4RK2A

Crystal structure of sugar transporter rhe_pf00321 from rhizobium etli, target efi-510806, an open conformation
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
393
structure length
393
Chain Sequence
AVTLKWALWDWDKTAYYKPLIEAYQAKHPNVKFEPMDLGSQDYQQMISTQLTGGSKDIDIVTIKDVPGYTNLVRAGNIADLSGFVKDQKIDPAPYGGLIEELTIDGKIYSLPFRSDFWIVYYNKDIFDKAGVPYPTNDMTWAQFDETAEKLAGGMGTNKTYGALLHTWRSTVQLPGILDGKHTLVDGDYAFLKPWYERALTLQKDGAIPSYAFLKTSNTHYSALFFNGTIGMLPMGTWFVGTQIAKVKSGESKSKNWGIVKFPHPDGVPAGTTAAQISGLAVNSNSQHKDAALDFIKFVAGPEGAAVVAATGTFPALKTADVSAKIASTPGFPQDEASKEALIPAKAYLEMAVNPNAAKIEVVLNRAHDAIMTDNTSVDDGLKEMTEGVKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative sugar ABC transporter, substrate-binding protein
publication title Crystal Structure of Sugar Transporter RHE_Pf00321 from Rhizobium Etli, Target EFI-510806
rcsb
source organism Rhizobium etli
molecule tags Transport protein
total genus 138
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4rk2A00
4RJZA 2QJEA 5H8QA 4RPOA 2AL5A 3HO7A 1NFTA 4NE4A 1OQGA 1DTZA 3L6GA 1MQGA 3RTFB 1PB7A 5FTHA 1YAEA 5KCJB 1M5BA 3N6UA 3LC8A 1B7ZA 3H03A 4OQOA 1SW4A 1Y1ZA 2ALUA 3EPEA 3QSLA 4PP0A 3D4CA 5AE4A 2V3TA 1M5FA 4YZZA 3SEXA 1TFDA 3H4ZA 4H0WA 5CM6A 2I4BA 2XD3A 3RN8A 2QMWA 5IKBA 1MY3A 4EF2A 3ZKKA 5H8NB 3BBRA 1VFEA 1NH7A 1I69A 3OXNA 3O2AA 2W7YA 1O7TA 4QFNA 1SD3A 4X1DA 3V8XB 4IO2A 4R6YA 3FXUA 1MQJA 3OO6A 4H5GA 5H8QB 1P1WA 1H76A 4ND9A 2DWJA 4ESWA 3LSLA 2D5WA 1B40A 4LQ2A 4DE8A 2O69A 4QHQA 2Q89A 4EQ9A 4GLIA 1O64A 1D4NA 1EZ9A 1LFIA 1FW0A 1JQFA 3H6VA 4H8JA 2DE4A 4ZE8A 4EXKA 1JW4A 3E3KA 3K2DA 3OO8A 1TFAA 4DIGA 3PMWA 4NEDA 3IOUA 4GRKA 1MY1A 4F1UA 2ESNA 4OWDA 2YJPA 3KBRA 2PYYA 3CSBA 3O6GA 3PPQA 3UP9A 4ELRA 4Z7EA 1AOVA 1AH5A 1BLFA 3JZJA 3PU5A 3FVOA 3MWBA 3KEIA 3EF7A 3T93B 3FVGA 1JW1A 4XXUA 1B6HA 4FE8A 3SEYA 1UIVA 5I59A 1ZJLA 1A8FA 2O84X 3N6TA 2QMXA 2PMSA 3T9XB 2REGA 1BP5A 4KYSA 1FQCA 4HW8A 5FHMA 1B52A 3I3VA 1POY1 3EHSA 3TTKA 1Y9UA 4POXA 3SEWA 5BUUA 4ELQA 2GFEA 1NL5A 4OFLA 4XKRA 4N6PA 4OEUA 4RK2A 1N04A 1OLAA 4KCCA 4KR5A 4EQBA 3MC2A 3TCFA 2DSFA 3S9EA 1MXUA 2OK2A 4TLLB 1MXWA 4KHZE 2ZNTA 3N26A 4HCWA 3OEMA 2F35A 4DXCA 1MQIA 4YMAA 1FQEA 2OCUA 2I3VA 3DP4A 4GVOA 4OHNA 2PVUA 1NNKA 4JSDA 4F3BA 1Q35A 5I59B 3PGFA 1MXYA 4E0XA 1B5IA 1OQHA 3R6UA 1JNFA 2RC8A 3ILTB 3K0VA 1BKAA 4PE5B 4JXIA 1H3DA 2M8CA 5I58A 4G4PA 1Y4TA 3T9HB 3C35A 4DLDA 2UYEA 4IY6A 2HFBA 1BIYA 4PFYA 1B7HA 3IB0A 3IAZA 4BDRA 2F34A 4Q8RA 1MY2A 4F22A 4QRZA 1TWYA 1N84A 2ZYOA 3H6UA 3MBPA 2DVCA 2NVUB 1LSTA 3Q28A 3CFZA 1J1NA 4QSDA 3VLVA 4LP2B 4ZEFA 3K6UA 1FQAA 4YICA 4F18A 5CMKA 1PEBA 3W9WA 3IJOB 4LQ5A 3TODA 3O97A 5F1QA 5I56A 2ONRA 2ONKE 2VGQA 4OESA 1MY0A 1P1NA 3DP8A 3FXQA 5H8FA 1LGBC 5I58B 1MDQA 1MG1A 3B6QA 2XXUA 3I6VA 3K1PA 4I9DA 1H44A 4JSOA 4OFOA 4EUOA 1MPDA 3UORA 4THIA 3MQ9A 3OELA 1LFGA 2O51A 1MXXA 1B1HA 4RY1A 1R6ZA 1IUDA 3O28A 1B4HA 4F3GA 1SW1A 1Q1KA 1RYOA 4NF8A 2NXOA 2V3QA 2QRYA 4QFOA 2QSXA 4Q5TA 3TYHA 2HEUA 3S9MC 1N3XA 4FJPA 3G3IA 4NF5A 1D9VA 4NMYA 1LB9A 1H43A 5FHOA 3RPWA 5I56B 3TEPA 1JETA 1NMUA 4GL8A 2Z8EA 1ZMGA 3H7MA 3TCGA 1JW5A 3KJTA 1URGA 3D4GA 2ZNSA 4IO3A 4QFLA 3O6HA 4IB2A 5DEXA 4I62A 3AXFA 4OYVA 2Y84A 1AMFA 1B2HA 4GQOA 2OLBA 4R75A 4YB7A 2REJA 2YLNA 1JEVA 1IXCA 2ZYNA 4FEBA 3U8QA 2B3FA 4EDPA 4U21A 1B4ZA 5TP9A 2HAUA 2XXTA 1B1XA 3ZKLA 4H1XA 4KI0E 1P99A 2OBGA 3PUXE 4NF8B 3Q26A 5J1DA 3MPKA 3C33A 4R73A 3MZ9A 3RQTA 4NF5B 4QFPA 3PPNA 4DCYA 2DQVA 3OOAA 2ABHA 4O3CA 4LZ8A 2H5YA 4LA9A 4JWOA 1MS7A 3LR1A 2OWTA 2UVIA 2QS4A 2THIA 4OETA 5DEXB 1B05A 5CBRA 1WVJA 1Y1MA 3ODBA 2AYSA 4FAJA 3DLNA 3L6HA 3OMBA 1MXZA 3PPOA 4ZE9A 3SDFA 4UA8A 2XD2A 2XXHA 3C32A 4ZZEA 5K2XA 2Q2CA 4MLVA 3V83A 4OXVA 5DVIA 2XHDA 3G3HA 5TP9B 1VR5A 4R9GA 1M5CA 1NKXA 2XXYA 4F1VA 2CZLA 3UK4A 3MVZA 4PFWA 4EF1A 3DP6A 1SI1A 3PUZE 4F31B 1ZLQA 1LB8A 2H25A 3TTNA 1N3WA 1MPCA 1AL3A 5IAIA 3VV5A 1ZIUA 1B32A 1FQBA 3FV2A 3IO4A 3T96B 2XX8A 2UVHA 2HQ0A 3FXRA 1MQHA 3PD8A 4RXLA 3C31A 4U22A 4UACA 3K1NA 3H6TA 3C34A 3O29A 2BJJX 1NNTA 3LSFB 2XXWA 1SYIA 1S9TA 1B7UA 1N0TA 4GIZA 1LAXA 5JEIA 2Q8JA 2V84A 3MUQA 2Q88A 1HSEA 3S9NC 1JEUA 4BDQA 3ZS6A 3FJMA 4R6KA 4YB5A 2VHAA 1IZ1A 1R1NA 3E4RA 1BTJA 1SBPA 2GHAA 2QS1A 3FJ7A 3TTLA 2D21A 1OVTA 3TQWA 1MM7A 5FHNA 4WEPA 3K01A 3H6WA 1YTVA 2R6GE 3MW0A 1Z7ME 2PT2A 3QK6A 2Y7IA 1MPBA 1L5TA 1B3HA 3OD7A 5AA2B 3K02A 2F8DA 1B9JA 3TCHA 1A40A 3CSGA 4HCYA 5EHMA 3R26A 5L9SA 3U72A 1N76A 2O6AA 1FTLA 4QSEA 1JVXA 1SYHA 1TT1A 5A5XA 4R9FA 2ONSA 1Y3NA 3Q27A 5CRYA 4G68A 3CR9A 5JK4A 1DPEA 3BKIB 2I0CA 3QIMA 1B46A 1NNPA 5K2YA 2Z22A 1LBCA 2P1SA 1LCTA 3MVYA 3VLWA 3LSWA 3O6IA 1SVXB 3T9VA 4KYDA 4R74A 5I2NA 3S2VA 2RINA 3M3FA 1IITA 2Z8FA 3GXAA 4H5FA 2XXIA 1DSNA 3K6VA 1GV8A 4DZ1A 1PBQA 1FTKA 1DTGA 2G93A 2IA4A 1LFHA 2V3UA 4IO7A 3LSXA 3U93A 3UN6A 3P7IA 3S9LC 4G68C 3HV1A 2XXQA 3BFTA 3MPLA 3HPIA 3C9HA 4AQ4A 4AB5A 3UIFA 1H45A 4MFIA 4YKIA 2HCAA 1B3EA 4RA1A 3KSXA 3O9PA 5A5XB 1Y20A 2QPQA 3VXCA 2I4CA 2O68A 1IIWA 4G68B 3A3UA 1P1QA 4QFKA 1OLCA 1XT8A 2UYFA 3TTRA 3M8UA 1ZBMA 3PMVA 4YU0A 2DVZA 1UIUA 3IOVA 2ZXTA 4IO4A 2XX9A 1DMBA 2Z23A 1B3GA 3PPPA 5I2NB 4RK9A 1M5EA 3K6WA 1YPNA 1Y3QA 4DDDA 2A5SA 4N07A 3LBSA 1A55A 4ISUA 5HPQA 4C1TA 4GFRA 1UTHA 3M3KA 1FTMA 2H99A 4KCDA 4EXLA 4KYEA 1ELJA 1MH3A 3IOTA 3N94A 3QAXA 2O7UA 3IR1A 3HSTA 4TQUQ 3KG2A 2P2AA 1PB8A 1FTJA 4M4GA 2P0SA 3FJGA 5JTYA 3EQ1A 1KWHA 2FYIA 3USDA 1SW2A 3TQLA 1PC3A 3FZVA 3T9UA 4RNSA 4F29A 3FV1A 1I6QA 2X7QA 3TDJA 4U4XA 2GH9A 2DWHA 3GBAA 2RCAA 4IGRA 3GZGA 1P1UA 2Y7PA 3GBBA 4F1YA 5AA3A 3KOTA 4G2ZA 4N13A 1UTHB 2H98A 3SERA 1FQDA 3MP8A 3IL1B 1US5A 3H3GA 2ZYKA 3V5AA 1A54A 4Z0IA 3G7WA 3KFMA 3C36A 4NTLA 1WDNA 2NOOA 1MQDA 3M3LA 3UGWA 4HTGA 3RY3A 4P0IA 3OEKA 4F19A 5KDTA 3IJXB 2R9JA 1QUJA 4PFUA 1N7XA 2PX1A 1B0HA 5JTYB 2DYXA 1LAHE 4EQ7A 2F7BA 4PQJA 2GHBA 4R6HA 1QVSA 1LCFA 4YAHX 3JYRA 3MP1A 4E0WA 1SQYA 1MRPA 2O1LA 3SKPA 4GWOA 2F6PA 4WXJA 1USYE 5I57A 4ESXA 1HSLA 3FVNA 3TUSA 2Y7KA 1SDXA 3CG1A 3CVGA 3MJNA 5AA4A 1IXHA 1FCKA 4G77A 1IXIA 5HM4B 5CI5A 1URDA 1Z7NE 2VOZA 5B7DA 2I0BA 3HN0A 3CFLA 1LBBA 4MBPA 2DE3A 5CMBA 2DXRA 4U23A 2E1SA 2PT1A 3LUYA 4GXSB 2G29A 5KDTB 1MY4A 4ECFA 4XTCQ 4NWDA 5F7VA 3N5LA 4YKKA 3PUYE 5AA2D 1B0LA 3OO7A 2F97A 3VVEA 3Q25A 4MLQA 4ZS9A 3PMXA 3R7XA 1QKAA 1R9LA 5I57B 1PB9A 1QULA 3IB1A 4U1OA 3E13X 1N7WA 4H67A 4K3FA 3VDFA 4NWCA 4LVQA 5AA4B 2F5XA 3RT8A 2I49A 2Y7WA 4H65A 5CC2A 5I84A 1YCJA 4GOTA 1QW0A 5ISUA 3CRBA 3FUZA 4BDNA 4L17A 4ZZAA 3IO6A 3EHTA 2HAVA 3PUVE 4M1VA 1NH8A 5H8HA 4TLMB 3B6WA 3U1OA 1QKBA 4JB7A 1S7YA 1QUIA 3ILUB 3OO9A 3QYTA 4GF8A 1FTOA 3K6XA 1EH3A 1R9QA 3KSJA 3QUFA 4BLAA 1EZOA 1RKMA 2HZKA 3Q29A 4OEVA 4P0GA 3IB2A 2F36A 3OENA 4BDOA 1MM6A 5AA1A 2F78A 3ZSFA 4R2FA 3MVXA 4OZ9A 1B5HA 3KJ7A 3SEVA 5ITPA 1A99A 5ICTA 4FIMA 3FIRA 1B51A 2I48A 3PPRA 5AA2A 4C0RA 3ECRA 2F7CA 2O7IA 2ZNUA 5ELVA 3S4UA 5TPAA 3EHUA 4NF4A 5H8HB 3A3CA 2RF1A 2UXAA 3QUJA 4TOZA 3WAFA 2ZYMA 4FECA 2DS9A 4OVJA 1B58A 1M5DA 4H6DA 3F11A 2QL3A 2H4IA 1UQWA 2OWSA 2F6GA 5DTBA 3VVFA 3G3FA 3KOSA 1JVYA 2PBWA 3W9VA 5KZTA 1ZU0A 2GRVA 3E9XA 5L8DA 2RCBA 4ELPA 3FASA 4X48A 3G3KA 1NNFA 2ANJA 2D3IA 2CMOA 1A7LA 2I3WA 3KN7A 4F3PA 1VFDA 4JBZA 5CMCA 2O1MA 2AL4A 3RT6B 4JWXA 1RYXA 1ZTYA 3FGSA 3MZ1A 4BDMA 2YPNA 1UTBA 4LONB 2B3BA 4I8CA 1II5A 2XXRA 3TPAA 1MH4A 3VE1B 2Z8DA 5DYHA 3T66A 4ZDMA 5TPAB 4DXUA 4NF4B 2KLFA 1ANFA 1PBPA 1GR2A 4F3SA 4F2QA 1F9BA 1GGGA 2QS3A 2E0SA 1IEJA 2I58A 3WAEA 5EHSA 3T22A 2ZMBA 3TTMA 3B7DA 2Q2AA 1XHYA 3RUMA 1OMPA 1LAGE 4MF3A 2RC9A 4OERA 1HSJA 1P1OA 3HHFA 1WODA 4LATA 5DT6A 3QXMA 4XKNA 4R2BA 2WKYA 2F7AA 4POWA 4GL0A 3OSRA 3IOWA 3GLBA 2FA7A 4YB6A 4P11A 3SETA 3KN3A 4JDFA 2XXXA 3U92A 1UTBB 2DP8A 3TKDA 4FEDA 3A09A 5I2KA 4IO5A 1MDP1 4GD5A 2Q9TA 1I6AA 2V25A 1OIBA 3O66A 4IY5A 3HHGA 4ELOA 1XVYA 4PETA 1S50A 3SESA 1D9YA 3C4MA 3ONMA 2DWIA 4X9TA 1PDAA 3RTWB 4F39A 4XIGQ 4QF9A 3TMGA 3RLFE 5LOMA 1US4A 4Q0CA 2XX7A 5ICQA 4XKPA 3K4UA 3H06B 4ZEIA 5DVFA 4Q30B 1GTKA 3PUWE 3RNNA 4LZ7A 3DELB 3CG3A 2AIXA 4ZEDA 1T0KA 2DXYA 3CI8A 2DWAA 3HCQA 3MVWA 2HXWA 2H9BA 1SW5A 4G8NA 5I2KB 3TZAA 5ITOA 3SEUA 1TXFA 1QJMA 1B3FA 1IQ7A 4FATA 2IEEA 4H8IA 1OVBA 1I6BA 4OENA 4U4SA 5H8SA 4XKQA 2A5TA 1DPPA 3TELA 3OSQA 4MH5A 4KD5A 2UVGA 3U94A 1URSA 1DOTA 2HZLA 4C1UA 4IGTA 3G3JA 4OFJA 2UVJA 3W15C 3THIA 1CB6A 3K1MA 2I6EA 5CBSA 1USYH 4O3BA 3G3GA 4ONYA 3VLUA 2X26A 3VFJA 4KFQA 2R71A 1XVXA 4ZEKA 3CIJA 3MAMA 4ZEBA 4DCXA 4G8HA 2NUVA 3IK6B 4GXAA 4R72A 2VP1A 1ZKBA 1XC1A 2RKMA 3DM0A 3MZBA 4KQPA 4LZ5A 4X1BA 1EU8A 1VE4A 4DXBA 2Y7RA 3IX1A 1O63A 4LUBA 3I5OA 3KN8A 4OTEA 4F2OA 1VSOA 2OJTA 4AB6A 5EYFA 2A5TB 1GVCA 4YKPA 2XXVA 4NF6A 1Y4CA 1A8EA 3K00A 2V93A 3EN3A 3UA8A 5B70A 4O3AA 3PD9A 4KPTA 1B3LA 4YMBA 3CFXA 3TFLA 5BWJA 4I1DA 1ATGA 1FQFA 1IXGA 1LAFE 1SI0A 1XS5A 3VXBA 2RC7A 1Y3PA 5H8FB 4BDLA 1B5JA 4ZECA 4WKMA 4JWYA 5L9OA 4FORA 4IO6A 4U1ZA 1POTA 5CMMA 5HBCA 3V89B 3KZGA 3FD3A 2XXPA 4G8MA 3PV0E 3FVKA 1CE2A 5KCJA 2X7PA 2LAOA 4U2RA 4WEDA 4RYAA 4NF6B 1XOCA 5TU0A 2OZZA 2DOJA 3JV9A 4YKJA 1AIVA 2VD3A 1MXVA 3KGCA 2DE2A 4HS7A 3IORA 1D3KA 4OMBA 3MP6A 5H8NA 5FTIA 5DVJA 3B6TA 1LLSA 3TAJA 2B65A 2VD2A 1EZPA 5M2VA 5L9MA 2FNCA 3VVDA 3FATA 2NWJA 2QS2A 1QUKA 4PFTA 4RPNA 3RGYA 3BFUA 4QSCA
chains in the Genus database with same CATH superfamily
4RJZA 2QJEA 5H8QA 4RPOA 4QXDA 2AL5A 3HO7A 1NFTA 4NE4A 1OQGA 1DTZA 3L6GA 1MQGA 3RTFB 1PB7A 5FTHA 1YAEA 4N6KA 5KCJB 4P1LA 1M5BA 3N6UA 3LC8A 1B7ZA 3H03A 4OQOA 1SW4A 1Y1ZA 2ALUA 3EPEA 3QSLA 4PP0A 3D4CA 5AE4A 2V3TA 1M5FA 4YZZA 3SEXA 1TFDA 3H4ZA 4H0WA 5CM6A 2I4BA 2XD3A 3RN8A 2QMWA 5IKBA 1MY3A 4EF2A 3ZKKA 5H8NB 3BBRA 1VFEA 1NH7A 1I69A 3HFUA 3OXNA 3O2AA 2W7YA 2Y5KA 1O7TA 4QFNA 1SD3A 4X1DA 3V8XB 2VPOA 4IO2A 4R6YA 3FXUA 1MQJA 3OO6A 4H5GA 5H8QB 1P1WA 1H76A 4ND9A 3T0JA 2DWJA 4P9KA 3KC0A 4ESWA 5I7IA 3LSLA 2F3DA 2D5WA 1B40A 4LQ2A 4DE8A 2O69A 4QHQA 1YZ0A 2Q89A 4XF5A 4EQ9A 4PFRA 2VPNA 4GLIA 1O64A 1D4NA 1EZ9A 2F3BA 1LFIA 1FW0A 1JQFA 3H6VA 1DBZA 3NOHA 4H8JA 2DE4A 4ZE8A 2XWVA 4EXKA 1JW4A 2ZZXA 3E3KA 3K2DA 3OO8A 5LTCA 5EQAA 5EYHA 1TFAA 4DIGA 3PMWA 4NEDA 3IOUA 4GRKA 1MY1A 4F1UA 2ESNA 4OWDA 2MKZA 2YJPA 3KBRA 2PYYA 3CSBA 3O6GA 3PPQA 3UP9A 4ELRA 1EYKA 4Z7EA 1AOVA 1AH5A 1BLFA 1FBHA 1RDXA 3JZJA 1FPIA 3PU5A 3FVOA 3MWBA 4H46A 3KEIA 3EF7A 3T93B 3FVGA 1JW1A 4XXUA 1B6HA 4FE8A 3SEYA 1UIVA 3B8BA 5I59A 1ZJLA 1A8FA 4PGPA 2O84X 3N6TA 2QMXA 2PMSA 3T9XB 4XEQA 3BIHA 2REGA 1BP5A 4KYSA 4NG7A 1FQCA 4HW8A 4GBWA 5FHMA 1B52A 2QFLA 3I3VA 1POY1 3EHSA 3TTKA 1Y9UA 4POXA 3SEWA 4OFLA 2GFEA 1FTAA 1NL5A 4XKRA 4ELQA 4N6PA 5BUUA 2ZZWA 4OEUA 4N15A 4RK2A 1N04A 1OLAA 4KCCA 4KR5A 4EQBA 3MC2A 3TCFA 2DSFA 3S9EA 1MXUA 2OK2A 4TLLB 1MXWA 4KHZE 2ZNTA 3N26A 4HCWA 3OEMA 2F35A 4DXCA 1MQIA 4YMAA 1FQEA 2OCUA 2I3VA 3DP4A 2XA5A 4GVOA 4OHNA 4LN5A 2PVUA 1NNKA 4GWWA 4JSDA 4F3BA 1Q35A 5I59B 3PGFA 1MXYA 4E0XA 1B5IA 4FBPA 5T3JA 1FRPA 1OQHA 3R6UA 4GBVA 1JNFA 2RC8A 3ILTB 1FBGA 3K0VA 1BKAA 2PFZA 1CNQA 4PE5B 4JXIA 1H3DA 2M8CA 5I58A 4G4PA 1Y4TA 3T9HB 2XXKA 3C35A 3U65A 4DLDA 1NV4A 2UYEA 4IY6A 2HFBA 1BIYA 4PFYA 1B7HA 3IB0A 2P3NA 3IAZA 4BDRA 2F34A 1KA0A 4Q8RA 4OVPA 1IMAA 1MY2A 4F22A 4HE2A 4HXVA 4QRZA 1TWYA 4QBAA 1N84A 2ZYOA 3H6UA 3MBPA 2DVCA 2OX3A 2NVUB 3EKIA 2WYPA 1LSTA 3Q28A 3CFZA 1J1NA 4QSDA 3VLVA 4LP2B 4ZEFA 3K6UA 1FQAA 4YICA 4F18A 5CMKA 1PEBA 3W9WA 4AS5A 2XWKA 3IJOB 4LQ5A 3TODA 3O97A 5F1QA 5I56A 2ONRA 2ONKE 2VGQA 1NV1A 4OESA 1MY0A 1P1NA 3DP8A 3FXQA 5H8FA 1LGBC 5I58B 1MDQA 1MG1A 3B6QA 2XXUA 3I6VA 3K1PA 4PF6A 4I9DA 1H44A 4JSOA 4OFOA 4EUOA 1MPDA 2FVZA 4JVCA 4X8RA 3UORA 4THIA 3MQ9A 3OELA 4GX3A 1LFGA 2O51A 1MXXA 1B1HA 4RY1A 4UABA 3LV0A 1R6ZA 1IUDA 3O28A 1IMFA 4MMPA 1B4HA 4O7IA 4F3GA 1SW1A 1Q1KA 1RYOA 4NF8A 2NXOA 2V3QA 2Q8MA 2QRYA 4QFOA 2QSXA 4Q5TA 3TYHA 2HEUA 3S9MC 1N3XA 4FJPA 3G3IA 4NF5A 1D9VA 4NMYA 1LB9A 1H43A 5FHOA 3RPWA 5I56B 3TEPA 1JETA 1NMUA 4GL8A 2Z8EA 5I3SA 4PBHA 1ZMGA 5ET6A 3H7MA 3TCGA 1JW5A 3KC1A 3KJTA 1URGA 3D4GA 2ZNSA 4IO3A 4QFLA 3O6HA 1AWBA 4IB2A 1YYZA 5DEXA 4I62A 3AXFA 4OYVA 2Y84A 1AMFA 1B2HA 4GQOA 2OLBA 4R75A 4YB7A 2REJA 5EQ8A 2YLNA 1JEVA 5LDZA 1IXCA 2ZYNA 4FEBA 3U8QA 2B3FA 4EDPA 4U21A 1B4ZA 5TP9A 2HAUA 2XXTA 1B1XA 3ZKLA 4H1XA 4KI0E 1P99A 2OBGA 3PUXE 1IMCA 4NF8B 4NX1A 3Q26A 5J1DA 3MPKA 3C33A 2V4CA 4R73A 3MZ9A 3RQTA 4NF5B 1FPBA 4PAFA 4QFPA 3PPNA 4DCYA 2DQVA 3OOAA 4NQ8A 2ABHA 4O3CA 4LZ8A 2H5YA 4LA9A 4JWOA 3B50A 4DI4B 1MS7A 3LR1A 2OWTA 2UVIA 2QS4A 2THIA 4OETA 5DEXB 1LBZA 1B05A 5CBRA 1WVJA 1Y1MA 3ODBA 2AYSA 4FAJA 3DLNA 3L6HA 3OMBA 1MXZA 3PPOA 4ZE9A 3SDFA 4UA8A 4GWZA 2XD2A 2XXHA 3C32A 4ZZEA 5K2XA 2Q2CA 4MLVA 3V83A 4OXVA 5DVIA 2XHDA 3G3HA 5TP9B 1VR5A 4R9GA 1M5CA 1NKXA 2XXYA 4MAGA 4F1VA 2CZLA 3UK4A 3MVZA 4PFWA 4EF1A 3DP6A 1SI1A 3PUZE 4F31B 1ZLQA 1LB8A 2H25A 3TTNA 1N3WA 1MPCA 1RDZA 2WEFA 1AL3A 5IAIA 3VV5A 1ZIUA 1B32A 1FQBA 3FV2A 3IO4A 3T96B 1LBVA 2XX8A 2UVHA 2HQ0A 5IZZA 3FXRA 1MQHA 3PD8A 4RXLA 3C31A 4U22A 4UACA 3K1NA 3H6TA 3C34A 3O29A 2BJJX 1NNTA 3LSFB 2XXWA 1SYIA 1S9TA 1B7UA 1N0TA 4GIZA 1LAXA 5JEIA 2Q8JA 2V84A 3MUQA 2Q88A 1HSEA 3S9NC 1JEUA 4BDQA 3ZS6A 3FJMA 4R6KA 4YB5A 4NAPA 2VHAA 1IZ1A 1R1NA 3E4RA 1BTJA 1SBPA 2GHAA 1KA1A 2QS1A 3FJ7A 3TTLA 2D21A 1OVTA 3TQWA 4KXPA 1MM7A 5FHNA 2WYKA 3IFCA 4WEPA 3K01A 3H6WA 1YTVA 2R6GE 4H45A 3MW0A 1Z7ME 5EQ9A 2PT2A 3QK6A 2QVVA 2Y7IA 3PTYA 1MPBA 1NUXA 1L5TA 4N6DA 1FJ6A 1B3HA 3OD7A 5AA2B 3K02A 2F8DA 1B9JA 3TCHA 1A40A 3CSGA 3FBPA 4HCYA 4OVTA 5EHMA 3R26A 5L9SA 3U72A 1N76A 2O6AA 1FTLA 2DDKA 4QSEA 1JVXA 1SYHA 1TT1A 1NUYA 5A5XA 4R9FA 2ONSA 1Y3NA 1NV7A 3Q27A 5CRYA 2B4MA 4G68A 3CR9A 5JK4A 1DPEA 3BKIB 2I0CA 3QIMA 1B46A 1NNPA 5K2YA 2Z22A 1LBCA 2P1SA 1LCTA 3MVYA 3VLWA 3LSWA 3O6IA 1SVXB 5IM2A 3T9VA 4KYDA 4R74A 5I2NA 3S2VA 2RINA 3M3FA 1IITA 2Z8FA 2QVRA 3GXAA 4H5FA 4NF0A 2XXIA 1DSNA 3K6VA 1GV8A 4NHBA 4DZ1A 1PBQA 1FTKA 1DTGA 2G93A 2IA4A 5ET7A 1LFHA 3ISPA 5J16A 2V3UA 1LBXA 4IO7A 3LSXA 3U93A 4GX6A 2QVUA 3UN6A 3P7IA 3S9LC 4G68C 3HV1A 2XXQA 3BFTA 3MPLA 3HPIA 3C9HA 4AQ4A 4AB5A 3RPLA 3UIFA 1H45A 4MFIA 4YKIA 2HCAA 1B3EA 4RA1A 3KSXA 1NV2A 3O9PA 5A5XB 1Y20A 2QPQA 3VXCA 2I4CA 2O68A 1IIWA 4G68B 3A3UA 1P1QA 4QFKA 1OLCA 1XT8A 2UYFA 4PDHA 3TTRA 3M8UA 1ZBMA 3PMVA 4YU0A 2DVZA 1UIUA 1IMEA 3IOVA 2ZXTA 1K9ZA 4IO4A 2XX9A 1DMBA 2Z23A 3T1BA 1B3GA 3PPPA 5I2NB 4RK9A 2FIEA 1M5EA 2PFYA 3K6WA 3MYUA 4MNPA 1YPNA 1Y3QA 4OVSA 5IZ3A 4DDDA 2A5SA 4N07A 3LBSA 1A55A 4ISUA 5HPQA 4C1TA 4GFRA 1UTHA 2Q74A 3M3KA 1FTMA 2H99A 4KCDA 4EXLA 4KYEA 1ELJA 3ROJA 1MH3A 3IOTA 3RPLB 3N94A 3QAXA 2O7UA 3IR1A 3HSTA 1YXIA 4DI3D 4TQUQ 3KG2A 4PBQA 2P2AA 1PB8A 1FTJA 4M4GA 1SPIA 4P3LA 2P0SA 3FJGA 5JTYA 3EQ1A 1KWHA 2FYIA 3USDA 1SW2A 3TQLA 1PC3A 3FZVA 3T9UA 4RNSA 4F29A 5ET5A 3FV1A 1I6QA 2X7QA 3TDJA 4U4XA 2GH9A 4I3YA 2DWHA 3GBAA 2RCAA 4IGRA 3GZGA 5IZ3B 1P1UA 2Y7PA 3GBBA 4F1YA 5AA3A 3KOTA 4G2ZA 2FBPA 5I5PA 4PE3A 4N13A 1UTHB 2H98A 4GWXA 1FQDA 3SERA 3MP8A 3IL1B 1US5A 1LBYA 3H3GA 2ZYKA 3V5AA 1A54A 4Z0IA 3G7WA 3KFMA 3C36A 4NTLA 1WDNA 2NOOA 1MQDA 3M3LA 3UGWA 4HTGA 3RY3A 4P0IA 1FPJA 3OEKA 4O94A 4F19A 5KDTA 3IJXB 3MSTA 2R9JA 1QUJA 4PFUA 1N7XA 2PX1A 1B0HA 5JTYB 2DYXA 1LAHE 4EQ7A 2F7BA 4PQJA 2GHBA 4HE0A 4R6HA 1QVSA 1LCFA 4YAHX 3JYRA 3MP1A 4E0WA 4N8YA 2WBDA 1SQYA 1MRPA 2WX9A 2O1LA 3SKPA 4GWOA 2F6PA 4WXJA 1USYE 5I57A 4ESXA 1HSLA 3FVNA 3TUSA 2VT5A 2Y7KA 1SDXA 3CG1A 3CVGA 3MJNA 5AA4A 1IXHA 1FCKA 4G77A 1IXIA 5HM4B 4JVIA 3D1RA 5CI5A 1FBFA 1URDA 1Z7NE 2VOZA 5B7DA 2I0BA 3HN0A 3CFLA 1LBBA 4MBPA 2DE3A 5CMBA 1FJ9A 2DXRA 4U23A 2E1SA 2PT1A 3LUYA 4GXSB 1IMDA 2G29A 5KDTB 1MY4A 4ECFA 4XTCQ 4NWDA 5F7VA 3N5LA 4YKKA 3PUYE 5AA2D 1B0LA 3OO7A 1NUZA 2F97A 3VVEA 3Q25A 4MLQA 4ZS9A 3PMXA 3R7XA 1QKAA 4PCDA 1R9LA 5I57B 1PB9A 1QULA 2XWIA 3IB1A 4N17A 4U1OA 4O7MA 4MNCA 3E13X 1N7WA 4H67A 4K3FA 3VDFA 4NWCA 2P3VA 4LVQA 5AA4B 1NUWA 1DK4A 2F5XA 4PF8A 3RT8A 2I49A 2Y7WA 4H65A 4MCOA 5CC2A 5I84A 1YCJA 4PGNA 4GOTA 1QW0A 5ISUA 3CRBA 3FUZA 4BDNA 4L17A 4ZZAA 3IO6A 3EHTA 2HAVA 3PUVE 4M1VA 1NH8A 5H8HA 3QMFA 4TLMB 3B6WA 3U1OA 1QKBA 4JB7A 1FPLA 1S7YA 1QUIA 3ILUB 3OO9A 3QYTA 4GF8A 1FTOA 3K6XA 4OA4A 1EH3A 1R9QA 3KSJA 4GX4A 3QUFA 4BLAA 1EZOA 1RKMA 2HZKA 3Q29A 1NV6A 3KBZA 4OEVA 4P0GA 3IB2A 2F36A 3OENA 4BDOA 2KR0A 4PDDA 1MM6A 5AA1A 2F78A 3ZSFA 1G0IA 3IFAA 4R2FA 5A5LA 1RDYA 3MVXA 4OZ9A 4JVDA 1B5HA 3KJ7A 3SEVA 2OWZA 4N4UA 5ITPA 3E79A 3BIGA 1A99A 5ICTA 4FIMA 3FIRA 1B51A 2I48A 3PPRA 5AA2A 4C0RA 1VDWA 1FSAA 3ECRA 2F7CA 5ET8A 2O7IA 1LBWA 2ZNUA 5ELVA 3S4UA 4PFBA 5TPAA 4P56A 3EHUA 4NF4A 5H8HB 3A3CA 1FBEA 2RF1A 2UXAA 3QUJA 4TOZA 3WAFA 2ZYMA 4FECA 2DS9A 4OVJA 1FBPA 1B58A 4PC9A 1M5DA 4H6DA 3F11A 2QL3A 2H4IA 2HXRA 1UQWA 2OWSA 2F6GA 5DTBA 4MX6A 3VVFA 3G3FA 3KOSA 2Y5LA 1JVYA 2PBWA 3W9VA 5KZTA 1ZU0A 4P8BA 2GRVA 3E9XA 5L8DA 2HPGA 2RCBA 4ELPA 3FASA 4X48A 3G3KA 1NNFA 2ANJA 2D3IA 4GWUA 2CMOA 1A7LA 2I3WA 3KN7A 4F3PA 1VFDA 4JBZA 5CMCA 2O1MA 2AL4A 3RT6B 2HHMA 4JWXA 1RYXA 1ZTYA 3FGSA 2GQ1A 3MZ1A 4BDMA 2YPNA 1UTBA 1XI6A 4LONB 2B3BA 4I8CA 1II5A 2XXRA 3TPAA 1MH4A 3VE1B 2Z8DA 5DYHA 3T66A 4ZDMA 5TPAB 1NI9A 4DXUA 4NF4B 2KLFA 1ANFA 1PBPA 1GR2A 4F3SA 4F2QA 1F9BA 1GGGA 2QS3A 2E0SA 1IEJA 2I58A 3WAEA 5EHSA 4NN3A 3T22A 2ZMBA 3TTMA 3B7DA 2Q2AA 1XHYA 3RUMA 1OMPA 1LAGE 4MF3A 2RC9A 4OERA 1HSJA 1P1OA 3HHFA 1WODA 4LATA 5DT6A 3QXMA 4XKNA 4R2BA 2WKYA 2F7AA 2CZHA 2FHYA 4POWA 4GL0A 3OSRA 3IOWA 3GLBA 2FA7A 4YB6A 4P11A 3SETA 1EYIA 1G0HA 3KN3A 4OVQA 4JDFA 2XXXA 3U92A 1UTBB 2DP8A 3TKDA 4FEDA 3A09A 5I2KA 4IO5A 1MDP1 4GD5A 2Q9TA 1I6AA 2V25A 1OIBA 3O66A 4IY5A 3HHGA 4ELOA 1XVYA 4N91A 4PETA 1S50A 3SESA 1D9YA 3C4MA 3ONMA 2DWIA 4I40A 4X9TA 1PDAA 3RTWB 4GWSA 4F39A 4XIGQ 4QF9A 1FPKA 3TMGA 3RLFE 5LOMA 1FPFA 1US4A 4N81A 4X04A 4Q0CA 2XX7A 5ICQA 4XKPA 3K4UA 3H06B 4ZEIA 5DVFA 2PCRA 4Q30B 1GTKA 3PUWE 1FBDA 4MJOA 3RNNA 4LZ7A 3DELB 4P1EA 2CEXA 1FBCA 3CG3A 2AIXA 4ZEDA 1T0KA 2DXYA 3CI8A 2DWAA 4PFIA 5EQ7A 3HCQA 3MVWA 4PAKA 2HXWA 4PAIA 2JJKA 2H9BA 1SW5A 4MNIA 4G8NA 5I2KB 3E78A 3TZAA 5ITOA 3SEUA 1TXFA 4O8MA 5IZ1A 1QGXA 1QJMA 1B3FA 1IQ7A 4FATA 2IEEA 4H8IA 1OVBA 1I6BA 4OENA 4U4SA 4IR8A 4OANA 5H8SA 4XKQA 2A5TA 1DPPA 3A29A 3TELA 2L5VA 3OSQA 4MH5A 4KD5A 5FBPA 2UVGA 1KZ8A 3U94A 1URSA 4HE1A 5DW8A 1NV0A 2WBBA 2B4LA 1DOTA 1BK4A 2HZLA 4C1UA 4IGTA 3G3JA 1Q9DA 4OFJA 2UVJA 3W15C 3THIA 1CB6A 3K1MA 1EYJA 2I6EA 5CBSA 4GWYA 1USYH 4O3BA 3G3GA 4ONYA 3VLUA 2X26A 3VFJA 4KFQA 1JP4A 2R71A 1XVXA 4ZEKA 3CIJA 3MAMA 4ZEBA 4DCXA 4G8HA 5EYGA 2NUVA 3IK6B 4GXAA 2R8TA 4R72A 3SZPA 2VP1A 4XFEA 1ZKBA 1XC1A 2RKMA 3DM0A 3GYYA 3MZBA 4KQPA 4LZ5A 4MHFA 4X1BA 1EU8A 5ESYA 3RYDA 1VE4A 4MEVA 4DXBA 2Y7RA 3IX1A 1O63A 1D9QA 4LUBA 3I5OA 2FIXA 3KN8A 4OTEA 4F2OA 1VSOA 2OJTA 4NGUA 4AB6A 5EYFA 2A5TB 1GVCA 2KQZA 4YKPA 2XXVA 2CEYA 1NV5A 4NF6A 1Y4CA 2BJIA 1A8EA 3K00A 4PTKA 2CZKA 2V93A 3EN3A 1IMBA 4OVRA 3UA8A 5B70A 4O3AA 3CHGA 3PD9A 1DCUA 4KPTA 1B3LA 4YMBA 2ZZVA 3CFXA 3TFLA 5BWJA 4I1DA 3LUZA 4P47A 1ATGA 1FQFA 1LEVA 1IXGA 1LAFE 1SI0A 1XS5A 4MIJA 3VXBA 2RC7A 1Y3PA 5H8FB 4BDLA 1B5JA 4ZECA 1FPDA 4WKMA 3FXBA 4JWYA 5L9OA 4FORA 1K9YA 4IO6A 4U1ZA 1NV3A 2CZIA 1POTA 5CMMA 5HBCA 3V89B 3KZGA 3FD3A 4N8GA 5IGAA 4G61A 2XXPA 4G8MA 3PV0E 1INPA 3FVKA 1CE2A 5KCJA 2X7PA 2LAOA 4U2RA 4WEDA 4RYAA 4NF6B 1XOCA 5TU0A 2OZZA 2DOJA 3JV9A 4YKJA 1AIVA 2VD3A 1MXVA 3KGCA 2DE2A 4HS7A 3IORA 1D3KA 4OMBA 3MP6A 5H8NA 5FTIA 2XWOA 5DVJA 3B6TA 1LLSA 4I3EA 3TAJA 1FPEA 5F24A 2B65A 2VD2A 1EZPA 5M2VA 5L9MA 4AS4A 2FNCA 3VVDA 3FATA 2NWJA 2QS2A 1FPGA 1QUKA 4PFTA 4RPNA 3RGYA 3BFUA 4QSCA
chains in the Genus database with same CATH topology
4RJZA 2QJEA 5H8QA 4RPOA 2AL5A 3HO7A 1NFTA 4NE4A 1OQGA 1DTZA 3L6GA 1MQGA 3RTFB 1PB7A 5FTHA 1YAEA 5KCJB 1M5BA 3N6UA 3LC8A 1B7ZA 3H03A 4OQOA 1SW4A 1Y1ZA 2ALUA 3EPEA 3QSLA 4PP0A 3D4CA 5AE4A 2V3TA 1M5FA 4YZZA 3SEXA 1TFDA 3H4ZA 4H0WA 5CM6A 2I4BA 2XD3A 3RN8A 2QMWA 5IKBA 1MY3A 4EF2A 3ZKKA 5H8NB 3BBRA 1VFEA 1NH7A 1I69A 3OXNA 3O2AA 2W7YA 1O7TA 4QFNA 1SD3A 4X1DA 3V8XB 4IO2A 4R6YA 3FXUA 1MQJA 3OO6A 4H5GA 5H8QB 1P1WA 1H76A 4ND9A 2DWJA 4ESWA 3LSLA 2D5WA 1B40A 4LQ2A 4DE8A 2O69A 4QHQA 2Q89A 4EQ9A 4GLIA 1O64A 1D4NA 1EZ9A 1LFIA 1FW0A 1JQFA 3H6VA 4H8JA 2DE4A 4ZE8A 4EXKA 1JW4A 3E3KA 3K2DA 3OO8A 1TFAA 4DIGA 3PMWA 4NEDA 3IOUA 4GRKA 1MY1A 4F1UA 2ESNA 4OWDA 2YJPA 3KBRA 2PYYA 3CSBA 3O6GA 3PPQA 3UP9A 4ELRA 4Z7EA 1AOVA 1AH5A 1BLFA 3JZJA 3PU5A 3FVOA 3MWBA 3KEIA 3EF7A 3T93B 3FVGA 1JW1A 4XXUA 1B6HA 4FE8A 3SEYA 1UIVA 5I59A 1ZJLA 1A8FA 2O84X 3N6TA 2QMXA 2PMSA 3T9XB 2REGA 1BP5A 4KYSA 1FQCA 4HW8A 5FHMA 1B52A 3I3VA 1POY1 3EHSA 3TTKA 1Y9UA 4POXA 3SEWA 5BUUA 4ELQA 2GFEA 1NL5A 4OFLA 4XKRA 4N6PA 4OEUA 4RK2A 1N04A 1OLAA 4KCCA 4KR5A 4EQBA 3MC2A 3TCFA 2DSFA 3S9EA 1MXUA 2OK2A 4TLLB 1MXWA 4KHZE 2ZNTA 3N26A 4HCWA 3OEMA 2F35A 4DXCA 1MQIA 4YMAA 1FQEA 2OCUA 2I3VA 3DP4A 4GVOA 4OHNA 2PVUA 1NNKA 4JSDA 4F3BA 1Q35A 5I59B 3PGFA 1MXYA 4E0XA 1B5IA 1OQHA 3R6UA 1JNFA 2RC8A 3ILTB 3K0VA 1BKAA 4PE5B 4JXIA 1H3DA 2M8CA 5I58A 4G4PA 1Y4TA 3T9HB 3C35A 4DLDA 2UYEA 4IY6A 2HFBA 1BIYA 4PFYA 1B7HA 3IB0A 3IAZA 4BDRA 2F34A 4Q8RA 1MY2A 4F22A 4QRZA 1TWYA 1N84A 2ZYOA 3H6UA 3MBPA 2DVCA 2NVUB 1LSTA 3Q28A 3CFZA 1J1NA 4QSDA 3VLVA 4LP2B 4ZEFA 3K6UA 1FQAA 4YICA 4F18A 5CMKA 1PEBA 3W9WA 3IJOB 4LQ5A 3TODA 3O97A 5F1QA 5I56A 2ONRA 2ONKE 2VGQA 4OESA 1MY0A 1P1NA 3DP8A 3FXQA 5H8FA 1LGBC 5I58B 1MDQA 1MG1A 3B6QA 2XXUA 3I6VA 3K1PA 4I9DA 1H44A 4JSOA 4OFOA 4EUOA 1MPDA 3UORA 4THIA 3MQ9A 3OELA 1LFGA 2O51A 1MXXA 1B1HA 4RY1A 1R6ZA 1IUDA 3O28A 1B4HA 4F3GA 1SW1A 1Q1KA 1RYOA 4NF8A 2NXOA 2V3QA 2QRYA 4QFOA 2QSXA 4Q5TA 3TYHA 2HEUA 3S9MC 1N3XA 4FJPA 3G3IA 4NF5A 1D9VA 4NMYA 1LB9A 1H43A 5FHOA 3RPWA 5I56B 3TEPA 1JETA 1NMUA 4GL8A 2Z8EA 1ZMGA 3H7MA 3TCGA 1JW5A 3KJTA 1URGA 3D4GA 2ZNSA 4IO3A 4QFLA 3O6HA 4IB2A 5DEXA 4I62A 3AXFA 4OYVA 2Y84A 1AMFA 1B2HA 4GQOA 2OLBA 4R75A 4YB7A 2REJA 2YLNA 1JEVA 1IXCA 2ZYNA 4FEBA 3U8QA 2B3FA 4EDPA 4U21A 1B4ZA 5TP9A 2HAUA 2XXTA 1B1XA 3ZKLA 4H1XA 4KI0E 1P99A 2OBGA 3PUXE 4NF8B 3Q26A 5J1DA 3MPKA 3C33A 4R73A 3MZ9A 3RQTA 4NF5B 4QFPA 3PPNA 4DCYA 2DQVA 3OOAA 2ABHA 4O3CA 4LZ8A 2H5YA 4LA9A 4JWOA 1MS7A 3LR1A 2OWTA 2UVIA 2QS4A 2THIA 4OETA 5DEXB 1B05A 5CBRA 1WVJA 1Y1MA 3ODBA 2AYSA 4FAJA 3DLNA 3L6HA 3OMBA 1MXZA 3PPOA 4ZE9A 3SDFA 4UA8A 2XD2A 2XXHA 3C32A 4ZZEA 5K2XA 2Q2CA 4MLVA 3V83A 4OXVA 5DVIA 2XHDA 3G3HA 5TP9B 1VR5A 4R9GA 1M5CA 1NKXA 2XXYA 4F1VA 2CZLA 3UK4A 3MVZA 4PFWA 4EF1A 3DP6A 1SI1A 3PUZE 4F31B 1ZLQA 1LB8A 2H25A 3TTNA 1N3WA 1MPCA 1AL3A 5IAIA 3VV5A 1ZIUA 1B32A 1FQBA 3FV2A 3IO4A 3T96B 2XX8A 2UVHA 2HQ0A 3FXRA 1MQHA 3PD8A 4RXLA 3C31A 4U22A 4UACA 3K1NA 3H6TA 3C34A 3O29A 2BJJX 1NNTA 3LSFB 2XXWA 1SYIA 1S9TA 1B7UA 1N0TA 4GIZA 1LAXA 5JEIA 2Q8JA 2V84A 3MUQA 2Q88A 1HSEA 3S9NC 1JEUA 4BDQA 3ZS6A 3FJMA 4R6KA 4YB5A 2VHAA 1IZ1A 1R1NA 3E4RA 1BTJA 1SBPA 2GHAA 2QS1A 3FJ7A 3TTLA 2D21A 1OVTA 3TQWA 1MM7A 5FHNA 4WEPA 3K01A 3H6WA 1YTVA 2R6GE 3MW0A 1Z7ME 2PT2A 3QK6A 2Y7IA 1MPBA 1L5TA 1B3HA 3OD7A 5AA2B 3K02A 2F8DA 1B9JA 3TCHA 1A40A 3CSGA 4HCYA 5EHMA 3R26A 5L9SA 3U72A 1N76A 2O6AA 1FTLA 4QSEA 1JVXA 1SYHA 1TT1A 5A5XA 4R9FA 2ONSA 1Y3NA 3Q27A 5CRYA 4G68A 3CR9A 5JK4A 1DPEA 3BKIB 2I0CA 3QIMA 1B46A 1NNPA 5K2YA 2Z22A 1LBCA 2P1SA 1LCTA 3MVYA 3VLWA 3LSWA 3O6IA 1SVXB 3T9VA 4KYDA 4R74A 5I2NA 3S2VA 2RINA 3M3FA 1IITA 2Z8FA 3GXAA 4H5FA 2XXIA 1DSNA 3K6VA 1GV8A 4DZ1A 1PBQA 1FTKA 1DTGA 2G93A 2IA4A 1LFHA 2V3UA 4IO7A 3LSXA 3U93A 3UN6A 3P7IA 3S9LC 4G68C 3HV1A 2XXQA 3BFTA 3MPLA 3HPIA 3C9HA 4AQ4A 4AB5A 3UIFA 1H45A 4MFIA 4YKIA 2HCAA 1B3EA 4RA1A 3KSXA 3O9PA 5A5XB 1Y20A 2QPQA 3VXCA 2I4CA 2O68A 1IIWA 4G68B 3A3UA 1P1QA 4QFKA 1OLCA 1XT8A 2UYFA 3TTRA 3M8UA 1ZBMA 3PMVA 4YU0A 2DVZA 1UIUA 3IOVA 2ZXTA 4IO4A 2XX9A 1DMBA 2Z23A 1B3GA 3PPPA 5I2NB 4RK9A 1M5EA 3K6WA 1YPNA 1Y3QA 4DDDA 2A5SA 4N07A 3LBSA 1A55A 4ISUA 5HPQA 4C1TA 4GFRA 1UTHA 3M3KA 1FTMA 2H99A 4KCDA 4EXLA 4KYEA 1ELJA 1MH3A 3IOTA 3N94A 3QAXA 2O7UA 3IR1A 3HSTA 4TQUQ 3KG2A 2P2AA 1PB8A 1FTJA 4M4GA 2P0SA 3FJGA 5JTYA 3EQ1A 1KWHA 2FYIA 3USDA 1SW2A 3TQLA 1PC3A 3FZVA 3T9UA 4RNSA 4F29A 3FV1A 1I6QA 2X7QA 3TDJA 4U4XA 2GH9A 2DWHA 3GBAA 2RCAA 4IGRA 3GZGA 1P1UA 2Y7PA 3GBBA 4F1YA 5AA3A 3KOTA 4G2ZA 4N13A 1UTHB 2H98A 3SERA 1FQDA 3MP8A 3IL1B 1US5A 3H3GA 2ZYKA 3V5AA 1A54A 4Z0IA 3G7WA 3KFMA 3C36A 4NTLA 1WDNA 2NOOA 1MQDA 3M3LA 3UGWA 4HTGA 3RY3A 4P0IA 3OEKA 4F19A 5KDTA 3IJXB 2R9JA 1QUJA 4PFUA 1N7XA 2PX1A 1B0HA 5JTYB 2DYXA 1LAHE 4EQ7A 2F7BA 4PQJA 2GHBA 4R6HA 1QVSA 1LCFA 4YAHX 3JYRA 3MP1A 4E0WA 1SQYA 1MRPA 2O1LA 3SKPA 4GWOA 2F6PA 4WXJA 1USYE 5I57A 4ESXA 1HSLA 3FVNA 3TUSA 2Y7KA 1SDXA 3CG1A 3CVGA 3MJNA 5AA4A 1IXHA 1FCKA 4G77A 1IXIA 5HM4B 5CI5A 1URDA 1Z7NE 2VOZA 5B7DA 2I0BA 3HN0A 3CFLA 1LBBA 4MBPA 2DE3A 5CMBA 2DXRA 4U23A 2E1SA 2PT1A 3LUYA 4GXSB 2G29A 5KDTB 1MY4A 4ECFA 4XTCQ 4NWDA 5F7VA 3N5LA 4YKKA 3PUYE 5AA2D 1B0LA 3OO7A 2F97A 3VVEA 3Q25A 4MLQA 4ZS9A 3PMXA 3R7XA 1QKAA 1R9LA 5I57B 1PB9A 1QULA 3IB1A 4U1OA 3E13X 1N7WA 4H67A 4K3FA 3VDFA 4NWCA 4LVQA 5AA4B 2F5XA 3RT8A 2I49A 2Y7WA 4H65A 5CC2A 5I84A 1YCJA 4GOTA 1QW0A 5ISUA 3CRBA 3FUZA 4BDNA 4L17A 4ZZAA 3IO6A 3EHTA 2HAVA 3PUVE 4M1VA 1NH8A 5H8HA 4TLMB 3B6WA 3U1OA 1QKBA 4JB7A 1S7YA 1QUIA 3ILUB 3OO9A 3QYTA 4GF8A 1FTOA 3K6XA 1EH3A 1R9QA 3KSJA 3QUFA 4BLAA 1EZOA 1RKMA 2HZKA 3Q29A 4OEVA 4P0GA 3IB2A 2F36A 3OENA 4BDOA 1MM6A 5AA1A 2F78A 3ZSFA 4R2FA 3MVXA 4OZ9A 1B5HA 3KJ7A 3SEVA 5ITPA 1A99A 5ICTA 4FIMA 3FIRA 1B51A 2I48A 3PPRA 5AA2A 4C0RA 3ECRA 2F7CA 2O7IA 2ZNUA 5ELVA 3S4UA 5TPAA 3EHUA 4NF4A 5H8HB 3A3CA 2RF1A 2UXAA 3QUJA 4TOZA 3WAFA 2ZYMA 4FECA 2DS9A 4OVJA 1B58A 1M5DA 4H6DA 3F11A 2QL3A 2H4IA 1UQWA 2OWSA 2F6GA 5DTBA 3VVFA 3G3FA 3KOSA 1JVYA 2PBWA 3W9VA 5KZTA 1ZU0A 2GRVA 3E9XA 5L8DA 2RCBA 4ELPA 3FASA 4X48A 3G3KA 1NNFA 2ANJA 2D3IA 2CMOA 1A7LA 2I3WA 3KN7A 4F3PA 1VFDA 4JBZA 5CMCA 2O1MA 2AL4A 3RT6B 4JWXA 1RYXA 1ZTYA 3FGSA 3MZ1A 4BDMA 2YPNA 1UTBA 4LONB 2B3BA 4I8CA 1II5A 2XXRA 3TPAA 1MH4A 3VE1B 2Z8DA 5DYHA 3T66A 4ZDMA 5TPAB 4DXUA 4NF4B 2KLFA 1ANFA 1PBPA 1GR2A 4F3SA 4F2QA 1F9BA 1GGGA 2QS3A 2E0SA 1IEJA 2I58A 3WAEA 5EHSA 3T22A 2ZMBA 3TTMA 3B7DA 2Q2AA 1XHYA 3RUMA 1OMPA 1LAGE 4MF3A 2RC9A 4OERA 1HSJA 1P1OA 3HHFA 1WODA 4LATA 5DT6A 3QXMA 4XKNA 4R2BA 2WKYA 2F7AA 4POWA 4GL0A 3OSRA 3IOWA 3GLBA 2FA7A 4YB6A 4P11A 3SETA 3KN3A 4JDFA 2XXXA 3U92A 1UTBB 2DP8A 3TKDA 4FEDA 3A09A 5I2KA 4IO5A 1MDP1 4GD5A 2Q9TA 1I6AA 2V25A 1OIBA 3O66A 4IY5A 3HHGA 4ELOA 1XVYA 4PETA 1S50A 3SESA 1D9YA 3C4MA 3ONMA 2DWIA 4X9TA 1PDAA 3RTWB 4F39A 4XIGQ 4QF9A 3TMGA 3RLFE 5LOMA 1US4A 4Q0CA 2XX7A 5ICQA 4XKPA 3K4UA 3H06B 4ZEIA 5DVFA 4Q30B 1GTKA 3PUWE 3RNNA 4LZ7A 3DELB 3CG3A 2AIXA 4ZEDA 1T0KA 2DXYA 3CI8A 2DWAA 3HCQA 3MVWA 2HXWA 2H9BA 1SW5A 4G8NA 5I2KB 3TZAA 5ITOA 3SEUA 1TXFA 1QJMA 1B3FA 1IQ7A 4FATA 2IEEA 4H8IA 1OVBA 1I6BA 4OENA 4U4SA 5H8SA 4XKQA 2A5TA 1DPPA 3TELA 3OSQA 4MH5A 4KD5A 2UVGA 3U94A 1URSA 1DOTA 2HZLA 4C1UA 4IGTA 3G3JA 4OFJA 2UVJA 3W15C 3THIA 1CB6A 3K1MA 2I6EA 5CBSA 1USYH 4O3BA 3G3GA 4ONYA 3VLUA 2X26A 3VFJA 4KFQA 2R71A 1XVXA 4ZEKA 3CIJA 3MAMA 4ZEBA 4DCXA 4G8HA 2NUVA 3IK6B 4GXAA 4R72A 2VP1A 1ZKBA 1XC1A 2RKMA 3DM0A 3MZBA 4KQPA 4LZ5A 4X1BA 1EU8A 1VE4A 4DXBA 2Y7RA 3IX1A 1O63A 4LUBA 3I5OA 3KN8A 4OTEA 4F2OA 1VSOA 2OJTA 4AB6A 5EYFA 2A5TB 1GVCA 4YKPA 2XXVA 4NF6A 1Y4CA 1A8EA 3K00A 2V93A 3EN3A 3UA8A 5B70A 4O3AA 3PD9A 4KPTA 1B3LA 4YMBA 3CFXA 3TFLA 5BWJA 4I1DA 1ATGA 1FQFA 1IXGA 1LAFE 1SI0A 1XS5A 3VXBA 2RC7A 1Y3PA 5H8FB 4BDLA 1B5JA 4ZECA 4WKMA 4JWYA 5L9OA 4FORA 4IO6A 4U1ZA 1POTA 5CMMA 5HBCA 3V89B 3KZGA 3FD3A 2XXPA 4G8MA 3PV0E 3FVKA 1CE2A 5KCJA 2X7PA 2LAOA 4U2RA 4WEDA 4RYAA 4NF6B 1XOCA 5TU0A 2OZZA 2DOJA 3JV9A 4YKJA 1AIVA 2VD3A 1MXVA 3KGCA 2DE2A 4HS7A 3IORA 1D3KA 4OMBA 3MP6A 5H8NA 5FTIA 5DVJA 3B6TA 1LLSA 3TAJA 2B65A 2VD2A 1EZPA 5M2VA 5L9MA 2FNCA 3VVDA 3FATA 2NWJA 2QS2A 1QUKA 4PFTA 4RPNA 3RGYA 3BFUA 4QSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJZ A;  2QJE A;  5H8Q A;  4RPO A;  2AL5 A;  3HO7 A;  1NFT A;  4NE4 A;  1OQG A;  1DTZ A;  3L6G A;  1MQG A;  3RTF B;  1PB7 A;  5FTH A;  1YAE A;  5KCJ B;  1M5B A;  3N6U A;  3LC8 A;  1B7Z A;  3H03 A;  4OQO A;  1SW4 A;  1Y1Z A;  2ALU A;  3EPE A;  3QSL A;  4PP0 A;  3D4C A;  5AE4 A;  2V3T A;  1M5F A;  4YZZ A;  3SEX A;  1TFD A;  3H4Z A;  4H0W A;  5CM6 A;  2I4B A;  2XD3 A;  3RN8 A;  2QMW A;  5IKB A;  1MY3 A;  4EF2 A;  3ZKK A;  5H8N B;  3BBR A;  1VFE A;  1NH7 A;  1I69 A;  3OXN A;  3O2A A;  2W7Y A;  1O7T A;  4QFN A;  1SD3 A;  4X1D A;  3V8X B;  4IO2 A;  4R6Y A;  3FXU A;  1MQJ A;  3OO6 A;  4H5G A;  5H8Q B;  1P1W A;  1H76 A;  4ND9 A;  2DWJ A;  4ESW A;  3LSL A;  2D5W A;  1B40 A;  4LQ2 A;  4DE8 A;  2O69 A;  4QHQ A;  2Q89 A;  4EQ9 A;  4GLI A;  1O64 A;  1D4N A;  1EZ9 A;  1LFI A;  1FW0 A;  1JQF A;  3H6V A;  4H8J A;  2DE4 A;  4ZE8 A;  4EXK A;  1JW4 A;  3E3K A;  3K2D A;  3OO8 A;  1TFA A;  4DIG A;  3PMW A;  4NED A;  3IOU A;  4GRK A;  1MY1 A;  4F1U A;  2ESN A;  4OWD A;  2YJP A;  3KBR A;  2PYY A;  3CSB A;  3O6G A;  3PPQ A;  3UP9 A;  4ELR A;  4Z7E A;  1AOV A;  1AH5 A;  1BLF A;  3JZJ A;  3PU5 A;  3FVO A;  3MWB A;  3KEI A;  3EF7 A;  3T93 B;  3FVG A;  1JW1 A;  4XXU A;  1B6H A;  4FE8 A;  3SEY A;  1UIV A;  5I59 A;  1ZJL A;  1A8F A;  2O84 X;  3N6T A;  2QMX A;  2PMS A;  3T9X B;  2REG A;  1BP5 A;  4KYS A;  1FQC A;  4HW8 A;  5FHM A;  1B52 A;  3I3V A;  1POY 1;  3EHS A;  3TTK A;  1Y9U A;  4POX A;  3SEW A;  5BUU A;  4ELQ A;  2GFE A;  1NL5 A;  4OFL A;  4XKR A;  4N6P A;  4OEU A;  4RK2 A;  1N04 A;  1OLA A;  4KCC A;  4KR5 A;  4EQB A;  3MC2 A;  3TCF A;  2DSF A;  3S9E A;  1MXU A;  2OK2 A;  4TLL B;  1MXW A;  4KHZ E;  2ZNT A;  3N26 A;  4HCW A;  3OEM A;  2F35 A;  4DXC A;  1MQI A;  4YMA A;  1FQE A;  2OCU A;  2I3V A;  3DP4 A;  4GVO A;  4OHN A;  2PVU A;  1NNK A;  4JSD A;  4F3B A;  1Q35 A;  5I59 B;  3PGF A;  1MXY A;  4E0X A;  1B5I A;  1OQH A;  3R6U A;  1JNF A;  2RC8 A;  3ILT B;  3K0V A;  1BKA A;  4PE5 B;  4JXI A;  1H3D A;  2M8C A;  5I58 A;  4G4P A;  1Y4T A;  3T9H B;  3C35 A;  4DLD A;  2UYE A;  4IY6 A;  2HFB A;  1BIY A;  4PFY A;  1B7H A;  3IB0 A;  3IAZ A;  4BDR A;  2F34 A;  4Q8R A;  1MY2 A;  4F22 A;  4QRZ A;  1TWY A;  1N84 A;  2ZYO A;  3H6U A;  3MBP A;  2DVC A;  2NVU B;  1LST A;  3Q28 A;  3CFZ A;  1J1N A;  4QSD A;  3VLV A;  4LP2 B;  4ZEF A;  3K6U A;  1FQA A;  4YIC A;  4F18 A;  5CMK A;  1PEB A;  3W9W A;  3IJO B;  4LQ5 A;  3TOD A;  3O97 A;  5F1Q A;  5I56 A;  2ONR A;  2ONK E;  2VGQ A;  4OES A;  1MY0 A;  1P1N A;  3DP8 A;  3FXQ A;  5H8F A;  1LGB C;  5I58 B;  1MDQ A;  1MG1 A;  3B6Q A;  2XXU A;  3I6V A;  3K1P A;  4I9D A;  1H44 A;  4JSO A;  4OFO A;  4EUO A;  1MPD A;  3UOR A;  4THI A;  3MQ9 A;  3OEL A;  1LFG A;  2O51 A;  1MXX A;  1B1H A;  4RY1 A;  1R6Z A;  1IUD A;  3O28 A;  1B4H A;  4F3G A;  1SW1 A;  1Q1K A;  1RYO A;  4NF8 A;  2NXO A;  2V3Q A;  2QRY A;  4QFO A;  2QSX A;  4Q5T A;  3TYH A;  2HEU A;  3S9M C;  1N3X A;  4FJP A;  3G3I A;  4NF5 A;  1D9V A;  4NMY A;  1LB9 A;  1H43 A;  5FHO A;  3RPW A;  5I56 B;  3TEP A;  1JET A;  1NMU A;  4GL8 A;  2Z8E A;  1ZMG A;  3H7M A;  3TCG A;  1JW5 A;  3KJT A;  1URG A;  3D4G A;  2ZNS A;  4IO3 A;  4QFL A;  3O6H A;  4IB2 A;  5DEX A;  4I62 A;  3AXF A;  4OYV A;  2Y84 A;  1AMF A;  1B2H A;  4GQO A;  2OLB A;  4R75 A;  4YB7 A;  2REJ A;  2YLN A;  1JEV A;  1IXC A;  2ZYN A;  4FEB A;  3U8Q A;  2B3F A;  4EDP A;  4U21 A;  1B4Z A;  5TP9 A;  2HAU A;  2XXT A;  1B1X A;  3ZKL A;  4H1X A;  4KI0 E;  1P99 A;  2OBG A;  3PUX E;  4NF8 B;  3Q26 A;  5J1D A;  3MPK A;  3C33 A;  4R73 A;  3MZ9 A;  3RQT A;  4NF5 B;  4QFP A;  3PPN A;  4DCY A;  2DQV A;  3OOA A;  2ABH A;  4O3C A;  4LZ8 A;  2H5Y A;  4LA9 A;  4JWO A;  1MS7 A;  3LR1 A;  2OWT A;  2UVI A;  2QS4 A;  2THI A;  4OET A;  5DEX B;  1B05 A;  5CBR A;  1WVJ A;  1Y1M A;  3ODB A;  2AYS A;  4FAJ A;  3DLN A;  3L6H A;  3OMB A;  1MXZ A;  3PPO A;  4ZE9 A;  3SDF A;  4UA8 A;  2XD2 A;  2XXH A;  3C32 A;  4ZZE A;  5K2X A;  2Q2C A;  4MLV A;  3V83 A;  4OXV A;  5DVI A;  2XHD A;  3G3H A;  5TP9 B;  1VR5 A;  4R9G A;  1M5C A;  1NKX A;  2XXY A;  4F1V A;  2CZL A;  3UK4 A;  3MVZ A;  4PFW A;  4EF1 A;  3DP6 A;  1SI1 A;  3PUZ E;  4F31 B;  1ZLQ A;  1LB8 A;  2H25 A;  3TTN A;  1N3W A;  1MPC A;  1AL3 A;  5IAI A;  3VV5 A;  1ZIU A;  1B32 A;  1FQB A;  3FV2 A;  3IO4 A;  3T96 B;  2XX8 A;  2UVH A;  2HQ0 A;  3FXR A;  1MQH A;  3PD8 A;  4RXL A;  3C31 A;  4U22 A;  4UAC A;  3K1N A;  3H6T A;  3C34 A;  3O29 A;  2BJJ X;  1NNT A;  3LSF B;  2XXW A;  1SYI A;  1S9T A;  1B7U A;  1N0T A;  4GIZ A;  1LAX A;  5JEI A;  2Q8J A;  2V84 A;  3MUQ A;  2Q88 A;  1HSE A;  3S9N C;  1JEU A;  4BDQ A;  3ZS6 A;  3FJM A;  4R6K A;  4YB5 A;  2VHA A;  1IZ1 A;  1R1N A;  3E4R A;  1BTJ A;  1SBP A;  2GHA A;  2QS1 A;  3FJ7 A;  3TTL A;  2D21 A;  1OVT A;  3TQW A;  1MM7 A;  5FHN A;  4WEP A;  3K01 A;  3H6W A;  1YTV A;  2R6G E;  3MW0 A;  1Z7M E;  2PT2 A;  3QK6 A;  2Y7I A;  1MPB A;  1L5T A;  1B3H A;  3OD7 A;  5AA2 B;  3K02 A;  2F8D A;  1B9J A;  3TCH A;  1A40 A;  3CSG A;  4HCY A;  5EHM A;  3R26 A;  5L9S A;  3U72 A;  1N76 A;  2O6A A;  1FTL A;  4QSE A;  1JVX A;  1SYH A;  1TT1 A;  5A5X A;  4R9F A;  2ONS A;  1Y3N A;  3Q27 A;  5CRY A;  4G68 A;  3CR9 A;  5JK4 A;  1DPE A;  3BKI B;  2I0C A;  3QIM A;  1B46 A;  1NNP A;  5K2Y A;  2Z22 A;  1LBC A;  2P1S A;  1LCT A;  3MVY A;  3VLW A;  3LSW A;  3O6I A;  1SVX B;  3T9V A;  4KYD A;  4R74 A;  5I2N A;  3S2V A;  2RIN A;  3M3F A;  1IIT A;  2Z8F A;  3GXA A;  4H5F A;  2XXI A;  1DSN A;  3K6V A;  1GV8 A;  4DZ1 A;  1PBQ A;  1FTK A;  1DTG A;  2G93 A;  2IA4 A;  1LFH A;  2V3U A;  4IO7 A;  3LSX A;  3U93 A;  3UN6 A;  3P7I A;  3S9L C;  4G68 C;  3HV1 A;  2XXQ A;  3BFT A;  3MPL A;  3HPI A;  3C9H A;  4AQ4 A;  4AB5 A;  3UIF A;  1H45 A;  4MFI A;  4YKI A;  2HCA A;  1B3E A;  4RA1 A;  3KSX A;  3O9P A;  5A5X B;  1Y20 A;  2QPQ A;  3VXC A;  2I4C A;  2O68 A;  1IIW A;  4G68 B;  3A3U A;  1P1Q A;  4QFK A;  1OLC A;  1XT8 A;  2UYF A;  3TTR A;  3M8U A;  1ZBM A;  3PMV A;  4YU0 A;  2DVZ A;  1UIU A;  3IOV A;  2ZXT A;  4IO4 A;  2XX9 A;  1DMB A;  2Z23 A;  1B3G A;  3PPP A;  5I2N B;  4RK9 A;  1M5E A;  3K6W A;  1YPN A;  1Y3Q A;  4DDD A;  2A5S A;  4N07 A;  3LBS A;  1A55 A;  4ISU A;  5HPQ A;  4C1T A;  4GFR A;  1UTH A;  3M3K A;  1FTM A;  2H99 A;  4KCD A;  4EXL A;  4KYE A;  1ELJ A;  1MH3 A;  3IOT A;  3N94 A;  3QAX A;  2O7U A;  3IR1 A;  3HST A;  4TQU Q;  3KG2 A;  2P2A A;  1PB8 A;  1FTJ A;  4M4G A;  2P0S A;  3FJG A;  5JTY A;  3EQ1 A;  1KWH A;  2FYI A;  3USD A;  1SW2 A;  3TQL A;  1PC3 A;  3FZV A;  3T9U A;  4RNS A;  4F29 A;  3FV1 A;  1I6Q A;  2X7Q A;  3TDJ A;  4U4X A;  2GH9 A;  2DWH A;  3GBA A;  2RCA A;  4IGR A;  3GZG A;  1P1U A;  2Y7P A;  3GBB A;  4F1Y A;  5AA3 A;  3KOT A;  4G2Z A;  4N13 A;  1UTH B;  2H98 A;  3SER A;  1FQD A;  3MP8 A;  3IL1 B;  1US5 A;  3H3G A;  2ZYK A;  3V5A A;  1A54 A;  4Z0I A;  3G7W A;  3KFM A;  3C36 A;  4NTL A;  1WDN A;  2NOO A;  1MQD A;  3M3L A;  3UGW A;  4HTG A;  3RY3 A;  4P0I A;  3OEK A;  4F19 A;  5KDT A;  3IJX B;  2R9J A;  1QUJ A;  4PFU A;  1N7X A;  2PX1 A;  1B0H A;  5JTY B;  2DYX A;  1LAH E;  4EQ7 A;  2F7B A;  4PQJ A;  2GHB A;  4R6H A;  1QVS A;  1LCF A;  4YAH X;  3JYR A;  3MP1 A;  4E0W A;  1SQY A;  1MRP A;  2O1L A;  3SKP A;  4GWO A;  2F6P A;  4WXJ A;  1USY E;  5I57 A;  4ESX A;  1HSL A;  3FVN A;  3TUS A;  2Y7K A;  1SDX A;  3CG1 A;  3CVG A;  3MJN A;  5AA4 A;  1IXH A;  1FCK A;  4G77 A;  1IXI A;  5HM4 B;  5CI5 A;  1URD A;  1Z7N E;  2VOZ A;  5B7D A;  2I0B A;  3HN0 A;  3CFL A;  1LBB A;  4MBP A;  2DE3 A;  5CMB A;  2DXR A;  4U23 A;  2E1S A;  2PT1 A;  3LUY A;  4GXS B;  2G29 A;  5KDT B;  1MY4 A;  4ECF A;  4XTC Q;  4NWD A;  5F7V A;  3N5L A;  4YKK A;  3PUY E;  5AA2 D;  1B0L A;  3OO7 A;  2F97 A;  3VVE A;  3Q25 A;  4MLQ A;  4ZS9 A;  3PMX A;  3R7X A;  1QKA A;  1R9L A;  5I57 B;  1PB9 A;  1QUL A;  3IB1 A;  4U1O A;  3E13 X;  1N7W A;  4H67 A;  4K3F A;  3VDF A;  4NWC A;  4LVQ A;  5AA4 B;  2F5X A;  3RT8 A;  2I49 A;  2Y7W A;  4H65 A;  5CC2 A;  5I84 A;  1YCJ A;  4GOT A;  1QW0 A;  5ISU A;  3CRB A;  3FUZ A;  4BDN A;  4L17 A;  4ZZA A;  3IO6 A;  3EHT A;  2HAV A;  3PUV E;  4M1V A;  1NH8 A;  5H8H A;  4TLM B;  3B6W A;  3U1O A;  1QKB A;  4JB7 A;  1S7Y A;  1QUI A;  3ILU B;  3OO9 A;  3QYT A;  4GF8 A;  1FTO A;  3K6X A;  1EH3 A;  1R9Q A;  3KSJ A;  3QUF A;  4BLA A;  1EZO A;  1RKM A;  2HZK A;  3Q29 A;  4OEV A;  4P0G A;  3IB2 A;  2F36 A;  3OEN A;  4BDO A;  1MM6 A;  5AA1 A;  2F78 A;  3ZSF A;  4R2F A;  3MVX A;  4OZ9 A;  1B5H A;  3KJ7 A;  3SEV A;  5ITP A;  1A99 A;  5ICT A;  4FIM A;  3FIR A;  1B51 A;  2I48 A;  3PPR A;  5AA2 A;  4C0R A;  3ECR A;  2F7C A;  2O7I A;  2ZNU A;  5ELV A;  3S4U A;  5TPA A;  3EHU A;  4NF4 A;  5H8H B;  3A3C A;  2RF1 A;  2UXA A;  3QUJ A;  4TOZ A;  3WAF A;  2ZYM A;  4FEC A;  2DS9 A;  4OVJ A;  1B58 A;  1M5D A;  4H6D A;  3F11 A;  2QL3 A;  2H4I A;  1UQW A;  2OWS A;  2F6G A;  5DTB A;  3VVF A;  3G3F A;  3KOS A;  1JVY A;  2PBW A;  3W9V A;  5KZT A;  1ZU0 A;  2GRV A;  3E9X A;  5L8D A;  2RCB A;  4ELP A;  3FAS A;  4X48 A;  3G3K A;  1NNF A;  2ANJ A;  2D3I A;  2CMO A;  1A7L A;  2I3W A;  3KN7 A;  4F3P A;  1VFD A;  4JBZ A;  5CMC A;  2O1M A;  2AL4 A;  3RT6 B;  4JWX A;  1RYX A;  1ZTY A;  3FGS A;  3MZ1 A;  4BDM A;  2YPN A;  1UTB A;  4LON B;  2B3B A;  4I8C A;  1II5 A;  2XXR A;  3TPA A;  1MH4 A;  3VE1 B;  2Z8D A;  5DYH A;  3T66 A;  4ZDM A;  5TPA B;  4DXU A;  4NF4 B;  2KLF A;  1ANF A;  1PBP A;  1GR2 A;  4F3S A;  4F2Q A;  1F9B A;  1GGG A;  2QS3 A;  2E0S A;  1IEJ A;  2I58 A;  3WAE A;  5EHS A;  3T22 A;  2ZMB A;  3TTM A;  3B7D A;  2Q2A A;  1XHY A;  3RUM A;  1OMP A;  1LAG E;  4MF3 A;  2RC9 A;  4OER A;  1HSJ A;  1P1O A;  3HHF A;  1WOD A;  4LAT A;  5DT6 A;  3QXM A;  4XKN A;  4R2B A;  2WKY A;  2F7A A;  4POW A;  4GL0 A;  3OSR A;  3IOW A;  3GLB A;  2FA7 A;  4YB6 A;  4P11 A;  3SET A;  3KN3 A;  4JDF A;  2XXX A;  3U92 A;  1UTB B;  2DP8 A;  3TKD A;  4FED A;  3A09 A;  5I2K A;  4IO5 A;  1MDP 1;  4GD5 A;  2Q9T A;  1I6A A;  2V25 A;  1OIB A;  3O66 A;  4IY5 A;  3HHG A;  4ELO A;  1XVY A;  4PET A;  1S50 A;  3SES A;  1D9Y A;  3C4M A;  3ONM A;  2DWI A;  4X9T A;  1PDA A;  3RTW B;  4F39 A;  4XIG Q;  4QF9 A;  3TMG A;  3RLF E;  5LOM A;  1US4 A;  4Q0C A;  2XX7 A;  5ICQ A;  4XKP A;  3K4U A;  3H06 B;  4ZEI A;  5DVF A;  4Q30 B;  1GTK A;  3PUW E;  3RNN A;  4LZ7 A;  3DEL B;  3CG3 A;  2AIX A;  4ZED A;  1T0K A;  2DXY A;  3CI8 A;  2DWA A;  3HCQ A;  3MVW A;  2HXW A;  2H9B A;  1SW5 A;  4G8N A;  5I2K B;  3TZA A;  5ITO A;  3SEU A;  1TXF A;  1QJM A;  1B3F A;  1IQ7 A;  4FAT A;  2IEE A;  4H8I A;  1OVB A;  1I6B A;  4OEN A;  4U4S A;  5H8S A;  4XKQ A;  2A5T A;  1DPP A;  3TEL A;  3OSQ A;  4MH5 A;  4KD5 A;  2UVG A;  3U94 A;  1URS A;  1DOT A;  2HZL A;  4C1U A;  4IGT A;  3G3J A;  4OFJ A;  2UVJ A;  3W15 C;  3THI A;  1CB6 A;  3K1M A;  2I6E A;  5CBS A;  1USY H;  4O3B A;  3G3G A;  4ONY A;  3VLU A;  2X26 A;  3VFJ A;  4KFQ A;  2R71 A;  1XVX A;  4ZEK A;  3CIJ A;  3MAM A;  4ZEB A;  4DCX A;  4G8H A;  2NUV A;  3IK6 B;  4GXA A;  4R72 A;  2VP1 A;  1ZKB A;  1XC1 A;  2RKM A;  3DM0 A;  3MZB A;  4KQP A;  4LZ5 A;  4X1B A;  1EU8 A;  1VE4 A;  4DXB A;  2Y7R A;  3IX1 A;  1O63 A;  4LUB A;  3I5O A;  3KN8 A;  4OTE A;  4F2O A;  1VSO A;  2OJT A;  4AB6 A;  5EYF A;  2A5T B;  1GVC A;  4YKP A;  2XXV A;  4NF6 A;  1Y4C A;  1A8E A;  3K00 A;  2V93 A;  3EN3 A;  3UA8 A;  5B70 A;  4O3A A;  3PD9 A;  4KPT A;  1B3L A;  4YMB A;  3CFX A;  3TFL A;  5BWJ A;  4I1D A;  1ATG A;  1FQF A;  1IXG A;  1LAF E;  1SI0 A;  1XS5 A;  3VXB A;  2RC7 A;  1Y3P A;  5H8F B;  4BDL A;  1B5J A;  4ZEC A;  4WKM A;  4JWY A;  5L9O A;  4FOR A;  4IO6 A;  4U1Z A;  1POT A;  5CMM A;  5HBC A;  3V89 B;  3KZG A;  3FD3 A;  2XXP A;  4G8M A;  3PV0 E;  3FVK A;  1CE2 A;  5KCJ A;  2X7P A;  2LAO A;  4U2R A;  4WED A;  4RYA A;  4NF6 B;  1XOC A;  5TU0 A;  2OZZ A;  2DOJ A;  3JV9 A;  4YKJ A;  1AIV A;  2VD3 A;  1MXV A;  3KGC A;  2DE2 A;  4HS7 A;  3IOR A;  1D3K A;  4OMB A;  3MP6 A;  5H8N A;  5FTI A;  5DVJ A;  3B6T A;  1LLS A;  3TAJ A;  2B65 A;  2VD2 A;  1EZP A;  5M2V A;  5L9M A;  2FNC A;  3VVD A;  3FAT A;  2NWJ A;  2QS2 A;  1QUK A;  4PFT A;  4RPN A;  3RGY A;  3BFU A;  4QSC A; 
#chains in the Genus database with same CATH topology
 4RJZ A;  2QJE A;  5H8Q A;  4RPO A;  4QXD A;  2AL5 A;  3HO7 A;  1NFT A;  4NE4 A;  1OQG A;  1DTZ A;  3L6G A;  1MQG A;  3RTF B;  1PB7 A;  5FTH A;  1YAE A;  4N6K A;  5KCJ B;  4P1L A;  1M5B A;  3N6U A;  3LC8 A;  1B7Z A;  3H03 A;  4OQO A;  1SW4 A;  1Y1Z A;  2ALU A;  3EPE A;  3QSL A;  4PP0 A;  3D4C A;  5AE4 A;  2V3T A;  1M5F A;  4YZZ A;  3SEX A;  1TFD A;  3H4Z A;  4H0W A;  5CM6 A;  2I4B A;  2XD3 A;  3RN8 A;  2QMW A;  5IKB A;  1MY3 A;  4EF2 A;  3ZKK A;  5H8N B;  3BBR A;  1VFE A;  1NH7 A;  1I69 A;  3HFU A;  3OXN A;  3O2A A;  2W7Y A;  2Y5K A;  1O7T A;  4QFN A;  1SD3 A;  4X1D A;  3V8X B;  2VPO A;  4IO2 A;  4R6Y A;  3FXU A;  1MQJ A;  3OO6 A;  4H5G A;  5H8Q B;  1P1W A;  1H76 A;  4ND9 A;  3T0J A;  2DWJ A;  4P9K A;  3KC0 A;  4ESW A;  5I7I A;  3LSL A;  2F3D A;  2D5W A;  1B40 A;  4LQ2 A;  4DE8 A;  2O69 A;  4QHQ A;  1YZ0 A;  2Q89 A;  4XF5 A;  4EQ9 A;  4PFR A;  2VPN A;  4GLI A;  1O64 A;  1D4N A;  1EZ9 A;  2F3B A;  1LFI A;  1FW0 A;  1JQF A;  3H6V A;  1DBZ A;  3NOH A;  4H8J A;  2DE4 A;  4ZE8 A;  2XWV A;  4EXK A;  1JW4 A;  2ZZX A;  3E3K A;  3K2D A;  3OO8 A;  5LTC A;  5EQA A;  5EYH A;  1TFA A;  4DIG A;  3PMW A;  4NED A;  3IOU A;  4GRK A;  1MY1 A;  4F1U A;  2ESN A;  4OWD A;  2MKZ A;  2YJP A;  3KBR A;  2PYY A;  3CSB A;  3O6G A;  3PPQ A;  3UP9 A;  4ELR A;  1EYK A;  4Z7E A;  1AOV A;  1AH5 A;  1BLF A;  1FBH A;  1RDX A;  3JZJ A;  1FPI A;  3PU5 A;  3FVO A;  3MWB A;  4H46 A;  3KEI A;  3EF7 A;  3T93 B;  3FVG A;  1JW1 A;  4XXU A;  1B6H A;  4FE8 A;  3SEY A;  1UIV A;  3B8B A;  5I59 A;  1ZJL A;  1A8F A;  4PGP A;  2O84 X;  3N6T A;  2QMX A;  2PMS A;  3T9X B;  4XEQ A;  3BIH A;  2REG A;  1BP5 A;  4KYS A;  4NG7 A;  1FQC A;  4HW8 A;  4GBW A;  5FHM A;  1B52 A;  2QFL A;  3I3V A;  1POY 1;  3EHS A;  3TTK A;  1Y9U A;  4POX A;  3SEW A;  4OFL A;  2GFE A;  1FTA A;  1NL5 A;  4XKR A;  4ELQ A;  4N6P A;  5BUU A;  2ZZW A;  4OEU A;  4N15 A;  4RK2 A;  1N04 A;  1OLA A;  4KCC A;  4KR5 A;  4EQB A;  3MC2 A;  3TCF A;  2DSF A;  3S9E A;  1MXU A;  2OK2 A;  4TLL B;  1MXW A;  4KHZ E;  2ZNT A;  3N26 A;  4HCW A;  3OEM A;  2F35 A;  4DXC A;  1MQI A;  4YMA A;  1FQE A;  2OCU A;  2I3V A;  3DP4 A;  2XA5 A;  4GVO A;  4OHN A;  4LN5 A;  2PVU A;  1NNK A;  4GWW A;  4JSD A;  4F3B A;  1Q35 A;  5I59 B;  3PGF A;  1MXY A;  4E0X A;  1B5I A;  4FBP A;  5T3J A;  1FRP A;  1OQH A;  3R6U A;  4GBV A;  1JNF A;  2RC8 A;  3ILT B;  1FBG A;  3K0V A;  1BKA A;  2PFZ A;  1CNQ A;  4PE5 B;  4JXI A;  1H3D A;  2M8C A;  5I58 A;  4G4P A;  1Y4T A;  3T9H B;  2XXK A;  3C35 A;  3U65 A;  4DLD A;  1NV4 A;  2UYE A;  4IY6 A;  2HFB A;  1BIY A;  4PFY A;  1B7H A;  3IB0 A;  2P3N A;  3IAZ A;  4BDR A;  2F34 A;  1KA0 A;  4Q8R A;  4OVP A;  1IMA A;  1MY2 A;  4F22 A;  4HE2 A;  4HXV A;  4QRZ A;  1TWY A;  4QBA A;  1N84 A;  2ZYO A;  3H6U A;  3MBP A;  2DVC A;  2OX3 A;  2NVU B;  3EKI A;  2WYP A;  1LST A;  3Q28 A;  3CFZ A;  1J1N A;  4QSD A;  3VLV A;  4LP2 B;  4ZEF A;  3K6U A;  1FQA A;  4YIC A;  4F18 A;  5CMK A;  1PEB A;  3W9W A;  4AS5 A;  2XWK A;  3IJO B;  4LQ5 A;  3TOD A;  3O97 A;  5F1Q A;  5I56 A;  2ONR A;  2ONK E;  2VGQ A;  1NV1 A;  4OES A;  1MY0 A;  1P1N A;  3DP8 A;  3FXQ A;  5H8F A;  1LGB C;  5I58 B;  1MDQ A;  1MG1 A;  3B6Q A;  2XXU A;  3I6V A;  3K1P A;  4PF6 A;  4I9D A;  1H44 A;  4JSO A;  4OFO A;  4EUO A;  1MPD A;  2FVZ A;  4JVC A;  4X8R A;  3UOR A;  4THI A;  3MQ9 A;  3OEL A;  4GX3 A;  1LFG A;  2O51 A;  1MXX A;  1B1H A;  4RY1 A;  4UAB A;  3LV0 A;  1R6Z A;  1IUD A;  3O28 A;  1IMF A;  4MMP A;  1B4H A;  4O7I A;  4F3G A;  1SW1 A;  1Q1K A;  1RYO A;  4NF8 A;  2NXO A;  2V3Q A;  2Q8M A;  2QRY A;  4QFO A;  2QSX A;  4Q5T A;  3TYH A;  2HEU A;  3S9M C;  1N3X A;  4FJP A;  3G3I A;  4NF5 A;  1D9V A;  4NMY A;  1LB9 A;  1H43 A;  5FHO A;  3RPW A;  5I56 B;  3TEP A;  1JET A;  1NMU A;  4GL8 A;  2Z8E A;  5I3S A;  4PBH A;  1ZMG A;  5ET6 A;  3H7M A;  3TCG A;  1JW5 A;  3KC1 A;  3KJT A;  1URG A;  3D4G A;  2ZNS A;  4IO3 A;  4QFL A;  3O6H A;  1AWB A;  4IB2 A;  1YYZ A;  5DEX A;  4I62 A;  3AXF A;  4OYV A;  2Y84 A;  1AMF A;  1B2H A;  4GQO A;  2OLB A;  4R75 A;  4YB7 A;  2REJ A;  5EQ8 A;  2YLN A;  1JEV A;  5LDZ A;  1IXC A;  2ZYN A;  4FEB A;  3U8Q A;  2B3F A;  4EDP A;  4U21 A;  1B4Z A;  5TP9 A;  2HAU A;  2XXT A;  1B1X A;  3ZKL A;  4H1X A;  4KI0 E;  1P99 A;  2OBG A;  3PUX E;  1IMC A;  4NF8 B;  4NX1 A;  3Q26 A;  5J1D A;  3MPK A;  3C33 A;  2V4C A;  4R73 A;  3MZ9 A;  3RQT A;  4NF5 B;  1FPB A;  4PAF A;  4QFP A;  3PPN A;  4DCY A;  2DQV A;  3OOA A;  4NQ8 A;  2ABH A;  4O3C A;  4LZ8 A;  2H5Y A;  4LA9 A;  4JWO A;  3B50 A;  4DI4 B;  1MS7 A;  3LR1 A;  2OWT A;  2UVI A;  2QS4 A;  2THI A;  4OET A;  5DEX B;  1LBZ A;  1B05 A;  5CBR A;  1WVJ A;  1Y1M A;  3ODB A;  2AYS A;  4FAJ A;  3DLN A;  3L6H A;  3OMB A;  1MXZ A;  3PPO A;  4ZE9 A;  3SDF A;  4UA8 A;  4GWZ A;  2XD2 A;  2XXH A;  3C32 A;  4ZZE A;  5K2X A;  2Q2C A;  4MLV A;  3V83 A;  4OXV A;  5DVI A;  2XHD A;  3G3H A;  5TP9 B;  1VR5 A;  4R9G A;  1M5C A;  1NKX A;  2XXY A;  4MAG A;  4F1V A;  2CZL A;  3UK4 A;  3MVZ A;  4PFW A;  4EF1 A;  3DP6 A;  1SI1 A;  3PUZ E;  4F31 B;  1ZLQ A;  1LB8 A;  2H25 A;  3TTN A;  1N3W A;  1MPC A;  1RDZ A;  2WEF A;  1AL3 A;  5IAI A;  3VV5 A;  1ZIU A;  1B32 A;  1FQB A;  3FV2 A;  3IO4 A;  3T96 B;  1LBV A;  2XX8 A;  2UVH A;  2HQ0 A;  5IZZ A;  3FXR A;  1MQH A;  3PD8 A;  4RXL A;  3C31 A;  4U22 A;  4UAC A;  3K1N A;  3H6T A;  3C34 A;  3O29 A;  2BJJ X;  1NNT A;  3LSF B;  2XXW A;  1SYI A;  1S9T A;  1B7U A;  1N0T A;  4GIZ A;  1LAX A;  5JEI A;  2Q8J A;  2V84 A;  3MUQ A;  2Q88 A;  1HSE A;  3S9N C;  1JEU A;  4BDQ A;  3ZS6 A;  3FJM A;  4R6K A;  4YB5 A;  4NAP A;  2VHA A;  1IZ1 A;  1R1N A;  3E4R A;  1BTJ A;  1SBP A;  2GHA A;  1KA1 A;  2QS1 A;  3FJ7 A;  3TTL A;  2D21 A;  1OVT A;  3TQW A;  4KXP A;  1MM7 A;  5FHN A;  2WYK A;  3IFC A;  4WEP A;  3K01 A;  3H6W A;  1YTV A;  2R6G E;  4H45 A;  3MW0 A;  1Z7M E;  5EQ9 A;  2PT2 A;  3QK6 A;  2QVV A;  2Y7I A;  3PTY A;  1MPB A;  1NUX A;  1L5T A;  4N6D A;  1FJ6 A;  1B3H A;  3OD7 A;  5AA2 B;  3K02 A;  2F8D A;  1B9J A;  3TCH A;  1A40 A;  3CSG A;  3FBP A;  4HCY A;  4OVT A;  5EHM A;  3R26 A;  5L9S A;  3U72 A;  1N76 A;  2O6A A;  1FTL A;  2DDK A;  4QSE A;  1JVX A;  1SYH A;  1TT1 A;  1NUY A;  5A5X A;  4R9F A;  2ONS A;  1Y3N A;  1NV7 A;  3Q27 A;  5CRY A;  2B4M A;  4G68 A;  3CR9 A;  5JK4 A;  1DPE A;  3BKI B;  2I0C A;  3QIM A;  1B46 A;  1NNP A;  5K2Y A;  2Z22 A;  1LBC A;  2P1S A;  1LCT A;  3MVY A;  3VLW A;  3LSW A;  3O6I A;  1SVX B;  5IM2 A;  3T9V A;  4KYD A;  4R74 A;  5I2N A;  3S2V A;  2RIN A;  3M3F A;  1IIT A;  2Z8F A;  2QVR A;  3GXA A;  4H5F A;  4NF0 A;  2XXI A;  1DSN A;  3K6V A;  1GV8 A;  4NHB A;  4DZ1 A;  1PBQ A;  1FTK A;  1DTG A;  2G93 A;  2IA4 A;  5ET7 A;  1LFH A;  3ISP A;  5J16 A;  2V3U A;  1LBX A;  4IO7 A;  3LSX A;  3U93 A;  4GX6 A;  2QVU A;  3UN6 A;  3P7I A;  3S9L C;  4G68 C;  3HV1 A;  2XXQ A;  3BFT A;  3MPL A;  3HPI A;  3C9H A;  4AQ4 A;  4AB5 A;  3RPL A;  3UIF A;  1H45 A;  4MFI A;  4YKI A;  2HCA A;  1B3E A;  4RA1 A;  3KSX A;  1NV2 A;  3O9P A;  5A5X B;  1Y20 A;  2QPQ A;  3VXC A;  2I4C A;  2O68 A;  1IIW A;  4G68 B;  3A3U A;  1P1Q A;  4QFK A;  1OLC A;  1XT8 A;  2UYF A;  4PDH A;  3TTR A;  3M8U A;  1ZBM A;  3PMV A;  4YU0 A;  2DVZ A;  1UIU A;  1IME A;  3IOV A;  2ZXT A;  1K9Z A;  4IO4 A;  2XX9 A;  1DMB A;  2Z23 A;  3T1B A;  1B3G A;  3PPP A;  5I2N B;  4RK9 A;  2FIE A;  1M5E A;  2PFY A;  3K6W A;  3MYU A;  4MNP A;  1YPN A;  1Y3Q A;  4OVS A;  5IZ3 A;  4DDD A;  2A5S A;  4N07 A;  3LBS A;  1A55 A;  4ISU A;  5HPQ A;  4C1T A;  4GFR A;  1UTH A;  2Q74 A;  3M3K A;  1FTM A;  2H99 A;  4KCD A;  4EXL A;  4KYE A;  1ELJ A;  3ROJ A;  1MH3 A;  3IOT A;  3RPL B;  3N94 A;  3QAX A;  2O7U A;  3IR1 A;  3HST A;  1YXI A;  4DI3 D;  4TQU Q;  3KG2 A;  4PBQ A;  2P2A A;  1PB8 A;  1FTJ A;  4M4G A;  1SPI A;  4P3L A;  2P0S A;  3FJG A;  5JTY A;  3EQ1 A;  1KWH A;  2FYI A;  3USD A;  1SW2 A;  3TQL A;  1PC3 A;  3FZV A;  3T9U A;  4RNS A;  4F29 A;  5ET5 A;  3FV1 A;  1I6Q A;  2X7Q A;  3TDJ A;  4U4X A;  2GH9 A;  4I3Y A;  2DWH A;  3GBA A;  2RCA A;  4IGR A;  3GZG A;  5IZ3 B;  1P1U A;  2Y7P A;  3GBB A;  4F1Y A;  5AA3 A;  3KOT A;  4G2Z A;  2FBP A;  5I5P A;  4PE3 A;  4N13 A;  1UTH B;  2H98 A;  4GWX A;  1FQD A;  3SER A;  3MP8 A;  3IL1 B;  1US5 A;  1LBY A;  3H3G A;  2ZYK A;  3V5A A;  1A54 A;  4Z0I A;  3G7W A;  3KFM A;  3C36 A;  4NTL A;  1WDN A;  2NOO A;  1MQD A;  3M3L A;  3UGW A;  4HTG A;  3RY3 A;  4P0I A;  1FPJ A;  3OEK A;  4O94 A;  4F19 A;  5KDT A;  3IJX B;  3MST A;  2R9J A;  1QUJ A;  4PFU A;  1N7X A;  2PX1 A;  1B0H A;  5JTY B;  2DYX A;  1LAH E;  4EQ7 A;  2F7B A;  4PQJ A;  2GHB A;  4HE0 A;  4R6H A;  1QVS A;  1LCF A;  4YAH X;  3JYR A;  3MP1 A;  4E0W A;  4N8Y A;  2WBD A;  1SQY A;  1MRP A;  2WX9 A;  2O1L A;  3SKP A;  4GWO A;  2F6P A;  4WXJ A;  1USY E;  5I57 A;  4ESX A;  1HSL A;  3FVN A;  3TUS A;  2VT5 A;  2Y7K A;  1SDX A;  3CG1 A;  3CVG A;  3MJN A;  5AA4 A;  1IXH A;  1FCK A;  4G77 A;  1IXI A;  5HM4 B;  4JVI A;  3D1R A;  5CI5 A;  1FBF A;  1URD A;  1Z7N E;  2VOZ A;  5B7D A;  2I0B A;  3HN0 A;  3CFL A;  1LBB A;  4MBP A;  2DE3 A;  5CMB A;  1FJ9 A;  2DXR A;  4U23 A;  2E1S A;  2PT1 A;  3LUY A;  4GXS B;  1IMD A;  2G29 A;  5KDT B;  1MY4 A;  4ECF A;  4XTC Q;  4NWD A;  5F7V A;  3N5L A;  4YKK A;  3PUY E;  5AA2 D;  1B0L A;  3OO7 A;  1NUZ A;  2F97 A;  3VVE A;  3Q25 A;  4MLQ A;  4ZS9 A;  3PMX A;  3R7X A;  1QKA A;  4PCD A;  1R9L A;  5I57 B;  1PB9 A;  1QUL A;  2XWI A;  3IB1 A;  4N17 A;  4U1O A;  4O7M A;  4MNC A;  3E13 X;  1N7W A;  4H67 A;  4K3F A;  3VDF A;  4NWC A;  2P3V A;  4LVQ A;  5AA4 B;  1NUW A;  1DK4 A;  2F5X A;  4PF8 A;  3RT8 A;  2I49 A;  2Y7W A;  4H65 A;  4MCO A;  5CC2 A;  5I84 A;  1YCJ A;  4PGN A;  4GOT A;  1QW0 A;  5ISU A;  3CRB A;  3FUZ A;  4BDN A;  4L17 A;  4ZZA A;  3IO6 A;  3EHT A;  2HAV A;  3PUV E;  4M1V A;  1NH8 A;  5H8H A;  3QMF A;  4TLM B;  3B6W A;  3U1O A;  1QKB A;  4JB7 A;  1FPL A;  1S7Y A;  1QUI A;  3ILU B;  3OO9 A;  3QYT A;  4GF8 A;  1FTO A;  3K6X A;  4OA4 A;  1EH3 A;  1R9Q A;  3KSJ A;  4GX4 A;  3QUF A;  4BLA A;  1EZO A;  1RKM A;  2HZK A;  3Q29 A;  1NV6 A;  3KBZ A;  4OEV A;  4P0G A;  3IB2 A;  2F36 A;  3OEN A;  4BDO A;  2KR0 A;  4PDD A;  1MM6 A;  5AA1 A;  2F78 A;  3ZSF A;  1G0I A;  3IFA A;  4R2F A;  5A5L A;  1RDY A;  3MVX A;  4OZ9 A;  4JVD A;  1B5H A;  3KJ7 A;  3SEV A;  2OWZ A;  4N4U A;  5ITP A;  3E79 A;  3BIG A;  1A99 A;  5ICT A;  4FIM A;  3FIR A;  1B51 A;  2I48 A;  3PPR A;  5AA2 A;  4C0R A;  1VDW A;  1FSA A;  3ECR A;  2F7C A;  5ET8 A;  2O7I A;  1LBW A;  2ZNU A;  5ELV A;  3S4U A;  4PFB A;  5TPA A;  4P56 A;  3EHU A;  4NF4 A;  5H8H B;  3A3C A;  1FBE A;  2RF1 A;  2UXA A;  3QUJ A;  4TOZ A;  3WAF A;  2ZYM A;  4FEC A;  2DS9 A;  4OVJ A;  1FBP A;  1B58 A;  4PC9 A;  1M5D A;  4H6D A;  3F11 A;  2QL3 A;  2H4I A;  2HXR A;  1UQW A;  2OWS A;  2F6G A;  5DTB A;  4MX6 A;  3VVF A;  3G3F A;  3KOS A;  2Y5L A;  1JVY A;  2PBW A;  3W9V A;  5KZT A;  1ZU0 A;  4P8B A;  2GRV A;  3E9X A;  5L8D A;  2HPG A;  2RCB A;  4ELP A;  3FAS A;  4X48 A;  3G3K A;  1NNF A;  2ANJ A;  2D3I A;  4GWU A;  2CMO A;  1A7L A;  2I3W A;  3KN7 A;  4F3P A;  1VFD A;  4JBZ A;  5CMC A;  2O1M A;  2AL4 A;  3RT6 B;  2HHM A;  4JWX A;  1RYX A;  1ZTY A;  3FGS A;  2GQ1 A;  3MZ1 A;  4BDM A;  2YPN A;  1UTB A;  1XI6 A;  4LON B;  2B3B A;  4I8C A;  1II5 A;  2XXR A;  3TPA A;  1MH4 A;  3VE1 B;  2Z8D A;  5DYH A;  3T66 A;  4ZDM A;  5TPA B;  1NI9 A;  4DXU A;  4NF4 B;  2KLF A;  1ANF A;  1PBP A;  1GR2 A;  4F3S A;  4F2Q A;  1F9B A;  1GGG A;  2QS3 A;  2E0S A;  1IEJ A;  2I58 A;  3WAE A;  5EHS A;  4NN3 A;  3T22 A;  2ZMB A;  3TTM A;  3B7D A;  2Q2A A;  1XHY A;  3RUM A;  1OMP A;  1LAG E;  4MF3 A;  2RC9 A;  4OER A;  1HSJ A;  1P1O A;  3HHF A;  1WOD A;  4LAT A;  5DT6 A;  3QXM A;  4XKN A;  4R2B A;  2WKY A;  2F7A A;  2CZH A;  2FHY A;  4POW A;  4GL0 A;  3OSR A;  3IOW A;  3GLB A;  2FA7 A;  4YB6 A;  4P11 A;  3SET A;  1EYI A;  1G0H A;  3KN3 A;  4OVQ A;  4JDF A;  2XXX A;  3U92 A;  1UTB B;  2DP8 A;  3TKD A;  4FED A;  3A09 A;  5I2K A;  4IO5 A;  1MDP 1;  4GD5 A;  2Q9T A;  1I6A A;  2V25 A;  1OIB A;  3O66 A;  4IY5 A;  3HHG A;  4ELO A;  1XVY A;  4N91 A;  4PET A;  1S50 A;  3SES A;  1D9Y A;  3C4M A;  3ONM A;  2DWI A;  4I40 A;  4X9T A;  1PDA A;  3RTW B;  4GWS A;  4F39 A;  4XIG Q;  4QF9 A;  1FPK A;  3TMG A;  3RLF E;  5LOM A;  1FPF A;  1US4 A;  4N81 A;  4X04 A;  4Q0C A;  2XX7 A;  5ICQ A;  4XKP A;  3K4U A;  3H06 B;  4ZEI A;  5DVF A;  2PCR A;  4Q30 B;  1GTK A;  3PUW E;  1FBD A;  4MJO A;  3RNN A;  4LZ7 A;  3DEL B;  4P1E A;  2CEX A;  1FBC A;  3CG3 A;  2AIX A;  4ZED A;  1T0K A;  2DXY A;  3CI8 A;  2DWA A;  4PFI A;  5EQ7 A;  3HCQ A;  3MVW A;  4PAK A;  2HXW A;  4PAI A;  2JJK A;  2H9B A;  1SW5 A;  4MNI A;  4G8N A;  5I2K B;  3E78 A;  3TZA A;  5ITO A;  3SEU A;  1TXF A;  4O8M A;  5IZ1 A;  1QGX A;  1QJM A;  1B3F A;  1IQ7 A;  4FAT A;  2IEE A;  4H8I A;  1OVB A;  1I6B A;  4OEN A;  4U4S A;  4IR8 A;  4OAN A;  5H8S A;  4XKQ A;  2A5T A;  1DPP A;  3A29 A;  3TEL A;  2L5V A;  3OSQ A;  4MH5 A;  4KD5 A;  5FBP A;  2UVG A;  1KZ8 A;  3U94 A;  1URS A;  4HE1 A;  5DW8 A;  1NV0 A;  2WBB A;  2B4L A;  1DOT A;  1BK4 A;  2HZL A;  4C1U A;  4IGT A;  3G3J A;  1Q9D A;  4OFJ A;  2UVJ A;  3W15 C;  3THI A;  1CB6 A;  3K1M A;  1EYJ A;  2I6E A;  5CBS A;  4GWY A;  1USY H;  4O3B A;  3G3G A;  4ONY A;  3VLU A;  2X26 A;  3VFJ A;  4KFQ A;  1JP4 A;  2R71 A;  1XVX A;  4ZEK A;  3CIJ A;  3MAM A;  4ZEB A;  4DCX A;  4G8H A;  5EYG A;  2NUV A;  3IK6 B;  4GXA A;  2R8T A;  4R72 A;  3SZP A;  2VP1 A;  4XFE A;  1ZKB A;  1XC1 A;  2RKM A;  3DM0 A;  3GYY A;  3MZB A;  4KQP A;  4LZ5 A;  4MHF A;  4X1B A;  1EU8 A;  5ESY A;  3RYD A;  1VE4 A;  4MEV A;  4DXB A;  2Y7R A;  3IX1 A;  1O63 A;  1D9Q A;  4LUB A;  3I5O A;  2FIX A;  3KN8 A;  4OTE A;  4F2O A;  1VSO A;  2OJT A;  4NGU A;  4AB6 A;  5EYF A;  2A5T B;  1GVC A;  2KQZ A;  4YKP A;  2XXV A;  2CEY A;  1NV5 A;  4NF6 A;  1Y4C A;  2BJI A;  1A8E A;  3K00 A;  4PTK A;  2CZK A;  2V93 A;  3EN3 A;  1IMB A;  4OVR A;  3UA8 A;  5B70 A;  4O3A A;  3CHG A;  3PD9 A;  1DCU A;  4KPT A;  1B3L A;  4YMB A;  2ZZV A;  3CFX A;  3TFL A;  5BWJ A;  4I1D A;  3LUZ A;  4P47 A;  1ATG A;  1FQF A;  1LEV A;  1IXG A;  1LAF E;  1SI0 A;  1XS5 A;  4MIJ A;  3VXB A;  2RC7 A;  1Y3P A;  5H8F B;  4BDL A;  1B5J A;  4ZEC A;  1FPD A;  4WKM A;  3FXB A;  4JWY A;  5L9O A;  4FOR A;  1K9Y A;  4IO6 A;  4U1Z A;  1NV3 A;  2CZI A;  1POT A;  5CMM A;  5HBC A;  3V89 B;  3KZG A;  3FD3 A;  4N8G A;  5IGA A;  4G61 A;  2XXP A;  4G8M A;  3PV0 E;  1INP A;  3FVK A;  1CE2 A;  5KCJ A;  2X7P A;  2LAO A;  4U2R A;  4WED A;  4RYA A;  4NF6 B;  1XOC A;  5TU0 A;  2OZZ A;  2DOJ A;  3JV9 A;  4YKJ A;  1AIV A;  2VD3 A;  1MXV A;  3KGC A;  2DE2 A;  4HS7 A;  3IOR A;  1D3K A;  4OMB A;  3MP6 A;  5H8N A;  5FTI A;  2XWO A;  5DVJ A;  3B6T A;  1LLS A;  4I3E A;  3TAJ A;  1FPE A;  5F24 A;  2B65 A;  2VD2 A;  1EZP A;  5M2V A;  5L9M A;  4AS4 A;  2FNC A;  3VVD A;  3FAT A;  2NWJ A;  2QS2 A;  1FPG A;  1QUK A;  4PFT A;  4RPN A;  3RGY A;  3BFU A;  4QSC A; 
#chains in the Genus database with same CATH homology
 4RJZ A;  2QJE A;  5H8Q A;  4RPO A;  2AL5 A;  3HO7 A;  1NFT A;  4NE4 A;  1OQG A;  1DTZ A;  3L6G A;  1MQG A;  3RTF B;  1PB7 A;  5FTH A;  1YAE A;  5KCJ B;  1M5B A;  3N6U A;  3LC8 A;  1B7Z A;  3H03 A;  4OQO A;  1SW4 A;  1Y1Z A;  2ALU A;  3EPE A;  3QSL A;  4PP0 A;  3D4C A;  5AE4 A;  2V3T A;  1M5F A;  4YZZ A;  3SEX A;  1TFD A;  3H4Z A;  4H0W A;  5CM6 A;  2I4B A;  2XD3 A;  3RN8 A;  2QMW A;  5IKB A;  1MY3 A;  4EF2 A;  3ZKK A;  5H8N B;  3BBR A;  1VFE A;  1NH7 A;  1I69 A;  3OXN A;  3O2A A;  2W7Y A;  1O7T A;  4QFN A;  1SD3 A;  4X1D A;  3V8X B;  4IO2 A;  4R6Y A;  3FXU A;  1MQJ A;  3OO6 A;  4H5G A;  5H8Q B;  1P1W A;  1H76 A;  4ND9 A;  2DWJ A;  4ESW A;  3LSL A;  2D5W A;  1B40 A;  4LQ2 A;  4DE8 A;  2O69 A;  4QHQ A;  2Q89 A;  4EQ9 A;  4GLI A;  1O64 A;  1D4N A;  1EZ9 A;  1LFI A;  1FW0 A;  1JQF A;  3H6V A;  4H8J A;  2DE4 A;  4ZE8 A;  4EXK A;  1JW4 A;  3E3K A;  3K2D A;  3OO8 A;  1TFA A;  4DIG A;  3PMW A;  4NED A;  3IOU A;  4GRK A;  1MY1 A;  4F1U A;  2ESN A;  4OWD A;  2YJP A;  3KBR A;  2PYY A;  3CSB A;  3O6G A;  3PPQ A;  3UP9 A;  4ELR A;  4Z7E A;  1AOV A;  1AH5 A;  1BLF A;  3JZJ A;  3PU5 A;  3FVO A;  3MWB A;  3KEI A;  3EF7 A;  3T93 B;  3FVG A;  1JW1 A;  4XXU A;  1B6H A;  4FE8 A;  3SEY A;  1UIV A;  5I59 A;  1ZJL A;  1A8F A;  2O84 X;  3N6T A;  2QMX A;  2PMS A;  3T9X B;  2REG A;  1BP5 A;  4KYS A;  1FQC A;  4HW8 A;  5FHM A;  1B52 A;  3I3V A;  1POY 1;  3EHS A;  3TTK A;  1Y9U A;  4POX A;  3SEW A;  5BUU A;  4ELQ A;  2GFE A;  1NL5 A;  4OFL A;  4XKR A;  4N6P A;  4OEU A;  4RK2 A;  1N04 A;  1OLA A;  4KCC A;  4KR5 A;  4EQB A;  3MC2 A;  3TCF A;  2DSF A;  3S9E A;  1MXU A;  2OK2 A;  4TLL B;  1MXW A;  4KHZ E;  2ZNT A;  3N26 A;  4HCW A;  3OEM A;  2F35 A;  4DXC A;  1MQI A;  4YMA A;  1FQE A;  2OCU A;  2I3V A;  3DP4 A;  4GVO A;  4OHN A;  2PVU A;  1NNK A;  4JSD A;  4F3B A;  1Q35 A;  5I59 B;  3PGF A;  1MXY A;  4E0X A;  1B5I A;  1OQH A;  3R6U A;  1JNF A;  2RC8 A;  3ILT B;  3K0V A;  1BKA A;  4PE5 B;  4JXI A;  1H3D A;  2M8C A;  5I58 A;  4G4P A;  1Y4T A;  3T9H B;  3C35 A;  4DLD A;  2UYE A;  4IY6 A;  2HFB A;  1BIY A;  4PFY A;  1B7H A;  3IB0 A;  3IAZ A;  4BDR A;  2F34 A;  4Q8R A;  1MY2 A;  4F22 A;  4QRZ A;  1TWY A;  1N84 A;  2ZYO A;  3H6U A;  3MBP A;  2DVC A;  2NVU B;  1LST A;  3Q28 A;  3CFZ A;  1J1N A;  4QSD A;  3VLV A;  4LP2 B;  4ZEF A;  3K6U A;  1FQA A;  4YIC A;  4F18 A;  5CMK A;  1PEB A;  3W9W A;  3IJO B;  4LQ5 A;  3TOD A;  3O97 A;  5F1Q A;  5I56 A;  2ONR A;  2ONK E;  2VGQ A;  4OES A;  1MY0 A;  1P1N A;  3DP8 A;  3FXQ A;  5H8F A;  1LGB C;  5I58 B;  1MDQ A;  1MG1 A;  3B6Q A;  2XXU A;  3I6V A;  3K1P A;  4I9D A;  1H44 A;  4JSO A;  4OFO A;  4EUO A;  1MPD A;  3UOR A;  4THI A;  3MQ9 A;  3OEL A;  1LFG A;  2O51 A;  1MXX A;  1B1H A;  4RY1 A;  1R6Z A;  1IUD A;  3O28 A;  1B4H A;  4F3G A;  1SW1 A;  1Q1K A;  1RYO A;  4NF8 A;  2NXO A;  2V3Q A;  2QRY A;  4QFO A;  2QSX A;  4Q5T A;  3TYH A;  2HEU A;  3S9M C;  1N3X A;  4FJP A;  3G3I A;  4NF5 A;  1D9V A;  4NMY A;  1LB9 A;  1H43 A;  5FHO A;  3RPW A;  5I56 B;  3TEP A;  1JET A;  1NMU A;  4GL8 A;  2Z8E A;  1ZMG A;  3H7M A;  3TCG A;  1JW5 A;  3KJT A;  1URG A;  3D4G A;  2ZNS A;  4IO3 A;  4QFL A;  3O6H A;  4IB2 A;  5DEX A;  4I62 A;  3AXF A;  4OYV A;  2Y84 A;  1AMF A;  1B2H A;  4GQO A;  2OLB A;  4R75 A;  4YB7 A;  2REJ A;  2YLN A;  1JEV A;  1IXC A;  2ZYN A;  4FEB A;  3U8Q A;  2B3F A;  4EDP A;  4U21 A;  1B4Z A;  5TP9 A;  2HAU A;  2XXT A;  1B1X A;  3ZKL A;  4H1X A;  4KI0 E;  1P99 A;  2OBG A;  3PUX E;  4NF8 B;  3Q26 A;  5J1D A;  3MPK A;  3C33 A;  4R73 A;  3MZ9 A;  3RQT A;  4NF5 B;  4QFP A;  3PPN A;  4DCY A;  2DQV A;  3OOA A;  2ABH A;  4O3C A;  4LZ8 A;  2H5Y A;  4LA9 A;  4JWO A;  1MS7 A;  3LR1 A;  2OWT A;  2UVI A;  2QS4 A;  2THI A;  4OET A;  5DEX B;  1B05 A;  5CBR A;  1WVJ A;  1Y1M A;  3ODB A;  2AYS A;  4FAJ A;  3DLN A;  3L6H A;  3OMB A;  1MXZ A;  3PPO A;  4ZE9 A;  3SDF A;  4UA8 A;  2XD2 A;  2XXH A;  3C32 A;  4ZZE A;  5K2X A;  2Q2C A;  4MLV A;  3V83 A;  4OXV A;  5DVI A;  2XHD A;  3G3H A;  5TP9 B;  1VR5 A;  4R9G A;  1M5C A;  1NKX A;  2XXY A;  4F1V A;  2CZL A;  3UK4 A;  3MVZ A;  4PFW A;  4EF1 A;  3DP6 A;  1SI1 A;  3PUZ E;  4F31 B;  1ZLQ A;  1LB8 A;  2H25 A;  3TTN A;  1N3W A;  1MPC A;  1AL3 A;  5IAI A;  3VV5 A;  1ZIU A;  1B32 A;  1FQB A;  3FV2 A;  3IO4 A;  3T96 B;  2XX8 A;  2UVH A;  2HQ0 A;  3FXR A;  1MQH A;  3PD8 A;  4RXL A;  3C31 A;  4U22 A;  4UAC A;  3K1N A;  3H6T A;  3C34 A;  3O29 A;  2BJJ X;  1NNT A;  3LSF B;  2XXW A;  1SYI A;  1S9T A;  1B7U A;  1N0T A;  4GIZ A;  1LAX A;  5JEI A;  2Q8J A;  2V84 A;  3MUQ A;  2Q88 A;  1HSE A;  3S9N C;  1JEU A;  4BDQ A;  3ZS6 A;  3FJM A;  4R6K A;  4YB5 A;  2VHA A;  1IZ1 A;  1R1N A;  3E4R A;  1BTJ A;  1SBP A;  2GHA A;  2QS1 A;  3FJ7 A;  3TTL A;  2D21 A;  1OVT A;  3TQW A;  1MM7 A;  5FHN A;  4WEP A;  3K01 A;  3H6W A;  1YTV A;  2R6G E;  3MW0 A;  1Z7M E;  2PT2 A;  3QK6 A;  2Y7I A;  1MPB A;  1L5T A;  1B3H A;  3OD7 A;  5AA2 B;  3K02 A;  2F8D A;  1B9J A;  3TCH A;  1A40 A;  3CSG A;  4HCY A;  5EHM A;  3R26 A;  5L9S A;  3U72 A;  1N76 A;  2O6A A;  1FTL A;  4QSE A;  1JVX A;  1SYH A;  1TT1 A;  5A5X A;  4R9F A;  2ONS A;  1Y3N A;  3Q27 A;  5CRY A;  4G68 A;  3CR9 A;  5JK4 A;  1DPE A;  3BKI B;  2I0C A;  3QIM A;  1B46 A;  1NNP A;  5K2Y A;  2Z22 A;  1LBC A;  2P1S A;  1LCT A;  3MVY A;  3VLW A;  3LSW A;  3O6I A;  1SVX B;  3T9V A;  4KYD A;  4R74 A;  5I2N A;  3S2V A;  2RIN A;  3M3F A;  1IIT A;  2Z8F A;  3GXA A;  4H5F A;  2XXI A;  1DSN A;  3K6V A;  1GV8 A;  4DZ1 A;  1PBQ A;  1FTK A;  1DTG A;  2G93 A;  2IA4 A;  1LFH A;  2V3U A;  4IO7 A;  3LSX A;  3U93 A;  3UN6 A;  3P7I A;  3S9L C;  4G68 C;  3HV1 A;  2XXQ A;  3BFT A;  3MPL A;  3HPI A;  3C9H A;  4AQ4 A;  4AB5 A;  3UIF A;  1H45 A;  4MFI A;  4YKI A;  2HCA A;  1B3E A;  4RA1 A;  3KSX A;  3O9P A;  5A5X B;  1Y20 A;  2QPQ A;  3VXC A;  2I4C A;  2O68 A;  1IIW A;  4G68 B;  3A3U A;  1P1Q A;  4QFK A;  1OLC A;  1XT8 A;  2UYF A;  3TTR A;  3M8U A;  1ZBM A;  3PMV A;  4YU0 A;  2DVZ A;  1UIU A;  3IOV A;  2ZXT A;  4IO4 A;  2XX9 A;  1DMB A;  2Z23 A;  1B3G A;  3PPP A;  5I2N B;  4RK9 A;  1M5E A;  3K6W A;  1YPN A;  1Y3Q A;  4DDD A;  2A5S A;  4N07 A;  3LBS A;  1A55 A;  4ISU A;  5HPQ A;  4C1T A;  4GFR A;  1UTH A;  3M3K A;  1FTM A;  2H99 A;  4KCD A;  4EXL A;  4KYE A;  1ELJ A;  1MH3 A;  3IOT A;  3N94 A;  3QAX A;  2O7U A;  3IR1 A;  3HST A;  4TQU Q;  3KG2 A;  2P2A A;  1PB8 A;  1FTJ A;  4M4G A;  2P0S A;  3FJG A;  5JTY A;  3EQ1 A;  1KWH A;  2FYI A;  3USD A;  1SW2 A;  3TQL A;  1PC3 A;  3FZV A;  3T9U A;  4RNS A;  4F29 A;  3FV1 A;  1I6Q A;  2X7Q A;  3TDJ A;  4U4X A;  2GH9 A;  2DWH A;  3GBA A;  2RCA A;  4IGR A;  3GZG A;  1P1U A;  2Y7P A;  3GBB A;  4F1Y A;  5AA3 A;  3KOT A;  4G2Z A;  4N13 A;  1UTH B;  2H98 A;  3SER A;  1FQD A;  3MP8 A;  3IL1 B;  1US5 A;  3H3G A;  2ZYK A;  3V5A A;  1A54 A;  4Z0I A;  3G7W A;  3KFM A;  3C36 A;  4NTL A;  1WDN A;  2NOO A;  1MQD A;  3M3L A;  3UGW A;  4HTG A;  3RY3 A;  4P0I A;  3OEK A;  4F19 A;  5KDT A;  3IJX B;  2R9J A;  1QUJ A;  4PFU A;  1N7X A;  2PX1 A;  1B0H A;  5JTY B;  2DYX A;  1LAH E;  4EQ7 A;  2F7B A;  4PQJ A;  2GHB A;  4R6H A;  1QVS A;  1LCF A;  4YAH X;  3JYR A;  3MP1 A;  4E0W A;  1SQY A;  1MRP A;  2O1L A;  3SKP A;  4GWO A;  2F6P A;  4WXJ A;  1USY E;  5I57 A;  4ESX A;  1HSL A;  3FVN A;  3TUS A;  2Y7K A;  1SDX A;  3CG1 A;  3CVG A;  3MJN A;  5AA4 A;  1IXH A;  1FCK A;  4G77 A;  1IXI A;  5HM4 B;  5CI5 A;  1URD A;  1Z7N E;  2VOZ A;  5B7D A;  2I0B A;  3HN0 A;  3CFL A;  1LBB A;  4MBP A;  2DE3 A;  5CMB A;  2DXR A;  4U23 A;  2E1S A;  2PT1 A;  3LUY A;  4GXS B;  2G29 A;  5KDT B;  1MY4 A;  4ECF A;  4XTC Q;  4NWD A;  5F7V A;  3N5L A;  4YKK A;  3PUY E;  5AA2 D;  1B0L A;  3OO7 A;  2F97 A;  3VVE A;  3Q25 A;  4MLQ A;  4ZS9 A;  3PMX A;  3R7X A;  1QKA A;  1R9L A;  5I57 B;  1PB9 A;  1QUL A;  3IB1 A;  4U1O A;  3E13 X;  1N7W A;  4H67 A;  4K3F A;  3VDF A;  4NWC A;  4LVQ A;  5AA4 B;  2F5X A;  3RT8 A;  2I49 A;  2Y7W A;  4H65 A;  5CC2 A;  5I84 A;  1YCJ A;  4GOT A;  1QW0 A;  5ISU A;  3CRB A;  3FUZ A;  4BDN A;  4L17 A;  4ZZA A;  3IO6 A;  3EHT A;  2HAV A;  3PUV E;  4M1V A;  1NH8 A;  5H8H A;  4TLM B;  3B6W A;  3U1O A;  1QKB A;  4JB7 A;  1S7Y A;  1QUI A;  3ILU B;  3OO9 A;  3QYT A;  4GF8 A;  1FTO A;  3K6X A;  1EH3 A;  1R9Q A;  3KSJ A;  3QUF A;  4BLA A;  1EZO A;  1RKM A;  2HZK A;  3Q29 A;  4OEV A;  4P0G A;  3IB2 A;  2F36 A;  3OEN A;  4BDO A;  1MM6 A;  5AA1 A;  2F78 A;  3ZSF A;  4R2F A;  3MVX A;  4OZ9 A;  1B5H A;  3KJ7 A;  3SEV A;  5ITP A;  1A99 A;  5ICT A;  4FIM A;  3FIR A;  1B51 A;  2I48 A;  3PPR A;  5AA2 A;  4C0R A;  3ECR A;  2F7C A;  2O7I A;  2ZNU A;  5ELV A;  3S4U A;  5TPA A;  3EHU A;  4NF4 A;  5H8H B;  3A3C A;  2RF1 A;  2UXA A;  3QUJ A;  4TOZ A;  3WAF A;  2ZYM A;  4FEC A;  2DS9 A;  4OVJ A;  1B58 A;  1M5D A;  4H6D A;  3F11 A;  2QL3 A;  2H4I A;  1UQW A;  2OWS A;  2F6G A;  5DTB A;  3VVF A;  3G3F A;  3KOS A;  1JVY A;  2PBW A;  3W9V A;  5KZT A;  1ZU0 A;  2GRV A;  3E9X A;  5L8D A;  2RCB A;  4ELP A;  3FAS A;  4X48 A;  3G3K A;  1NNF A;  2ANJ A;  2D3I A;  2CMO A;  1A7L A;  2I3W A;  3KN7 A;  4F3P A;  1VFD A;  4JBZ A;  5CMC A;  2O1M A;  2AL4 A;  3RT6 B;  4JWX A;  1RYX A;  1ZTY A;  3FGS A;  3MZ1 A;  4BDM A;  2YPN A;  1UTB A;  4LON B;  2B3B A;  4I8C A;  1II5 A;  2XXR A;  3TPA A;  1MH4 A;  3VE1 B;  2Z8D A;  5DYH A;  3T66 A;  4ZDM A;  5TPA B;  4DXU A;  4NF4 B;  2KLF A;  1ANF A;  1PBP A;  1GR2 A;  4F3S A;  4F2Q A;  1F9B A;  1GGG A;  2QS3 A;  2E0S A;  1IEJ A;  2I58 A;  3WAE A;  5EHS A;  3T22 A;  2ZMB A;  3TTM A;  3B7D A;  2Q2A A;  1XHY A;  3RUM A;  1OMP A;  1LAG E;  4MF3 A;  2RC9 A;  4OER A;  1HSJ A;  1P1O A;  3HHF A;  1WOD A;  4LAT A;  5DT6 A;  3QXM A;  4XKN A;  4R2B A;  2WKY A;  2F7A A;  4POW A;  4GL0 A;  3OSR A;  3IOW A;  3GLB A;  2FA7 A;  4YB6 A;  4P11 A;  3SET A;  3KN3 A;  4JDF A;  2XXX A;  3U92 A;  1UTB B;  2DP8 A;  3TKD A;  4FED A;  3A09 A;  5I2K A;  4IO5 A;  1MDP 1;  4GD5 A;  2Q9T A;  1I6A A;  2V25 A;  1OIB A;  3O66 A;  4IY5 A;  3HHG A;  4ELO A;  1XVY A;  4PET A;  1S50 A;  3SES A;  1D9Y A;  3C4M A;  3ONM A;  2DWI A;  4X9T A;  1PDA A;  3RTW B;  4F39 A;  4XIG Q;  4QF9 A;  3TMG A;  3RLF E;  5LOM A;  1US4 A;  4Q0C A;  2XX7 A;  5ICQ A;  4XKP A;  3K4U A;  3H06 B;  4ZEI A;  5DVF A;  4Q30 B;  1GTK A;  3PUW E;  3RNN A;  4LZ7 A;  3DEL B;  3CG3 A;  2AIX A;  4ZED A;  1T0K A;  2DXY A;  3CI8 A;  2DWA A;  3HCQ A;  3MVW A;  2HXW A;  2H9B A;  1SW5 A;  4G8N A;  5I2K B;  3TZA A;  5ITO A;  3SEU A;  1TXF A;  1QJM A;  1B3F A;  1IQ7 A;  4FAT A;  2IEE A;  4H8I A;  1OVB A;  1I6B A;  4OEN A;  4U4S A;  5H8S A;  4XKQ A;  2A5T A;  1DPP A;  3TEL A;  3OSQ A;  4MH5 A;  4KD5 A;  2UVG A;  3U94 A;  1URS A;  1DOT A;  2HZL A;  4C1U A;  4IGT A;  3G3J A;  4OFJ A;  2UVJ A;  3W15 C;  3THI A;  1CB6 A;  3K1M A;  2I6E A;  5CBS A;  1USY H;  4O3B A;  3G3G A;  4ONY A;  3VLU A;  2X26 A;  3VFJ A;  4KFQ A;  2R71 A;  1XVX A;  4ZEK A;  3CIJ A;  3MAM A;  4ZEB A;  4DCX A;  4G8H A;  2NUV A;  3IK6 B;  4GXA A;  4R72 A;  2VP1 A;  1ZKB A;  1XC1 A;  2RKM A;  3DM0 A;  3MZB A;  4KQP A;  4LZ5 A;  4X1B A;  1EU8 A;  1VE4 A;  4DXB A;  2Y7R A;  3IX1 A;  1O63 A;  4LUB A;  3I5O A;  3KN8 A;  4OTE A;  4F2O A;  1VSO A;  2OJT A;  4AB6 A;  5EYF A;  2A5T B;  1GVC A;  4YKP A;  2XXV A;  4NF6 A;  1Y4C A;  1A8E A;  3K00 A;  2V93 A;  3EN3 A;  3UA8 A;  5B70 A;  4O3A A;  3PD9 A;  4KPT A;  1B3L A;  4YMB A;  3CFX A;  3TFL A;  5BWJ A;  4I1D A;  1ATG A;  1FQF A;  1IXG A;  1LAF E;  1SI0 A;  1XS5 A;  3VXB A;  2RC7 A;  1Y3P A;  5H8F B;  4BDL A;  1B5J A;  4ZEC A;  4WKM A;  4JWY A;  5L9O A;  4FOR A;  4IO6 A;  4U1Z A;  1POT A;  5CMM A;  5HBC A;  3V89 B;  3KZG A;  3FD3 A;  2XXP A;  4G8M A;  3PV0 E;  3FVK A;  1CE2 A;  5KCJ A;  2X7P A;  2LAO A;  4U2R A;  4WED A;  4RYA A;  4NF6 B;  1XOC A;  5TU0 A;  2OZZ A;  2DOJ A;  3JV9 A;  4YKJ A;  1AIV A;  2VD3 A;  1MXV A;  3KGC A;  2DE2 A;  4HS7 A;  3IOR A;  1D3K A;  4OMB A;  3MP6 A;  5H8N A;  5FTI A;  5DVJ A;  3B6T A;  1LLS A;  3TAJ A;  2B65 A;  2VD2 A;  1EZP A;  5M2V A;  5L9M A;  2FNC A;  3VVD A;  3FAT A;  2NWJ A;  2QS2 A;  1QUK A;  4PFT A;  4RPN A;  3RGY A;  3BFU A;  4QSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...