;  1B05 A;  2F35 A;  3OO8 A;  3U1O A;  5I58 B;  3CSB A;  3K02 A;  4OES A;  2OLB A;  1MY2 A;  1WOD A;  1XS5 A;  4P11 A;  3OMB A;  1LB9 A;  4YIC A;  4F22 A;  3PUX E;  1FQE A;  2ONR A;  1N7W A;  3MP6 A;  2DOJ A;  3PPP A;  4G8H A;  4OET A;  1TXF A;  3FV2 A;  2P2A A;  3F11 A;  4ZEI A;  3KFM A;  5LOM A;  2DSF A;  1P1O A;  4F1Y A;  2Y7P A;  1H76 A;  3UN6 A;  3VXC A;  1VSO A;  4KD5 A;  4NF5 B;  4O3B A;  2X7P A;  1TFA A;  3W9V A;  1ZIU A;  4I62 A;  4M4G A;  5I2K B;  5L9M A;  1EH3 A;  3S9E A;  3FAT A;  5FTH A;  1US4 A;  2RKM A;  3Q26 A;  2DWI A;  3C9H A;  4R6Y A;  5M2V A;  1N7X A;  2F8D A;  4WXJ A;  4AQ4 A;  4F3B A;  1CB6 A;  1HSE A;  1O64 A;  1TFD A;  2RCA A;  4HCY A;  2QMW A;  5TPA A;  3BFT A;  3S2V A;  3PV0 E;  1POY 1;  2F7C A;  3FUZ A;  2CZL A;  2GRV A;  2HZK A;  3PPO A;  4GLI A;  3RUM A;  3RNN A;  4KI0 E;  4OMB A;  3DEL B;  3TYH A;  3KJT A;  3ZS6 A;  3D4C A;  4OEN A;  4QSC A;  1URG A;  5B70 A;  1EZ9 A;  1MPB A;  2NXO A;  3K6V A;  3LSL A;  4IY5 A;  4OWD A;  5H8F B;  3IR1 A;  1B0H A;  5I57 B;  4E0X A;  3IB0 A;  5AE4 A;  1JW5 A;  4PFW A;  1MDQ A;  1URD A;  1MPC A;  1M5F A;  2F7A A;  2Q2C A;  3IAZ A;  2UVI A;  4U2R A;  1QUL A;  1SBP A;  4U1O A;  2RC7 A;  3O6H A;  3B6Q A;  5L8D A;  1XT8 A;  4G68 A;  2I49 A;  2IA4 A;  2XD3 A;  4N13 A;  2D3I A;  1P99 A;  4HW8 A;  1IIW A;  4G8N A;  1XOC A;  2O7U A;  1FTO A;  3C34 A;  2F7B A;  1R6Z A;  3LSF B;  3T9V A;  2OCU A;  3IJO B;  4OFL A;  3RN8 A;  1A8E A;  3MQ9 A;  3C31 A;  3UIF A;  3TCG A;  1B7U A;  1B1H A;  1QJM A;  2NOO A;  2XXY A;  3E9X A;  4GWO A;  4KYD A;  4NWD A;  4QFL A;  3CFZ A;  3V8X B;  1LCT A;  4RA1 A;  2DYX A;  1S50 A;  2F6P A;  4MH5 A;  1UIV A;  1DPE A;  1PC3 A;  3DLN A;  3KOS A;  3E4R A;  4YB7 A;  3IOT A;  4GXA A;  3P7I A;  3H6V A;  3TEL A;  4GL0 A;  2HXW A;  5H8N B;  1I69 A;  1O63 A;  3HO7 A;  4F18 A;  3JZJ A;  2QS3 A;  4TLL B;  3LUY A;  1H3D A;  3VE1 B;  3TZA A;  4H5F A;  3RPW A;  3OSQ A;  3E3K A;  2ZXT A;  3GBA A;  3OEL A;  4O3C A;  1H45 A;  3GLB A;  3KBR A;  4DIG A;  1M5C A;  2IEE A;  4RXL A;  4U4S A;  1ZKB A;  1Y4T A;  2PT2 A;  4F3G A;  1POT A;  3JYR A;  1JW1 A;  1S7Y A;  2PMS A;  4WEP A;  2ZMB A;  3T96 B;  5JK4 A;  4GD5 A;  3TUS A;  4JDF A;  2KLF A;  3U92 A;  1D9Y A;  4R2F A;  4RPN A;  5ICQ A;  1KWH A;  4OFO A;  4U1Z A;  1IXG A;  4IO2 A;  3B6T A;  2QRY A;  4GFR A;  4KFQ A;  2G93 A;  2ONS A;  2QS2 A;  2UVH A;  3RY3 A;  3TAJ A;  5I84 A;  3O9P A;  1ELJ A;  2W7Y A;  3WAF A;  4BDO A;  5BUU A;  5CM6 A;  2GFE A;  1YAE A;  1R9L A;  2LAO A;  5CC2 A;  3CSG A;  2F36 A;  1N76 A;  3HN0 A;  1DPP A;  5I2N B;  3ZKK A;  2Y84 A;  2O7I A;  3R7X A;  1LST A;  2FYI A;  3LSW A;  4H5G A;  3WAE A;  4HCW A;  5H8H B;  2AL4 A;  3BFU A;  3LSX A;  3K1M A;  3O66 A;  3VXB A;  3C32 A;  3KSX A;  1MM7 A;  1USY E;  3MVY A;  4X48 A;  4C0R A;  2QJE A;  2Y7I A;  1TT1 A;  3CVG A;  4YB5 A;  4PQJ A;  2VGQ A;  3MVZ A;  2V3U A;  3PD8 A;  1F9B A;  4ZEF A;  5IKB A;  3TTN A;  2Q88 A;  3HPI A;  4JSO A;  5KDT B;  3FJ7 A;  1ZMG A;  1GV8 A;  4KCD A;  3GZG A;  3Q29 A;  5EHM A;  3S9L C;  1TWY A;  2R9J A;  2FA7 A;  1SD3 A;  4O3A A;  5DVJ A;  4ELO A;  4EXK A;  3MVW A;  3PUW E;  3VV5 A;  3UA8 A;  5H8Q B;  4GOT A;  4H6D A;  2GH9 A;  2GHA A;  1LCF A;  1OVT A;  2QS1 A;  3KN3 A;  4LZ8 A;  1DSN A;  4R75 A;  3SEV A;  4ZZA A;  4X9T A;  4QFP A;  4DLD A;  3EHU A;  3SES A;  4OEV A;  2YJP A;  1A7L A;  4OVJ A;  1QKB A;  1NL5 A;  1R9Q A;  2B3F A;  2X26 A;  1P1Q A;  3VVF A;  3ZKL A;  4I9D A;  3KJ7 A;  2F97 A;  5I59 A;  4JWO A;  1Z7N E;  4BDL A;  3L6H A;  3O6G A;  3ODB A;  1FQC A;  3KZG A;  4IY6 A;  3S4U A;  2F6G A;  3E13 X;  4G68 B;  3MW0 A;  1B7H A;  4NE4 A;  3U94 A;  1PDA A;  1EZO A;  3QAX A;  1HSJ A;  5HM4 B;  1MQH A;  3V89 B;  4EQB A;  3G3J A;  3RGY A;  2NVU B;  2UVJ A;  1QUI A;  3OO6 A;  4KCC A;  4YKI A;  3BKI B;  3K00 A;  3FVG A;  3OEM A;  5BWJ A;  2O6A A;  1Y1M A;  3T93 B;  1B5H A;  1GTK A;  3K6W A;  3O6I A;  4I1D A;  4JWY A;  3Q25 A;  4R6H A;  4R72 A;  5TP9 A;  5H8F A;  4G8M A;  4H1X A;  3Q27 A;  2VD3 A;  2HZL A;  3VVD A;  2XXR A;  1MXU A;  4HTG A;  4RK2 A;  3O28 A;  4P0G A;  5TU0 A;  2DS9 A;  2I48 A;  2REG A;  3GBB A;  4YZZ A;  4YKP A;  5TPA B;  2ZNT A;  1IEJ A;  1URS A;  2Z22 A;  2ZYM A;  1B52 A;  3PPN A;  4XKP A;  1H43 A;  1MQD A;  2ZYO A;  4RY1 A;  1DMB A;  1B3F A;  1NNT A;  1UTH B;  3OSR A;  4QSD A;  2XD2 A;  5F7V A;  3MBP A;  3K01 A;  3FGS A;  5HPQ A;  4EQ9 A;  1LFH A;  4NF5 A;  3MPL A;  1MM6 A;  3TTL A;  1NMU A;  4RK9 A;  2O1M A;  1JW4 A;  3DP6 A;  1Q35 A;  2I4C A;  1MXW A;  3IOW A;  2NWJ A;  3RTW B;  4BLA A;  5B7D A;  3MVX A;  1AOV A;  1A40 A;  4N6P A;  1WVJ A;  3HCQ A;  4ONY A;  2P0S A;  1XVX A;  1IQ7 A;  3JV9 A;  1D4N A;  2XX8 A;  5EHS A;  3K6X A;  1S9T A;  2Q89 A;  3CFL A;  1VFE A;  2DE3 A;  4F2Q A;  4LAT A;  4BDQ A;  4EF1 A;  3QYT A;  1LBC A;  4IB2 A;  1I6A A;  3H6T A;  5ITP A;  1B3L A;  1SQY A;  1ZTY A;  3MAM A;  1DTZ A;  4C1U A;  1SW1 A;  1IXI A;  4M1V A;  3B7D A;  4JWX A;  4XXU A;  4LQ5 A;  4P0I A;  4U21 A;  4BDN A;  1XC1 A;  3IOU A;  1BIY A;  2H25 A;  2Z8D A;  2ZYN A;  2DP8 A;  3TDJ A;  4YKJ A;  2V93 A;  5H8N A;  1FTM A;  3FJG A;  1MS7 A;  5DTB A;  3VLV A;  3LBS A;  3VVE A;  5AA2 D;  1B4H A;  2GHB A;  4H67 A;  4H65 A;  3N94 A;  4JBZ A;  3FVN A;  1MXV A;  1J1N A;  1NNF A;  1NFT A;  3H03 A;  3W9W A;  4BDR A;  4DXB A;  2VP1 A;  5CBR A;  1T0K A;  3HHG A;  1ZU0 A;  2PT1 A;  1LBB A;  3O2A A;  2UXA A;  3PMW A;  4NF8 A;  5FHN A;  4ZEB A;  5ICT A;  1OMP A;  1QW0 A;  2WKY A;  5ELV A;  3RT6 B;  4LQ2 A;  4OXV A;  4JB7 A;  4LUB A;  4ZDM A;  3T9U A;  4DXC A;  3KOT A;  2E1S A;  1O7T A;  3PD9 A;  4QFO A;  4BDM A;  1D9V A;  1B32 A;  1JVX A;  2V3T A;  1LFG A;  1MY1 A;  1NNP A;  4NTL A;  4THI A;  5CRY A;  2NUV A;  3K0V A;  2DWA A;  2V25 A;  2Z8F A;  5I57 A;  4IO7 A;  1B5I A;  1BP5 A;  1LLS A;  1M5B A;  2QSX A;  3FVO A;  3MC2 A;  5CMC A;  1Y20 A;  2ZNU A;  4YMA A;  5IAI A;  1RKM A;  2Q2A A;  3MP8 A;  4DCX A;  5JTY A;  1OLA A;  1FQB A;  3ECR A;  1LFI A;  4OFJ A;  5K2X A;  4ZEC A;  2M8C A;  4OQO A;  3SEU A;  2QPQ A;  3I3V A;  1LB8 A;  3LR1 A;  5CBS A;  2UVG A;  4YMB A;  3CI8 A;  2QS4 A;  2YPN A;  2D21 A;  2I3V A;  4GRK A;  4G77 A;  1YTV A;  4Q8R A;  4GVO A;  1BKA A;  1Y3N A;  3EPE A;  2ALU A;  2AYS A;  3DM0 A;  3G3G A;  1B3G A;  3I5O A;  1H44 A;  4ND9 A;  3CG3 A;  3EHT A;  3O29 A;  3SEW A;  1SW4 A;  5CI5 A;  3UGW A;  4KR5 A;  4DCY A;  1GVC A;  3R6U A;  1UIU A;  1RYO A;  1Q1K A;  1OIB A;  2YLN A;  2ZYK A;  3CRB A;  3ILU B;  1JEU A;  1N3X A;  3FV1 A;  2OZZ A;  3C36 A;  1SI0 A;  4L17 A;  2Q8J A;  4DE8 A;  2XXH A;  3A3U A;  5DEX B;  4F2O A;  3KN7 A;  5ISU A;  1ZJL A;  3IB2 A;  3EF7 A;  5AA2 A;  5J1D A;  3U8Q A;  2Z23 A;  5I58 A;  2QMX A;  3MZB A;  4PFT A;  2O1L A;  3ZSF A;  2PVU A;  4DXU A;  3N26 A;  3CG1 A;  3D4G A;  3C33 A;  2DXR A;  3TQL A;  4YAH X;  5KDT A;  2E0S A;  1Z7M E;  3QUJ A;  4NED A;  2HFB A;  1UQW A;  2REJ A;  4QSE A;  1JVY A;  1D3K A;  4UA8 A;  5I2K A;  3UOR A;  3TOD A;  4OHN A;  3EN3 A;  3FXQ A;  1NNK A;  3MUQ A;  4MLQ A;  4GL8 A;  5I2N A;  1RYX A;  4ELQ A;  5HBC A;  1N04 A;  2XXV A;  1UTH A;  3PPR A;  2H9B A;  1P1N A;  1PB7 A;  2I6E A;  4NF6 A;  2ONK E;  2XXU A;  5CMM A;  4FIM A;  1B5J A;  2Y7K A;  3FJM A;  2OK2 A;  1IIT A;  1MRP A;  2DVZ A;  4HS7 A;  4AB5 A;  1I6B A;  1PEB A;  4IO3 A;  1PBP A;  2I0C A;  1B9J A;  4Q5T A;  1Y4C A;  2DXY A;  4DDD A;  1M5D A;  1LAH E;  3SDF A;  3RLF E;  5F1Q A;  3S9N C;  3KSJ A;  5TP9 B;  1Y3Q A;  4LON B;  1JET A;  3K1P A;  4ZS9 A;  4Z0I A;  1MPD A;  4ZZE A;  1MQG A;  1VE4 A;  1FCK A;  5KZT A;  4IGR A;  2H5Y A;  4EXL A;  4LZ5 A;  4AB6 A;  4FEB A;  4F29 A;  3EQ1 A;  4DZ1 A;  4EQ7 A;  4G4P A;  4PFU A;  3PUZ E;  1MY4 A;  2ESN A;  4U4X A;  1I6Q A;  3PMV A;  3MZ9 A;  5I59 B;  4ISU A;  1B46 A;  5DVI A;  1AIV A;  4PFY A;  2D5W A;  3U93 A;  3TTM A;  2PX1 A;  2DQV A;  2THI A;  1B3H A;  4U23 A;  1MG1 A;  2AIX A;  1US5 A;  3ONM A;  3A09 A;  4NF4 A;  2I4B A;  4ELP A;  5I56 B;  3QK6 A;  2ANJ A;  2RC9 A;  3MP1 A;  1IZ1 A;  2V3Q A;  2RCB A;  3BBR A;  2VOZ A;  2XX9 A;  4NMY A;  1GGG A;  1GR2 A;  4FJP A;  1AH5 A;  4OTE A;  5CMB A;  5H8Q A;  2XXI A;  4ESX A;  1FQA A;  4ELR A;  4PET A;  1OLC A;  3HV1 A;  3N6T A;  3Q28 A;  4G2Z A;  2ABH A;  4X1D A;  2HEU A;  3M3F A;  4I8C A;  2I58 A;  3TFL A;  2DE4 A;  4R9G A;  1EU8 A;  2X7Q A;  3K4U A;  3QSL A;  4FE8 A;  4XKR A;  1N0T A;  1FQF A;  1FQD A;  1QVS A;  5FHM A;  4ESW A;  4Z7E A;  1LAF E;  2G29 A;  2A5T B;  3MJN A;  4IGT A;  4MBP A;  1FTJ A;  4RYA A;  4ECF A;  1MDP 1;  2XHD A;  1QKA A;  1FTL A;  5A5X B;  2R6G E;  2H99 A;  3IOR A;  3N5L A;  3MZ1 A;  1AL3 A;  4KYS A;  4NF4 B;  1SVX B;  2RC8 A;  3OO7 A;  4G68 C;  4TOZ A;  1VR5 A;  3FXR A;  1IXH A;  1QUJ A;  3OEN A;  1SYI A;  4IO6 A;  1MXZ A;  3FAS A;  1BLF A;  2OWT A;  3IX1 A;  1LAG E;  3PMX A;  4H8I A;  5ITO A;  3SET A;  3C35 A;  4X1B A;  4FAJ A;  2RF1 A;  2XXQ A;  2XXW A;  3MWB A;  5H8S A;  5AA4 A;  4C1T A;  2O51 A;  2Q9T A;  3UK4 A;  2A5S A;  3FZV A;  3IK6 B;  4KQP A;  2P1S A;  3MPK A;  2AL5 A;  1B6H A;  1BTJ A;  2HAV A;  3KN8 A;  2BJJ X;  1A8F A;  3IO4 A;  3VLW A;  1B51 A;  4Q30 B;  3IL1 B;  4RNS A;  1ZLQ A;  4KYE A;  4MFI A;  4EDP A;  4EF2 A;  3OEK A;  4MF3 A;  3TPA A;  4UAC A;  5JEI A;  2FNC A;  3M3K A;  4KPT A;  2F5X A;  3H4Z A;  2XXP A;  3KEI A;  4ZE8 A;  1NH8 A;  4TLM B;  1B58 A;  2QL3 A;  3M8U A;  2R71 A;  3CR9 A;  4YB6 A;  1Y1Z A;  3IO6 A;  3K1N A;  3KGC A;  4QFK A;  3OOA A;  1B2H A;  2O69 A;  2XXX A;  3QUF A;  3LC8 A;  1B4Z A;  1USY H;  3N6U A;  3GXA A;  3QIM A;  4JXI A;  4POX A;  4Q0C A;  3T9X B;  3VFJ A;  4QF9 A;  4IO4 A;  1JQF A;  4U22 A;  1ZBM A;  3H6U A;  5EYF A;  3IJX B;  3A3C A;  2XX7 A;  3CIJ A;  4YU0 A;  2DE2 A;  2V84 A;  4JSD A;  3RTF B;  3TTK A;  1IXC A;  1MH4 A;  1P1W A;  5AA4 B;  1B7Z A;  1NH7 A;  3TTR A;  2HCA A;  3SEY A;  3T22 A;  3FXU A;  4F3S A;  4F31 B;  3CFX A;  3M3L A;  2VHA A;  4F39 A;  4QFN A;  3C4M A;  4IO5 A;  4H0W A;  3FIR A;  1WDN A;  3FD3 A;  3OD7 A;  3ILT B;  4R9F A;  2HQ0 A;  4NWC A;  1PB8 A;  1DOT A;  1LAX A;  1MQJ A;  2A5T A;  1FTK A;  2RIN A;  3G7W A;  3K6U A;  1XVY A;  3PUY E;  3O97 A;  4H8J A;  2OBG A;  1PBQ A;  1A54 A;  3I6V A;  4R6K A;  4MLV A;  3PU5 A;  1Y9U A;  4EUO A;  1MQI A;  4WKM A;  1QUK A;  3H6W A;  4N07 A;  3K2D A;  4OYV A;  5AA2 B;  1EZP A;  4GQO A;  4LP2 B;  3H7M A;  2F34 A;  4PP0 A;  2I0B A;  3U72 A;  5DEX A;  1XHY A;  4FED A;  4WED A;  1YPN A;  5L9S A;  3TKD A;  3FVK A;  3IOV A;  2F78 A;  4LZ7 A;  3UP9 A;  5AA3 A;  3PPQ A;  3S9M C;  3TEP A;  3KG2 A;  5DT6 A;  1AMF A;  5I56 A;  1B3E A;  4K3F A;  1SDX A;  1MXX A;  4POW A;  4TQU Q;  4XTC Q;  2HAU A;  1JNF A;  3RQT A;  1M5E A;  1SYH A;  1VFD A;  4OZ9 A;  2DWJ A;  4OEU A;  1A99 A;  1ATG A;  2UYE A;  4QRZ A;  1MY3 A;  5AA1 A;  3HHF A;  3SEX A;  3T9H B;  1A55 A;  5FTI A;  1YCJ A;  5K2Y A;  3SKP A;  1OVB A;  5DVF A;  5FHO A;  4F3P A;  1ANF A;  2O84 X;  1B1X A;  3T66 A;  4ZED A;  4R73 A;  4GF8 A;  3TCH A;  4FOR A;  1HSL A;  1IUD A;  1CE2 A;  5DYH A;  1PB9 A;  1MXY A;  5JTY B;  3PGF A;  4XIG Q;  3EHS A;  1MY0 A;  2PYY A;  4RPO A;  1SI1 A;  3TQW A;  1DTG A;  4ZE9 A;  4XKQ A;  4KHZ E;  2Y7W A;  5H8H A;  5KCJ B;  3QXM A;  4PE5 B;  2XXT A;  3OXN A;  2O68 A;  2ZNS A;  1SW2 A;  2OWS A;  2Z8E A;  3G3K A;  4FEC A;  4GXS B;  2B65 A;  4LA9 A;  2UYF A;  4YKK A;  3VDF A;  3W15 C;  3V83 A;  3H06 B;  1FW0 A;  1SW5 A;  2CMO A;  2I3W A;  4F1U A;  1L5T A;  1B40 A;  4NF8 B;  3HST A;  4XKN A;  3AXF A;  1UTB B;  4LVQ A;  3USD A;  4NF6 B;  1N3W A;  1OQG A;  4GIZ A;  4R2B A;  3B6W A;  5L9O A;  2B3B A;  4F19 A;  1MH3 A;  3VLU A;  3OO9 A;  5A5X A;  1NKX A;  2DVC A;  1B0L A;  1P1U A;  2H4I A;  2H98 A;  2PBW A;  3L6G A;  3THI A;  1UTB A;  4F1V A;  3DP4 A;  4QHQ A;  1Y3P A;  3G3I A;  4ZEK A;  3TMG A;  1N84 A;  3G3F A;  3PUV E;  1JEV A;  3RT8 A;  3R26 A;  3SER A;  3TCF A;  1II5 A;  3DP8 A;  4OER A;  1LGB C;  3H3G A; 
#chains in the Genus database with same CATH topology
 4GWX A;  2Y7R A;  4FAT A;  2OJT A;  3K02 A;  4P11 A;  3OMB A;  3MP6 A;  2DOJ A;  4OET A;  3FV2 A;  2P2A A;  1LEV A;  1P1O A;  4GWU A;  4MIJ A;  4NF5 B;  4O3B A;  2OWZ A;  3W9V A;  4I62 A;  5L9M A;  4AS5 A;  4WXJ A;  1CB6 A;  1TFD A;  2RCA A;  3PV0 E;  2GRV A;  3DEL B;  4OEN A;  4QSC A;  1MPB A;  3K6V A;  4IY5 A;  1B0H A;  2F7A A;  3IAZ A;  1QUL A;  4U1O A;  5L8D A;  2IA4 A;  2D3I A;  4HW8 A;  4N17 A;  2VT5 A;  3RN8 A;  1A8E A;  3MQ9 A;  2XXY A;  1BK4 A;  4MH5 A;  4YB7 A;  1PC3 A;  3DLN A;  3E4R A;  3A29 A;  3P7I A;  4GXA A;  1I69 A;  1O63 A;  3HO7 A;  4NX1 A;  3FXB A;  3VE1 B;  4H5F A;  3RPW A;  4OVQ A;  3E3K A;  2ZXT A;  3OEL A;  4DIG A;  1POT A;  1JW1 A;  2QVU A;  4GWS A;  3U92 A;  2KLF A;  1D9Y A;  1KWH A;  4OFO A;  4KFQ A;  3TAJ A;  2W7Y A;  2GFE A;  2O7I A;  4H5G A;  4HCW A;  5H8H B;  1MM7 A;  3MST A;  2QJE A;  1TT1 A;  4YB5 A;  3HPI A;  2ZZX A;  4GWY A;  5KDT B;  4ELO A;  4EXK A;  3PUW E;  2FBP A;  5H8Q B;  2QS1 A;  4R75 A;  1QKB A;  4FBP A;  2X26 A;  1IMD A;  1Z7N E;  3ODB A;  1EYJ A;  1D9Q A;  1B7H A;  3U94 A;  1MQH A;  4EQB A;  3FBP A;  3G3J A;  2WYP A;  1NUZ A;  3T93 B;  3K6W A;  3O6I A;  4FAJ A;  1YZ0 A;  3Q25 A;  3GBB A;  4YZZ A;  5DW8 A;  2Z22 A;  3PPN A;  1DMB A;  1UTH B;  3OSR A;  5F7V A;  4EQ9 A;  1IMA A;  4NF5 A;  4OVR A;  1MM6 A;  1NMU A;  4P8B A;  5B7D A;  1A40 A;  4N91 A;  3JV9 A;  1FPL A;  1VFE A;  2WBD A;  1LBC A;  3H6T A;  1SQY A;  4U21 A;  2H25 A;  2DP8 A;  4YKJ A;  2V93 A;  1FTM A;  3VVE A;  5AA2 D;  3N94 A;  1FBP A;  3W9W A;  1T0K A;  2VP1 A;  2MKZ A;  2UXA A;  3PMW A;  5FHN A;  4ZEB A;  4LUB A;  3PD9 A;  4QFO A;  4BDM A;  1D9V A;  1B32 A;  1JVX A;  1LFG A;  1NNP A;  2NUV A;  1BP5 A;  3FVO A;  1RKM A;  2QPQ A;  3I3V A;  1LB8 A;  4UAB A;  1FPF A;  4Q8R A;  3DM0 A;  4ND9 A;  4PDD A;  4KR5 A;  4DCY A;  4MEV A;  3FV1 A;  4L17 A;  2OZZ A;  3C36 A;  2XXH A;  3A3U A;  1ZJL A;  5J1D A;  5I58 A;  3MZB A;  3ZSF A;  2PVU A;  4DXU A;  3N26 A;  2DXR A;  3TQL A;  4YAH X;  2E0S A;  5LTC A;  1JVY A;  1NNK A;  3MUQ A;  1RYX A;  1UTH A;  3PPR A;  2XXU A;  2QVR A;  4FIM A;  1B5J A;  2Y7K A;  1MRP A;  4AB5 A;  1PEB A;  3QMF A;  2I0C A;  2DXY A;  4DDD A;  1M5D A;  3SDF A;  3S9N C;  2XA5 A;  4Z0I A;  4HXV A;  5KZT A;  5T3J A;  4F29 A;  2F3D A;  4QBA A;  3PUZ E;  1I6Q A;  4PTK A;  3ROJ A;  4PFY A;  2THI A;  2V3Q A;  1KZ8 A;  5H8Q A;  4ESX A;  1FQA A;  2HEU A;  2I58 A;  1EU8 A;  2X7Q A;  3K4U A;  5FHM A;  1LAF E;  2G29 A;  2A5T B;  2JJK A;  4MBP A;  1FTJ A;  2H99 A;  4PFI A;  3VVF A;  1SVX B;  1VR5 A;  3FXR A;  5H8H A;  2WX9 A;  3SET A;  4F3S A;  2OWT A;  1LAG E;  3FZV A;  3IK6 B;  4KQP A;  1IMB A;  3KN8 A;  1A8F A;  3VLW A;  3IL1 B;  4MFI A;  2QVV A;  1NUY A;  4UAC A;  3H4Z A;  2XXP A;  4ZE8 A;  1NH8 A;  4YB6 A;  2QL3 A;  3M8U A;  2R71 A;  4N4U A;  3IO6 A;  5ET6 A;  2XXX A;  1B4Z A;  3QIM A;  4DI3 D;  4QF9 A;  1ZBM A;  3H6U A;  2DE2 A;  1MH4 A;  3T22 A;  4GX6 A;  4QFN A;  4H0W A;  4R9F A;  2HQ0 A;  1MQJ A;  2A5T A;  4H8J A;  1FPB A;  1PBQ A;  1A54 A;  3I6V A;  4JVC A;  1FJ9 A;  4R6K A;  4MLV A;  1KA0 A;  3K2D A;  4OYV A;  5AA2 B;  1EZP A;  1RDZ A;  3H7M A;  1XHY A;  4WED A;  1YPN A;  3TKD A;  3FVK A;  1AMF A;  4XTC Q;  3RQT A;  4OZ9 A;  2UYE A;  4GX3 A;  4QRZ A;  1YCJ A;  1OVB A;  5DVF A;  5FHO A;  4F3P A;  2Y5L A;  3T66 A;  1B1X A;  2OX3 A;  1HSL A;  4N8Y A;  1MXY A;  1DCU A;  4RPO A;  1SI1 A;  1DTG A;  2O68 A;  1SW2 A;  3G3K A;  3V83 A;  1L5T A;  1B40 A;  3AXF A;  4LVQ A;  4R2B A;  5A5X A;  1NKX A;  2DVC A;  3THI A;  2H98 A;  2PBW A;  2CZH A;  3DP4 A;  1N84 A;  4I40 A;  1JEV A;  3SER A;  3TCF A;  4NHB A;  1SPI A;  1LGB C;  2WEF A;  4RJZ A;  1FTA A;  2DWH A;  1YYZ A;  4R74 A;  4E0W A;  1R1N A;  5KCJ A;  4O7I A;  5I58 B;  2HHM A;  3CSB A;  4OES A;  2OLB A;  1WOD A;  1LB9 A;  3PUX E;  1FQE A;  2ONR A;  3PPP A;  1TXF A;  5LOM A;  2DSF A;  3VXC A;  1IME A;  4KD5 A;  2X7P A;  1ZIU A;  1EH3 A;  2PFZ A;  5FTH A;  1US4 A;  2RKM A;  2DWI A;  5M2V A;  1HSE A;  1O64 A;  3S2V A;  2QMW A;  3BFT A;  2F7C A;  2HZK A;  4XFE A;  3RUM A;  4KI0 E;  4OMB A;  3KJT A;  2PCR A;  1URG A;  2NXO A;  4PAK A;  3IR1 A;  4E0X A;  1JW5 A;  1MDQ A;  1URD A;  1M5F A;  4PBH A;  2UVI A;  3B6Q A;  1XT8 A;  2XD3 A;  4N13 A;  1P99 A;  1IIW A;  4G8N A;  3C34 A;  2F7B A;  3LSF B;  3IJO B;  4OFL A;  5IZZ A;  3V8X B;  2DYX A;  1K9Z A;  4PAI A;  3H6V A;  4F18 A;  4O8M A;  3GBA A;  4F3G A;  4N8G A;  3JYR A;  3KC0 A;  1S7Y A;  3T96 B;  3TUS A;  1IXG A;  4GFR A;  2ONS A;  2QS2 A;  2UVH A;  3O9P A;  1ELJ A;  5CM6 A;  1LBY A;  1YAE A;  2LAO A;  3CSG A;  2F36 A;  1LST A;  3LSW A;  2AL4 A;  3BFU A;  1F9B A;  3TTN A;  4JVD A;  1GV8 A;  4KCD A;  3GZG A;  4MAG A;  1LBV A;  1TWY A;  2FA7 A;  3MVW A;  2FIX A;  4GOT A;  1LCF A;  1OVT A;  4LZ8 A;  1DSN A;  3SEV A;  3SES A;  1A7L A;  1R9Q A;  1P1Q A;  2WYK A;  1NV2 A;  3ZKL A;  4JWO A;  1RDY A;  3E13 X;  1PDA A;  3GYY A;  3QAX A;  4MCO A;  2UVJ A;  2P3V A;  1GTK A;  4I1D A;  4JWY A;  4R6H A;  4GX4 A;  4R72 A;  5TP9 A;  2XWV A;  2VD3 A;  3Q27 A;  2XXR A;  4RK2 A;  5TU0 A;  2DS9 A;  2REG A;  1IMC A;  5TPA B;  2ZNT A;  2ZYM A;  5CBR A;  2ZYO A;  4QSD A;  2XD2 A;  3K01 A;  3MPL A;  1JW4 A;  1MXW A;  3MVX A;  1D4N A;  2XX8 A;  3CFL A;  4EF1 A;  4BDQ A;  4IB2 A;  1B3L A;  2CEX A;  3MAM A;  1DTZ A;  1SW1 A;  1IXI A;  4M1V A;  3B7D A;  4P0I A;  1BIY A;  2ZYN A;  3FJG A;  1INP A;  5EQ7 A;  4H67 A;  2GHB A;  4H65 A;  3FVN A;  3HHG A;  1ZU0 A;  4NF8 A;  5ICT A;  4ZDM A;  4DXC A;  3KOT A;  1O7T A;  1NUW A;  2V3T A;  4NTL A;  5CRY A;  2QSX A;  3MC2 A;  5CMC A;  1Y20 A;  1RDX A;  4KXP A;  5ET8 A;  1OLA A;  3ECR A;  4OFJ A;  3SEU A;  2YPN A;  2D21 A;  2I3V A;  4GRK A;  3I5O A;  1B3G A;  3UGW A;  3O29 A;  1SW4 A;  4NG7 A;  2YLN A;  2Q8J A;  4XEQ A;  4F2O A;  3IB2 A;  2Z23 A;  5IZ1 A;  5IZ3 A;  4OAN A;  4PFT A;  3CG1 A;  1Z7M E;  3QUJ A;  1LBZ A;  3TOD A;  4ELQ A;  2H9B A;  2ONK E;  2PFY A;  3FJM A;  1I6B A;  4GBV A;  1AWB A;  4MMP A;  1LAH E;  2XWI A;  4LON B;  1MPD A;  1MQG A;  3EQ1 A;  4G4P A;  4PFU A;  4U4X A;  3SZP A;  1B46 A;  1FSA A;  2D5W A;  2PX1 A;  4U23 A;  4GWW A;  1US5 A;  3ONM A;  3A09 A;  4NF4 A;  1IZ1 A;  2DDK A;  1GR2 A;  4FJP A;  1AH5 A;  4OTE A;  5CMB A;  2XXI A;  3HV1 A;  3Q28 A;  4G2Z A;  4PE3 A;  3M3F A;  1FQF A;  1FQD A;  1QVS A;  4ESW A;  4Z7E A;  1MDP 1;  2XHD A;  2R6G E;  4G68 C;  1SYI A;  4IO6 A;  1MXZ A;  3FAS A;  4X1B A;  2RF1 A;  5AA4 A;  4C1T A;  3LV0 A;  3UK4 A;  1BTJ A;  2HAV A;  3IO4 A;  4RNS A;  2L5V A;  4EDP A;  4MF3 A;  2Y5K A;  3M3K A;  3HFU A;  4TLM B;  4P9K A;  1Y1Z A;  4AS4 A;  3KGC A;  1FPD A;  1B2H A;  2O69 A;  2GQ1 A;  1USY H;  3T9X B;  3VFJ A;  4JXI A;  1JQF A;  1B7Z A;  4IR8 A;  2KQZ A;  3FXU A;  3FD3 A;  3ILT B;  5EQA A;  4NWC A;  5L9O A;  1LAX A;  2OBG A;  1QUK A;  4P1L A;  3H6W A;  3U72 A;  2I0B A;  5DEX A;  4LZ7 A;  5AA3 A;  3S9M C;  3TEP A;  3KG2 A;  1B3E A;  4TQU Q;  1QGX A;  1SYH A;  3T9H B;  1A99 A;  1DBZ A;  1MY3 A;  5AA1 A;  1ANF A;  2O84 X;  1DK4 A;  2FHY A;  4ZED A;  4GF8 A;  3TCH A;  4NAP A;  5DYH A;  5JTY B;  3PGF A;  4PDH A;  1MY0 A;  1VDW A;  3TQW A;  4ZE9 A;  3CHG A;  2Y7W A;  2XXT A;  3OXN A;  1KA1 A;  2OWS A;  4FEC A;  2B65 A;  4LA9 A;  2UYF A;  1FW0 A;  1SW5 A;  2CMO A;  2I3W A;  3HST A;  1UTB B;  4NF6 B;  4N81 A;  4GIZ A;  1P1U A;  1B0L A;  2H4I A;  4F1V A;  3E79 A;  4ZEK A;  3G3F A;  3PUV E;  1EYK A;  1II5 A;  4OER A;  3D1R A;  5CMK A;  2VD2 A;  3IB1 A;  3V5A A;  3G3H A;  3U1O A;  1MY2 A;  1XS5 A;  4YIC A;  1N7W A;  3F11 A;  3KFM A;  4F1Y A;  2Y7P A;  1H76 A;  4M4G A;  5I2K B;  4O7M A;  3Q26 A;  4R6Y A;  1FBH A;  1NV7 A;  4HCY A;  3VLU A;  3FUZ A;  3U65 A;  2CZL A;  3RNN A;  3D4C A;  1EZ9 A;  5H8F B;  1MPC A;  2RC7 A;  4G68 A;  1XOC A;  1FTO A;  1R6Z A;  3T9V A;  3TCG A;  2NOO A;  1QJM A;  4KYD A;  4NWD A;  4QFL A;  1LCT A;  4RA1 A;  2F6P A;  1S50 A;  1UIV A;  3KOS A;  2HXW A;  1FJ6 A;  3JZJ A;  2QS3 A;  4TLL B;  3LUY A;  3TZA A;  1G0I A;  3KBR A;  4PBQ A;  1M5C A;  2IEE A;  4RXL A;  4U4S A;  2PT2 A;  2PMS A;  4WEP A;  5JK4 A;  4R2F A;  4U1Z A;  3LUZ A;  3B6T A;  5I84 A;  4BDO A;  4O94 A;  3HN0 A;  1NI9 A;  2Y84 A;  3K1M A;  3C32 A;  3KC1 A;  3MVY A;  2Y7I A;  2V3U A;  2FVZ A;  1ZMG A;  1NV4 A;  3Q29 A;  5IZ3 B;  3S9L C;  2R9J A;  1SD3 A;  4O3A A;  5DVJ A;  3UA8 A;  4H6D A;  2GHA A;  4N15 A;  3EHU A;  4PGN A;  5I7I A;  2B3F A;  4I9D A;  5I59 A;  2F97 A;  4BDL A;  2HXR A;  1FQC A;  3KZG A;  4G68 B;  4NE4 A;  5EYH A;  4KCC A;  1QUI A;  3OO6 A;  4YKI A;  3OEM A;  3FVG A;  1B5H A;  5H8F A;  4G8M A;  1MXU A;  4H46 A;  4HTG A;  4P0G A;  2I48 A;  1IEJ A;  5IGA A;  5I2N A;  1H43 A;  4MNC A;  4RY1 A;  1B3F A;  3FGS A;  3TTL A;  3RTW B;  2O1M A;  2NWJ A;  1Q35 A;  4BLA A;  1AOV A;  4N6P A;  1WVJ A;  4ONY A;  2P0S A;  4MJO A;  1XVX A;  5EHS A;  1IMF A;  1S9T A;  2DE3 A;  4F2Q A;  4LAT A;  3QYT A;  2Q74 A;  1K9Y A;  4LQ5 A;  2Q8M A;  4BDN A;  3IOU A;  5H8N A;  3VLV A;  1FPK A;  3LBS A;  1MXV A;  1J1N A;  1NNF A;  3EKI A;  2B4L A;  4BDR A;  2XWO A;  2PT1 A;  1LBB A;  3O2A A;  1OMP A;  2WKY A;  4OXV A;  4JB7 A;  3T9U A;  3B50 A;  1MY1 A;  2Z8F A;  5I57 A;  4IO7 A;  1B5I A;  1LLS A;  2ZNU A;  4YMA A;  2Q2A A;  4DCX A;  5JTY A;  5ET5 A;  2WBB A;  3LR1 A;  5CBS A;  3KBZ A;  4G77 A;  1YTV A;  4OVT A;  1Y3N A;  3EPE A;  2ALU A;  3G3G A;  1H44 A;  3CG3 A;  5CI5 A;  1GVC A;  1UIU A;  1RYO A;  4JVI A;  1CNQ A;  1JEU A;  1N3X A;  4DE8 A;  5ISU A;  5DEX B;  3T1B A;  1XI6 A;  3EF7 A;  2QMX A;  2O1L A;  3D4G A;  2HFB A;  2REJ A;  4QSE A;  3UOR A;  1FBC A;  4OHN A;  1N04 A;  1PB7 A;  4NF0 A;  2I6E A;  5CMM A;  2OK2 A;  1IIT A;  2DVZ A;  4QXD A;  4Q5T A;  1Y4C A;  2CEY A;  3RLF E;  5F1Q A;  1FBD A;  3KSJ A;  1JET A;  3K1P A;  1FBF A;  4ZS9 A;  1FCK A;  4IGR A;  2H5Y A;  4EXL A;  4LZ5 A;  4AB6 A;  4FEB A;  1FPG A;  1MY4 A;  2ESN A;  5I59 B;  3MYU A;  4HE1 A;  1B3H A;  2AIX A;  4MNI A;  4XF5 A;  4ELP A;  5I56 B;  2RC9 A;  3BBR A;  2XX9 A;  1OLC A;  2ABH A;  4X1D A;  4I8C A;  4HE0 A;  3TFL A;  3QSL A;  4FE8 A;  4XKR A;  4IGT A;  4ECF A;  1NV1 A;  3USD A;  4NF4 B;  3MZ1 A;  4TOZ A;  3OO7 A;  2RC8 A;  4ZEC A;  4PCD A;  1IXH A;  1BLF A;  3IX1 A;  3E78 A;  3SEW A;  3C35 A;  2XXQ A;  5H8S A;  2Q9T A;  2A5S A;  2P1S A;  1B6H A;  4Q30 B;  1ZLQ A;  4KYE A;  5JEI A;  2FNC A;  3KEI A;  1B58 A;  3CR9 A;  4QFK A;  3OOA A;  3LC8 A;  4GBW A;  4U22 A;  3A3C A;  2XX7 A;  4YU0 A;  1IXC A;  1P1W A;  3TTR A;  2HCA A;  3SEY A;  4F31 B;  3M3L A;  4F39 A;  3B8B A;  3C4M A;  4IO5 A;  3FIR A;  1WDN A;  5EYG A;  1FTK A;  2RIN A;  1XVY A;  4I3Y A;  4EUO A;  4N07 A;  4GQO A;  4LP2 B;  4FED A;  5L9S A;  3RYD A;  3PPQ A;  5I56 A;  4K3F A;  4POW A;  2HAU A;  1M5E A;  4DI4 B;  1ATG A;  1A55 A;  5FTI A;  5K2Y A;  4R73 A;  4FOR A;  5EQ9 A;  1PB9 A;  4XKQ A;  2B4M A;  2ZNS A;  2Z8E A;  4N6K A;  4GXS B;  4PFR A;  3W15 C;  4YKK A;  1NV6 A;  4NF8 B;  4XKN A;  1N3W A;  1OQG A;  3B6W A;  3L6G A;  1FRP A;  1UTB A;  1Y3P A;  1NV0 A;  3R26 A;  3DP8 A;  1FBG A;  1OQH A;  5F24 A;  1B05 A;  2F35 A;  3OO8 A;  4F22 A;  4G8H A;  4ZEI A;  3UN6 A;  4MHF A;  1VSO A;  4P56 A;  1TFA A;  4PAF A;  3S9E A;  3FAT A;  3C9H A;  1N7X A;  2F8D A;  4AQ4 A;  4F3B A;  5TPA A;  2VPN A;  4GLI A;  1POY 1;  3PPO A;  4DZ1 A;  5ITP A;  3TYH A;  3ZS6 A;  5B70 A;  3LSL A;  4OWD A;  5I57 B;  3IB0 A;  5AE4 A;  4PFW A;  2Q2C A;  4U2R A;  4G61 A;  1SBP A;  3ISP A;  3O6H A;  2I49 A;  1NUX A;  2O7U A;  2OCU A;  2ZZW A;  3C31 A;  3UIF A;  1B7U A;  1B1H A;  4GWO A;  3E9X A;  5HBC A;  3CFZ A;  1DPE A;  3IOT A;  3TEL A;  4GL0 A;  4P47 A;  5H8N B;  1H3D A;  3OSQ A;  3BIH A;  4O3C A;  1H45 A;  3GLB A;  1ZKB A;  1Y4T A;  2ZMB A;  4GD5 A;  4JDF A;  4RPN A;  5ICQ A;  4IO2 A;  3RY3 A;  2QRY A;  2G93 A;  5BUU A;  3WAF A;  2FIE A;  1R9L A;  5CC2 A;  3NOH A;  1N76 A;  1DPP A;  5I2N B;  3ZKK A;  4LN5 A;  3R7X A;  3WAE A;  2FYI A;  2V4C A;  3LSX A;  3O66 A;  3VXB A;  3KSX A;  1USY E;  4X48 A;  4C0R A;  3CVG A;  4PQJ A;  2VGQ A;  5IM2 A;  3MVZ A;  3PD8 A;  4ZEF A;  5IKB A;  2Q88 A;  4JSO A;  2XXK A;  4HE2 A;  3FJ7 A;  5EHM A;  3VV5 A;  2GH9 A;  3KN3 A;  4ZZA A;  4X9T A;  4QFP A;  4DLD A;  4OEV A;  2YJP A;  4OVJ A;  1NL5 A;  4P1E A;  4PC9 A;  3IFA A;  3KJ7 A;  4I3E A;  3L6H A;  3O6G A;  2F3B A;  2R8T A;  3S4U A;  4IY6 A;  2F6G A;  3MW0 A;  1EZO A;  5HM4 B;  1HSJ A;  3V89 B;  3RGY A;  2NVU B;  5BWJ A;  3BKI B;  3K00 A;  2O6A A;  1Y1M A;  4H1X A;  3VVD A;  2HZL A;  5ET7 A;  3O28 A;  2CZI A;  4YKP A;  1URS A;  1B52 A;  4XKP A;  1MQD A;  4MX6 A;  1NNT A;  2BJI A;  3MBP A;  5HPQ A;  1LFH A;  4RK9 A;  3DP6 A;  2I4C A;  3IOW A;  3HCQ A;  1IQ7 A;  3K6X A;  2Q89 A;  2ZZV A;  5A5L A;  1I6A A;  1ZTY A;  4C1U A;  3PTY A;  4PF6 A;  4JWX A;  4XXU A;  1XC1 A;  2Z8D A;  3TDJ A;  1MS7 A;  5DTB A;  1FBE A;  1B4H A;  4PFB A;  4OVS A;  4JBZ A;  4DXB A;  3H03 A;  1NFT A;  1QW0 A;  5ELV A;  3RT6 B;  4LQ2 A;  2E1S A;  4THI A;  3K0V A;  2DWA A;  2V25 A;  2VPO A;  4X04 A;  1M5B A;  1EYI A;  5IAI A;  3MP8 A;  1FQB A;  1LFI A;  5K2X A;  2M8C A;  4OQO A;  2UVG A;  4YMB A;  3CI8 A;  2QS4 A;  4OA4 A;  4GVO A;  1BKA A;  5I2K A;  2AYS A;  4POX A;  3EHT A;  3R6U A;  1Q1K A;  1OIB A;  2ZYK A;  3CRB A;  3ILU B;  1SI0 A;  3KN7 A;  2CZK A;  5AA2 A;  3U8Q A;  4OVP A;  3C33 A;  5KDT A;  4NED A;  1UQW A;  1D3K A;  4UA8 A;  1JP4 A;  3EN3 A;  3FXQ A;  4MLQ A;  4GL8 A;  4N6D A;  2XXV A;  1P1N A;  4NF6 A;  4HS7 A;  4IO3 A;  4PGP A;  4P3L A;  1PBP A;  1B9J A;  5TP9 B;  1Y3Q A;  4ZZE A;  1VE4 A;  2KR0 A;  4EQ7 A;  4NGU A;  3BIG A;  3PMV A;  3MZ9 A;  1FPE A;  1NV3 A;  4ISU A;  5DVI A;  1AIV A;  3U93 A;  3TTM A;  5ESY A;  2DQV A;  1MG1 A;  1G0H A;  2I4B A;  3QK6 A;  2ANJ A;  3MP1 A;  4NMY A;  2RCB A;  2VOZ A;  1GGG A;  4PF8 A;  4ELR A;  4PET A;  3N6T A;  2DE4 A;  4R9G A;  1N0T A;  3MJN A;  4RYA A;  1QKA A;  1FTL A;  3IOR A;  3N5L A;  4KYS A;  1AL3 A;  4X8R A;  4MNP A;  3OEN A;  1QUJ A;  3PMX A;  5ITO A;  4H8I A;  3MWB A;  2XXW A;  2O51 A;  3MPK A;  2AL5 A;  2BJJ X;  1B51 A;  4NQ8 A;  5I3S A;  4EF2 A;  3OEK A;  3TPA A;  4KPT A;  2F5X A;  3K1N A;  3QUF A;  3RPL A;  3T0J A;  3N6U A;  3GXA A;  4Q0C A;  4IO4 A;  5EYF A;  3IJX B;  3CIJ A;  2V84 A;  4JSD A;  3RTF B;  3TTK A;  5AA4 B;  1NH7 A;  2XWK A;  1YXI A;  3CFX A;  2VHA A;  2P3N A;  2QFL A;  5EQ8 A;  3OD7 A;  1PB8 A;  1DOT A;  3K6U A;  3G7W A;  3PUY E;  3O97 A;  5FBP A;  3PU5 A;  1Y9U A;  1MQI A;  4WKM A;  4PP0 A;  2F34 A;  3IOV A;  2F78 A;  3UP9 A;  5DT6 A;  1FPI A;  1SDX A;  1MXX A;  1JNF A;  1LBW A;  1VFD A;  2DWJ A;  4OEU A;  3SEX A;  3HHF A;  4NN3 A;  3SKP A;  5LDZ A;  1IUD A;  1CE2 A;  5J16 A;  4XIG Q;  3EHS A;  5I5P A;  2PYY A;  4KHZ E;  5KCJ B;  3QXM A;  4PE5 B;  4GWZ A;  4H45 A;  2HPG A;  1FPJ A;  1NV5 A;  3VDF A;  3H06 B;  4F1U A;  1LBX A;  3IFC A;  1Q9D A;  2B3B A;  4F19 A;  1MH3 A;  5A5X B;  3OO9 A;  4QHQ A;  3G3I A;  3TMG A;  3RT8 A;  3H3G A;  3RPL B; 
#chains in the Genus database with same CATH homology
 5CMK A;  4RJZ A;  2VD2 A;  2DWH A;  2Y7R A;  1OQH A;  4R74 A;  4E0W A;  1R1N A;  3IB1 A;  3V5A A;  4FAT A;  3G3H A;  2OJT A;  5KCJ A;  1B05 A;  2F35 A;  3OO8 A;  3U1O A;  5I58 B;  3CSB A;  3K02 A;  4OES A;  2OLB A;  1MY2 A;  1WOD A;  1XS5 A;  4P11 A;  3OMB A;  1LB9 A;  4YIC A;  4F22 A;  3PUX E;  1FQE A;  2ONR A;  1N7W A;  3MP6 A;  2DOJ A;  3PPP A;  4G8H A;  4OET A;  1TXF A;  3FV2 A;  2P2A A;  3F11 A;  4ZEI A;  3KFM A;  5LOM A;  2DSF A;  1P1O A;  4F1Y A;  2Y7P A;  1H76 A;  3UN6 A;  3VXC A;  1VSO A;  4KD5 A;  4NF5 B;  4O3B A;  2X7P A;  1TFA A;  3W9V A;  1ZIU A;  4I62 A;  4M4G A;  5I2K B;  5L9M A;  1EH3 A;  3S9E A;  3FAT A;  5FTH A;  1US4 A;  2RKM A;  3Q26 A;  2DWI A;  3C9H A;  4R6Y A;  5M2V A;  1N7X A;  2F8D A;  4WXJ A;  4AQ4 A;  4F3B A;  1CB6 A;  1HSE A;  1O64 A;  1TFD A;  2RCA A;  4HCY A;  2QMW A;  5TPA A;  3BFT A;  3S2V A;  3PV0 E;  1POY 1;  2F7C A;  3FUZ A;  2CZL A;  2GRV A;  2HZK A;  3PPO A;  4GLI A;  3RUM A;  3RNN A;  4KI0 E;  4OMB A;  3DEL B;  3TYH A;  3KJT A;  3ZS6 A;  3D4C A;  4OEN A;  4QSC A;  1URG A;  5B70 A;  1EZ9 A;  1MPB A;  2NXO A;  3K6V A;  3LSL A;  4IY5 A;  4OWD A;  5H8F B;  3IR1 A;  1B0H A;  5I57 B;  4E0X A;  3IB0 A;  5AE4 A;  1JW5 A;  4PFW A;  1MDQ A;  1URD A;  1MPC A;  1M5F A;  2F7A A;  2Q2C A;  3IAZ A;  2UVI A;  4U2R A;  1QUL A;  1SBP A;  4U1O A;  2RC7 A;  3O6H A;  3B6Q A;  5L8D A;  1XT8 A;  4G68 A;  2I49 A;  2IA4 A;  2XD3 A;  4N13 A;  2D3I A;  1P99 A;  4HW8 A;  1IIW A;  4G8N A;  1XOC A;  2O7U A;  1FTO A;  3C34 A;  2F7B A;  1R6Z A;  3LSF B;  3T9V A;  2OCU A;  3IJO B;  4OFL A;  3RN8 A;  1A8E A;  3MQ9 A;  3C31 A;  3UIF A;  3TCG A;  1B7U A;  1B1H A;  1QJM A;  2NOO A;  2XXY A;  3E9X A;  4GWO A;  4KYD A;  4NWD A;  4QFL A;  3CFZ A;  3V8X B;  1LCT A;  4RA1 A;  2DYX A;  1S50 A;  2F6P A;  4MH5 A;  1UIV A;  1DPE A;  1PC3 A;  3DLN A;  3KOS A;  3E4R A;  4YB7 A;  3IOT A;  4GXA A;  3P7I A;  3H6V A;  3TEL A;  4GL0 A;  2HXW A;  5H8N B;  1I69 A;  1O63 A;  3HO7 A;  4F18 A;  3JZJ A;  2QS3 A;  4TLL B;  3LUY A;  1H3D A;  3VE1 B;  3TZA A;  4H5F A;  3RPW A;  3OSQ A;  3E3K A;  2ZXT A;  3GBA A;  3OEL A;  4O3C A;  1H45 A;  3GLB A;  3KBR A;  4DIG A;  1M5C A;  2IEE A;  4RXL A;  4U4S A;  1ZKB A;  1Y4T A;  2PT2 A;  4F3G A;  1POT A;  3JYR A;  1JW1 A;  1S7Y A;  2PMS A;  4WEP A;  2ZMB A;  3T96 B;  5JK4 A;  4GD5 A;  3TUS A;  4JDF A;  2KLF A;  3U92 A;  1D9Y A;  4R2F A;  4RPN A;  5ICQ A;  1KWH A;  4OFO A;  4U1Z A;  1IXG A;  4IO2 A;  3B6T A;  2QRY A;  4GFR A;  4KFQ A;  2G93 A;  2ONS A;  2QS2 A;  2UVH A;  3RY3 A;  3TAJ A;  5I84 A;  3O9P A;  1ELJ A;  2W7Y A;  3WAF A;  4BDO A;  5BUU A;  5CM6 A;  2GFE A;  1YAE A;  1R9L A;  2LAO A;  5CC2 A;  3CSG A;  2F36 A;  1N76 A;  3HN0 A;  1DPP A;  5I2N B;  3ZKK A;  2Y84 A;  2O7I A;  3R7X A;  1LST A;  2FYI A;  3LSW A;  4H5G A;  3WAE A;  4HCW A;  5H8H B;  2AL4 A;  3BFU A;  3LSX A;  3K1M A;  3O66 A;  3VXB A;  3C32 A;  3KSX A;  1MM7 A;  1USY E;  3MVY A;  4X48 A;  4C0R A;  2QJE A;  2Y7I A;  1TT1 A;  3CVG A;  4YB5 A;  4PQJ A;  2VGQ A;  3MVZ A;  2V3U A;  3PD8 A;  1F9B A;  4ZEF A;  5IKB A;  3TTN A;  2Q88 A;  3HPI A;  4JSO A;  5KDT B;  3FJ7 A;  1ZMG A;  1GV8 A;  4KCD A;  3GZG A;  3Q29 A;  5EHM A;  3S9L C;  1TWY A;  2R9J A;  2FA7 A;  1SD3 A;  4O3A A;  5DVJ A;  4ELO A;  4EXK A;  3MVW A;  3PUW E;  3VV5 A;  3UA8 A;  5H8Q B;  4GOT A;  4H6D A;  2GH9 A;  2GHA A;  1LCF A;  1OVT A;  2QS1 A;  3KN3 A;  4LZ8 A;  1DSN A;  4R75 A;  3SEV A;  4ZZA A;  4X9T A;  4QFP A;  4DLD A;  3EHU A;  3SES A;  4OEV A;  2YJP A;  1A7L A;  4OVJ A;  1QKB A;  1NL5 A;  1R9Q A;  2B3F A;  2X26 A;  1P1Q A;  3VVF A;  3ZKL A;  4I9D A;  3KJ7 A;  2F97 A;  5I59 A;  4JWO A;  1Z7N E;  4BDL A;  3L6H A;  3O6G A;  3ODB A;  1FQC A;  3KZG A;  4IY6 A;  3S4U A;  2F6G A;  3E13 X;  4G68 B;  3MW0 A;  1B7H A;  4NE4 A;  3U94 A;  1PDA A;  1EZO A;  3QAX A;  1HSJ A;  5HM4 B;  1MQH A;  3V89 B;  4EQB A;  3G3J A;  3RGY A;  2NVU B;  2UVJ A;  1QUI A;  3OO6 A;  4KCC A;  4YKI A;  3BKI B;  3K00 A;  3FVG A;  3OEM A;  5BWJ A;  2O6A A;  1Y1M A;  3T93 B;  1B5H A;  1GTK A;  3K6W A;  3O6I A;  4I1D A;  4JWY A;  3Q25 A;  4R6H A;  4R72 A;  5TP9 A;  5H8F A;  4G8M A;  4H1X A;  3Q27 A;  2VD3 A;  2HZL A;  3VVD A;  2XXR A;  1MXU A;  4HTG A;  4RK2 A;  3O28 A;  4P0G A;  5TU0 A;  2DS9 A;  2I48 A;  2REG A;  3GBB A;  4YZZ A;  4YKP A;  5TPA B;  2ZNT A;  1IEJ A;  1URS A;  2Z22 A;  2ZYM A;  1B52 A;  3PPN A;  4XKP A;  1H43 A;  1MQD A;  2ZYO A;  4RY1 A;  1DMB A;  1B3F A;  1NNT A;  1UTH B;  3OSR A;  4QSD A;  2XD2 A;  5F7V A;  3MBP A;  3K01 A;  3FGS A;  5HPQ A;  4EQ9 A;  1LFH A;  4NF5 A;  3MPL A;  1MM6 A;  3TTL A;  1NMU A;  4RK9 A;  2O1M A;  1JW4 A;  3DP6 A;  1Q35 A;  2I4C A;  1MXW A;  3IOW A;  2NWJ A;  3RTW B;  4BLA A;  5B7D A;  3MVX A;  1AOV A;  1A40 A;  4N6P A;  1WVJ A;  3HCQ A;  4ONY A;  2P0S A;  1XVX A;  1IQ7 A;  3JV9 A;  1D4N A;  2XX8 A;  5EHS A;  3K6X A;  1S9T A;  2Q89 A;  3CFL A;  1VFE A;  2DE3 A;  4F2Q A;  4LAT A;  4BDQ A;  4EF1 A;  3QYT A;  1LBC A;  4IB2 A;  1I6A A;  3H6T A;  5ITP A;  1B3L A;  1SQY A;  1ZTY A;  3MAM A;  1DTZ A;  4C1U A;  1SW1 A;  1IXI A;  4M1V A;  3B7D A;  4JWX A;  4XXU A;  4LQ5 A;  4P0I A;  4U21 A;  4BDN A;  1XC1 A;  3IOU A;  1BIY A;  2H25 A;  2Z8D A;  2ZYN A;  2DP8 A;  3TDJ A;  4YKJ A;  2V93 A;  5H8N A;  1FTM A;  3FJG A;  1MS7 A;  5DTB A;  3VLV A;  3LBS A;  3VVE A;  5AA2 D;  1B4H A;  2GHB A;  4H67 A;  4H65 A;  3N94 A;  4JBZ A;  3FVN A;  1MXV A;  1J1N A;  1NNF A;  1NFT A;  3H03 A;  3W9W A;  4BDR A;  4DXB A;  2VP1 A;  5CBR A;  1T0K A;  3HHG A;  1ZU0 A;  2PT1 A;  1LBB A;  3O2A A;  2UXA A;  3PMW A;  4NF8 A;  5FHN A;  4ZEB A;  5ICT A;  1OMP A;  1QW0 A;  2WKY A;  5ELV A;  3RT6 B;  4LQ2 A;  4OXV A;  4JB7 A;  4LUB A;  4ZDM A;  3T9U A;  4DXC A;  3KOT A;  2E1S A;  1O7T A;  3PD9 A;  4QFO A;  4BDM A;  1D9V A;  1B32 A;  1JVX A;  2V3T A;  1LFG A;  1MY1 A;  1NNP A;  4NTL A;  4THI A;  5CRY A;  2NUV A;  3K0V A;  2DWA A;  2V25 A;  2Z8F A;  5I57 A;  4IO7 A;  1B5I A;  1BP5 A;  1LLS A;  1M5B A;  2QSX A;  3FVO A;  3MC2 A;  5CMC A;  1Y20 A;  2ZNU A;  4YMA A;  5IAI A;  1RKM A;  2Q2A A;  3MP8 A;  4DCX A;  5JTY A;  1OLA A;  1FQB A;  3ECR A;  1LFI A;  4OFJ A;  5K2X A;  4ZEC A;  2M8C A;  4OQO A;  3SEU A;  2QPQ A;  3I3V A;  1LB8 A;  3LR1 A;  5CBS A;  2UVG A;  4YMB A;  3CI8 A;  2QS4 A;  2YPN A;  2D21 A;  2I3V A;  4GRK A;  4G77 A;  1YTV A;  4Q8R A;  4GVO A;  1BKA A;  1Y3N A;  3EPE A;  2ALU A;  2AYS A;  3DM0 A;  3G3G A;  1B3G A;  3I5O A;  1H44 A;  4ND9 A;  3CG3 A;  3EHT A;  3O29 A;  3SEW A;  1SW4 A;  5CI5 A;  3UGW A;  4KR5 A;  4DCY A;  1GVC A;  3R6U A;  1UIU A;  1RYO A;  1Q1K A;  1OIB A;  2YLN A;  2ZYK A;  3CRB A;  3ILU B;  1JEU A;  1N3X A;  3FV1 A;  2OZZ A;  3C36 A;  1SI0 A;  4L17 A;  2Q8J A;  4DE8 A;  2XXH A;  3A3U A;  5DEX B;  4F2O A;  3KN7 A;  5ISU A;  1ZJL A;  3IB2 A;  3EF7 A;  5AA2 A;  5J1D A;  3U8Q A;  2Z23 A;  5I58 A;  2QMX A;  3MZB A;  4PFT A;  2O1L A;  3ZSF A;  2PVU A;  4DXU A;  3N26 A;  3CG1 A;  3D4G A;  3C33 A;  2DXR A;  3TQL A;  4YAH X;  5KDT A;  2E0S A;  1Z7M E;  3QUJ A;  4NED A;  2HFB A;  1UQW A;  2REJ A;  4QSE A;  1JVY A;  1D3K A;  4UA8 A;  5I2K A;  3UOR A;  3TOD A;  4OHN A;  3EN3 A;  3FXQ A;  1NNK A;  3MUQ A;  4MLQ A;  4GL8 A;  5I2N A;  1RYX A;  4ELQ A;  5HBC A;  1N04 A;  2XXV A;  1UTH A;  3PPR A;  2H9B A;  1P1N A;  1PB7 A;  2I6E A;  4NF6 A;  2ONK E;  2XXU A;  5CMM A;  4FIM A;  1B5J A;  2Y7K A;  3FJM A;  2OK2 A;  1IIT A;  1MRP A;  2DVZ A;  4HS7 A;  4AB5 A;  1I6B A;  1PEB A;  4IO3 A;  1PBP A;  2I0C A;  1B9J A;  4Q5T A;  1Y4C A;  2DXY A;  4DDD A;  1M5D A;  1LAH E;  3SDF A;  3RLF E;  5F1Q A;  3S9N C;  3KSJ A;  5TP9 B;  1Y3Q A;  4LON B;  1JET A;  3K1P A;  4ZS9 A;  4Z0I A;  1MPD A;  4ZZE A;  1MQG A;  1VE4 A;  1FCK A;  5KZT A;  4IGR A;  2H5Y A;  4EXL A;  4LZ5 A;  4AB6 A;  4FEB A;  4F29 A;  3EQ1 A;  4DZ1 A;  4EQ7 A;  4G4P A;  4PFU A;  3PUZ E;  1MY4 A;  2ESN A;  4U4X A;  1I6Q A;  3PMV A;  3MZ9 A;  5I59 B;  4ISU A;  1B46 A;  5DVI A;  1AIV A;  4PFY A;  2D5W A;  3U93 A;  3TTM A;  2PX1 A;  2DQV A;  2THI A;  1B3H A;  4U23 A;  1MG1 A;  2AIX A;  1US5 A;  3ONM A;  3A09 A;  4NF4 A;  2I4B A;  4ELP A;  5I56 B;  3QK6 A;  2ANJ A;  2RC9 A;  3MP1 A;  1IZ1 A;  2V3Q A;  2RCB A;  3BBR A;  2VOZ A;  2XX9 A;  4NMY A;  1GGG A;  1GR2 A;  4FJP A;  1AH5 A;  4OTE A;  5CMB A;  5H8Q A;  2XXI A;  4ESX A;  1FQA A;  4ELR A;  4PET A;  1OLC A;  3HV1 A;  3N6T A;  3Q28 A;  4G2Z A;  2ABH A;  4X1D A;  2HEU A;  3M3F A;  4I8C A;  2I58 A;  3TFL A;  2DE4 A;  4R9G A;  1EU8 A;  2X7Q A;  3K4U A;  3QSL A;  4FE8 A;  4XKR A;  1N0T A;  1FQF A;  1FQD A;  1QVS A;  5FHM A;  4ESW A;  4Z7E A;  1LAF E;  2G29 A;  2A5T B;  3MJN A;  4IGT A;  4MBP A;  1FTJ A;  4RYA A;  4ECF A;  1MDP 1;  2XHD A;  1QKA A;  1FTL A;  5A5X B;  2R6G E;  2H99 A;  3IOR A;  3N5L A;  3MZ1 A;  1AL3 A;  4KYS A;  4NF4 B;  1SVX B;  2RC8 A;  3OO7 A;  4G68 C;  4TOZ A;  1VR5 A;  3FXR A;  1IXH A;  1QUJ A;  3OEN A;  1SYI A;  4IO6 A;  1MXZ A;  3FAS A;  1BLF A;  2OWT A;  3IX1 A;  1LAG E;  3PMX A;  4H8I A;  5ITO A;  3SET A;  3C35 A;  4X1B A;  4FAJ A;  2RF1 A;  2XXQ A;  2XXW A;  3MWB A;  5H8S A;  5AA4 A;  4C1T A;  2O51 A;  2Q9T A;  3UK4 A;  2A5S A;  3FZV A;  3IK6 B;  4KQP A;  2P1S A;  3MPK A;  2AL5 A;  1B6H A;  1BTJ A;  2HAV A;  3KN8 A;  2BJJ X;  1A8F A;  3IO4 A;  3VLW A;  1B51 A;  4Q30 B;  3IL1 B;  4RNS A;  1ZLQ A;  4KYE A;  4MFI A;  4EDP A;  4EF2 A;  3OEK A;  4MF3 A;  3TPA A;  4UAC A;  5JEI A;  2FNC A;  3M3K A;  4KPT A;  2F5X A;  3H4Z A;  2XXP A;  3KEI A;  4ZE8 A;  1NH8 A;  4TLM B;  1B58 A;  2QL3 A;  3M8U A;  2R71 A;  3CR9 A;  4YB6 A;  1Y1Z A;  3IO6 A;  3K1N A;  3KGC A;  4QFK A;  3OOA A;  1B2H A;  2O69 A;  2XXX A;  3QUF A;  3LC8 A;  1B4Z A;  1USY H;  3N6U A;  3GXA A;  3QIM A;  4JXI A;  4POX A;  4Q0C A;  3T9X B;  3VFJ A;  4QF9 A;  4IO4 A;  1JQF A;  4U22 A;  1ZBM A;  3H6U A;  5EYF A;  3IJX B;  3A3C A;  2XX7 A;  3CIJ A;  4YU0 A;  2DE2 A;  2V84 A;  4JSD A;  3RTF B;  3TTK A;  1IXC A;  1MH4 A;  1P1W A;  5AA4 B;  1B7Z A;  1NH7 A;  3TTR A;  2HCA A;  3SEY A;  3T22 A;  3FXU A;  4F3S A;  4F31 B;  3CFX A;  3M3L A;  2VHA A;  4F39 A;  4QFN A;  3C4M A;  4IO5 A;  4H0W A;  3FIR A;  1WDN A;  3FD3 A;  3OD7 A;  3ILT B;  4R9F A;  2HQ0 A;  4NWC A;  1PB8 A;  1DOT A;  1LAX A;  1MQJ A;  2A5T A;  1FTK A;  2RIN A;  3G7W A;  3K6U A;  1XVY A;  3PUY E;  3O97 A;  4H8J A;  2OBG A;  1PBQ A;  1A54 A;  3I6V A;  4R6K A;  4MLV A;  3PU5 A;  1Y9U A;  4EUO A;  1MQI A;  4WKM A;  1QUK A;  3H6W A;  4N07 A;  3K2D A;  4OYV A;  5AA2 B;  1EZP A;  4GQO A;  4LP2 B;  3H7M A;  2F34 A;  4PP0 A;  2I0B A;  3U72 A;  5DEX A;  1XHY A;  4FED A;  4WED A;  1YPN A;  5L9S A;  3TKD A;  3FVK A;  3IOV A;  2F78 A;  4LZ7 A;  3UP9 A;  5AA3 A;  3PPQ A;  3S9M C;  3TEP A;  3KG2 A;  5DT6 A;  1AMF A;  5I56 A;  1B3E A;  4K3F A;  1SDX A;  1MXX A;  4POW A;  4TQU Q;  4XTC Q;  2HAU A;  1JNF A;  3RQT A;  1M5E A;  1SYH A;  1VFD A;  4OZ9 A;  2DWJ A;  4OEU A;  1A99 A;  1ATG A;  2UYE A;  4QRZ A;  1MY3 A;  5AA1 A;  3HHF A;  3SEX A;  3T9H B;  1A55 A;  5FTI A;  1YCJ A;  5K2Y A;  3SKP A;  1OVB A;  5DVF A;  5FHO A;  4F3P A;  1ANF A;  2O84 X;  1B1X A;  3T66 A;  4ZED A;  4R73 A;  4GF8 A;  3TCH A;  4FOR A;  1HSL A;  1IUD A;  1CE2 A;  5DYH A;  1PB9 A;  1MXY A;  5JTY B;  3PGF A;  4XIG Q;  3EHS A;  1MY0 A;  2PYY A;  4RPO A;  1SI1 A;  3TQW A;  1DTG A;  4ZE9 A;  4XKQ A;  4KHZ E;  2Y7W A;  5H8H A;  5KCJ B;  3QXM A;  4PE5 B;  2XXT A;  3OXN A;  2O68 A;  2ZNS A;  1SW2 A;  2OWS A;  2Z8E A;  3G3K A;  4FEC A;  4GXS B;  2B65 A;  4LA9 A;  2UYF A;  4YKK A;  3VDF A;  3W15 C;  3V83 A;  3H06 B;  1FW0 A;  1SW5 A;  2CMO A;  2I3W A;  4F1U A;  1L5T A;  1B40 A;  4NF8 B;  3HST A;  4XKN A;  3AXF A;  1UTB B;  4LVQ A;  3USD A;  4NF6 B;  1N3W A;  1OQG A;  4GIZ A;  4R2B A;  3B6W A;  5L9O A;  2B3B A;  4F19 A;  1MH3 A;  3VLU A;  3OO9 A;  5A5X A;  1NKX A;  2DVC A;  1B0L A;  1P1U A;  2H4I A;  2H98 A;  2PBW A;  3L6G A;  3THI A;  1UTB A;  4F1V A;  3DP4 A;  4QHQ A;  1Y3P A;  3G3I A;  4ZEK A;  3TMG A;  1N84 A;  3G3F A;  3PUV E;  1JEV A;  3RT8 A;  3R26 A;  3SER A;  3TCF A;  1II5 A;  3DP8 A;  4OER A;  1LGB C;  3H3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...