4RK2A

Crystal structure of sugar transporter rhe_pf00321 from rhizobium etli, target efi-510806, an open conformation
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
393
structure length
393
Chain Sequence
b'AVTLKWALWDWDKTAYYKPLIEAYQAKHPNVKFEPMDLGSQDYQQMISTQLTGGSKDIDIVTIKDVPGYTNLVRAGNIADLSGFVKDQKIDPAPYGGLIEELTIDGKIYSLPFRSDFWIVYYNKDIFDKAGVPYPTNDMTWAQFDETAEKLAGGMGTNKTYGALLHTWRSTVQLPGILDGKHTLVDGDYAFLKPWYERALTLQKDGAIPSYAFLKTSNTHYSALFFNGTIGMLPMGTWFVGTQIAKVKSGESKSKNWGIVKFPHPDGVPAGTTAAQISGLAVNSNSQHKDAALDFIKFVAGPEGAAVVAATGTFPALKTADVSAKIASTPGFPQDEASKEALIPAKAYLEMAVNPNAAKIEVVLNRAHDAIMTDNTSVDDGLKEMTEGVKAIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative sugar ABC transporter, substrate-binding protein
publication title Crystal Structure of Sugar Transporter RHE_Pf00321 from Rhizobium Etli, Target EFI-510806
rcsb
source organism Rhizobium etli
molecule tags Transport protein
total genus 138
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4rk2A00
3HCQA 3GBBA 3FATA 2D21A 4R73A 2Q2CA 4DLDA 1XOCA 3UA8A 1VFEA 1EZOA 4OXVA 2H9BA 3U8QA 4KI0E 3KEIA 4ZS9A 1XHYA 3TTRA 3T9HB 3EN3A 2XXQA 4ISUA 3C33A 1FTJA 1HSEA 3TTKA 5I84A 2Z8EA 2Q2AA 1JETA 4MLQA 3K00A 4LQ2A 4F1YA 3O29A 4KPTA 4RPNA 1NL5A 3SEUA 2F34A 4FE8A 3H6TA 3K6WA 1SW2A 2O51A 4POWA 2F5XA 5DTBA 4IGTA 2Z23A 1M5FA 1OLCA 2OCUA 3OENA 4KYSA 5HBCA 1DMBA 3SEVA 1JW1A 4OESA 2VP1A 3LSWA 1PBQA 2QSXA 3DLNA 2QPQA 1WDNA 1S7YA 3DP8A 4LUBA 3TEPA 5JEIA 3RGYA 1I6BA 4IO4A 2OLBA 3VVFA 1QKBA 1MRPA 3K02A 2FYIA 3KJ7A 1LB9A 3O9PA 3KZGA 3R7XA 4KFQA 4QFOA 4ESXA 4GXSB 4TQUQ 1BIYA 1MXWA 2OWTA 4BLAA 3T9VA 2PVUA 3KGCA 3IAZA 5FHOA 3B6TA 1MY1A 1JEVA 3N6UA 3A09A 2AL4A 2UVGA 5JK4A 3MUQA 1BP5A 4IO3A 2D3IA 3GZGA 4ELQA 4YICA 1UIVA 1AMFA 5FHMA 2HAVA 1OVBA 1BTJA 2DP8A 3Q27A 1MM6A 3G3GA 3IL1B 4POXA 3JZJA 1A8FA 2DOJA 4FECA 5CI5A 3H6UA 4L17A 4ZE9A 4F3PA 4U1OA 2UVIA 4H5GA 3OSRA 4JBZA 1EU8A 4EF1A 4P11A 4G68C 3N6TA 3E9XA 3VFJA 1DSNA 5I56B 4TLMB 1B3EA 3I6VA 1MY4A 1B3GA 1LFIA 3IR1A 4RYAA 3ILUB 3FGSA 2V3TA 3VDFA 1P99A 4G2ZA 2I4BA 1RKMA 3PU5A 1N3XA 3N94A 4ELRA 1RYOA 1MDQA 1IXGA 1UIUA 3OELA 3TQLA 2P1SA 2PYYA 3S9MC 3VXCA 3V5AA 3TZAA 5K2XA 4DZ1A 2DYXA 1B3LA 1POY1 3PD9A 3O2AA 4GL0A 4I1DA 3WAEA 1LCTA 4OMBA 1N76A 4MFIA 3FXRA 4G8NA 1MY3A 3KN3A 3S4UA 2W7YA 3FVGA 3H6WA 3KJTA 3LSFB 2V25A 4ZEFA 3MZ1A 1SW5A 4FIMA 5IAIA 1TFAA 4YB7A 3L6GA 2XXUA 4NWCA 4NF8B 4PQJA 1MQDA 1JVYA 1R9QA 3CG3A 2ONRA 1FQFA 3DELB 3IOWA 2A5TB 5KDTB 5F7VA 4U21A 4KYDA 5I56A 4KQPA 2G29A 1P1UA 4OYVA 3WAFA 4HW8A 1B5IA 1JEUA 1VR5A 4NE4A 3TPAA 2XXWA 2Y7RA 2BJJX 5IKBA 4HS7A 4F1UA 4YKPA 5K2YA 1H43A 3PUYE 3TQWA 4KHZE 2V3QA 1B4HA 4UACA 3CR9A 3E3KA 2RC8A 1FTMA 3PUWE 4F3BA 2F7CA 1NMUA 3QAXA 4BDLA 1SW4A 3VV5A 5ISUA 1B0HA 2Q88A 4ZE8A 3KFMA 4HCWA 1OIBA 4X1DA 2B3BA 4ONYA 3KG2A 1T0KA 1Y4CA 4UA8A 4WEDA 3O28A 4ZZAA 4F1VA 1UQWA 5TPAB 3IOTA 4QSEA 2ZNSA 4U22A 3PUZE 5H8HB 4NF8A 3PMWA 3QSLA 3BFTA 4MF3A 1Y3NA 2NOOA 2GRVA 1M5DA 3QUJA 4YKIA 3N26A 3IO4A 3ZKKA 1TFDA 4DXBA 2A5TA 1A8EA 5KDTA 2Z8FA 1HSJA 3KOSA 1QULA 2O1LA 2RCBA 3PPRA 4ND9A 1URGA 1MPDA 1DTGA 1ZIUA 4BDNA 1LLSA 2GH9A 5FTHA 3MVXA 4GFRA 1BLFA 3HHGA 2RCAA 2E1SA 2QS4A 3G3IA 5AA2D 1FTKA 1ZU0A 4YKKA 1FTLA 2DS9A 1A54A 3Q26A 4JB7A 1N0TA 4G68B 2O69A 3FZVA 4ZECA 5EHSA 1QUJA 2OWSA 3TCGA 1D4NA 2HEUA 3TODA 4FEBA 3MPKA 1B3HA 5M2VA 3LUYA 4OTEA 3RQTA 2GHBA 1LAXA 3FJGA 2V93A 3HN0A 3P7IA 3ODBA 1OVTA 2A5SA 2OJTA 4YMBA 3EHTA 2AL5A 1FTOA 3E13X 4U4XA 3EF7A 1PDAA 1B58A 3OEMA 3C4MA 5TPAA 5KZTA 3OEKA 4BDQA 3O6IA 2Y84A 5H8HA 2NXOA 3VXBA 4XKNA 1FQAA 2IA4A 1PB9A 4ZEDA 3RLFE 1PEBA 3OO7A 4ELPA 1FCKA 4XXUA 4ECFA 1OQGA 1NNFA 2F36A 1UTBB 1LAHE 4IY6A 3CFZA 2X7PA 3Q29A 3T66A 2Z8DA 4C1UA 4MBPA 4KR5A 4GL8A 3H6VA 5BWJA 2F8DA 4YU0A 3H3GA 3RT8A 4NEDA 4EXLA 4QFLA 2P0SA 2P2AA 4G68A 5L9SA 2XX9A 2ALUA 1H44A 4C0RA 2Q9TA 4Q30B 2ONKE 3QYTA 1MQIA 2NVUB 4EQBA 1SYHA 4N6PA 1B7HA 2WKYA 2XXVA 4GOTA 3OD7A 5DEXB 2XXTA 3OO9A 4OFLA 1NNTA 1LAFE 4F18A 4I62A 4IO6A 5TU0A 2FNCA 3FVNA 3PPPA 1MXVA 1ZMGA 3FJMA 2ZYNA 2DWIA 5CMBA 3FV2A 4RPOA 3TUSA 4OENA 3FVOA 3U1OA 1I69A 3ZSFA 2XX8A 4Z0IA 1NFTA 4HTGA 3PPNA 3GXAA 4C1TA 4LA9A 5H8SA 2F6PA 4O3BA 2XXRA 2DE4A 3C32A 5I2NB 4MLVA 1UTBA 1VE4A 1B6HA 2I0BA 5AE4A 4R6KA 4FEDA 1DTZA 2H99A 2YPNA 4EDPA 4RXLA 1TXFA 4BDMA 2DSFA 2DVZA 4OZ9A 1B40A 4PFWA 1VFDA 2PBWA 3D4GA 3LR1A 1MS7A 2Z22A 5ICQA 2F7AA 4F39A 4R2FA 1Q35A 3IORA 3TYHA 5H8QB 4QSCA 3UN6A 2DXRA 3FXQA 1ANFA 3U93A 2ABHA 2CMOA 2I48A 4GLIA 2HFBA 1H3DA 2F78A 3RN8A 4ZDMA 1B7ZA 3VE1B 5EYFA 1A55A 4H1XA 4U23A 4RJZA 4XIGQ 3C34A 5DEXA 5FTIA 4JSOA 4ZEBA 2ONSA 4IO2A 2ZNTA 4N07A 4OETA 4EF2A 3TTNA 4F22A 2XHDA 3R6UA 1II5A 1Y20A 3QUFA 4Q5TA 1POTA 4GIZA 2E0SA 2ZYOA 4O3CA 4Z7EA 1YPNA 1OLAA 1XT8A 1JW4A 4WEPA 2Q89A 3H03A 1LCFA 1CE2A 2XXYA 3MVZA 3W9VA 2UVJA 5JTYB 3CIJA 1US5A 1MPBA 4FJPA 5I2NA 1XVYA 5A5XB 1FQBA 3MP1A 5ITOA 4GQOA 2H4IA 4F29A 1M5EA 2I6EA 4OVJA 4F3GA 1JVXA 1FQDA 1SD3A 3ZS6A 3KOTA 3S2VA 3B7DA 5B70A 5H8FB 3M3KA 4OERA 5I2KB 3OMBA 5ELVA 5H8QA 4JDFA 3FIRA 3MWBA 2LAOA 3T93B 1NH8A 2F35A 3A3CA 3U94A 1QUIA 3RTFB 5DYHA 2Y7PA 2UXAA 1ZLQA 5HPQA 3KN7A 1ELJA 4H6DA 1P1QA 2DWAA 1LBBA 5CM6A 1JW5A 3OSQA 3OO8A 3QXMA 1B52A 4KCCA 3RY3A 4JWOA 4GWOA 1XC1A 4KYEA 1FQEA 2UVHA 1MQGA 3FXUA 1XS5A 1NNKA 2REJA 2XXHA 3IB2A 3PUVE 3V83A 1URDA 4H8IA 4I8CA 1USYH 3OOAA 4I9DA 5CRYA 5JTYA 1MXXA 2OBGA 3M3FA 3FVKA 1SI1A 1JNFA 2B65A 1Y3QA 1JQFA 3JV9A 5H8NB 3TKDA 5A5XA 1IXIA 3O6GA 3VLVA 2XX7A 4LZ7A 2PT2A 5ITPA 3IK6B 1KWHA 1DPEA 3FUZA 3IO6A 3O6HA 5AA3A 1GTKA 1LSTA 1A99A 1UTHB 4R74A 3B6QA 5H8FA 5I2KA 1ATGA 1URSA 1B32A 4H65A 3PUXE 1IIWA 3HPIA 4PFUA 4Q0CA 5I58B 2DXYA 5CMKA 2I3WA 3CFXA 2AIXA 1SYIA 4GVOA 4G4PA 3H4ZA 2THIA 4EQ9A 2DWHA 1R1NA 2O84X 1MXUA 2B3FA 1Y1ZA 2RINA 3M3LA 4R9FA 3C9HA 3IOUA 4X1BA 3L6HA 3G3KA 1P1OA 1B1HA 2XD2A 3KSJA 4JWYA 5FHNA 3CRBA 5CMMA 2O68A 2ANJA 3K6UA 3EHSA 3TTLA 1FW0A 3CVGA 1J1NA 5HM4B 3MAMA 1D3KA 2ZYMA 5ICTA 4Q8RA 4ZEKA 1AIVA 1MQHA 4RY1A 2HZLA 4QFPA 3DM0A 4FAJA 1MH4A 3TTMA 2H25A 5H8NA 2NUVA 3O66A 2I58A 2DE3A 3SDFA 2O1MA 2RF1A 4XKQA 2HZKA 4IY5A 2DWJA 5DVJA 3HSTA 1BKAA 4OWDA 4P0IA 3VLUA 2G93A 1F9BA 1UTHA 2X26A 1B46A 3V89B 4WKMA 4GD5A 3CFLA 4LATA 5L9MA 3SKPA 4EXKA 2QJEA 4TLLB 1IUDA 1WODA 4PFYA 5I58A 2Y7KA 1M5CA 4G8MA 5BUUA 3UORA 2O6AA 4U1ZA 1B7UA 3MPLA 1R9LA 3EPEA 1IITA 1Y9UA 4ELOA 1Y4TA 1I6AA 1ZJLA 3S9EA 4BDOA 1PB7A 4PETA 3UP9A 3D4CA 1B5HA 1WVJA 3T22A 2NWJA 3VVDA 1N04A 1EH3A 4F2QA 3VLWA 4OEUA 2YLNA 1GVCA 2QMXA 1SDXA 2QRYA 3PD8A 4RK2A 3MZ9A 2XXPA 1MG1A 1MXZA 5I59B 3G3FA 2DQVA 3IJOB 4M4GA 1NKXA 2Y7IA 3S9NC 4QSDA 1EZ9A 1A40A 3UK4A 3H06B 4IO5A 4LP2B 4TOZA 5DT6A 2ZNUA 3K0VA 2R9JA 1I6QA 2XXIA 4XKPA 2R71A 3ZKLA 5I57B 3DP6A 2PT1A 3OXNA 3MP6A 1VSOA 2RKMA 3F11A 1B2HA 1DPPA 4YB5A 2XD3A 3HV1A 3IB1A 3M8UA 5L9OA 4YB6A 5LOMA 3H7MA 3G3HA 2HQ0A 3KSXA 1TT1A 5CMCA 1QKAA 3KBRA 1ZBMA 2VHAA 5TP9B 3N5LA 1TWYA 5KCJB 3UGWA 2I49A 1B0LA 3PV0E 4H67A 4P0GA 3MQ9A 4KCDA 4H5FA 3USDA 2QL3A 1D9VA 4RNSA 1YCJA 4G77A 1MY2A 1B5JA 2YJPA 1SBPA 4PFTA 1FQCA 1A7LA 1O64A 4LVQA 1Z7NE 1USYE 1HSLA 1PB8A 4R75A 4YZZA 1N7WA 5I59A 3MVYA 3W15C 3IOVA 2FA7A 2I4CA 3PPOA 3IX1A 2DE2A 1O7TA 2H5YA 5AA1A 4EQ7A 3K2DA 2O7UA 1S9TA 3OO6A 5CBRA 4EUOA 3PMXA 4R6YA 4R72A 4NF6B 5AA2B 1MQJA 3T9XB 2R6GE 4DE8A 3QK6A 4DDDA 3MW0A 1ZKBA 5I57A 4M1VA 2VOZA 4G8HA 4MH5A 4YAHX 5F1QA 2VD3A 3RPWA 2UYEA 3SEXA 1GR2A 1B9JA 3MC2A 1SVXB 1LFGA 2X7QA 5TP9A 4YKJA 3C31A 4PE5B 4R9GA 2I3VA 5KCJA 2ZMBA 3IB0A 1B3FA 1MXYA 4F3SA 1IZ1A 3LSXA 1AH5A 2VGQA 3CSBA 1SQYA 1EZPA 4DXCA 4HCYA 2F97A 4AB6A 4AQ4A 1B05A 2VD2A 1RYXA 3K1PA 1YTVA 4IB2A 1PC3A 1L5TA 2ESNA 1P1NA 2IEEA 3TCHA 2REGA 4LONB 1IXCA 4NF5B 3IJXB 3MP8A 3O97A 3G7WA 4F19A 4FATA 1GGGA 1B1XA 4WXJA 3BFUA 1MDP1 4H0WA 3RUMA 1Q1KA 3THIA 3PGFA 2QS2A 3HHFA 3SERA 2HXWA 1QJMA 1LAGE 4X48A 3R26A 1DOTA 3K01A 1IEJA 1YAEA 4NF6A 5AA2A 4OFJA 3VVEA 3EHUA 1SW1A 3S9LC 3KN8A 3MZBA 1PBPA 5J1DA 3K1MA 2PX1A 4R6HA 1N3WA 4H8JA 4BDRA 3G3JA 2ZXTA 2PMSA 4NWDA 3SETA 1MH3A 2KLFA 2D5WA 1AL3A 3C35A 1Y3PA 1NNPA 3LBSA 3HO7A 2M8CA 3AXFA 3RTWB 1OMPA 4LZ8A 1NH7A 4O3AA 2QS3A 3FJ7A 2OK2A 4QF9A 2I0CA 5DVFA 3U92A 3FV1A 4GXAA 4N13A 3RNNA 1M5BA 1SI0A 1QUKA 2DVCA 5B7DA 1CB6A 1QW0A 2GFEA 4U4SA 4ZZEA 5L8DA 4NF4B 4ZEIA 2GHAA 3BBRA 2CZLA 3RT6B 4THIA 2Q8JA 3UIFA 4NMYA 3I5OA 1GV8A 3TELA 3TFLA 2QMWA 4U2RA 4NF5A 2F7BA 3C36A 1N7XA 3W9WA 4NTLA 4GF8A 1OQHA 1AOVA 1S50A 2XXXA 3U72A 3MJNA 3Q28A 1ZTYA 3LSLA 1H76A 3T9UA 4OHNA 4RK9A 4OFOA 4F2OA 3PMVA 3JYRA 3TCFA 2V3UA 3FD3A 3MBPA 4QFNA 5AA4B 4QHQA 3ONMA 4YMAA 3K6XA 1P1WA 3BKIB 4GRKA 4E0XA 3PPQA 2F6GA 4IO7A 3SEYA 5CBSA 2QS1A 1MM7A 2V84A 3TAJA 1LBCA 4QFKA 4DCYA 1H45A 1O63A 1LGBC 2H98A 3V8XB 4LZ5A 4DCXA 3K4UA 3CSGA 4QRZA 1US4A 1N84A 1MPCA 1Z7ME 1QVSA 5CC2A 1IQ7A 4OQOA 3T96B 4JSDA 3GLBA 3DP4A 3K1NA 4XTCQ 2HAUA 4R2BA 4KD5A 1Y1MA 2UYFA 3Q25A 4F31B 2O7IA 3CI8A 4ESWA 3ILTB 4PP0A 3CG1A 3QIMA 2Y7WA 1R6ZA 1B4ZA 1D9YA 4X9TA 1XVXA 4XKRA 1LFHA 4DIGA 2OZZA 2HCAA 4LQ5A 4IGRA 4NF4A 3A3UA 3ECRA 3SEWA 2RC7A 4OEVA 1IXHA 4JXIA 3FASA 3TMGA 2ZYKA 5EHMA 4AB5A 1MY0A 3SESA 3K6VA 4K3FA 3TDJA 1B51A 3MVWA 4FORA 5DVIA 3EQ1A 2RC9A 3GBAA 2AYSA 4E0WA 5AA4A 4DXUA 1LB8A 3B6WA 4RA1A 3I3VA 3E4RA 3LC8A 4JWXA
chains in the Genus database with same CATH superfamily
3HCQA 3GBBA 5EQ8A 3FATA 2D21A 1LEVA 4R73A 2Q2CA 4DLDA 4PGPA 1XOCA 3UA8A 1VFEA 1EZOA 4OXVA 2H9BA 3U8QA 4MAGA 4KI0E 3KEIA 4ZS9A 5A5LA 1XHYA 3TTRA 3B50A 4O8MA 3T9HB 1FBGA 3EN3A 2XXQA 4ISUA 1FBPA 3C33A 1FTJA 1HSEA 3TTKA 5I84A 1IMAA 2Z8EA 2F3BA 2Q2AA 1JETA 4MLQA 3K00A 1KA1A 4LQ2A 4F1YA 3O29A 3E79A 4KPTA 4RPNA 1NL5A 3SEUA 2F34A 3SZPA 4FE8A 2QVVA 3H6TA 3K6WA 1SW2A 2O51A 4POWA 2F5XA 3RPLA 5DTBA 4IGTA 2Z23A 1M5FA 1OLCA 2OCUA 3OENA 4KYSA 5HBCA 1DMBA 3SEVA 1JW1A 4OESA 3BIHA 2VP1A 3LSWA 1NV4A 4PBHA 1PBQA 2QSXA 3DLNA 2QPQA 1WDNA 1S7YA 3IFCA 3DP8A 4LUBA 2Y5LA 4OANA 3TEPA 2GQ1A 5JEIA 3RGYA 1I6BA 4IO4A 2OLBA 3VVFA 1QKBA 1MRPA 3K02A 2FYIA 2Q8MA 3KJ7A 4JVIA 1LB9A 3O9PA 2KR0A 2CZKA 3KZGA 3R7XA 4KFQA 1DK4A 4QFOA 4ESXA 4GXSB 4TQUQ 1BIYA 1MXWA 2OWTA 4P9KA 4BLAA 1G0IA 3T9VA 2PVUA 3KGCA 3IAZA 2JJKA 3B6TA 5FHOA 1MY1A 1FPGA 1JEVA 1VDWA 3N6UA 3A09A 1RDZA 2AL4A 2UVGA 5JK4A 3MUQA 1BP5A 4IO3A 2D3IA 1QGXA 3GZGA 4ELQA 4YICA 1UIVA 1AMFA 5FHMA 2HAVA 1OVBA 1BTJA 2DP8A 4NX1A 3Q27A 1MM6A 3G3GA 3IL1B 4POXA 3JZJA 1A8FA 2DOJA 4FECA 5CI5A 3H6UA 4L17A 4ZE9A 4F3PA 4U1OA 2UVIA 4H5GA 3OSRA 4JBZA 3T1BA 1EU8A 4EF1A 4P11A 4G68C 3N6TA 3E9XA 3VFJA 1DSNA 5I56B 4TLMB 1B3EA 3I6VA 1MY4A 1B3GA 4HE0A 1LFIA 3IR1A 4RYAA 3ILUB 3FGSA 3PTYA 2V3TA 3VDFA 2XWVA 1P99A 2XXKA 4G2ZA 4PFBA 2I4BA 2MKZA 1RKMA 3PU5A 1N3XA 4MIJA 3N94A 4ELRA 1RYOA 1MDQA 1IXGA 1UIUA 4I40A 3OELA 3TQLA 2P1SA 2PYYA 3S9MC 3VXCA 3V5AA 3TZAA 5K2XA 4DZ1A 2DYXA 1B3LA 1POY1 3PD9A 3O2AA 4N8GA 4GL0A 4MEVA 4I1DA 3WAEA 1IMDA 1LCTA 4OMBA 1N76A 5IZ3B 4MFIA 3FXRA 4G8NA 1MY3A 3KN3A 3S4UA 2W7YA 3FVGA 3H6WA 3KJTA 1BK4A 3LSFB 4PF8A 2V25A 4ZEFA 1NV5A 3MZ1A 1SW5A 4FIMA 5IAIA 1TFAA 4YB7A 3MSTA 4PFRA 1FBFA 3L6GA 2XXUA 5ESYA 4NWCA 4NF8B 4PQJA 1YXIA 5EQ9A 1MQDA 1JVYA 1R9QA 3CG3A 2ONRA 4GX4A 1FQFA 3DELB 3IOWA 2A5TB 5IZ1A 5KDTB 5F7VA 4U21A 4KYDA 5I56A 4JVCA 4KQPA 2G29A 1P1UA 4OYVA 3WAFA 4HW8A 1B5IA 1JEUA 4DI4B 1VR5A 4NG7A 3KC1A 4NE4A 3TPAA 2XXWA 2Y7RA 2BJJX 4MCOA 5IKBA 4HS7A 4F1UA 1FJ6A 1IMFA 4PF6A 4YKPA 5K2YA 1H43A 3PUYE 3TQWA 4X04A 4KHZE 2V3QA 1B4HA 4UACA 3CR9A 3E3KA 2RC8A 1FTMA 3PUWE 4F3BA 2F7CA 1NMUA 5EYGA 3QAXA 4BDLA 1SW4A 3VV5A 5ISUA 5IZ3A 4JVDA 1B0HA 2Q88A 4ZE8A 3KFMA 4HCWA 1OIBA 4X1DA 4OVQA 2B3BA 3LV0A 5EYHA 4ONYA 3KG2A 1T0KA 1Y4CA 3QMFA 1IMCA 1FJ9A 4UA8A 4WEDA 2HXRA 4PAFA 3O28A 4ZZAA 4F1VA 1UQWA 5TPAB 3IOTA 4QSEA 2ZNSA 4U22A 3PUZE 4PC9A 5H8HB 4NF8A 3PMWA 3QSLA 5IM2A 3BFTA 4MF3A 1Y3NA 2NOOA 2GRVA 1M5DA 3QUJA 4YKIA 1NV2A 3N26A 3IO4A 3ZKKA 4HE2A 1TFDA 4DXBA 2A5TA 1A8EA 5KDTA 2Z8FA 4O7MA 2OWZA 2PFYA 1HSJA 3KOSA 1QULA 2O1LA 2RCBA 3PPRA 1KZ8A 4ND9A 1URGA 1MPDA 1NV6A 1DTGA 1ZIUA 4BDNA 1LLSA 2GH9A 5FTHA 3MVXA 4GFRA 2HHMA 3HFUA 1BLFA 1FBCA 3HHGA 2RCAA 2E1SA 2QS4A 3G3IA 5AA2D 1FTKA 4OVTA 1ZU0A 4YKKA 4QBAA 1FTLA 4OA4A 2QVUA 2DS9A 1A54A 3Q26A 4JB7A 1N0TA 4G68B 2O69A 3FZVA 5EHSA 4ZECA 1QUJA 2OWSA 3TCGA 1D4NA 2P3VA 2HEUA 3TODA 4FEBA 2OX3A 3MPKA 1B3HA 4HE1A 5M2VA 3LUYA 4OTEA 3RQTA 1RDXA 2GHBA 1NI9A 1LAXA 1Q9DA 3FJGA 2V93A 3HN0A 3P7IA 3ODBA 4MNIA 1OVTA 2A5SA 2OJTA 4YMBA 3EHTA 2P3NA 2AL5A 1FTOA 2PFZA 3E13X 4U4XA 3EF7A 1PDAA 1B58A 3OEMA 3C4MA 5TPAA 3U65A 3OEKA 4BDQA 5KZTA 3O6IA 2Y84A 5H8HA 2NXOA 4XEQA 3VXBA 4XKNA 1FQAA 2IA4A 1PB9A 4NGUA 4ZEDA 3RLFE 4FBPA 1PEBA 3OO7A 4ELPA 1FCKA 4XXUA 4ECFA 1OQGA 1NNFA 2F36A 1UTBB 4G61A 1LAHE 4IY6A 3CFZA 2X7PA 1FBEA 3Q29A 3T66A 2Z8DA 4C1UA 1CNQA 4MBPA 4KR5A 4GL8A 3H6VA 5BWJA 2F8DA 4YU0A 1FTAA 3H3GA 3RT8A 4NEDA 4EXLA 4QFLA 5FBPA 2P0SA 4I3YA 2P2AA 3CHGA 3ISPA 4G68A 5L9SA 2XX9A 2ALUA 4P56A 1H44A 1FPLA 2Q9TA 4C0RA 4Q30B 2ONKE 3QYTA 4OVSA 1MQIA 2NVUB 4EQBA 4PAKA 1SYHA 4N6PA 1B7HA 2WBBA 2WKYA 2XXVA 4GOTA 3OD7A 5DEXB 2XXTA 3OO9A 4OFLA 1NNTA 1LAFE 4F18A 4I62A 4IO6A 5TU0A 2FNCA 3FVNA 3PPPA 1MXVA 1ZMGA 3FJMA 2ZYNA 2DWIA 5CMBA 3FV2A 5ET5A 4RPOA 3TUSA 4OENA 3FVOA 3U1OA 1I69A 3ZSFA 1EYIA 2XX8A 4Z0IA 1NFTA 4HTGA 3PPNA 3GXAA 5EQAA 1NUWA 4C1TA 4PCDA 4MJOA 4LA9A 5H8SA 1FPKA 2F6PA 4O3BA 2XXRA 2DE4A 3C32A 5I2NB 4MLVA 1UTBA 5I5PA 4XF5A 1VE4A 1B6HA 2I0BA 5AE4A 4R6KA 4FEDA 1DTZA 2H99A 2YPNA 4EDPA 4N91A 5T3JA 1LBWA 4RXLA 1TXFA 2CEXA 4BDMA 2DSFA 2DVZA 4OZ9A 1B40A 4PFWA 4N17A 1VFDA 2PBWA 3D4GA 3LR1A 1MS7A 2Z22A 5ICQA 2F7AA 4F39A 4R2FA 1Q35A 3IORA 3TYHA 5H8QB 4QSCA 3UN6A 2DXRA 3FXQA 1ANFA 3U93A 2ABHA 2CMOA 2I48A 4GLIA 4HXVA 2HFBA 1NV0A 1LBXA 1H3DA 2F78A 3RN8A 1DBZA 4ZDMA 1G0HA 1B7ZA 4AS5A 3VE1B 5EYFA 1LBZA 1A55A 4H1XA 4U23A 3T0JA 2VT5A 4N15A 4RJZA 4XIGQ 3C34A 5DEXA 5FTIA 1FPIA 4JSOA 1FRPA 4ZEBA 2ONSA 4AS4A 4IO2A 4MNCA 3MYUA 5EQ7A 2ZNTA 4N07A 4OETA 4EF2A 3TTNA 4F22A 2XHDA 2F3DA 3R6UA 1II5A 1Y20A 3QUFA 4Q5TA 1POTA 4GIZA 2E0SA 2ZYOA 4O3CA 4Z7EA 4NHBA 1K9ZA 1YPNA 1OLAA 1XT8A 1JW4A 4WEPA 2Q89A 2FIXA 3H03A 1LCFA 1CE2A 2XXYA 3MVZA 3W9VA 2UVJA 5JTYB 1FPBA 3CIJA 1US5A 1MPBA 4FJPA 5I2NA 1XVYA 5A5XB 1FQBA 3MP1A 4H45A 5ITOA 4GQOA 2H4IA 4F29A 3GYYA 1M5EA 2I6EA 4NAPA 4P47A 4OVJA 4O94A 4F3GA 1JVXA 1FQDA 4UABA 1SD3A 3ZS6A 5IGAA 3KOTA 3S2VA 3B7DA 5B70A 5H8FB 3M3KA 4OERA 5I2KB 4GBVA 3OMBA 5ELVA 5H8QA 4JDFA 3FIRA 3MWBA 3IFAA 4PDHA 2LAOA 3T93B 1NH8A 2F35A 3A3CA 3U94A 1QUIA 3RTFB 5DYHA 2Y7PA 2UXAA 1ZLQA 5HPQA 4OVRA 3KN7A 1FPFA 1ELJA 2FHYA 4H6DA 1P1QA 3A29A 2DWAA 1LBBA 5CM6A 1JW5A 2WEFA 3OSQA 3OO8A 3QXMA 1B52A 4KCCA 3RY3A 4JWOA 2FBPA 4OVPA 4GWOA 1XC1A 4KYEA 1FQEA 2UVHA 4NF0A 1MQGA 4IR8A 3FXUA 1XI6A 1XS5A 1NNKA 2REJA 2XXHA 3IB2A 3PUVE 3V83A 1NV3A 1URDA 4H8IA 4I8CA 1USYH 3OOAA 4I9DA 5CRYA 5JTYA 1MXXA 2OBGA 3M3FA 3FVKA 1SI1A 1JNFA 2B65A 1Y3QA 3FBPA 1JQFA 3JV9A 5H8NB 3TKDA 5A5XA 1IXIA 3O6GA 3VLVA 2XX7A 5I7IA 4LZ7A 2PT2A 5ET6A 5ITPA 3IK6B 1KWHA 1DPEA 4P1EA 4MMPA 3FUZA 3IO6A 3O6HA 5AA3A 1GTKA 1LSTA 1A99A 1UTHB 4R74A 3B6QA 3FXBA 1FPDA 5H8FA 4P8BA 4P3LA 5I2KA 1ATGA 1URSA 1B32A 4NN3A 4H65A 3PUXE 2Y5KA 1IIWA 3HPIA 4PFUA 4Q0CA 4X8RA 5I58B 2DXYA 4MNPA 5CMKA 2I3WA 3CFXA 2AIXA 1SYIA 4GVOA 4N6DA 4G4PA 3H4ZA 2THIA 4EQ9A 2DWHA 1R1NA 2QVRA 2O84X 1MXUA 2B3FA 1Y1ZA 2RINA 3M3LA 4R9FA 3C9HA 3IOUA 4X1BA 1K9YA 3L6HA 3G3KA 1P1OA 1B1HA 2XD2A 3KSJA 4JWYA 5FHNA 3CRBA 5CMMA 4N81A 2O68A 4LN5A 4I3EA 2ANJA 3K6UA 3EHSA 3TTLA 1FW0A 1KA0A 3CVGA 1J1NA 5HM4B 5LDZA 3MAMA 4PBQA 1D3KA 2ZYMA 5ICTA 4Q8RA 4ZEKA 1AIVA 1MQHA 4RY1A 2HZLA 4QFPA 3DM0A 4FAJA 1MH4A 3TTMA 2H25A 4MHFA 5H8NA 4MX6A 2NUVA 3O66A 4PTKA 2I58A 2DE3A 3SDFA 2O1MA 2RF1A 4XKQA 2HZKA 4IY5A 2DWJA 5DVJA 4GWUA 3HSTA 1BKAA 4OWDA 4P0IA 3VLUA 2G93A 1F9BA 1UTHA 2X26A 1B46A 3V89B 4WKMA 4GD5A 3CFLA 4LATA 5L9MA 3SKPA 4EXKA 2QJEA 1RDYA 4TLLB 1IUDA 1WODA 4PFYA 5I58A 2Y7KA 1M5CA 4G8MA 5BUUA 3UORA 3NOHA 2O6AA 3D1RA 4U1ZA 1B7UA 3MPLA 1R9LA 3EPEA 1IITA 1Y9UA 4ELOA 1Y4TA 1I6AA 1ZJLA 3S9EA 4BDOA 1PB7A 4PETA 3UP9A 3D4CA 1B5HA 2WYPA 1WVJA 3T22A 2NWJA 1IMBA 3VVDA 4DI3D 1FBHA 1N04A 1EH3A 4F2QA 4PE3A 3VLWA 4OEUA 2YLNA 1YZ0A 1GVCA 2QMXA 1SDXA 2QRYA 4PGNA 4RK2A 3PD8A 3MZ9A 2XXPA 1MG1A 1MXZA 5I59B 1EYJA 5DW8A 3G3FA 2DQVA 3IJOB 4M4GA 1NKXA 2Y7IA 3S9NC 2L5VA 4QSDA 1EZ9A 1A40A 3UK4A 3H06B 4IO5A 4LP2B 4TOZA 2KQZA 5DT6A 2ZNUA 3K0VA 4GBWA 2VPNA 2R9JA 1I6QA 2XXIA 4XKPA 2WBDA 2R71A 3ZKLA 5I57B 3DP6A 2PT1A 3OXNA 3MP6A 1VSOA 2RKMA 3F11A 1B2HA 1DPPA 4YB5A 2FIEA 2XD3A 3HV1A 3IB1A 3M8UA 5L9OA 4YB6A 5LOMA 3H7MA 2XA5A 3G3HA 2HQ0A 3KSXA 1TT1A 5CMCA 1QKAA 1NUXA 3KBRA 1ZBMA 2VHAA 2ZZWA 5TP9B 1SPIA 4PFIA 4P1LA 1INPA 3N5LA 1TWYA 4NQ8A 5KCJB 4QXDA 3UGWA 5IZZA 2I49A 1B0LA 1LBVA 3PV0E 4H67A 4P0GA 1NUYA 3MQ9A 4KCDA 4H5FA 3USDA 2QL3A 1D9VA 2ZZVA 4RNSA 1YCJA 4G77A 5ET8A 1MY2A 1B5JA 3B8BA 2YJPA 1AWBA 1SBPA 4PFTA 1FQCA 1A7LA 1O64A 4LVQA 1Z7NE 1FSAA 4KXPA 1USYE 1HSLA 1PB8A 4R75A 4YZZA 1IMEA 4PAIA 1N7WA 5I59A 3MVYA 3W15C 4N4UA 3IOVA 2FA7A 2I4CA 3PPOA 3IX1A 2DE2A 1O7TA 2BJIA 2H5YA 5AA1A 4EQ7A 3K2DA 2O7UA 1S9TA 3OO6A 5CBRA 4EUOA 3PMXA 4R6YA 4R72A 4NF6B 5AA2B 1NUZA 1NV7A 1MQJA 3T9XB 2R6GE 4DE8A 3QK6A 4DDDA 3MW0A 3ROJA 4GWYA 1ZKBA 1LBYA 5I57A 4M1VA 2VOZA 4G8HA 4MH5A 4YAHX 5F1QA 2VD3A 3RPWA 2UYEA 4GWSA 3SEXA 1GR2A 1B9JA 3LUZA 3MC2A 1SVXB 5F24A 1LFGA 2X7QA 5TP9A 4YKJA 3C31A 4PE5B 4R9GA 2I3VA 2DDKA 5KCJA 1JP4A 2ZMBA 3IB0A 1B3FA 1MXYA 4GX6A 4F3SA 1IZ1A 3LSXA 1AH5A 2VGQA 3CSBA 1SQYA 1EZPA 2WYKA 4DXCA 4HCYA 2F97A 4AB6A 4AQ4A 1B05A 2VD2A 5J16A 1RYXA 3K1PA 1YTVA 4O7IA 4IB2A 1PC3A 1L5TA 2ESNA 1P1NA 2IEEA 3TCHA 2REGA 4LONB 1IXCA 4NF5B 3IJXB 3MP8A 3O97A 3G7WA 4F19A 4FATA 5I3SA 1GGGA 1B1XA 4WXJA 4GWZA 3BFUA 1MDP1 4H0WA 3RUMA 1Q1KA 3THIA 2PCRA 3PGFA 3KBZA 2QS2A 3HHFA 3SERA 2HXWA 1QJMA 1LAGE 1FPJA 2V4CA 2CEYA 4X48A 3R26A 1DOTA 3K01A 4N6KA 1IEJA 1YAEA 4NF6A 5AA2A 4OFJA 3VVEA 3EHUA 1SW1A 3S9LC 3KN8A 3MZBA 3EKIA 4H46A 1PBPA 5J1DA 3K1MA 2PX1A 4R6HA 1N3WA 4H8JA 4BDRA 3G3JA 2ZXTA 2PMSA 4NWDA 3SETA 1MH3A 2KLFA 2D5WA 1AL3A 3C35A 1Y3PA 1NNPA 3LBSA 3HO7A 2CZHA 2M8CA 3AXFA 1OMPA 4LZ8A 1NH7A 3RTWB 4O3AA 2XWKA 2QS3A 2B4LA 3FJ7A 2OK2A 4QF9A 2FVZA 2I0CA 5DVFA 3U92A 3FV1A 3KC0A 4GXAA 4N13A 2R8TA 3RNNA 1M5BA 1NV1A 1SI0A 1QUKA 2DVCA 5B7DA 1CB6A 1QW0A 2GFEA 4U4SA 4ZZEA 4NF4B 4GWXA 4ZEIA 1FPEA 5L8DA 2GHAA 2QFLA 3BBRA 2CZLA 3RT6B 4THIA 3RYDA 2Q8JA 3UIFA 4NMYA 3I5OA 1GV8A 3TELA 3TFLA 2QMWA 4U2RA 4NF5A 4PDDA 2F7BA 3C36A 1N7XA 3W9WA 4NTLA 4GF8A 1OQHA 1AOVA 1S50A 2XXXA 3U72A 3MJNA 3Q28A 1ZTYA 3LSLA 1H76A 2HPGA 3T9UA 4OHNA 4RK9A 4OFOA 4F2OA 3PMVA 3JYRA 3TCFA 2V3UA 3FD3A 3MBPA 2VPOA 1EYKA 4QFNA 5AA4B 4QHQA 3ONMA 4YMAA 3K6XA 1P1WA 3BKIB 5ET7A 4GRKA 4E0XA 3PPQA 2F6GA 4IO7A 3SEYA 2ZZXA 5CBSA 2QS1A 1MM7A 2V84A 3TAJA 1LBCA 4QFKA 4DCYA 1H45A 1O63A 1LGBC 2H98A 3V8XB 4LZ5A 4DCXA 3K4UA 3CSGA 4QRZA 1US4A 1N84A 1MPCA 5LTCA 1Z7ME 1QVSA 5CC2A 1IQ7A 4OQOA 3T96B 4JSDA 3GLBA 2XWIA 3DP4A 3K1NA 4XTCQ 2HAUA 4R2BA 4KD5A 1Y1MA 2UYFA 3Q25A 4F31B 2O7IA 3CI8A 4ESWA 3ILTB 4GWWA 3CG1A 4PP0A 3QIMA 2Y7WA 1R6ZA 4XFEA 1B4ZA 1D9YA 4X9TA 1YYZA 1XVXA 4XKRA 1LFHA 4DIGA 2WX9A 2OZZA 2HCAA 4LQ5A 4IGRA 4NF4A 2Q74A 3A3UA 3ECRA 3SEWA 2RC7A 4OEVA 3E78A 2CZIA 1IXHA 4JXIA 3FASA 1FBDA 3TMGA 2ZYKA 1DCUA 5EHMA 3RPLB 4AB5A 1D9QA 1MY0A 3SESA 3K6VA 4K3FA 3TDJA 1B51A 2XWOA 3MVWA 4FORA 5DVIA 3EQ1A 2RC9A 3GBAA 2AYSA 4E0WA 5AA4A 4DXUA 1LB8A 2B4MA 3B6WA 4N8YA 4RA1A 3I3VA 3BIGA 3E4RA 3LC8A 4JWXA 4GX3A
chains in the Genus database with same CATH topology
3HCQA 3GBBA 3FATA 2D21A 4R73A 2Q2CA 4DLDA 1XOCA 3UA8A 1VFEA 1EZOA 4OXVA 2H9BA 3U8QA 4KI0E 3KEIA 4ZS9A 1XHYA 3TTRA 3T9HB 3EN3A 2XXQA 4ISUA 3C33A 1FTJA 1HSEA 3TTKA 5I84A 2Z8EA 2Q2AA 1JETA 4MLQA 3K00A 4LQ2A 4F1YA 3O29A 4KPTA 4RPNA 1NL5A 3SEUA 2F34A 4FE8A 3H6TA 3K6WA 1SW2A 2O51A 4POWA 2F5XA 5DTBA 4IGTA 2Z23A 1M5FA 1OLCA 2OCUA 3OENA 4KYSA 5HBCA 1DMBA 3SEVA 1JW1A 4OESA 2VP1A 3LSWA 1PBQA 2QSXA 3DLNA 2QPQA 1WDNA 1S7YA 3DP8A 4LUBA 3TEPA 5JEIA 3RGYA 1I6BA 4IO4A 2OLBA 3VVFA 1QKBA 1MRPA 3K02A 2FYIA 3KJ7A 1LB9A 3O9PA 3KZGA 3R7XA 4KFQA 4QFOA 4ESXA 4GXSB 4TQUQ 1BIYA 1MXWA 2OWTA 4BLAA 3T9VA 2PVUA 3KGCA 3IAZA 5FHOA 3B6TA 1MY1A 1JEVA 3N6UA 3A09A 2AL4A 2UVGA 5JK4A 3MUQA 1BP5A 4IO3A 2D3IA 3GZGA 4ELQA 4YICA 1UIVA 1AMFA 5FHMA 2HAVA 1OVBA 1BTJA 2DP8A 3Q27A 1MM6A 3G3GA 3IL1B 4POXA 3JZJA 1A8FA 2DOJA 4FECA 5CI5A 3H6UA 4L17A 4ZE9A 4F3PA 4U1OA 2UVIA 4H5GA 3OSRA 4JBZA 1EU8A 4EF1A 4P11A 4G68C 3N6TA 3E9XA 3VFJA 1DSNA 5I56B 4TLMB 1B3EA 3I6VA 1MY4A 1B3GA 1LFIA 3IR1A 4RYAA 3ILUB 3FGSA 2V3TA 3VDFA 1P99A 4G2ZA 2I4BA 1RKMA 3PU5A 1N3XA 3N94A 4ELRA 1RYOA 1MDQA 1IXGA 1UIUA 3OELA 3TQLA 2P1SA 2PYYA 3S9MC 3VXCA 3V5AA 3TZAA 5K2XA 4DZ1A 2DYXA 1B3LA 1POY1 3PD9A 3O2AA 4GL0A 4I1DA 3WAEA 1LCTA 4OMBA 1N76A 4MFIA 3FXRA 4G8NA 1MY3A 3KN3A 3S4UA 2W7YA 3FVGA 3H6WA 3KJTA 3LSFB 2V25A 4ZEFA 3MZ1A 1SW5A 4FIMA 5IAIA 1TFAA 4YB7A 3L6GA 2XXUA 4NWCA 4NF8B 4PQJA 1MQDA 1JVYA 1R9QA 3CG3A 2ONRA 1FQFA 3DELB 3IOWA 2A5TB 5KDTB 5F7VA 4U21A 4KYDA 5I56A 4KQPA 2G29A 1P1UA 4OYVA 3WAFA 4HW8A 1B5IA 1JEUA 1VR5A 4NE4A 3TPAA 2XXWA 2Y7RA 2BJJX 5IKBA 4HS7A 4F1UA 4YKPA 5K2YA 1H43A 3PUYE 3TQWA 4KHZE 2V3QA 1B4HA 4UACA 3CR9A 3E3KA 2RC8A 1FTMA 3PUWE 4F3BA 2F7CA 1NMUA 3QAXA 4BDLA 1SW4A 3VV5A 5ISUA 1B0HA 2Q88A 4ZE8A 3KFMA 4HCWA 1OIBA 4X1DA 2B3BA 4ONYA 3KG2A 1T0KA 1Y4CA 4UA8A 4WEDA 3O28A 4ZZAA 4F1VA 1UQWA 5TPAB 3IOTA 4QSEA 2ZNSA 4U22A 3PUZE 5H8HB 4NF8A 3PMWA 3QSLA 3BFTA 4MF3A 1Y3NA 2NOOA 2GRVA 1M5DA 3QUJA 4YKIA 3N26A 3IO4A 3ZKKA 1TFDA 4DXBA 2A5TA 1A8EA 5KDTA 2Z8FA 1HSJA 3KOSA 1QULA 2O1LA 2RCBA 3PPRA 4ND9A 1URGA 1MPDA 1DTGA 1ZIUA 4BDNA 1LLSA 2GH9A 5FTHA 3MVXA 4GFRA 1BLFA 3HHGA 2RCAA 2E1SA 2QS4A 3G3IA 5AA2D 1FTKA 1ZU0A 4YKKA 1FTLA 2DS9A 1A54A 3Q26A 4JB7A 1N0TA 4G68B 2O69A 3FZVA 4ZECA 5EHSA 1QUJA 2OWSA 3TCGA 1D4NA 2HEUA 3TODA 4FEBA 3MPKA 1B3HA 5M2VA 3LUYA 4OTEA 3RQTA 2GHBA 1LAXA 3FJGA 2V93A 3HN0A 3P7IA 3ODBA 1OVTA 2A5SA 2OJTA 4YMBA 3EHTA 2AL5A 1FTOA 3E13X 4U4XA 3EF7A 1PDAA 1B58A 3OEMA 3C4MA 5TPAA 5KZTA 3OEKA 4BDQA 3O6IA 2Y84A 5H8HA 2NXOA 3VXBA 4XKNA 1FQAA 2IA4A 1PB9A 4ZEDA 3RLFE 1PEBA 3OO7A 4ELPA 1FCKA 4XXUA 4ECFA 1OQGA 1NNFA 2F36A 1UTBB 1LAHE 4IY6A 3CFZA 2X7PA 3Q29A 3T66A 2Z8DA 4C1UA 4MBPA 4KR5A 4GL8A 3H6VA 5BWJA 2F8DA 4YU0A 3H3GA 3RT8A 4NEDA 4EXLA 4QFLA 2P0SA 2P2AA 4G68A 5L9SA 2XX9A 2ALUA 1H44A 4C0RA 2Q9TA 4Q30B 2ONKE 3QYTA 1MQIA 2NVUB 4EQBA 1SYHA 4N6PA 1B7HA 2WKYA 2XXVA 4GOTA 3OD7A 5DEXB 2XXTA 3OO9A 4OFLA 1NNTA 1LAFE 4F18A 4I62A 4IO6A 5TU0A 2FNCA 3FVNA 3PPPA 1MXVA 1ZMGA 3FJMA 2ZYNA 2DWIA 5CMBA 3FV2A 4RPOA 3TUSA 4OENA 3FVOA 3U1OA 1I69A 3ZSFA 2XX8A 4Z0IA 1NFTA 4HTGA 3PPNA 3GXAA 4C1TA 4LA9A 5H8SA 2F6PA 4O3BA 2XXRA 2DE4A 3C32A 5I2NB 4MLVA 1UTBA 1VE4A 1B6HA 2I0BA 5AE4A 4R6KA 4FEDA 1DTZA 2H99A 2YPNA 4EDPA 4RXLA 1TXFA 4BDMA 2DSFA 2DVZA 4OZ9A 1B40A 4PFWA 1VFDA 2PBWA 3D4GA 3LR1A 1MS7A 2Z22A 5ICQA 2F7AA 4F39A 4R2FA 1Q35A 3IORA 3TYHA 5H8QB 4QSCA 3UN6A 2DXRA 3FXQA 1ANFA 3U93A 2ABHA 2CMOA 2I48A 4GLIA 2HFBA 1H3DA 2F78A 3RN8A 4ZDMA 1B7ZA 3VE1B 5EYFA 1A55A 4H1XA 4U23A 4RJZA 4XIGQ 3C34A 5DEXA 5FTIA 4JSOA 4ZEBA 2ONSA 4IO2A 2ZNTA 4N07A 4OETA 4EF2A 3TTNA 4F22A 2XHDA 3R6UA 1II5A 1Y20A 3QUFA 4Q5TA 1POTA 4GIZA 2E0SA 2ZYOA 4O3CA 4Z7EA 1YPNA 1OLAA 1XT8A 1JW4A 4WEPA 2Q89A 3H03A 1LCFA 1CE2A 2XXYA 3MVZA 3W9VA 2UVJA 5JTYB 3CIJA 1US5A 1MPBA 4FJPA 5I2NA 1XVYA 5A5XB 1FQBA 3MP1A 5ITOA 4GQOA 2H4IA 4F29A 1M5EA 2I6EA 4OVJA 4F3GA 1JVXA 1FQDA 1SD3A 3ZS6A 3KOTA 3S2VA 3B7DA 5B70A 5H8FB 3M3KA 4OERA 5I2KB 3OMBA 5ELVA 5H8QA 4JDFA 3FIRA 3MWBA 2LAOA 3T93B 1NH8A 2F35A 3A3CA 3U94A 1QUIA 3RTFB 5DYHA 2Y7PA 2UXAA 1ZLQA 5HPQA 3KN7A 1ELJA 4H6DA 1P1QA 2DWAA 1LBBA 5CM6A 1JW5A 3OSQA 3OO8A 3QXMA 1B52A 4KCCA 3RY3A 4JWOA 4GWOA 1XC1A 4KYEA 1FQEA 2UVHA 1MQGA 3FXUA 1XS5A 1NNKA 2REJA 2XXHA 3IB2A 3PUVE 3V83A 1URDA 4H8IA 4I8CA 1USYH 3OOAA 4I9DA 5CRYA 5JTYA 1MXXA 2OBGA 3M3FA 3FVKA 1SI1A 1JNFA 2B65A 1Y3QA 1JQFA 3JV9A 5H8NB 3TKDA 5A5XA 1IXIA 3O6GA 3VLVA 2XX7A 4LZ7A 2PT2A 5ITPA 3IK6B 1KWHA 1DPEA 3FUZA 3IO6A 3O6HA 5AA3A 1GTKA 1LSTA 1A99A 1UTHB 4R74A 3B6QA 5H8FA 5I2KA 1ATGA 1URSA 1B32A 4H65A 3PUXE 1IIWA 3HPIA 4PFUA 4Q0CA 5I58B 2DXYA 5CMKA 2I3WA 3CFXA 2AIXA 1SYIA 4GVOA 4G4PA 3H4ZA 2THIA 4EQ9A 2DWHA 1R1NA 2O84X 1MXUA 2B3FA 1Y1ZA 2RINA 3M3LA 4R9FA 3C9HA 3IOUA 4X1BA 3L6HA 3G3KA 1P1OA 1B1HA 2XD2A 3KSJA 4JWYA 5FHNA 3CRBA 5CMMA 2O68A 2ANJA 3K6UA 3EHSA 3TTLA 1FW0A 3CVGA 1J1NA 5HM4B 3MAMA 1D3KA 2ZYMA 5ICTA 4Q8RA 4ZEKA 1AIVA 1MQHA 4RY1A 2HZLA 4QFPA 3DM0A 4FAJA 1MH4A 3TTMA 2H25A 5H8NA 2NUVA 3O66A 2I58A 2DE3A 3SDFA 2O1MA 2RF1A 4XKQA 2HZKA 4IY5A 2DWJA 5DVJA 3HSTA 1BKAA 4OWDA 4P0IA 3VLUA 2G93A 1F9BA 1UTHA 2X26A 1B46A 3V89B 4WKMA 4GD5A 3CFLA 4LATA 5L9MA 3SKPA 4EXKA 2QJEA 4TLLB 1IUDA 1WODA 4PFYA 5I58A 2Y7KA 1M5CA 4G8MA 5BUUA 3UORA 2O6AA 4U1ZA 1B7UA 3MPLA 1R9LA 3EPEA 1IITA 1Y9UA 4ELOA 1Y4TA 1I6AA 1ZJLA 3S9EA 4BDOA 1PB7A 4PETA 3UP9A 3D4CA 1B5HA 1WVJA 3T22A 2NWJA 3VVDA 1N04A 1EH3A 4F2QA 3VLWA 4OEUA 2YLNA 1GVCA 2QMXA 1SDXA 2QRYA 3PD8A 4RK2A 3MZ9A 2XXPA 1MG1A 1MXZA 5I59B 3G3FA 2DQVA 3IJOB 4M4GA 1NKXA 2Y7IA 3S9NC 4QSDA 1EZ9A 1A40A 3UK4A 3H06B 4IO5A 4LP2B 4TOZA 5DT6A 2ZNUA 3K0VA 2R9JA 1I6QA 2XXIA 4XKPA 2R71A 3ZKLA 5I57B 3DP6A 2PT1A 3OXNA 3MP6A 1VSOA 2RKMA 3F11A 1B2HA 1DPPA 4YB5A 2XD3A 3HV1A 3IB1A 3M8UA 5L9OA 4YB6A 5LOMA 3H7MA 3G3HA 2HQ0A 3KSXA 1TT1A 5CMCA 1QKAA 3KBRA 1ZBMA 2VHAA 5TP9B 3N5LA 1TWYA 5KCJB 3UGWA 2I49A 1B0LA 3PV0E 4H67A 4P0GA 3MQ9A 4KCDA 4H5FA 3USDA 2QL3A 1D9VA 4RNSA 1YCJA 4G77A 1MY2A 1B5JA 2YJPA 1SBPA 4PFTA 1FQCA 1A7LA 1O64A 4LVQA 1Z7NE 1USYE 1HSLA 1PB8A 4R75A 4YZZA 1N7WA 5I59A 3MVYA 3W15C 3IOVA 2FA7A 2I4CA 3PPOA 3IX1A 2DE2A 1O7TA 2H5YA 5AA1A 4EQ7A 3K2DA 2O7UA 1S9TA 3OO6A 5CBRA 4EUOA 3PMXA 4R6YA 4R72A 4NF6B 5AA2B 1MQJA 3T9XB 2R6GE 4DE8A 3QK6A 4DDDA 3MW0A 1ZKBA 5I57A 4M1VA 2VOZA 4G8HA 4MH5A 4YAHX 5F1QA 2VD3A 3RPWA 2UYEA 3SEXA 1GR2A 1B9JA 3MC2A 1SVXB 1LFGA 2X7QA 5TP9A 4YKJA 3C31A 4PE5B 4R9GA 2I3VA 5KCJA 2ZMBA 3IB0A 1B3FA 1MXYA 4F3SA 1IZ1A 3LSXA 1AH5A 2VGQA 3CSBA 1SQYA 1EZPA 4DXCA 4HCYA 2F97A 4AB6A 4AQ4A 1B05A 2VD2A 1RYXA 3K1PA 1YTVA 4IB2A 1PC3A 1L5TA 2ESNA 1P1NA 2IEEA 3TCHA 2REGA 4LONB 1IXCA 4NF5B 3IJXB 3MP8A 3O97A 3G7WA 4F19A 4FATA 1GGGA 1B1XA 4WXJA 3BFUA 1MDP1 4H0WA 3RUMA 1Q1KA 3THIA 3PGFA 2QS2A 3HHFA 3SERA 2HXWA 1QJMA 1LAGE 4X48A 3R26A 1DOTA 3K01A 1IEJA 1YAEA 4NF6A 5AA2A 4OFJA 3VVEA 3EHUA 1SW1A 3S9LC 3KN8A 3MZBA 1PBPA 5J1DA 3K1MA 2PX1A 4R6HA 1N3WA 4H8JA 4BDRA 3G3JA 2ZXTA 2PMSA 4NWDA 3SETA 1MH3A 2KLFA 2D5WA 1AL3A 3C35A 1Y3PA 1NNPA 3LBSA 3HO7A 2M8CA 3AXFA 3RTWB 1OMPA 4LZ8A 1NH7A 4O3AA 2QS3A 3FJ7A 2OK2A 4QF9A 2I0CA 5DVFA 3U92A 3FV1A 4GXAA 4N13A 3RNNA 1M5BA 1SI0A 1QUKA 2DVCA 5B7DA 1CB6A 1QW0A 2GFEA 4U4SA 4ZZEA 5L8DA 4NF4B 4ZEIA 2GHAA 3BBRA 2CZLA 3RT6B 4THIA 2Q8JA 3UIFA 4NMYA 3I5OA 1GV8A 3TELA 3TFLA 2QMWA 4U2RA 4NF5A 2F7BA 3C36A 1N7XA 3W9WA 4NTLA 4GF8A 1OQHA 1AOVA 1S50A 2XXXA 3U72A 3MJNA 3Q28A 1ZTYA 3LSLA 1H76A 3T9UA 4OHNA 4RK9A 4OFOA 4F2OA 3PMVA 3JYRA 3TCFA 2V3UA 3FD3A 3MBPA 4QFNA 5AA4B 4QHQA 3ONMA 4YMAA 3K6XA 1P1WA 3BKIB 4GRKA 4E0XA 3PPQA 2F6GA 4IO7A 3SEYA 5CBSA 2QS1A 1MM7A 2V84A 3TAJA 1LBCA 4QFKA 4DCYA 1H45A 1O63A 1LGBC 2H98A 3V8XB 4LZ5A 4DCXA 3K4UA 3CSGA 4QRZA 1US4A 1N84A 1MPCA 1Z7ME 1QVSA 5CC2A 1IQ7A 4OQOA 3T96B 4JSDA 3GLBA 3DP4A 3K1NA 4XTCQ 2HAUA 4R2BA 4KD5A 1Y1MA 2UYFA 3Q25A 4F31B 2O7IA 3CI8A 4ESWA 3ILTB 4PP0A 3CG1A 3QIMA 2Y7WA 1R6ZA 1B4ZA 1D9YA 4X9TA 1XVXA 4XKRA 1LFHA 4DIGA 2OZZA 2HCAA 4LQ5A 4IGRA 4NF4A 3A3UA 3ECRA 3SEWA 2RC7A 4OEVA 1IXHA 4JXIA 3FASA 3TMGA 2ZYKA 5EHMA 4AB5A 1MY0A 3SESA 3K6VA 4K3FA 3TDJA 1B51A 3MVWA 4FORA 5DVIA 3EQ1A 2RC9A 3GBAA 2AYSA 4E0WA 5AA4A 4DXUA 1LB8A 3B6WA 4RA1A 3I3VA 3E4RA 3LC8A 4JWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCQ A;  3GBB A;  3FAT A;  2D21 A;  4R73 A;  2Q2C A;  4DLD A;  1XOC A;  3UA8 A;  1VFE A;  1EZO A;  4OXV A;  2H9B A;  3U8Q A;  4KI0 E;  3KEI A;  4ZS9 A;  1XHY A;  3TTR A;  3T9H B;  3EN3 A;  2XXQ A;  4ISU A;  3C33 A;  1FTJ A;  1HSE A;  3TTK A;  5I84 A;  2Z8E A;  2Q2A A;  1JET A;  4MLQ A;  3K00 A;  4LQ2 A;  4F1Y A;  3O29 A;  4KPT A;  4RPN A;  1NL5 A;  3SEU A;  2F34 A;  4FE8 A;  3H6T A;  3K6W A;  1SW2 A;  2O51 A;  4POW A;  2F5X A;  5DTB A;  4IGT A;  2Z23 A;  1M5F A;  1OLC A;  2OCU A;  3OEN A;  4KYS A;  5HBC A;  1DMB A;  3SEV A;  1JW1 A;  4OES A;  2VP1 A;  3LSW A;  1PBQ A;  2QSX A;  3DLN A;  2QPQ A;  1WDN A;  1S7Y A;  3DP8 A;  4LUB A;  3TEP A;  5JEI A;  3RGY A;  1I6B A;  4IO4 A;  2OLB A;  3VVF A;  1QKB A;  1MRP A;  3K02 A;  2FYI A;  3KJ7 A;  1LB9 A;  3O9P A;  3KZG A;  3R7X A;  4KFQ A;  4QFO A;  4ESX A;  4GXS B;  4TQU Q;  1BIY A;  1MXW A;  2OWT A;  4BLA A;  3T9V A;  2PVU A;  3KGC A;  3IAZ A;  5FHO A;  3B6T A;  1MY1 A;  1JEV A;  3N6U A;  3A09 A;  2AL4 A;  2UVG A;  5JK4 A;  3MUQ A;  1BP5 A;  4IO3 A;  2D3I A;  3GZG A;  4ELQ A;  4YIC A;  1UIV A;  1AMF A;  5FHM A;  2HAV A;  1OVB A;  1BTJ A;  2DP8 A;  3Q27 A;  1MM6 A;  3G3G A;  3IL1 B;  4POX A;  3JZJ A;  1A8F A;  2DOJ A;  4FEC A;  5CI5 A;  3H6U A;  4L17 A;  4ZE9 A;  4F3P A;  4U1O A;  2UVI A;  4H5G A;  3OSR A;  4JBZ A;  1EU8 A;  4EF1 A;  4P11 A;  4G68 C;  3N6T A;  3E9X A;  3VFJ A;  1DSN A;  5I56 B;  4TLM B;  1B3E A;  3I6V A;  1MY4 A;  1B3G A;  1LFI A;  3IR1 A;  4RYA A;  3ILU B;  3FGS A;  2V3T A;  3VDF A;  1P99 A;  4G2Z A;  2I4B A;  1RKM A;  3PU5 A;  1N3X A;  3N94 A;  4ELR A;  1RYO A;  1MDQ A;  1IXG A;  1UIU A;  3OEL A;  3TQL A;  2P1S A;  2PYY A;  3S9M C;  3VXC A;  3V5A A;  3TZA A;  5K2X A;  4DZ1 A;  2DYX A;  1B3L A;  1POY 1;  3PD9 A;  3O2A A;  4GL0 A;  4I1D A;  3WAE A;  1LCT A;  4OMB A;  1N76 A;  4MFI A;  3FXR A;  4G8N A;  1MY3 A;  3KN3 A;  3S4U A;  2W7Y A;  3FVG A;  3H6W A;  3KJT A;  3LSF B;  2V25 A;  4ZEF A;  3MZ1 A;  1SW5 A;  4FIM A;  5IAI A;  1TFA A;  4YB7 A;  3L6G A;  2XXU A;  4NWC A;  4NF8 B;  4PQJ A;  1MQD A;  1JVY A;  1R9Q A;  3CG3 A;  2ONR A;  1FQF A;  3DEL B;  3IOW A;  2A5T B;  5KDT B;  5F7V A;  4U21 A;  4KYD A;  5I56 A;  4KQP A;  2G29 A;  1P1U A;  4OYV A;  3WAF A;  4HW8 A;  1B5I A;  1JEU A;  1VR5 A;  4NE4 A;  3TPA A;  2XXW A;  2Y7R A;  2BJJ X;  5IKB A;  4HS7 A;  4F1U A;  4YKP A;  5K2Y A;  1H43 A;  3PUY E;  3TQW A;  4KHZ E;  2V3Q A;  1B4H A;  4UAC A;  3CR9 A;  3E3K A;  2RC8 A;  1FTM A;  3PUW E;  4F3B A;  2F7C A;  1NMU A;  3QAX A;  4BDL A;  1SW4 A;  3VV5 A;  5ISU A;  1B0H A;  2Q88 A;  4ZE8 A;  3KFM A;  4HCW A;  1OIB A;  4X1D A;  2B3B A;  4ONY A;  3KG2 A;  1T0K A;  1Y4C A;  4UA8 A;  4WED A;  3O28 A;  4ZZA A;  4F1V A;  1UQW A;  5TPA B;  3IOT A;  4QSE A;  2ZNS A;  4U22 A;  3PUZ E;  5H8H B;  4NF8 A;  3PMW A;  3QSL A;  3BFT A;  4MF3 A;  1Y3N A;  2NOO A;  2GRV A;  1M5D A;  3QUJ A;  4YKI A;  3N26 A;  3IO4 A;  3ZKK A;  1TFD A;  4DXB A;  2A5T A;  1A8E A;  5KDT A;  2Z8F A;  1HSJ A;  3KOS A;  1QUL A;  2O1L A;  2RCB A;  3PPR A;  4ND9 A;  1URG A;  1MPD A;  1DTG A;  1ZIU A;  4BDN A;  1LLS A;  2GH9 A;  5FTH A;  3MVX A;  4GFR A;  1BLF A;  3HHG A;  2RCA A;  2E1S A;  2QS4 A;  3G3I A;  5AA2 D;  1FTK A;  1ZU0 A;  4YKK A;  1FTL A;  2DS9 A;  1A54 A;  3Q26 A;  4JB7 A;  1N0T A;  4G68 B;  2O69 A;  3FZV A;  4ZEC A;  5EHS A;  1QUJ A;  2OWS A;  3TCG A;  1D4N A;  2HEU A;  3TOD A;  4FEB A;  3MPK A;  1B3H A;  5M2V A;  3LUY A;  4OTE A;  3RQT A;  2GHB A;  1LAX A;  3FJG A;  2V93 A;  3HN0 A;  3P7I A;  3ODB A;  1OVT A;  2A5S A;  2OJT A;  4YMB A;  3EHT A;  2AL5 A;  1FTO A;  3E13 X;  4U4X A;  3EF7 A;  1PDA A;  1B58 A;  3OEM A;  3C4M A;  5TPA A;  5KZT A;  3OEK A;  4BDQ A;  3O6I A;  2Y84 A;  5H8H A;  2NXO A;  3VXB A;  4XKN A;  1FQA A;  2IA4 A;  1PB9 A;  4ZED A;  3RLF E;  1PEB A;  3OO7 A;  4ELP A;  1FCK A;  4XXU A;  4ECF A;  1OQG A;  1NNF A;  2F36 A;  1UTB B;  1LAH E;  4IY6 A;  3CFZ A;  2X7P A;  3Q29 A;  3T66 A;  2Z8D A;  4C1U A;  4MBP A;  4KR5 A;  4GL8 A;  3H6V A;  5BWJ A;  2F8D A;  4YU0 A;  3H3G A;  3RT8 A;  4NED A;  4EXL A;  4QFL A;  2P0S A;  2P2A A;  4G68 A;  5L9S A;  2XX9 A;  2ALU A;  1H44 A;  4C0R A;  2Q9T A;  4Q30 B;  2ONK E;  3QYT A;  1MQI A;  2NVU B;  4EQB A;  1SYH A;  4N6P A;  1B7H A;  2WKY A;  2XXV A;  4GOT A;  3OD7 A;  5DEX B;  2XXT A;  3OO9 A;  4OFL A;  1NNT A;  1LAF E;  4F18 A;  4I62 A;  4IO6 A;  5TU0 A;  2FNC A;  3FVN A;  3PPP A;  1MXV A;  1ZMG A;  3FJM A;  2ZYN A;  2DWI A;  5CMB A;  3FV2 A;  4RPO A;  3TUS A;  4OEN A;  3FVO A;  3U1O A;  1I69 A;  3ZSF A;  2XX8 A;  4Z0I A;  1NFT A;  4HTG A;  3PPN A;  3GXA A;  4C1T A;  4LA9 A;  5H8S A;  2F6P A;  4O3B A;  2XXR A;  2DE4 A;  3C32 A;  5I2N B;  4MLV A;  1UTB A;  1VE4 A;  1B6H A;  2I0B A;  5AE4 A;  4R6K A;  4FED A;  1DTZ A;  2H99 A;  2YPN A;  4EDP A;  4RXL A;  1TXF A;  4BDM A;  2DSF A;  2DVZ A;  4OZ9 A;  1B40 A;  4PFW A;  1VFD A;  2PBW A;  3D4G A;  3LR1 A;  1MS7 A;  2Z22 A;  5ICQ A;  2F7A A;  4F39 A;  4R2F A;  1Q35 A;  3IOR A;  3TYH A;  5H8Q B;  4QSC A;  3UN6 A;  2DXR A;  3FXQ A;  1ANF A;  3U93 A;  2ABH A;  2CMO A;  2I48 A;  4GLI A;  2HFB A;  1H3D A;  2F78 A;  3RN8 A;  4ZDM A;  1B7Z A;  3VE1 B;  5EYF A;  1A55 A;  4H1X A;  4U23 A;  4RJZ A;  4XIG Q;  3C34 A;  5DEX A;  5FTI A;  4JSO A;  4ZEB A;  2ONS A;  4IO2 A;  2ZNT A;  4N07 A;  4OET A;  4EF2 A;  3TTN A;  4F22 A;  2XHD A;  3R6U A;  1II5 A;  1Y20 A;  3QUF A;  4Q5T A;  1POT A;  4GIZ A;  2E0S A;  2ZYO A;  4O3C A;  4Z7E A;  1YPN A;  1OLA A;  1XT8 A;  1JW4 A;  4WEP A;  2Q89 A;  3H03 A;  1LCF A;  1CE2 A;  2XXY A;  3MVZ A;  3W9V A;  2UVJ A;  5JTY B;  3CIJ A;  1US5 A;  1MPB A;  4FJP A;  5I2N A;  1XVY A;  5A5X B;  1FQB A;  3MP1 A;  5ITO A;  4GQO A;  2H4I A;  4F29 A;  1M5E A;  2I6E A;  4OVJ A;  4F3G A;  1JVX A;  1FQD A;  1SD3 A;  3ZS6 A;  3KOT A;  3S2V A;  3B7D A;  5B70 A;  5H8F B;  3M3K A;  4OER A;  5I2K B;  3OMB A;  5ELV A;  5H8Q A;  4JDF A;  3FIR A;  3MWB A;  2LAO A;  3T93 B;  1NH8 A;  2F35 A;  3A3C A;  3U94 A;  1QUI A;  3RTF B;  5DYH A;  2Y7P A;  2UXA A;  1ZLQ A;  5HPQ A;  3KN7 A;  1ELJ A;  4H6D A;  1P1Q A;  2DWA A;  1LBB A;  5CM6 A;  1JW5 A;  3OSQ A;  3OO8 A;  3QXM A;  1B52 A;  4KCC A;  3RY3 A;  4JWO A;  4GWO A;  1XC1 A;  4KYE A;  1FQE A;  2UVH A;  1MQG A;  3FXU A;  1XS5 A;  1NNK A;  2REJ A;  2XXH A;  3IB2 A;  3PUV E;  3V83 A;  1URD A;  4H8I A;  4I8C A;  1USY H;  3OOA A;  4I9D A;  5CRY A;  5JTY A;  1MXX A;  2OBG A;  3M3F A;  3FVK A;  1SI1 A;  1JNF A;  2B65 A;  1Y3Q A;  1JQF A;  3JV9 A;  5H8N B;  3TKD A;  5A5X A;  1IXI A;  3O6G A;  3VLV A;  2XX7 A;  4LZ7 A;  2PT2 A;  5ITP A;  3IK6 B;  1KWH A;  1DPE A;  3FUZ A;  3IO6 A;  3O6H A;  5AA3 A;  1GTK A;  1LST A;  1A99 A;  1UTH B;  4R74 A;  3B6Q A;  5H8F A;  5I2K A;  1ATG A;  1URS A;  1B32 A;  4H65 A;  3PUX E;  1IIW A;  3HPI A;  4PFU A;  4Q0C A;  5I58 B;  2DXY A;  5CMK A;  2I3W A;  3CFX A;  2AIX A;  1SYI A;  4GVO A;  4G4P A;  3H4Z A;  2THI A;  4EQ9 A;  2DWH A;  1R1N A;  2O84 X;  1MXU A;  2B3F A;  1Y1Z A;  2RIN A;  3M3L A;  4R9F A;  3C9H A;  3IOU A;  4X1B A;  3L6H A;  3G3K A;  1P1O A;  1B1H A;  2XD2 A;  3KSJ A;  4JWY A;  5FHN A;  3CRB A;  5CMM A;  2O68 A;  2ANJ A;  3K6U A;  3EHS A;  3TTL A;  1FW0 A;  3CVG A;  1J1N A;  5HM4 B;  3MAM A;  1D3K A;  2ZYM A;  5ICT A;  4Q8R A;  4ZEK A;  1AIV A;  1MQH A;  4RY1 A;  2HZL A;  4QFP A;  3DM0 A;  4FAJ A;  1MH4 A;  3TTM A;  2H25 A;  5H8N A;  2NUV A;  3O66 A;  2I58 A;  2DE3 A;  3SDF A;  2O1M A;  2RF1 A;  4XKQ A;  2HZK A;  4IY5 A;  2DWJ A;  5DVJ A;  3HST A;  1BKA A;  4OWD A;  4P0I A;  3VLU A;  2G93 A;  1F9B A;  1UTH A;  2X26 A;  1B46 A;  3V89 B;  4WKM A;  4GD5 A;  3CFL A;  4LAT A;  5L9M A;  3SKP A;  4EXK A;  2QJE A;  4TLL B;  1IUD A;  1WOD A;  4PFY A;  5I58 A;  2Y7K A;  1M5C A;  4G8M A;  5BUU A;  3UOR A;  2O6A A;  4U1Z A;  1B7U A;  3MPL A;  1R9L A;  3EPE A;  1IIT A;  1Y9U A;  4ELO A;  1Y4T A;  1I6A A;  1ZJL A;  3S9E A;  4BDO A;  1PB7 A;  4PET A;  3UP9 A;  3D4C A;  1B5H A;  1WVJ A;  3T22 A;  2NWJ A;  3VVD A;  1N04 A;  1EH3 A;  4F2Q A;  3VLW A;  4OEU A;  2YLN A;  1GVC A;  2QMX A;  1SDX A;  2QRY A;  3PD8 A;  4RK2 A;  3MZ9 A;  2XXP A;  1MG1 A;  1MXZ A;  5I59 B;  3G3F A;  2DQV A;  3IJO B;  4M4G A;  1NKX A;  2Y7I A;  3S9N C;  4QSD A;  1EZ9 A;  1A40 A;  3UK4 A;  3H06 B;  4IO5 A;  4LP2 B;  4TOZ A;  5DT6 A;  2ZNU A;  3K0V A;  2R9J A;  1I6Q A;  2XXI A;  4XKP A;  2R71 A;  3ZKL A;  5I57 B;  3DP6 A;  2PT1 A;  3OXN A;  3MP6 A;  1VSO A;  2RKM A;  3F11 A;  1B2H A;  1DPP A;  4YB5 A;  2XD3 A;  3HV1 A;  3IB1 A;  3M8U A;  5L9O A;  4YB6 A;  5LOM A;  3H7M A;  3G3H A;  2HQ0 A;  3KSX A;  1TT1 A;  5CMC A;  1QKA A;  3KBR A;  1ZBM A;  2VHA A;  5TP9 B;  3N5L A;  1TWY A;  5KCJ B;  3UGW A;  2I49 A;  1B0L A;  3PV0 E;  4H67 A;  4P0G A;  3MQ9 A;  4KCD A;  4H5F A;  3USD A;  2QL3 A;  1D9V A;  4RNS A;  1YCJ A;  4G77 A;  1MY2 A;  1B5J A;  2YJP A;  1SBP A;  4PFT A;  1FQC A;  1A7L A;  1O64 A;  4LVQ A;  1Z7N E;  1USY E;  1HSL A;  1PB8 A;  4R75 A;  4YZZ A;  1N7W A;  5I59 A;  3MVY A;  3W15 C;  3IOV A;  2FA7 A;  2I4C A;  3PPO A;  3IX1 A;  2DE2 A;  1O7T A;  2H5Y A;  5AA1 A;  4EQ7 A;  3K2D A;  2O7U A;  1S9T A;  3OO6 A;  5CBR A;  4EUO A;  3PMX A;  4R6Y A;  4R72 A;  4NF6 B;  5AA2 B;  1MQJ A;  3T9X B;  2R6G E;  4DE8 A;  3QK6 A;  4DDD A;  3MW0 A;  1ZKB A;  5I57 A;  4M1V A;  2VOZ A;  4G8H A;  4MH5 A;  4YAH X;  5F1Q A;  2VD3 A;  3RPW A;  2UYE A;  3SEX A;  1GR2 A;  1B9J A;  3MC2 A;  1SVX B;  1LFG A;  2X7Q A;  5TP9 A;  4YKJ A;  3C31 A;  4PE5 B;  4R9G A;  2I3V A;  5KCJ A;  2ZMB A;  3IB0 A;  1B3F A;  1MXY A;  4F3S A;  1IZ1 A;  3LSX A;  1AH5 A;  2VGQ A;  3CSB A;  1SQY A;  1EZP A;  4DXC A;  4HCY A;  2F97 A;  4AB6 A;  4AQ4 A;  1B05 A;  2VD2 A;  1RYX A;  3K1P A;  1YTV A;  4IB2 A;  1PC3 A;  1L5T A;  2ESN A;  1P1N A;  2IEE A;  3TCH A;  2REG A;  4LON B;  1IXC A;  4NF5 B;  3IJX B;  3MP8 A;  3O97 A;  3G7W A;  4F19 A;  4FAT A;  1GGG A;  1B1X A;  4WXJ A;  3BFU A;  1MDP 1;  4H0W A;  3RUM A;  1Q1K A;  3THI A;  3PGF A;  2QS2 A;  3HHF A;  3SER A;  2HXW A;  1QJM A;  1LAG E;  4X48 A;  3R26 A;  1DOT A;  3K01 A;  1IEJ A;  1YAE A;  4NF6 A;  5AA2 A;  4OFJ A;  3VVE A;  3EHU A;  1SW1 A;  3S9L C;  3KN8 A;  3MZB A;  1PBP A;  5J1D A;  3K1M A;  2PX1 A;  4R6H A;  1N3W A;  4H8J A;  4BDR A;  3G3J A;  2ZXT A;  2PMS A;  4NWD A;  3SET A;  1MH3 A;  2KLF A;  2D5W A;  1AL3 A;  3C35 A;  1Y3P A;  1NNP A;  3LBS A;  3HO7 A;  2M8C A;  3AXF A;  3RTW B;  1OMP A;  4LZ8 A;  1NH7 A;  4O3A A;  2QS3 A;  3FJ7 A;  2OK2 A;  4QF9 A;  2I0C A;  5DVF A;  3U92 A;  3FV1 A;  4GXA A;  4N13 A;  3RNN A;  1M5B A;  1SI0 A;  1QUK A;  2DVC A;  5B7D A;  1CB6 A;  1QW0 A;  2GFE A;  4U4S A;  4ZZE A;  5L8D A;  4NF4 B;  4ZEI A;  2GHA A;  3BBR A;  2CZL A;  3RT6 B;  4THI A;  2Q8J A;  3UIF A;  4NMY A;  3I5O A;  1GV8 A;  3TEL A;  3TFL A;  2QMW A;  4U2R A;  4NF5 A;  2F7B A;  3C36 A;  1N7X A;  3W9W A;  4NTL A;  4GF8 A;  1OQH A;  1AOV A;  1S50 A;  2XXX A;  3U72 A;  3MJN A;  3Q28 A;  1ZTY A;  3LSL A;  1H76 A;  3T9U A;  4OHN A;  4RK9 A;  4OFO A;  4F2O A;  3PMV A;  3JYR A;  3TCF A;  2V3U A;  3FD3 A;  3MBP A;  4QFN A;  5AA4 B;  4QHQ A;  3ONM A;  4YMA A;  3K6X A;  1P1W A;  3BKI B;  4GRK A;  4E0X A;  3PPQ A;  2F6G A;  4IO7 A;  3SEY A;  5CBS A;  2QS1 A;  1MM7 A;  2V84 A;  3TAJ A;  1LBC A;  4QFK A;  4DCY A;  1H45 A;  1O63 A;  1LGB C;  2H98 A;  3V8X B;  4LZ5 A;  4DCX A;  3K4U A;  3CSG A;  4QRZ A;  1US4 A;  1N84 A;  1MPC A;  1Z7M E;  1QVS A;  5CC2 A;  1IQ7 A;  4OQO A;  3T96 B;  4JSD A;  3GLB A;  3DP4 A;  3K1N A;  4XTC Q;  2HAU A;  4R2B A;  4KD5 A;  1Y1M A;  2UYF A;  3Q25 A;  4F31 B;  2O7I A;  3CI8 A;  4ESW A;  3ILT B;  4PP0 A;  3CG1 A;  3QIM A;  2Y7W A;  1R6Z A;  1B4Z A;  1D9Y A;  4X9T A;  1XVX A;  4XKR A;  1LFH A;  4DIG A;  2OZZ A;  2HCA A;  4LQ5 A;  4IGR A;  4NF4 A;  3A3U A;  3ECR A;  3SEW A;  2RC7 A;  4OEV A;  1IXH A;  4JXI A;  3FAS A;  3TMG A;  2ZYK A;  5EHM A;  4AB5 A;  1MY0 A;  3SES A;  3K6V A;  4K3F A;  3TDJ A;  1B51 A;  3MVW A;  4FOR A;  5DVI A;  3EQ1 A;  2RC9 A;  3GBA A;  2AYS A;  4E0W A;  5AA4 A;  4DXU A;  1LB8 A;  3B6W A;  4RA1 A;  3I3V A;  3E4R A;  3LC8 A;  4JWX A; 
#chains in the Genus database with same CATH topology
 3HCQ A;  3GBB A;  5EQ8 A;  3FAT A;  2D21 A;  1LEV A;  4R73 A;  2Q2C A;  4DLD A;  4PGP A;  1XOC A;  3UA8 A;  1VFE A;  1EZO A;  4OXV A;  2H9B A;  3U8Q A;  4MAG A;  4KI0 E;  3KEI A;  4ZS9 A;  5A5L A;  1XHY A;  3TTR A;  3B50 A;  4O8M A;  3T9H B;  1FBG A;  3EN3 A;  2XXQ A;  4ISU A;  1FBP A;  3C33 A;  1FTJ A;  1HSE A;  3TTK A;  5I84 A;  1IMA A;  2Z8E A;  2F3B A;  2Q2A A;  1JET A;  4MLQ A;  3K00 A;  1KA1 A;  4LQ2 A;  4F1Y A;  3O29 A;  3E79 A;  4KPT A;  4RPN A;  1NL5 A;  3SEU A;  2F34 A;  3SZP A;  4FE8 A;  2QVV A;  3H6T A;  3K6W A;  1SW2 A;  2O51 A;  4POW A;  2F5X A;  3RPL A;  5DTB A;  4IGT A;  2Z23 A;  1M5F A;  1OLC A;  2OCU A;  3OEN A;  4KYS A;  5HBC A;  1DMB A;  3SEV A;  1JW1 A;  4OES A;  3BIH A;  2VP1 A;  3LSW A;  1NV4 A;  4PBH A;  1PBQ A;  2QSX A;  3DLN A;  2QPQ A;  1WDN A;  1S7Y A;  3IFC A;  3DP8 A;  4LUB A;  2Y5L A;  4OAN A;  3TEP A;  2GQ1 A;  5JEI A;  3RGY A;  1I6B A;  4IO4 A;  2OLB A;  3VVF A;  1QKB A;  1MRP A;  3K02 A;  2FYI A;  2Q8M A;  3KJ7 A;  4JVI A;  1LB9 A;  3O9P A;  2KR0 A;  2CZK A;  3KZG A;  3R7X A;  4KFQ A;  1DK4 A;  4QFO A;  4ESX A;  4GXS B;  4TQU Q;  1BIY A;  1MXW A;  2OWT A;  4P9K A;  4BLA A;  1G0I A;  3T9V A;  2PVU A;  3KGC A;  3IAZ A;  2JJK A;  3B6T A;  5FHO A;  1MY1 A;  1FPG A;  1JEV A;  1VDW A;  3N6U A;  3A09 A;  1RDZ A;  2AL4 A;  2UVG A;  5JK4 A;  3MUQ A;  1BP5 A;  4IO3 A;  2D3I A;  1QGX A;  3GZG A;  4ELQ A;  4YIC A;  1UIV A;  1AMF A;  5FHM A;  2HAV A;  1OVB A;  1BTJ A;  2DP8 A;  4NX1 A;  3Q27 A;  1MM6 A;  3G3G A;  3IL1 B;  4POX A;  3JZJ A;  1A8F A;  2DOJ A;  4FEC A;  5CI5 A;  3H6U A;  4L17 A;  4ZE9 A;  4F3P A;  4U1O A;  2UVI A;  4H5G A;  3OSR A;  4JBZ A;  3T1B A;  1EU8 A;  4EF1 A;  4P11 A;  4G68 C;  3N6T A;  3E9X A;  3VFJ A;  1DSN A;  5I56 B;  4TLM B;  1B3E A;  3I6V A;  1MY4 A;  1B3G A;  4HE0 A;  1LFI A;  3IR1 A;  4RYA A;  3ILU B;  3FGS A;  3PTY A;  2V3T A;  3VDF A;  2XWV A;  1P99 A;  2XXK A;  4G2Z A;  4PFB A;  2I4B A;  2MKZ A;  1RKM A;  3PU5 A;  1N3X A;  4MIJ A;  3N94 A;  4ELR A;  1RYO A;  1MDQ A;  1IXG A;  1UIU A;  4I40 A;  3OEL A;  3TQL A;  2P1S A;  2PYY A;  3S9M C;  3VXC A;  3V5A A;  3TZA A;  5K2X A;  4DZ1 A;  2DYX A;  1B3L A;  1POY 1;  3PD9 A;  3O2A A;  4N8G A;  4GL0 A;  4MEV A;  4I1D A;  3WAE A;  1IMD A;  1LCT A;  4OMB A;  1N76 A;  5IZ3 B;  4MFI A;  3FXR A;  4G8N A;  1MY3 A;  3KN3 A;  3S4U A;  2W7Y A;  3FVG A;  3H6W A;  3KJT A;  1BK4 A;  3LSF B;  4PF8 A;  2V25 A;  4ZEF A;  1NV5 A;  3MZ1 A;  1SW5 A;  4FIM A;  5IAI A;  1TFA A;  4YB7 A;  3MST A;  4PFR A;  1FBF A;  3L6G A;  2XXU A;  5ESY A;  4NWC A;  4NF8 B;  4PQJ A;  1YXI A;  5EQ9 A;  1MQD A;  1JVY A;  1R9Q A;  3CG3 A;  2ONR A;  4GX4 A;  1FQF A;  3DEL B;  3IOW A;  2A5T B;  5IZ1 A;  5KDT B;  5F7V A;  4U21 A;  4KYD A;  5I56 A;  4JVC A;  4KQP A;  2G29 A;  1P1U A;  4OYV A;  3WAF A;  4HW8 A;  1B5I A;  1JEU A;  4DI4 B;  1VR5 A;  4NG7 A;  3KC1 A;  4NE4 A;  3TPA A;  2XXW A;  2Y7R A;  2BJJ X;  4MCO A;  5IKB A;  4HS7 A;  4F1U A;  1FJ6 A;  1IMF A;  4PF6 A;  4YKP A;  5K2Y A;  1H43 A;  3PUY E;  3TQW A;  4X04 A;  4KHZ E;  2V3Q A;  1B4H A;  4UAC A;  3CR9 A;  3E3K A;  2RC8 A;  1FTM A;  3PUW E;  4F3B A;  2F7C A;  1NMU A;  5EYG A;  3QAX A;  4BDL A;  1SW4 A;  3VV5 A;  5ISU A;  5IZ3 A;  4JVD A;  1B0H A;  2Q88 A;  4ZE8 A;  3KFM A;  4HCW A;  1OIB A;  4X1D A;  4OVQ A;  2B3B A;  3LV0 A;  5EYH A;  4ONY A;  3KG2 A;  1T0K A;  1Y4C A;  3QMF A;  1IMC A;  1FJ9 A;  4UA8 A;  4WED A;  2HXR A;  4PAF A;  3O28 A;  4ZZA A;  4F1V A;  1UQW A;  5TPA B;  3IOT A;  4QSE A;  2ZNS A;  4U22 A;  3PUZ E;  4PC9 A;  5H8H B;  4NF8 A;  3PMW A;  3QSL A;  5IM2 A;  3BFT A;  4MF3 A;  1Y3N A;  2NOO A;  2GRV A;  1M5D A;  3QUJ A;  4YKI A;  1NV2 A;  3N26 A;  3IO4 A;  3ZKK A;  4HE2 A;  1TFD A;  4DXB A;  2A5T A;  1A8E A;  5KDT A;  2Z8F A;  4O7M A;  2OWZ A;  2PFY A;  1HSJ A;  3KOS A;  1QUL A;  2O1L A;  2RCB A;  3PPR A;  1KZ8 A;  4ND9 A;  1URG A;  1MPD A;  1NV6 A;  1DTG A;  1ZIU A;  4BDN A;  1LLS A;  2GH9 A;  5FTH A;  3MVX A;  4GFR A;  2HHM A;  3HFU A;  1BLF A;  1FBC A;  3HHG A;  2RCA A;  2E1S A;  2QS4 A;  3G3I A;  5AA2 D;  1FTK A;  4OVT A;  1ZU0 A;  4YKK A;  4QBA A;  1FTL A;  4OA4 A;  2QVU A;  2DS9 A;  1A54 A;  3Q26 A;  4JB7 A;  1N0T A;  4G68 B;  2O69 A;  3FZV A;  5EHS A;  4ZEC A;  1QUJ A;  2OWS A;  3TCG A;  1D4N A;  2P3V A;  2HEU A;  3TOD A;  4FEB A;  2OX3 A;  3MPK A;  1B3H A;  4HE1 A;  5M2V A;  3LUY A;  4OTE A;  3RQT A;  1RDX A;  2GHB A;  1NI9 A;  1LAX A;  1Q9D A;  3FJG A;  2V93 A;  3HN0 A;  3P7I A;  3ODB A;  4MNI A;  1OVT A;  2A5S A;  2OJT A;  4YMB A;  3EHT A;  2P3N A;  2AL5 A;  1FTO A;  2PFZ A;  3E13 X;  4U4X A;  3EF7 A;  1PDA A;  1B58 A;  3OEM A;  3C4M A;  5TPA A;  3U65 A;  3OEK A;  4BDQ A;  5KZT A;  3O6I A;  2Y84 A;  5H8H A;  2NXO A;  4XEQ A;  3VXB A;  4XKN A;  1FQA A;  2IA4 A;  1PB9 A;  4NGU A;  4ZED A;  3RLF E;  4FBP A;  1PEB A;  3OO7 A;  4ELP A;  1FCK A;  4XXU A;  4ECF A;  1OQG A;  1NNF A;  2F36 A;  1UTB B;  4G61 A;  1LAH E;  4IY6 A;  3CFZ A;  2X7P A;  1FBE A;  3Q29 A;  3T66 A;  2Z8D A;  4C1U A;  1CNQ A;  4MBP A;  4KR5 A;  4GL8 A;  3H6V A;  5BWJ A;  2F8D A;  4YU0 A;  1FTA A;  3H3G A;  3RT8 A;  4NED A;  4EXL A;  4QFL A;  5FBP A;  2P0S A;  4I3Y A;  2P2A A;  3CHG A;  3ISP A;  4G68 A;  5L9S A;  2XX9 A;  2ALU A;  4P56 A;  1H44 A;  1FPL A;  2Q9T A;  4C0R A;  4Q30 B;  2ONK E;  3QYT A;  4OVS A;  1MQI A;  2NVU B;  4EQB A;  4PAK A;  1SYH A;  4N6P A;  1B7H A;  2WBB A;  2WKY A;  2XXV A;  4GOT A;  3OD7 A;  5DEX B;  2XXT A;  3OO9 A;  4OFL A;  1NNT A;  1LAF E;  4F18 A;  4I62 A;  4IO6 A;  5TU0 A;  2FNC A;  3FVN A;  3PPP A;  1MXV A;  1ZMG A;  3FJM A;  2ZYN A;  2DWI A;  5CMB A;  3FV2 A;  5ET5 A;  4RPO A;  3TUS A;  4OEN A;  3FVO A;  3U1O A;  1I69 A;  3ZSF A;  1EYI A;  2XX8 A;  4Z0I A;  1NFT A;  4HTG A;  3PPN A;  3GXA A;  5EQA A;  1NUW A;  4C1T A;  4PCD A;  4MJO A;  4LA9 A;  5H8S A;  1FPK A;  2F6P A;  4O3B A;  2XXR A;  2DE4 A;  3C32 A;  5I2N B;  4MLV A;  1UTB A;  5I5P A;  4XF5 A;  1VE4 A;  1B6H A;  2I0B A;  5AE4 A;  4R6K A;  4FED A;  1DTZ A;  2H99 A;  2YPN A;  4EDP A;  4N91 A;  5T3J A;  1LBW A;  4RXL A;  1TXF A;  2CEX A;  4BDM A;  2DSF A;  2DVZ A;  4OZ9 A;  1B40 A;  4PFW A;  4N17 A;  1VFD A;  2PBW A;  3D4G A;  3LR1 A;  1MS7 A;  2Z22 A;  5ICQ A;  2F7A A;  4F39 A;  4R2F A;  1Q35 A;  3IOR A;  3TYH A;  5H8Q B;  4QSC A;  3UN6 A;  2DXR A;  3FXQ A;  1ANF A;  3U93 A;  2ABH A;  2CMO A;  2I48 A;  4GLI A;  4HXV A;  2HFB A;  1NV0 A;  1LBX A;  1H3D A;  2F78 A;  3RN8 A;  1DBZ A;  4ZDM A;  1G0H A;  1B7Z A;  4AS5 A;  3VE1 B;  5EYF A;  1LBZ A;  1A55 A;  4H1X A;  4U23 A;  3T0J A;  2VT5 A;  4N15 A;  4RJZ A;  4XIG Q;  3C34 A;  5DEX A;  5FTI A;  1FPI A;  4JSO A;  1FRP A;  4ZEB A;  2ONS A;  4AS4 A;  4IO2 A;  4MNC A;  3MYU A;  5EQ7 A;  2ZNT A;  4N07 A;  4OET A;  4EF2 A;  3TTN A;  4F22 A;  2XHD A;  2F3D A;  3R6U A;  1II5 A;  1Y20 A;  3QUF A;  4Q5T A;  1POT A;  4GIZ A;  2E0S A;  2ZYO A;  4O3C A;  4Z7E A;  4NHB A;  1K9Z A;  1YPN A;  1OLA A;  1XT8 A;  1JW4 A;  4WEP A;  2Q89 A;  2FIX A;  3H03 A;  1LCF A;  1CE2 A;  2XXY A;  3MVZ A;  3W9V A;  2UVJ A;  5JTY B;  1FPB A;  3CIJ A;  1US5 A;  1MPB A;  4FJP A;  5I2N A;  1XVY A;  5A5X B;  1FQB A;  3MP1 A;  4H45 A;  5ITO A;  4GQO A;  2H4I A;  4F29 A;  3GYY A;  1M5E A;  2I6E A;  4NAP A;  4P47 A;  4OVJ A;  4O94 A;  4F3G A;  1JVX A;  1FQD A;  4UAB A;  1SD3 A;  3ZS6 A;  5IGA A;  3KOT A;  3S2V A;  3B7D A;  5B70 A;  5H8F B;  3M3K A;  4OER A;  5I2K B;  4GBV A;  3OMB A;  5ELV A;  5H8Q A;  4JDF A;  3FIR A;  3MWB A;  3IFA A;  4PDH A;  2LAO A;  3T93 B;  1NH8 A;  2F35 A;  3A3C A;  3U94 A;  1QUI A;  3RTF B;  5DYH A;  2Y7P A;  2UXA A;  1ZLQ A;  5HPQ A;  4OVR A;  3KN7 A;  1FPF A;  1ELJ A;  2FHY A;  4H6D A;  1P1Q A;  3A29 A;  2DWA A;  1LBB A;  5CM6 A;  1JW5 A;  2WEF A;  3OSQ A;  3OO8 A;  3QXM A;  1B52 A;  4KCC A;  3RY3 A;  4JWO A;  2FBP A;  4OVP A;  4GWO A;  1XC1 A;  4KYE A;  1FQE A;  2UVH A;  4NF0 A;  1MQG A;  4IR8 A;  3FXU A;  1XI6 A;  1XS5 A;  1NNK A;  2REJ A;  2XXH A;  3IB2 A;  3PUV E;  3V83 A;  1NV3 A;  1URD A;  4H8I A;  4I8C A;  1USY H;  3OOA A;  4I9D A;  5CRY A;  5JTY A;  1MXX A;  2OBG A;  3M3F A;  3FVK A;  1SI1 A;  1JNF A;  2B65 A;  1Y3Q A;  3FBP A;  1JQF A;  3JV9 A;  5H8N B;  3TKD A;  5A5X A;  1IXI A;  3O6G A;  3VLV A;  2XX7 A;  5I7I A;  4LZ7 A;  2PT2 A;  5ET6 A;  5ITP A;  3IK6 B;  1KWH A;  1DPE A;  4P1E A;  4MMP A;  3FUZ A;  3IO6 A;  3O6H A;  5AA3 A;  1GTK A;  1LST A;  1A99 A;  1UTH B;  4R74 A;  3B6Q A;  3FXB A;  1FPD A;  5H8F A;  4P8B A;  4P3L A;  5I2K A;  1ATG A;  1URS A;  1B32 A;  4NN3 A;  4H65 A;  3PUX E;  2Y5K A;  1IIW A;  3HPI A;  4PFU A;  4Q0C A;  4X8R A;  5I58 B;  2DXY A;  4MNP A;  5CMK A;  2I3W A;  3CFX A;  2AIX A;  1SYI A;  4GVO A;  4N6D A;  4G4P A;  3H4Z A;  2THI A;  4EQ9 A;  2DWH A;  1R1N A;  2QVR A;  2O84 X;  1MXU A;  2B3F A;  1Y1Z A;  2RIN A;  3M3L A;  4R9F A;  3C9H A;  3IOU A;  4X1B A;  1K9Y A;  3L6H A;  3G3K A;  1P1O A;  1B1H A;  2XD2 A;  3KSJ A;  4JWY A;  5FHN A;  3CRB A;  5CMM A;  4N81 A;  2O68 A;  4LN5 A;  4I3E A;  2ANJ A;  3K6U A;  3EHS A;  3TTL A;  1FW0 A;  1KA0 A;  3CVG A;  1J1N A;  5HM4 B;  5LDZ A;  3MAM A;  4PBQ A;  1D3K A;  2ZYM A;  5ICT A;  4Q8R A;  4ZEK A;  1AIV A;  1MQH A;  4RY1 A;  2HZL A;  4QFP A;  3DM0 A;  4FAJ A;  1MH4 A;  3TTM A;  2H25 A;  4MHF A;  5H8N A;  4MX6 A;  2NUV A;  3O66 A;  4PTK A;  2I58 A;  2DE3 A;  3SDF A;  2O1M A;  2RF1 A;  4XKQ A;  2HZK A;  4IY5 A;  2DWJ A;  5DVJ A;  4GWU A;  3HST A;  1BKA A;  4OWD A;  4P0I A;  3VLU A;  2G93 A;  1F9B A;  1UTH A;  2X26 A;  1B46 A;  3V89 B;  4WKM A;  4GD5 A;  3CFL A;  4LAT A;  5L9M A;  3SKP A;  4EXK A;  2QJE A;  1RDY A;  4TLL B;  1IUD A;  1WOD A;  4PFY A;  5I58 A;  2Y7K A;  1M5C A;  4G8M A;  5BUU A;  3UOR A;  3NOH A;  2O6A A;  3D1R A;  4U1Z A;  1B7U A;  3MPL A;  1R9L A;  3EPE A;  1IIT A;  1Y9U A;  4ELO A;  1Y4T A;  1I6A A;  1ZJL A;  3S9E A;  4BDO A;  1PB7 A;  4PET A;  3UP9 A;  3D4C A;  1B5H A;  2WYP A;  1WVJ A;  3T22 A;  2NWJ A;  1IMB A;  3VVD A;  4DI3 D;  1FBH A;  1N04 A;  1EH3 A;  4F2Q A;  4PE3 A;  3VLW A;  4OEU A;  2YLN A;  1YZ0 A;  1GVC A;  2QMX A;  1SDX A;  2QRY A;  4PGN A;  4RK2 A;  3PD8 A;  3MZ9 A;  2XXP A;  1MG1 A;  1MXZ A;  5I59 B;  1EYJ A;  5DW8 A;  3G3F A;  2DQV A;  3IJO B;  4M4G A;  1NKX A;  2Y7I A;  3S9N C;  2L5V A;  4QSD A;  1EZ9 A;  1A40 A;  3UK4 A;  3H06 B;  4IO5 A;  4LP2 B;  4TOZ A;  2KQZ A;  5DT6 A;  2ZNU A;  3K0V A;  4GBW A;  2VPN A;  2R9J A;  1I6Q A;  2XXI A;  4XKP A;  2WBD A;  2R71 A;  3ZKL A;  5I57 B;  3DP6 A;  2PT1 A;  3OXN A;  3MP6 A;  1VSO A;  2RKM A;  3F11 A;  1B2H A;  1DPP A;  4YB5 A;  2FIE A;  2XD3 A;  3HV1 A;  3IB1 A;  3M8U A;  5L9O A;  4YB6 A;  5LOM A;  3H7M A;  2XA5 A;  3G3H A;  2HQ0 A;  3KSX A;  1TT1 A;  5CMC A;  1QKA A;  1NUX A;  3KBR A;  1ZBM A;  2VHA A;  2ZZW A;  5TP9 B;  1SPI A;  4PFI A;  4P1L A;  1INP A;  3N5L A;  1TWY A;  4NQ8 A;  5KCJ B;  4QXD A;  3UGW A;  5IZZ A;  2I49 A;  1B0L A;  1LBV A;  3PV0 E;  4H67 A;  4P0G A;  1NUY A;  3MQ9 A;  4KCD A;  4H5F A;  3USD A;  2QL3 A;  1D9V A;  2ZZV A;  4RNS A;  1YCJ A;  4G77 A;  5ET8 A;  1MY2 A;  1B5J A;  3B8B A;  2YJP A;  1AWB A;  1SBP A;  4PFT A;  1FQC A;  1A7L A;  1O64 A;  4LVQ A;  1Z7N E;  1FSA A;  4KXP A;  1USY E;  1HSL A;  1PB8 A;  4R75 A;  4YZZ A;  1IME A;  4PAI A;  1N7W A;  5I59 A;  3MVY A;  3W15 C;  4N4U A;  3IOV A;  2FA7 A;  2I4C A;  3PPO A;  3IX1 A;  2DE2 A;  1O7T A;  2BJI A;  2H5Y A;  5AA1 A;  4EQ7 A;  3K2D A;  2O7U A;  1S9T A;  3OO6 A;  5CBR A;  4EUO A;  3PMX A;  4R6Y A;  4R72 A;  4NF6 B;  5AA2 B;  1NUZ A;  1NV7 A;  1MQJ A;  3T9X B;  2R6G E;  4DE8 A;  3QK6 A;  4DDD A;  3MW0 A;  3ROJ A;  4GWY A;  1ZKB A;  1LBY A;  5I57 A;  4M1V A;  2VOZ A;  4G8H A;  4MH5 A;  4YAH X;  5F1Q A;  2VD3 A;  3RPW A;  2UYE A;  4GWS A;  3SEX A;  1GR2 A;  1B9J A;  3LUZ A;  3MC2 A;  1SVX B;  5F24 A;  1LFG A;  2X7Q A;  5TP9 A;  4YKJ A;  3C31 A;  4PE5 B;  4R9G A;  2I3V A;  2DDK A;  5KCJ A;  1JP4 A;  2ZMB A;  3IB0 A;  1B3F A;  1MXY A;  4GX6 A;  4F3S A;  1IZ1 A;  3LSX A;  1AH5 A;  2VGQ A;  3CSB A;  1SQY A;  1EZP A;  2WYK A;  4DXC A;  4HCY A;  2F97 A;  4AB6 A;  4AQ4 A;  1B05 A;  2VD2 A;  5J16 A;  1RYX A;  3K1P A;  1YTV A;  4O7I A;  4IB2 A;  1PC3 A;  1L5T A;  2ESN A;  1P1N A;  2IEE A;  3TCH A;  2REG A;  4LON B;  1IXC A;  4NF5 B;  3IJX B;  3MP8 A;  3O97 A;  3G7W A;  4F19 A;  4FAT A;  5I3S A;  1GGG A;  1B1X A;  4WXJ A;  4GWZ A;  3BFU A;  1MDP 1;  4H0W A;  3RUM A;  1Q1K A;  3THI A;  2PCR A;  3PGF A;  3KBZ A;  2QS2 A;  3HHF A;  3SER A;  2HXW A;  1QJM A;  1LAG E;  1FPJ A;  2V4C A;  2CEY A;  4X48 A;  3R26 A;  1DOT A;  3K01 A;  4N6K A;  1IEJ A;  1YAE A;  4NF6 A;  5AA2 A;  4OFJ A;  3VVE A;  3EHU A;  1SW1 A;  3S9L C;  3KN8 A;  3MZB A;  3EKI A;  4H46 A;  1PBP A;  5J1D A;  3K1M A;  2PX1 A;  4R6H A;  1N3W A;  4H8J A;  4BDR A;  3G3J A;  2ZXT A;  2PMS A;  4NWD A;  3SET A;  1MH3 A;  2KLF A;  2D5W A;  1AL3 A;  3C35 A;  1Y3P A;  1NNP A;  3LBS A;  3HO7 A;  2CZH A;  2M8C A;  3AXF A;  1OMP A;  4LZ8 A;  1NH7 A;  3RTW B;  4O3A A;  2XWK A;  2QS3 A;  2B4L A;  3FJ7 A;  2OK2 A;  4QF9 A;  2FVZ A;  2I0C A;  5DVF A;  3U92 A;  3FV1 A;  3KC0 A;  4GXA A;  4N13 A;  2R8T A;  3RNN A;  1M5B A;  1NV1 A;  1SI0 A;  1QUK A;  2DVC A;  5B7D A;  1CB6 A;  1QW0 A;  2GFE A;  4U4S A;  4ZZE A;  4NF4 B;  4GWX A;  4ZEI A;  1FPE A;  5L8D A;  2GHA A;  2QFL A;  3BBR A;  2CZL A;  3RT6 B;  4THI A;  3RYD A;  2Q8J A;  3UIF A;  4NMY A;  3I5O A;  1GV8 A;  3TEL A;  3TFL A;  2QMW A;  4U2R A;  4NF5 A;  4PDD A;  2F7B A;  3C36 A;  1N7X A;  3W9W A;  4NTL A;  4GF8 A;  1OQH A;  1AOV A;  1S50 A;  2XXX A;  3U72 A;  3MJN A;  3Q28 A;  1ZTY A;  3LSL A;  1H76 A;  2HPG A;  3T9U A;  4OHN A;  4RK9 A;  4OFO A;  4F2O A;  3PMV A;  3JYR A;  3TCF A;  2V3U A;  3FD3 A;  3MBP A;  2VPO A;  1EYK A;  4QFN A;  5AA4 B;  4QHQ A;  3ONM A;  4YMA A;  3K6X A;  1P1W A;  3BKI B;  5ET7 A;  4GRK A;  4E0X A;  3PPQ A;  2F6G A;  4IO7 A;  3SEY A;  2ZZX A;  5CBS A;  2QS1 A;  1MM7 A;  2V84 A;  3TAJ A;  1LBC A;  4QFK A;  4DCY A;  1H45 A;  1O63 A;  1LGB C;  2H98 A;  3V8X B;  4LZ5 A;  4DCX A;  3K4U A;  3CSG A;  4QRZ A;  1US4 A;  1N84 A;  1MPC A;  5LTC A;  1Z7M E;  1QVS A;  5CC2 A;  1IQ7 A;  4OQO A;  3T96 B;  4JSD A;  3GLB A;  2XWI A;  3DP4 A;  3K1N A;  4XTC Q;  2HAU A;  4R2B A;  4KD5 A;  1Y1M A;  2UYF A;  3Q25 A;  4F31 B;  2O7I A;  3CI8 A;  4ESW A;  3ILT B;  4GWW A;  3CG1 A;  4PP0 A;  3QIM A;  2Y7W A;  1R6Z A;  4XFE A;  1B4Z A;  1D9Y A;  4X9T A;  1YYZ A;  1XVX A;  4XKR A;  1LFH A;  4DIG A;  2WX9 A;  2OZZ A;  2HCA A;  4LQ5 A;  4IGR A;  4NF4 A;  2Q74 A;  3A3U A;  3ECR A;  3SEW A;  2RC7 A;  4OEV A;  3E78 A;  2CZI A;  1IXH A;  4JXI A;  3FAS A;  1FBD A;  3TMG A;  2ZYK A;  1DCU A;  5EHM A;  3RPL B;  4AB5 A;  1D9Q A;  1MY0 A;  3SES A;  3K6V A;  4K3F A;  3TDJ A;  1B51 A;  2XWO A;  3MVW A;  4FOR A;  5DVI A;  3EQ1 A;  2RC9 A;  3GBA A;  2AYS A;  4E0W A;  5AA4 A;  4DXU A;  1LB8 A;  2B4M A;  3B6W A;  4N8Y A;  4RA1 A;  3I3V A;  3BIG A;  3E4R A;  3LC8 A;  4JWX A;  4GX3 A; 
#chains in the Genus database with same CATH homology
 3HCQ A;  3GBB A;  3FAT A;  2D21 A;  4R73 A;  2Q2C A;  4DLD A;  1XOC A;  3UA8 A;  1VFE A;  1EZO A;  4OXV A;  2H9B A;  3U8Q A;  4KI0 E;  3KEI A;  4ZS9 A;  1XHY A;  3TTR A;  3T9H B;  3EN3 A;  2XXQ A;  4ISU A;  3C33 A;  1FTJ A;  1HSE A;  3TTK A;  5I84 A;  2Z8E A;  2Q2A A;  1JET A;  4MLQ A;  3K00 A;  4LQ2 A;  4F1Y A;  3O29 A;  4KPT A;  4RPN A;  1NL5 A;  3SEU A;  2F34 A;  4FE8 A;  3H6T A;  3K6W A;  1SW2 A;  2O51 A;  4POW A;  2F5X A;  5DTB A;  4IGT A;  2Z23 A;  1M5F A;  1OLC A;  2OCU A;  3OEN A;  4KYS A;  5HBC A;  1DMB A;  3SEV A;  1JW1 A;  4OES A;  2VP1 A;  3LSW A;  1PBQ A;  2QSX A;  3DLN A;  2QPQ A;  1WDN A;  1S7Y A;  3DP8 A;  4LUB A;  3TEP A;  5JEI A;  3RGY A;  1I6B A;  4IO4 A;  2OLB A;  3VVF A;  1QKB A;  1MRP A;  3K02 A;  2FYI A;  3KJ7 A;  1LB9 A;  3O9P A;  3KZG A;  3R7X A;  4KFQ A;  4QFO A;  4ESX A;  4GXS B;  4TQU Q;  1BIY A;  1MXW A;  2OWT A;  4BLA A;  3T9V A;  2PVU A;  3KGC A;  3IAZ A;  5FHO A;  3B6T A;  1MY1 A;  1JEV A;  3N6U A;  3A09 A;  2AL4 A;  2UVG A;  5JK4 A;  3MUQ A;  1BP5 A;  4IO3 A;  2D3I A;  3GZG A;  4ELQ A;  4YIC A;  1UIV A;  1AMF A;  5FHM A;  2HAV A;  1OVB A;  1BTJ A;  2DP8 A;  3Q27 A;  1MM6 A;  3G3G A;  3IL1 B;  4POX A;  3JZJ A;  1A8F A;  2DOJ A;  4FEC A;  5CI5 A;  3H6U A;  4L17 A;  4ZE9 A;  4F3P A;  4U1O A;  2UVI A;  4H5G A;  3OSR A;  4JBZ A;  1EU8 A;  4EF1 A;  4P11 A;  4G68 C;  3N6T A;  3E9X A;  3VFJ A;  1DSN A;  5I56 B;  4TLM B;  1B3E A;  3I6V A;  1MY4 A;  1B3G A;  1LFI A;  3IR1 A;  4RYA A;  3ILU B;  3FGS A;  2V3T A;  3VDF A;  1P99 A;  4G2Z A;  2I4B A;  1RKM A;  3PU5 A;  1N3X A;  3N94 A;  4ELR A;  1RYO A;  1MDQ A;  1IXG A;  1UIU A;  3OEL A;  3TQL A;  2P1S A;  2PYY A;  3S9M C;  3VXC A;  3V5A A;  3TZA A;  5K2X A;  4DZ1 A;  2DYX A;  1B3L A;  1POY 1;  3PD9 A;  3O2A A;  4GL0 A;  4I1D A;  3WAE A;  1LCT A;  4OMB A;  1N76 A;  4MFI A;  3FXR A;  4G8N A;  1MY3 A;  3KN3 A;  3S4U A;  2W7Y A;  3FVG A;  3H6W A;  3KJT A;  3LSF B;  2V25 A;  4ZEF A;  3MZ1 A;  1SW5 A;  4FIM A;  5IAI A;  1TFA A;  4YB7 A;  3L6G A;  2XXU A;  4NWC A;  4NF8 B;  4PQJ A;  1MQD A;  1JVY A;  1R9Q A;  3CG3 A;  2ONR A;  1FQF A;  3DEL B;  3IOW A;  2A5T B;  5KDT B;  5F7V A;  4U21 A;  4KYD A;  5I56 A;  4KQP A;  2G29 A;  1P1U A;  4OYV A;  3WAF A;  4HW8 A;  1B5I A;  1JEU A;  1VR5 A;  4NE4 A;  3TPA A;  2XXW A;  2Y7R A;  2BJJ X;  5IKB A;  4HS7 A;  4F1U A;  4YKP A;  5K2Y A;  1H43 A;  3PUY E;  3TQW A;  4KHZ E;  2V3Q A;  1B4H A;  4UAC A;  3CR9 A;  3E3K A;  2RC8 A;  1FTM A;  3PUW E;  4F3B A;  2F7C A;  1NMU A;  3QAX A;  4BDL A;  1SW4 A;  3VV5 A;  5ISU A;  1B0H A;  2Q88 A;  4ZE8 A;  3KFM A;  4HCW A;  1OIB A;  4X1D A;  2B3B A;  4ONY A;  3KG2 A;  1T0K A;  1Y4C A;  4UA8 A;  4WED A;  3O28 A;  4ZZA A;  4F1V A;  1UQW A;  5TPA B;  3IOT A;  4QSE A;  2ZNS A;  4U22 A;  3PUZ E;  5H8H B;  4NF8 A;  3PMW A;  3QSL A;  3BFT A;  4MF3 A;  1Y3N A;  2NOO A;  2GRV A;  1M5D A;  3QUJ A;  4YKI A;  3N26 A;  3IO4 A;  3ZKK A;  1TFD A;  4DXB A;  2A5T A;  1A8E A;  5KDT A;  2Z8F A;  1HSJ A;  3KOS A;  1QUL A;  2O1L A;  2RCB A;  3PPR A;  4ND9 A;  1URG A;  1MPD A;  1DTG A;  1ZIU A;  4BDN A;  1LLS A;  2GH9 A;  5FTH A;  3MVX A;  4GFR A;  1BLF A;  3HHG A;  2RCA A;  2E1S A;  2QS4 A;  3G3I A;  5AA2 D;  1FTK A;  1ZU0 A;  4YKK A;  1FTL A;  2DS9 A;  1A54 A;  3Q26 A;  4JB7 A;  1N0T A;  4G68 B;  2O69 A;  3FZV A;  4ZEC A;  5EHS A;  1QUJ A;  2OWS A;  3TCG A;  1D4N A;  2HEU A;  3TOD A;  4FEB A;  3MPK A;  1B3H A;  5M2V A;  3LUY A;  4OTE A;  3RQT A;  2GHB A;  1LAX A;  3FJG A;  2V93 A;  3HN0 A;  3P7I A;  3ODB A;  1OVT A;  2A5S A;  2OJT A;  4YMB A;  3EHT A;  2AL5 A;  1FTO A;  3E13 X;  4U4X A;  3EF7 A;  1PDA A;  1B58 A;  3OEM A;  3C4M A;  5TPA A;  5KZT A;  3OEK A;  4BDQ A;  3O6I A;  2Y84 A;  5H8H A;  2NXO A;  3VXB A;  4XKN A;  1FQA A;  2IA4 A;  1PB9 A;  4ZED A;  3RLF E;  1PEB A;  3OO7 A;  4ELP A;  1FCK A;  4XXU A;  4ECF A;  1OQG A;  1NNF A;  2F36 A;  1UTB B;  1LAH E;  4IY6 A;  3CFZ A;  2X7P A;  3Q29 A;  3T66 A;  2Z8D A;  4C1U A;  4MBP A;  4KR5 A;  4GL8 A;  3H6V A;  5BWJ A;  2F8D A;  4YU0 A;  3H3G A;  3RT8 A;  4NED A;  4EXL A;  4QFL A;  2P0S A;  2P2A A;  4G68 A;  5L9S A;  2XX9 A;  2ALU A;  1H44 A;  4C0R A;  2Q9T A;  4Q30 B;  2ONK E;  3QYT A;  1MQI A;  2NVU B;  4EQB A;  1SYH A;  4N6P A;  1B7H A;  2WKY A;  2XXV A;  4GOT A;  3OD7 A;  5DEX B;  2XXT A;  3OO9 A;  4OFL A;  1NNT A;  1LAF E;  4F18 A;  4I62 A;  4IO6 A;  5TU0 A;  2FNC A;  3FVN A;  3PPP A;  1MXV A;  1ZMG A;  3FJM A;  2ZYN A;  2DWI A;  5CMB A;  3FV2 A;  4RPO A;  3TUS A;  4OEN A;  3FVO A;  3U1O A;  1I69 A;  3ZSF A;  2XX8 A;  4Z0I A;  1NFT A;  4HTG A;  3PPN A;  3GXA A;  4C1T A;  4LA9 A;  5H8S A;  2F6P A;  4O3B A;  2XXR A;  2DE4 A;  3C32 A;  5I2N B;  4MLV A;  1UTB A;  1VE4 A;  1B6H A;  2I0B A;  5AE4 A;  4R6K A;  4FED A;  1DTZ A;  2H99 A;  2YPN A;  4EDP A;  4RXL A;  1TXF A;  4BDM A;  2DSF A;  2DVZ A;  4OZ9 A;  1B40 A;  4PFW A;  1VFD A;  2PBW A;  3D4G A;  3LR1 A;  1MS7 A;  2Z22 A;  5ICQ A;  2F7A A;  4F39 A;  4R2F A;  1Q35 A;  3IOR A;  3TYH A;  5H8Q B;  4QSC A;  3UN6 A;  2DXR A;  3FXQ A;  1ANF A;  3U93 A;  2ABH A;  2CMO A;  2I48 A;  4GLI A;  2HFB A;  1H3D A;  2F78 A;  3RN8 A;  4ZDM A;  1B7Z A;  3VE1 B;  5EYF A;  1A55 A;  4H1X A;  4U23 A;  4RJZ A;  4XIG Q;  3C34 A;  5DEX A;  5FTI A;  4JSO A;  4ZEB A;  2ONS A;  4IO2 A;  2ZNT A;  4N07 A;  4OET A;  4EF2 A;  3TTN A;  4F22 A;  2XHD A;  3R6U A;  1II5 A;  1Y20 A;  3QUF A;  4Q5T A;  1POT A;  4GIZ A;  2E0S A;  2ZYO A;  4O3C A;  4Z7E A;  1YPN A;  1OLA A;  1XT8 A;  1JW4 A;  4WEP A;  2Q89 A;  3H03 A;  1LCF A;  1CE2 A;  2XXY A;  3MVZ A;  3W9V A;  2UVJ A;  5JTY B;  3CIJ A;  1US5 A;  1MPB A;  4FJP A;  5I2N A;  1XVY A;  5A5X B;  1FQB A;  3MP1 A;  5ITO A;  4GQO A;  2H4I A;  4F29 A;  1M5E A;  2I6E A;  4OVJ A;  4F3G A;  1JVX A;  1FQD A;  1SD3 A;  3ZS6 A;  3KOT A;  3S2V A;  3B7D A;  5B70 A;  5H8F B;  3M3K A;  4OER A;  5I2K B;  3OMB A;  5ELV A;  5H8Q A;  4JDF A;  3FIR A;  3MWB A;  2LAO A;  3T93 B;  1NH8 A;  2F35 A;  3A3C A;  3U94 A;  1QUI A;  3RTF B;  5DYH A;  2Y7P A;  2UXA A;  1ZLQ A;  5HPQ A;  3KN7 A;  1ELJ A;  4H6D A;  1P1Q A;  2DWA A;  1LBB A;  5CM6 A;  1JW5 A;  3OSQ A;  3OO8 A;  3QXM A;  1B52 A;  4KCC A;  3RY3 A;  4JWO A;  4GWO A;  1XC1 A;  4KYE A;  1FQE A;  2UVH A;  1MQG A;  3FXU A;  1XS5 A;  1NNK A;  2REJ A;  2XXH A;  3IB2 A;  3PUV E;  3V83 A;  1URD A;  4H8I A;  4I8C A;  1USY H;  3OOA A;  4I9D A;  5CRY A;  5JTY A;  1MXX A;  2OBG A;  3M3F A;  3FVK A;  1SI1 A;  1JNF A;  2B65 A;  1Y3Q A;  1JQF A;  3JV9 A;  5H8N B;  3TKD A;  5A5X A;  1IXI A;  3O6G A;  3VLV A;  2XX7 A;  4LZ7 A;  2PT2 A;  5ITP A;  3IK6 B;  1KWH A;  1DPE A;  3FUZ A;  3IO6 A;  3O6H A;  5AA3 A;  1GTK A;  1LST A;  1A99 A;  1UTH B;  4R74 A;  3B6Q A;  5H8F A;  5I2K A;  1ATG A;  1URS A;  1B32 A;  4H65 A;  3PUX E;  1IIW A;  3HPI A;  4PFU A;  4Q0C A;  5I58 B;  2DXY A;  5CMK A;  2I3W A;  3CFX A;  2AIX A;  1SYI A;  4GVO A;  4G4P A;  3H4Z A;  2THI A;  4EQ9 A;  2DWH A;  1R1N A;  2O84 X;  1MXU A;  2B3F A;  1Y1Z A;  2RIN A;  3M3L A;  4R9F A;  3C9H A;  3IOU A;  4X1B A;  3L6H A;  3G3K A;  1P1O A;  1B1H A;  2XD2 A;  3KSJ A;  4JWY A;  5FHN A;  3CRB A;  5CMM A;  2O68 A;  2ANJ A;  3K6U A;  3EHS A;  3TTL A;  1FW0 A;  3CVG A;  1J1N A;  5HM4 B;  3MAM A;  1D3K A;  2ZYM A;  5ICT A;  4Q8R A;  4ZEK A;  1AIV A;  1MQH A;  4RY1 A;  2HZL A;  4QFP A;  3DM0 A;  4FAJ A;  1MH4 A;  3TTM A;  2H25 A;  5H8N A;  2NUV A;  3O66 A;  2I58 A;  2DE3 A;  3SDF A;  2O1M A;  2RF1 A;  4XKQ A;  2HZK A;  4IY5 A;  2DWJ A;  5DVJ A;  3HST A;  1BKA A;  4OWD A;  4P0I A;  3VLU A;  2G93 A;  1F9B A;  1UTH A;  2X26 A;  1B46 A;  3V89 B;  4WKM A;  4GD5 A;  3CFL A;  4LAT A;  5L9M A;  3SKP A;  4EXK A;  2QJE A;  4TLL B;  1IUD A;  1WOD A;  4PFY A;  5I58 A;  2Y7K A;  1M5C A;  4G8M A;  5BUU A;  3UOR A;  2O6A A;  4U1Z A;  1B7U A;  3MPL A;  1R9L A;  3EPE A;  1IIT A;  1Y9U A;  4ELO A;  1Y4T A;  1I6A A;  1ZJL A;  3S9E A;  4BDO A;  1PB7 A;  4PET A;  3UP9 A;  3D4C A;  1B5H A;  1WVJ A;  3T22 A;  2NWJ A;  3VVD A;  1N04 A;  1EH3 A;  4F2Q A;  3VLW A;  4OEU A;  2YLN A;  1GVC A;  2QMX A;  1SDX A;  2QRY A;  3PD8 A;  4RK2 A;  3MZ9 A;  2XXP A;  1MG1 A;  1MXZ A;  5I59 B;  3G3F A;  2DQV A;  3IJO B;  4M4G A;  1NKX A;  2Y7I A;  3S9N C;  4QSD A;  1EZ9 A;  1A40 A;  3UK4 A;  3H06 B;  4IO5 A;  4LP2 B;  4TOZ A;  5DT6 A;  2ZNU A;  3K0V A;  2R9J A;  1I6Q A;  2XXI A;  4XKP A;  2R71 A;  3ZKL A;  5I57 B;  3DP6 A;  2PT1 A;  3OXN A;  3MP6 A;  1VSO A;  2RKM A;  3F11 A;  1B2H A;  1DPP A;  4YB5 A;  2XD3 A;  3HV1 A;  3IB1 A;  3M8U A;  5L9O A;  4YB6 A;  5LOM A;  3H7M A;  3G3H A;  2HQ0 A;  3KSX A;  1TT1 A;  5CMC A;  1QKA A;  3KBR A;  1ZBM A;  2VHA A;  5TP9 B;  3N5L A;  1TWY A;  5KCJ B;  3UGW A;  2I49 A;  1B0L A;  3PV0 E;  4H67 A;  4P0G A;  3MQ9 A;  4KCD A;  4H5F A;  3USD A;  2QL3 A;  1D9V A;  4RNS A;  1YCJ A;  4G77 A;  1MY2 A;  1B5J A;  2YJP A;  1SBP A;  4PFT A;  1FQC A;  1A7L A;  1O64 A;  4LVQ A;  1Z7N E;  1USY E;  1HSL A;  1PB8 A;  4R75 A;  4YZZ A;  1N7W A;  5I59 A;  3MVY A;  3W15 C;  3IOV A;  2FA7 A;  2I4C A;  3PPO A;  3IX1 A;  2DE2 A;  1O7T A;  2H5Y A;  5AA1 A;  4EQ7 A;  3K2D A;  2O7U A;  1S9T A;  3OO6 A;  5CBR A;  4EUO A;  3PMX A;  4R6Y A;  4R72 A;  4NF6 B;  5AA2 B;  1MQJ A;  3T9X B;  2R6G E;  4DE8 A;  3QK6 A;  4DDD A;  3MW0 A;  1ZKB A;  5I57 A;  4M1V A;  2VOZ A;  4G8H A;  4MH5 A;  4YAH X;  5F1Q A;  2VD3 A;  3RPW A;  2UYE A;  3SEX A;  1GR2 A;  1B9J A;  3MC2 A;  1SVX B;  1LFG A;  2X7Q A;  5TP9 A;  4YKJ A;  3C31 A;  4PE5 B;  4R9G A;  2I3V A;  5KCJ A;  2ZMB A;  3IB0 A;  1B3F A;  1MXY A;  4F3S A;  1IZ1 A;  3LSX A;  1AH5 A;  2VGQ A;  3CSB A;  1SQY A;  1EZP A;  4DXC A;  4HCY A;  2F97 A;  4AB6 A;  4AQ4 A;  1B05 A;  2VD2 A;  1RYX A;  3K1P A;  1YTV A;  4IB2 A;  1PC3 A;  1L5T A;  2ESN A;  1P1N A;  2IEE A;  3TCH A;  2REG A;  4LON B;  1IXC A;  4NF5 B;  3IJX B;  3MP8 A;  3O97 A;  3G7W A;  4F19 A;  4FAT A;  1GGG A;  1B1X A;  4WXJ A;  3BFU A;  1MDP 1;  4H0W A;  3RUM A;  1Q1K A;  3THI A;  3PGF A;  2QS2 A;  3HHF A;  3SER A;  2HXW A;  1QJM A;  1LAG E;  4X48 A;  3R26 A;  1DOT A;  3K01 A;  1IEJ A;  1YAE A;  4NF6 A;  5AA2 A;  4OFJ A;  3VVE A;  3EHU A;  1SW1 A;  3S9L C;  3KN8 A;  3MZB A;  1PBP A;  5J1D A;  3K1M A;  2PX1 A;  4R6H A;  1N3W A;  4H8J A;  4BDR A;  3G3J A;  2ZXT A;  2PMS A;  4NWD A;  3SET A;  1MH3 A;  2KLF A;  2D5W A;  1AL3 A;  3C35 A;  1Y3P A;  1NNP A;  3LBS A;  3HO7 A;  2M8C A;  3AXF A;  3RTW B;  1OMP A;  4LZ8 A;  1NH7 A;  4O3A A;  2QS3 A;  3FJ7 A;  2OK2 A;  4QF9 A;  2I0C A;  5DVF A;  3U92 A;  3FV1 A;  4GXA A;  4N13 A;  3RNN A;  1M5B A;  1SI0 A;  1QUK A;  2DVC A;  5B7D A;  1CB6 A;  1QW0 A;  2GFE A;  4U4S A;  4ZZE A;  5L8D A;  4NF4 B;  4ZEI A;  2GHA A;  3BBR A;  2CZL A;  3RT6 B;  4THI A;  2Q8J A;  3UIF A;  4NMY A;  3I5O A;  1GV8 A;  3TEL A;  3TFL A;  2QMW A;  4U2R A;  4NF5 A;  2F7B A;  3C36 A;  1N7X A;  3W9W A;  4NTL A;  4GF8 A;  1OQH A;  1AOV A;  1S50 A;  2XXX A;  3U72 A;  3MJN A;  3Q28 A;  1ZTY A;  3LSL A;  1H76 A;  3T9U A;  4OHN A;  4RK9 A;  4OFO A;  4F2O A;  3PMV A;  3JYR A;  3TCF A;  2V3U A;  3FD3 A;  3MBP A;  4QFN A;  5AA4 B;  4QHQ A;  3ONM A;  4YMA A;  3K6X A;  1P1W A;  3BKI B;  4GRK A;  4E0X A;  3PPQ A;  2F6G A;  4IO7 A;  3SEY A;  5CBS A;  2QS1 A;  1MM7 A;  2V84 A;  3TAJ A;  1LBC A;  4QFK A;  4DCY A;  1H45 A;  1O63 A;  1LGB C;  2H98 A;  3V8X B;  4LZ5 A;  4DCX A;  3K4U A;  3CSG A;  4QRZ A;  1US4 A;  1N84 A;  1MPC A;  1Z7M E;  1QVS A;  5CC2 A;  1IQ7 A;  4OQO A;  3T96 B;  4JSD A;  3GLB A;  3DP4 A;  3K1N A;  4XTC Q;  2HAU A;  4R2B A;  4KD5 A;  1Y1M A;  2UYF A;  3Q25 A;  4F31 B;  2O7I A;  3CI8 A;  4ESW A;  3ILT B;  4PP0 A;  3CG1 A;  3QIM A;  2Y7W A;  1R6Z A;  1B4Z A;  1D9Y A;  4X9T A;  1XVX A;  4XKR A;  1LFH A;  4DIG A;  2OZZ A;  2HCA A;  4LQ5 A;  4IGR A;  4NF4 A;  3A3U A;  3ECR A;  3SEW A;  2RC7 A;  4OEV A;  1IXH A;  4JXI A;  3FAS A;  3TMG A;  2ZYK A;  5EHM A;  4AB5 A;  1MY0 A;  3SES A;  3K6V A;  4K3F A;  3TDJ A;  1B51 A;  3MVW A;  4FOR A;  5DVI A;  3EQ1 A;  2RC9 A;  3GBA A;  2AYS A;  4E0W A;  5AA4 A;  4DXU A;  1LB8 A;  3B6W A;  4RA1 A;  3I3V A;  3E4R A;  3LC8 A;  4JWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...